BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25011_g4_i2 len=945 path=[10771:0-563 11335:564-607 10726:608-651
10770:652-944]

Length=945
                                                                      Score     E

gb|ADU56817.1|  MADS-box protein AGL2 subfamily                         355   2e-119   
ref|NP_001289529.1|  agamous-like MADS-box protein AGL9 homolog         348   1e-116   
gb|AAP83377.1|  SEPALLATA3-like MADS-box                                345   6e-116   Solanum lycopersicum
ref|NP_001234384.1|  agamous-like MADS-box protein AGL9 homolog         347   6e-116   
gb|AHW58034.1|  SEP3                                                    347   7e-116   
ref|XP_006352168.1|  PREDICTED: agamous-like MADS-box protein AGL...    345   2e-115   
gb|ADP09004.1|  SEP3-like protein                                       345   3e-115   
ref|XP_009600809.1|  PREDICTED: agamous-like MADS-box protein AGL...    343   2e-114   
gb|AEA76419.1|  putative SEP3                                           341   4e-114   
sp|Q03489.2|AGL9_PETHY  RecName: Full=Agamous-like MADS-box prote...    342   4e-114   Petunia x hybrida [garden petunia]
gb|AAP83395.1|  SEPALLATA3-like MADS-box                                340   5e-114   Petunia x hybrida [garden petunia]
dbj|BAG55316.1|  transcription factor                                   339   4e-113   Petunia integrifolia subsp. inflata
emb|CBI27678.3|  unnamed protein product                                335   1e-111   
ref|NP_001268114.1|  MADS-box protein 4                                 332   3e-110   
dbj|BAN89460.1|  sepallata 3                                            330   3e-109   
gb|AAP83366.1|  SEPALLATA3-like MADS-box                                322   8e-107   Antirrhinum majus [garden snapdragon]
emb|CAA64742.1|  DEFH72                                                 323   9e-107   Antirrhinum majus [garden snapdragon]
ref|XP_007043947.1|  K-box region and MADS-box transcription fact...    323   1e-106   
gb|ABQ59277.2|  sepallata 3-like MADS box protein                       321   2e-106   Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_011086825.1|  PREDICTED: agamous-like MADS-box protein AGL...    322   3e-106   
emb|CAL36578.1|  deficiens H200 homologue                               320   1e-105   Misopates orontium
ref|XP_004140534.1|  PREDICTED: agamous-like MADS-box protein AGL...    319   3e-105   
gb|AAP83410.1|  SEPALLATA3-like MADS-box                                318   6e-105   Syringa vulgaris
gb|AEQ75503.1|  MADS-domain transcription factor                        317   6e-105   
ref|NP_001284431.1|  agamous-like MADS-box protein AGL9 homolog         317   1e-104   
ref|XP_007043949.1|  K-box region and MADS-box transcription fact...    317   3e-104   
gb|AEL33633.1|  SEPALLATA3                                              315   1e-103   
gb|KDP26829.1|  hypothetical protein JCGZ_17987                         316   1e-103   
gb|AAP83364.1|  SEPALLATA3-like MADS-box                                313   3e-103   Antirrhinum majus [garden snapdragon]
gb|AEJ76840.1|  MADS16                                                  314   3e-103   
gb|KHG25284.1|  Agamous-like MADS-box protein AGL9                      314   3e-103   
emb|CAA64743.1|  DEFH200                                                314   4e-103   Antirrhinum majus [garden snapdragon]
gb|AHA87180.1|  sepallata 3                                             311   2e-102   
gb|ADU15477.1|  SEP3                                                    310   1e-101   
gb|AEN75254.1|  transcription factor MADS3                              308   4e-101   
ref|XP_008222191.1|  PREDICTED: agamous-like MADS-box protein AGL...    308   5e-101   
ref|NP_001289232.1|  agamous-like MADS-box protein AGL9 homolog         308   6e-101   
ref|NP_001280756.1|  agamous-like MADS-box protein AGL9 homolog         308   8e-101   
ref|XP_007223808.1|  hypothetical protein PRUPE_ppa010679mg             307   2e-100   
dbj|BAM36705.1|  MADS transcriptional factor SEP3 homolog               307   3e-100   
ref|XP_006437995.1|  hypothetical protein CICLE_v10032507mg             306   3e-100   
dbj|BAF34912.1|  MADS-box protein                                       306   3e-100   Citrus unshiu [satsuma mandarin]
ref|XP_007043948.1|  K-box region and MADS-box transcription fact...    307   4e-100   
dbj|BAJ11578.1|  transcription factor                                   306   4e-100   
gb|ADF49576.1|  transcription factor MADS-box 2                         306   5e-100   
gb|AAX13298.1|  MADS box protein SEP3                                   305   1e-99    Lotus japonicus
ref|XP_004171788.1|  PREDICTED: agamous-like MADS-box protein AGL...    301   1e-98    
gb|AAO22982.1|  MADS-box transcription factor CDM44                     303   1e-98    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AGA61758.1|  sepallata 3                                             302   1e-98    
gb|AEO45959.1|  SEPALLATA3-like protein                                 301   3e-98    
ref|XP_009372256.1|  PREDICTED: agamous-like MADS-box protein AGL...    301   4e-98    
gb|AAP83365.1|  SEPALLATA3-like MADS-box                                300   5e-98    Antirrhinum majus [garden snapdragon]
ref|XP_010653929.1|  PREDICTED: MADS-box protein 4 isoform X1           300   1e-97    
ref|XP_006437994.1|  hypothetical protein CICLE_v10032507mg             299   2e-97    
gb|AIC33052.1|  flower development transporter SEP3                     298   7e-97    
ref|XP_006437997.1|  hypothetical protein CICLE_v10032507mg             298   2e-96    
ref|XP_006579433.1|  PREDICTED: uncharacterized protein LOC100805...    296   2e-96    
ref|XP_011036099.1|  PREDICTED: agamous-like MADS-box protein AGL...    296   3e-96    
ref|XP_006579435.1|  PREDICTED: uncharacterized protein LOC100805...    296   3e-96    
ref|XP_002514893.1|  mads box protein, putative                         293   4e-96    Ricinus communis
dbj|BAK09620.1|  MADS-box transcription factor                          295   7e-96    
ref|XP_006585131.1|  PREDICTED: MADS-box transcription factor 1-l...    295   1e-95    
ref|XP_006585129.1|  PREDICTED: MADS-box transcription factor 1-l...    295   1e-95    
gb|KGN46460.1|  hypothetical protein Csa_6G095270                       292   1e-95    
ref|XP_006437996.1|  hypothetical protein CICLE_v10032507mg             295   1e-95    
ref|XP_010090648.1|  Agamous-like MADS-box protein AGL9-like protein    294   2e-95    
gb|ABE02212.1|  SEP-like                                                294   2e-95    Populus tomentosa [Chinese white poplar]
gb|ADC79704.1|  SEPALLATA3-like protein                                 294   3e-95    Pachysandra terminalis
ref|XP_006579436.1|  PREDICTED: uncharacterized protein LOC100805...    294   3e-95    
gb|AAR01779.1|  MADS-box protein                                        294   3e-95    Prunus dulcis [sweet almond]
gb|ABD17387.1|  MADS-box protein SEP3                                   294   3e-95    Taihangia rupestris
gb|KHN34832.1|  MADS-box transcription factor 1                         293   3e-95    
ref|XP_006579434.1|  PREDICTED: uncharacterized protein LOC100805...    293   4e-95    
ref|XP_011020782.1|  PREDICTED: agamous-like MADS-box protein AGL...    293   4e-95    
gb|ABD19719.1|  SEP3-like MADS-box protein                              294   4e-95    Taihangia rupestris
gb|AAO49811.1|  SEP3-related MADS-box protein                           293   4e-95    Populus tremuloides
ref|XP_006585132.1|  PREDICTED: MADS-box transcription factor 1-l...    292   1e-94    
ref|XP_006585130.1|  PREDICTED: MADS-box transcription factor 1-l...    292   1e-94    
gb|AGH61294.1|  sepallata 3                                             292   1e-94    
emb|CAX65571.1|  GRCD5 protein                                          291   3e-94    Gerbera hybrid cultivar
gb|AEE60891.1|  MADS-box protein 5                                      291   4e-94    
gb|ABQ85951.1|  MADS-box transcription factor SEP-like 2                291   4e-94    Trochodendron aralioides
ref|XP_009372255.1|  PREDICTED: agamous-like MADS-box protein AGL...    291   6e-94    
ref|XP_008340236.1|  PREDICTED: agamous-like MADS-box protein AGL...    290   7e-94    
ref|XP_006484143.1|  PREDICTED: agamous-like MADS-box protein AGL...    290   1e-93    
gb|AET04966.2|  MADS-box transcription factor                           289   2e-93    
gb|AAN15182.1|  MADS box protein GHMADS-1                               289   2e-93    Gossypium hirsutum [American cotton]
ref|XP_004504397.1|  PREDICTED: agamous-like MADS-box protein AGL...    287   1e-92    
gb|ADC79703.1|  SEPALLATA3-like protein                                 287   1e-92    Pachysandra terminalis
gb|ADC79706.1|  SEPALLATA3-like protein                                 287   1e-92    Euptelea pleiosperma
ref|XP_010682728.1|  PREDICTED: agamous-like MADS-box protein AGL...    285   5e-92    
ref|XP_004504398.1|  PREDICTED: agamous-like MADS-box protein AGL...    285   1e-91    
ref|XP_008459849.1|  PREDICTED: agamous-like MADS-box protein AGL...    284   1e-91    
gb|AFU81296.1|  SEPALLATA3                                              285   1e-91    
emb|CAB95648.1|  MADS box protein                                       284   2e-91    Betula pendula [white birch]
gb|AFL03390.1|  MADS box transcription factor SEP3                      282   4e-91    
ref|XP_010250667.1|  PREDICTED: agamous-like MADS-box protein AGL...    283   7e-91    
gb|ADD25191.1|  SEP3                                                    282   7e-91    Nelumbo nucifera [Indian lotus]
ref|XP_004502275.1|  PREDICTED: MADS-box transcription factor 1-l...    282   1e-90    
ref|XP_007163780.1|  hypothetical protein PHAVU_001G263400g             282   1e-90    
gb|KHN24051.1|  MADS-box transcription factor 1                         282   1e-90    
ref|XP_004502274.1|  PREDICTED: MADS-box transcription factor 1-l...    282   1e-90    
ref|NP_001236390.1|  MADS transcription factor                          281   3e-90    
ref|XP_007163779.1|  hypothetical protein PHAVU_001G263400g             281   3e-90    
gb|ABD17386.1|  MADS-box protein SEP3-1                                 284   3e-90    Taihangia rupestris
ref|XP_003601749.1|  MADS-box transcription factor                      281   4e-90    
ref|XP_004310096.1|  PREDICTED: agamous-like MADS-box protein AGL...    278   4e-90    
ref|XP_010682729.1|  PREDICTED: agamous-like MADS-box protein AGL...    280   5e-90    
sp|O65874.1|MTF1_PEA  RecName: Full=MADS-box transcription factor 1     280   6e-90    Pisum sativum [garden pea]
gb|AAR06665.1|  transcription factor SEP3                               279   6e-90    Chloranthus spicatus [cha-ran]
ref|XP_008340234.1|  PREDICTED: agamous-like MADS-box protein AGL...    280   1e-89    
gb|AAT46095.1|  SEPALLATA-like protein                                  278   3e-89    Akebia trifoliata
ref|XP_006415783.1|  hypothetical protein EUTSA_v10008591mg             277   1e-88    
gb|ABQ85953.1|  MADS-box transcription factor SEP-like 4                276   2e-88    Trochodendron aralioides
gb|AAX15920.1|  AGL9                                                    275   4e-88    Liriodendron tulipifera
ref|XP_008801852.1|  PREDICTED: agamous-like MADS-box protein AGL...    275   5e-88    
gb|AEF59026.1|  MADS-2                                                  272   2e-87    
ref|XP_010913017.1|  PREDICTED: agamous-like MADS-box protein AGL...    273   3e-87    
ref|XP_003538541.1|  PREDICTED: MADS-box transcription factor 1-l...    273   4e-87    
gb|KDO81856.1|  hypothetical protein CISIN_1g047287mg                   271   6e-87    
ref|XP_006591442.1|  PREDICTED: MADS-box transcription factor 1-l...    273   6e-87    
dbj|BAB70747.1|  putative MADS-domain transcription factor MpMADS13     270   3e-86    Magnolia praecocissima
gb|AAX15924.1|  AGL9.2                                                  271   3e-86    Persea americana
dbj|BAO74164.1|  MADS-box transcription factor SEP3.2                   270   6e-86    
gb|ABI60898.1|  MADS-box transcription factor                           270   8e-86    Arachis hypogaea [goober]
gb|AJC01941.1|  MADS-box protein                                        266   4e-85    
gb|ABK41485.1|  putative MADS box protein                               267   9e-85    Elaeis guineensis
ref|XP_010025292.1|  PREDICTED: agamous-like MADS-box protein AGL...    267   1e-84    
ref|XP_003630490.1|  MADS-box transcription factor                      270   1e-84    
ref|XP_010917558.1|  PREDICTED: agamous-like MADS-box protein AGL...    266   1e-84    
gb|AFX72879.1|  MADS-box protein SEP3                                   266   2e-84    
ref|XP_010499199.1|  PREDICTED: developmental protein SEPALLATA 3...    266   2e-84    
gb|AAX15918.1|  AGL9                                                    266   2e-84    Eschscholzia californica
ref|XP_009415892.1|  PREDICTED: agamous-like MADS-box protein AGL...    266   3e-84    
dbj|BAD10945.1|  SEPALLATA3 homologous protein                          265   3e-84    Silene latifolia
dbj|BAM34478.1|  MADS-box transcription factor                          265   4e-84    
gb|KFK44483.1|  developmental protein sepallata 3                       265   4e-84    
gb|AAX15923.1|  AGL9.1                                                  264   1e-83    Persea americana
ref|XP_010530562.1|  PREDICTED: developmental protein SEPALLATA 3...    265   1e-83    
gb|AIU94433.1|  MADS-box transcription factor 2 isoform 1               264   1e-83    
gb|ACJ64678.1|  MADS-box protein MADS2                                  264   2e-83    Musa acuminata AAA Group [Cavendish banana]
ref|XP_002890717.1|  hypothetical protein ARALYDRAFT_472923             263   4e-83    
ref|NP_850953.1|  MADs box transcription factor SEPALLATA3              263   4e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010499198.1|  PREDICTED: developmental protein SEPALLATA 3...    262   9e-83    
ref|XP_010460483.1|  PREDICTED: developmental protein SEPALLATA 3...    262   1e-82    
ref|XP_010499197.1|  PREDICTED: developmental protein SEPALLATA 3...    262   1e-82    
gb|AAZ95252.1|  MADS box protein SEP1                                   261   2e-82    Dendrobium crumenatum
ref|XP_009113783.1|  PREDICTED: agamous-like MADS-box protein AGL...    261   3e-82    
gb|AIU94765.1|  class E MADS-domain transcription factor                259   5e-82    
gb|ADJ67238.1|  MADS box transcription factor 6                         260   5e-82    
gb|AIU94434.1|  MADS-box transcription factor 2 isoform 2               260   5e-82    
ref|XP_010025293.1|  PREDICTED: agamous-like MADS-box protein AGL...    260   6e-82    
ref|XP_010530561.1|  PREDICTED: developmental protein SEPALLATA 3...    260   7e-82    
dbj|BAC80253.1|  MADS-box transcription factor                          259   9e-82    Houttuynia cordata [chameleon-plant]
gb|AIU94764.1|  class E MADS-domain transcription factor                258   1e-81    
emb|CDY27603.1|  BnaA09g28040D                                          259   2e-81    
gb|AIU94432.1|  MADS-box transcription factor 2 isoform 3               258   3e-81    
gb|AIU94762.1|  class E MADS-domain transcription factor                258   3e-81    
ref|NP_564214.2|  MADs box transcription factor SEPALLATA3              258   3e-81    Arabidopsis thaliana [mouse-ear cress]
gb|ACA24481.1|  agamous-like 9 protein 1                                257   3e-81    
ref|XP_008801850.1|  PREDICTED: agamous-like MADS-box protein AGL...    259   4e-81    
ref|XP_010478051.1|  PREDICTED: developmental protein SEPALLATA 3...    258   4e-81    
gb|AAP83398.1|  SEPALLATA3-like MADS-box                                256   4e-81    Papaver nudicaule [Arctic poppy]
ref|XP_010531079.1|  PREDICTED: developmental protein SEPALLATA 3...    258   5e-81    
gb|ABC70706.1|  MADS-box transcription factor                           257   5e-81    Asparagus virgatus
ref|XP_010499195.1|  PREDICTED: developmental protein SEPALLATA 3...    258   6e-81    
ref|XP_010460482.1|  PREDICTED: developmental protein SEPALLATA 3...    258   6e-81    
ref|XP_010917559.1|  PREDICTED: agamous-like MADS-box protein AGL...    257   7e-81    
ref|XP_010460481.1|  PREDICTED: developmental protein SEPALLATA 3...    258   7e-81    
gb|ABQ85950.1|  MADS-box transcription factor SEP-like 1                256   7e-81    Trochodendron aralioides
gb|AIU94430.1|  MADS-box transcription factor 2 isoform 2               256   1e-80    
gb|AHW52536.1|  SEPALLATA-like MADS-box protein 1                       256   1e-80    
gb|AAP20094.1|  MADS4                                                   253   2e-80    Vitis vinifera
gb|AAX53102.1|  AGL9-like protein                                       255   2e-80    Eupomatia bennettii
sp|Q38694.1|AGL9_ARADE  RecName: Full=Agamous-like MADS-box prote...    256   2e-80    x Aranda deborah
gb|AHM92084.1|  MADS-box protein 8                                      256   2e-80    
ref|XP_009113782.1|  PREDICTED: agamous-like MADS-box protein AGL...    256   2e-80    
gb|AAQ83834.1|  MADS box protein                                        255   3e-80    Asparagus officinalis
gb|ADD25199.1|  SEP3                                                    254   3e-80    Nuphar advena
sp|O04067.1|AGL9_SINAL  RecName: Full=Agamous-like MADS-box prote...    255   6e-80    Sinapis alba [bai jie]
gb|AGT20513.1|  SEP3                                                    254   9e-80    
ref|XP_004504399.1|  PREDICTED: agamous-like MADS-box protein AGL...    254   9e-80    
ref|XP_010682730.1|  PREDICTED: agamous-like MADS-box protein AGL...    253   2e-79    
gb|AHJ80843.1|  SEPALLATA3                                              253   2e-79    
ref|XP_010913018.1|  PREDICTED: agamous-like MADS-box protein AGL...    253   2e-79    
ref|XP_010478049.1|  PREDICTED: developmental protein SEPALLATA 3...    253   2e-79    
gb|AFH66785.1|  SEP-like MADS-box protein                               253   2e-79    
ref|XP_010478050.1|  PREDICTED: developmental protein SEPALLATA 3...    253   2e-79    
ref|XP_008801853.1|  PREDICTED: agamous-like MADS-box protein AGL...    253   2e-79    
ref|XP_009419371.1|  PREDICTED: agamous-like MADS-box protein AGL...    253   2e-79    
ref|XP_010531071.1|  PREDICTED: developmental protein SEPALLATA 3...    253   3e-79    
gb|AIU94763.1|  class E MADS-domain transcription factor                252   4e-79    
ref|XP_010460480.1|  PREDICTED: developmental protein SEPALLATA 3...    253   4e-79    
gb|ABD62860.1|  SEP3.2                                                  252   5e-79    Persea borbonia [red bay]
ref|XP_006415782.1|  hypothetical protein EUTSA_v10008591mg             250   5e-79    
ref|XP_009102995.1|  PREDICTED: agamous-like MADS-box protein AGL...    252   7e-79    
gb|ABF67487.1|  MADS-domain transcription factor                        251   1e-78    Impatiens hawkeri
ref|XP_004504400.1|  PREDICTED: agamous-like MADS-box protein AGL...    251   1e-78    
gb|ACB69510.1|  SEPALLATA3-like MADS-box protein                        251   2e-78    Crocus sativus [saffron crocus]
gb|ABS17562.1|  SEPALLATA 3-like protein                                250   3e-78    Platanus x hispanica [London plane tree]
emb|CDY03905.1|  BnaC07g11300D                                          251   4e-78    
emb|CDX84935.1|  BnaC05g21200D                                          250   6e-78    
gb|ACB69509.1|  SEPALLATA3-like MADS-box protein                        249   7e-78    Crocus sativus [saffron crocus]
ref|XP_008801855.1|  PREDICTED: agamous-like MADS-box protein AGL...    247   9e-78    
emb|CDY15724.1|  BnaA07g08950D                                          249   1e-77    
gb|AIU94761.1|  class E MADS-domain transcription factor                248   1e-77    
ref|XP_010478048.1|  PREDICTED: developmental protein SEPALLATA 3...    249   2e-77    
gb|ACA24482.1|  agamous-like 9 protein 2                                248   2e-77    
ref|XP_009102994.1|  PREDICTED: agamous-like MADS-box protein AGL...    248   2e-77    
dbj|BAG50409.1|  MADS-box transcription factor                          247   3e-77    Cardamine sp. SIM-2007
gb|AAX53104.1|  AGL9-like protein                                       246   3e-77    Magnolia grandiflora [southern magnolia]
gb|ABD62861.1|  SEP3.1                                                  247   3e-77    Persea borbonia [red bay]
gb|ABC70710.1|  MADS-box transcription factor                           247   4e-77    Asparagus officinalis
ref|NP_001242742.1|  uncharacterized protein LOC100805078               246   5e-77    
sp|Q42464.1|AGL9_SOLLC  RecName: Full=Agamous-like MADS-box prote...    246   7e-77    Solanum lycopersicum
gb|AGV31155.1|  E-class MADS-box protein                                246   1e-76    
gb|AHM92085.1|  MADS-box protein 9                                      245   5e-76    
gb|ABC70707.1|  MADS-box transcription factor                           244   5e-76    Asparagus virgatus
gb|AAX15916.1|  AGL9                                                    243   6e-76    Amborella trichopoda
ref|XP_006848294.1|  hypothetical protein AMTR_s00013p00103080          243   1e-75    
gb|AEX92976.1|  MADS box protein 1                                      243   2e-75    
gb|AHW52538.1|  SEPALLATA-like MADS-box protein 3                       243   3e-75    
gb|AHY82573.1|  MADS-box protein 6                                      242   4e-75    
gb|ACJ64681.1|  MADS-box protein MADS4                                  242   6e-75    Musa acuminata AAA Group [Cavendish banana]
gb|ACB69511.1|  SEPALLATA3-like MADS-box protein                        241   1e-74    Crocus sativus [saffron crocus]
dbj|BAM34479.1|  MADS-box transcription factor                          241   2e-74    
ref|XP_010499200.1|  PREDICTED: developmental protein SEPALLATA 3...    239   4e-74    
ref|XP_010499201.1|  PREDICTED: developmental protein SEPALLATA 3...    239   5e-74    
dbj|BAL05005.1|  putative MADS box protein                              238   2e-73    
gb|ACB69512.1|  SEPALLATA3-like MADS-box protein                        236   6e-73    Crocus sativus [saffron crocus]
ref|NP_001185081.1|  MADs box transcription factor SEPALLATA3           236   1e-72    
ref|XP_008801851.1|  PREDICTED: agamous-like MADS-box protein AGL...    236   2e-72    
ref|XP_009109826.1|  PREDICTED: agamous-like MADS-box protein AGL...    234   4e-72    
ref|XP_008801854.1|  PREDICTED: agamous-like MADS-box protein AGL...    231   3e-71    
emb|CDY11824.1|  BnaC03g57540D                                          232   5e-71    
ref|XP_010260833.1|  PREDICTED: MADS-box protein CMB1                   231   6e-71    
ref|XP_009109825.1|  PREDICTED: agamous-like MADS-box protein AGL...    230   2e-70    
ref|XP_006305560.1|  hypothetical protein CARUB_v100101340mg            229   6e-70    
ref|XP_002299317.2|  hypothetical protein POPTR_0001s13650g             226   8e-70    Populus trichocarpa [western balsam poplar]
gb|EPS62764.1|  hypothetical protein M569_12026                         224   1e-69    
ref|NP_001268109.1|  MADS-box protein 2                                 228   1e-69    
ref|XP_010257958.1|  PREDICTED: developmental protein SEPALLATA 1       228   2e-69    
ref|XP_006385890.1|  hypothetical protein POPTR_0003s16810g             224   8e-69    
ref|XP_006593703.1|  PREDICTED: developmental protein SEPALLATA 1...    226   2e-68    
ref|XP_010660492.1|  PREDICTED: MADS-box protein 2 isoform X1           224   4e-68    
gb|KCW86945.1|  hypothetical protein EUGRSUZ_B03515                     220   1e-67    
ref|XP_003544012.1|  PREDICTED: developmental protein SEPALLATA 1...    223   1e-67    
gb|EYU33465.1|  hypothetical protein MIMGU_mgv1a0126182mg               219   2e-67    
gb|AAY21913.2|  putative MADS box protein                               222   2e-67    Musa acuminata [banana]
ref|XP_006603756.1|  PREDICTED: MADS-box protein isoform X1             223   2e-67    
ref|XP_007139420.1|  hypothetical protein PHAVU_008G027900g             222   4e-67    
gb|ACD39982.1|  MADS1                                                   221   5e-67    Carica papaya [mamon]
ref|NP_001238296.1|  MADS-box protein                                   221   6e-67    
gb|AAQ83836.1|  MADS box protein                                        220   8e-67    Asparagus officinalis
gb|KHN29767.1|  Developmental protein SEPALLATA 2                       220   2e-66    
gb|AAX15922.1|  AGL2                                                    219   2e-66    Acorus americanus [sweetflag]
dbj|BAM34480.1|  MADS-box transcription factor                          218   5e-66    
ref|XP_006856372.1|  hypothetical protein AMTR_s00047p00190220          219   5e-66    
gb|ADD25197.1|  SEP2                                                    217   1e-65    Nuphar advena
gb|AFO68790.1|  agamous-like protein 234                                217   1e-65    
ref|XP_009384296.1|  PREDICTED: MADS-box transcription factor 8-like    217   2e-65    
ref|XP_009405081.1|  PREDICTED: agamous-like MADS-box protein AGL...    216   2e-65    
gb|AIE44769.1|  putative MADS-domain transcription factor AGL2          217   2e-65    
gb|KEH25149.1|  MADS-box transcription factor                           217   2e-65    
ref|XP_004507289.1|  PREDICTED: developmental protein SEPALLATA 1...    217   3e-65    
gb|AFO68778.1|  agamous-like protein 2                                  216   3e-65    
ref|XP_004154725.1|  PREDICTED: developmental protein SEPALLATA 2...    217   3e-65    
ref|XP_004507287.1|  PREDICTED: developmental protein SEPALLATA 1...    217   3e-65    
ref|XP_003531877.1|  PREDICTED: developmental protein SEPALLATA 1...    216   6e-65    
ref|XP_010694125.1|  PREDICTED: developmental protein SEPALLATA 1...    216   7e-65    
ref|XP_007151389.1|  hypothetical protein PHAVU_004G042300g             216   8e-65    
ref|XP_007032865.1|  K-box region and MADS-box transcription fact...    216   8e-65    
ref|NP_001267667.1|  developmental protein SEPALLATA 2-like             216   9e-65    
ref|XP_010694117.1|  PREDICTED: developmental protein SEPALLATA 1...    216   1e-64    
gb|AGV54737.1|  developmental protein SEPALLATA 2-like protein          216   1e-64    
ref|XP_006585806.1|  PREDICTED: developmental protein SEPALLATA 1...    215   1e-64    
gb|ADD25190.1|  SEP1                                                    214   2e-64    Nelumbo nucifera [Indian lotus]
ref|XP_009373783.1|  PREDICTED: developmental protein SEPALLATA 1...    215   2e-64    
gb|ACO72983.1|  SEP3-like MADS-box protein                              215   2e-64    Alpinia hainanensis [cao dou kou]
ref|XP_004507288.1|  PREDICTED: developmental protein SEPALLATA 1...    214   3e-64    
gb|AAX53103.1|  AGL2-like protein                                       214   3e-64    
gb|AFK42306.1|  unknown                                                 214   3e-64    
ref|XP_009373782.1|  PREDICTED: developmental protein SEPALLATA 1...    214   4e-64    
gb|AAC25922.1|  MADS-box protein 1                                      214   5e-64    
ref|XP_010694134.1|  PREDICTED: developmental protein SEPALLATA 1...    214   5e-64    
ref|XP_003621519.1|  MADS-box protein                                   213   9e-64    
ref|XP_006659622.1|  PREDICTED: MADS-box transcription factor 7-like    213   1e-63    
ref|XP_006660815.1|  PREDICTED: MADS-box transcription factor 8-like    213   1e-63    
ref|XP_009378252.1|  PREDICTED: developmental protein SEPALLATA 1...    213   1e-63    
ref|XP_008464576.1|  PREDICTED: developmental protein SEPALLATA 1...    213   1e-63    
emb|CAE46179.1|  AGL2-like MADS box transcription factor                211   2e-63    
ref|NP_001280893.1|  developmental protein SEPALLATA 1                  212   2e-63    
ref|XP_006602962.1|  PREDICTED: developmental protein SEPALLATA 1...    212   2e-63    
ref|XP_008341807.1|  PREDICTED: developmental protein SEPALLATA 1...    211   4e-63    
gb|ADR83588.1|  Sepallata 1-like protein                                211   7e-63    
gb|AHH28266.1|  MADS-box transcription factor                           211   8e-63    
ref|XP_007151388.1|  hypothetical protein PHAVU_004G042300g             209   1e-62    
emb|CAN59955.1|  hypothetical protein VITISV_006723                     210   1e-62    
gb|ADD25207.1|  SEP1                                                    208   2e-62    
gb|AFO68791.1|  agamous-like protein 234                                209   2e-62    
gb|AET98846.1|  SEPALLATA1                                              209   2e-62    
gb|AHH28272.1|  MADS-box transcription factor                           209   2e-62    
ref|XP_004491903.1|  PREDICTED: developmental protein SEPALLATA 1...    210   2e-62    
gb|AHH28254.1|  MADS-box transcription factor                           209   2e-62    
ref|XP_003552609.1|  PREDICTED: developmental protein SEPALLATA 1...    210   2e-62    
gb|AAX15921.1|  AGL2                                                    207   3e-62    
ref|XP_008230291.1|  PREDICTED: developmental protein SEPALLATA 1...    209   3e-62    
gb|AFU81295.1|  SEPALLATA1                                              209   4e-62    
ref|XP_007215876.1|  hypothetical protein PRUPE_ppa010548mg             209   4e-62    
dbj|BAC80255.1|  MADS-box transcription factor                          208   6e-62    
gb|AES77737.2|  MADS-box transcription factor                           208   7e-62    
emb|CAC37398.1|  MADS2 protein                                          206   7e-62    
gb|AAX69068.1|  MADS box protein M6                                     208   8e-62    
gb|ABQ85952.1|  MADS-box transcription factor SEP-like 3                207   8e-62    
ref|XP_011021072.1|  PREDICTED: developmental protein SEPALLATA 2...    208   9e-62    
ref|XP_006430949.1|  hypothetical protein CICLE_v10012593mg             208   1e-61    
gb|AAF12701.2|  Apetala 1 protein                                       207   1e-61    
ref|XP_002306051.2|  hypothetical protein POPTR_0004s11440g             207   1e-61    
ref|XP_004491904.1|  PREDICTED: developmental protein SEPALLATA 1...    207   1e-61    
gb|AHH28301.1|  MADS-box transcription factor                           206   1e-61    
emb|CAA04920.1|  MdMADS9                                                207   2e-61    
gb|ADL36750.1|  MADS domain class transcription factor                  207   2e-61    
ref|XP_006482430.1|  PREDICTED: developmental protein SEPALLATA 1...    207   2e-61    
gb|KDP24297.1|  hypothetical protein JCGZ_25593                         207   2e-61    
ref|XP_008357795.1|  PREDICTED: LOW QUALITY PROTEIN: developmenta...    207   2e-61    
gb|ADL36751.1|  MADS domain class transcription factor                  207   2e-61    
ref|XP_011014957.1|  PREDICTED: developmental protein SEPALLATA 2...    207   2e-61    
ref|XP_008230292.1|  PREDICTED: developmental protein SEPALLATA 1...    207   3e-61    
gb|AAY30858.1|  MADS-box transcription factor                           206   3e-61    
gb|AAL08423.2|AF185574_1  transcription factor MAGL4                    206   3e-61    
gb|AAP83390.1|  SEPALLATA1-like MADS-box                                206   4e-61    
gb|AFM30904.1|  transcription factor MADS4                              205   9e-61    
gb|ADC79694.1|  SEPALLATA1-like protein                                 205   1e-60    
gb|EEC84853.1|  hypothetical protein OsI_31966                          205   1e-60    
gb|AAB53193.1|  MADS box protein                                        204   1e-60    
ref|XP_010558530.1|  PREDICTED: developmental protein SEPALLATA 1       205   1e-60    
ref|NP_001063613.1|  Os09g0507200                                       205   2e-60    
ref|XP_008365428.1|  PREDICTED: developmental protein SEPALLATA 1...    205   2e-60    
dbj|BAC80254.1|  MADS-box transcription factor                          205   2e-60    
gb|ABG78619.1|  MADS4                                                   204   2e-60    
ref|XP_008230289.1|  PREDICTED: developmental protein SEPALLATA 1...    204   2e-60    
ref|XP_010099309.1|  Developmental protein SEPALLATA 2                  204   2e-60    
ref|XP_007215877.1|  hypothetical protein PRUPE_ppa010548mg             204   2e-60    
gb|ADV90800.1|  SEP3-like protein                                       204   2e-60    
gb|KHG17252.1|  Developmental SEPALLATA 2 -like protein                 204   3e-60    
gb|AEJ76841.1|  MADS17                                                  204   3e-60    
ref|NP_001234201.1|  TAGL2 transcription factor                         204   4e-60    
ref|NP_001289804.1|  MADS-box transcription factor 8                    204   5e-60    
gb|ADN37686.1|  SEP3                                                    199   7e-60    
ref|XP_010315869.1|  PREDICTED: MADS-box protein isoform X1             203   7e-60    
gb|AAP83376.1|  SEPALLATA1-like MADS-box                                202   8e-60    
ref|XP_006338336.1|  PREDICTED: developmental protein SEPALLATA 1...    203   9e-60    
gb|AAP83375.1|  SEPALLATA1-like MADS-box                                202   9e-60    
gb|ACB45304.1|  MIKC-type MADS-box transcription factor WM10A           202   1e-59    
ref|NP_001233911.1|  MADS-box protein                                   202   1e-59    
ref|XP_008230290.1|  PREDICTED: developmental protein SEPALLATA 1...    202   1e-59    
ref|XP_008811033.1|  PREDICTED: agamous-like MADS-box protein AGL...    202   2e-59    
gb|ADC79693.1|  SEPALLATA1-like protein                                 202   2e-59    
gb|AAQ72498.1|  MADS-box protein 12                                     202   2e-59    
gb|AAC78282.1|  MADS box protein                                        200   2e-59    
gb|AAD38370.1|  MADS-box protein FDRMADS1                               201   3e-59    
gb|ADD25177.1|  SEP1-1                                                  201   4e-59    
gb|AEF59025.1|  MADS-1                                                  201   4e-59    
ref|XP_008811035.1|  PREDICTED: agamous-like MADS-box protein AGL...    201   5e-59    
ref|XP_008811034.1|  PREDICTED: agamous-like MADS-box protein AGL...    201   5e-59    
dbj|BAF75018.1|  MADS-box protein                                       201   5e-59    
gb|AHC54178.1|  sepallata-like MADS box transcription factor 3          198   6e-59    
gb|AGW23364.1|  MADS box protein MADS62                                 201   6e-59    
ref|XP_010029406.1|  PREDICTED: developmental protein SEPALLATA 1       201   7e-59    
gb|AAQ11687.1|  MADS box protein                                        201   7e-59    
ref|XP_004304204.1|  PREDICTED: developmental protein SEPALLATA 2...    201   7e-59    
sp|Q0J466.2|MADS7_ORYSJ  RecName: Full=MADS-box transcription fac...    201   8e-59    
ref|XP_006408426.1|  hypothetical protein EUTSA_v10021390mg             201   8e-59    
ref|XP_009608616.1|  PREDICTED: developmental protein SEPALLATA 1...    200   9e-59    
gb|AHH28302.1|  MADS-box transcription factor                           199   1e-58    
dbj|BAG50408.1|  MADS-box transcription factor                          199   1e-58    
gb|AGT20511.1|  SEP2.a                                                  200   1e-58    
dbj|BAC79181.1|  MADS-box protein                                       199   1e-58    
gb|AAC49816.2|  MADS box protein                                        200   1e-58    
gb|AFX72877.1|  MADS-box protein SEP2A                                  199   2e-58    
ref|XP_008811037.1|  PREDICTED: agamous-like MADS-box protein AGL...    199   3e-58    
gb|ABF57918.1|  MADS-box transcription factor TaAGL16                   199   3e-58    
gb|AAZ77748.1|  AGL2-like MADS box 3                                    199   3e-58    
ref|XP_004974003.1|  PREDICTED: MADS-box transcription factor 7-like    199   3e-58    
gb|ABF57932.1|  MADS-box transcription factor TaAGL30                   199   3e-58    
emb|CAB97355.1|  MADS-box protein 9                                     199   3e-58    
ref|XP_010463632.1|  PREDICTED: developmental protein SEPALLATA 2...    199   4e-58    
gb|AAP83413.1|  SEPALLATA3-like MADS-box                                197   4e-58    
dbj|BAF75017.1|  MADS-box protein                                       199   4e-58    
ref|XP_010485469.1|  PREDICTED: developmental protein SEPALLATA 2       199   4e-58    
gb|ACF78403.1|  unknown                                                 198   5e-58    
gb|AAU82009.1|  SEPALLATA2                                              198   6e-58    
ref|XP_004957289.1|  PREDICTED: MADS-box transcription factor 8-l...    198   6e-58    
ref|NP_186880.1|  developmental protein SEPALLATA 2                     198   6e-58    
gb|AAO42085.1|  putative floral homeotic protein AGL4                   198   6e-58    
emb|CAM59053.1|  MIKC-type MADS-box transcription factor WM10A          198   7e-58    
emb|CAA75241.1|  M79 protein                                            198   7e-58    
ref|XP_002460491.1|  hypothetical protein SORBIDRAFT_02g029310          197   9e-58    
gb|AHC54165.1|  sepallata-like MADS box transcription factor 3          195   9e-58    
gb|AHM92083.1|  MADS-box protein 7                                      198   9e-58    
dbj|BAF75016.1|  MADS-box protein                                       197   1e-57    
gb|EYU33464.1|  hypothetical protein MIMGU_mgv1a0126182mg               194   1e-57    
emb|CDY57524.1|  BnaA05g33600D                                          197   1e-57    
gb|AAO45877.1|  MADS5                                                   197   1e-57    
ref|NP_001288311.1|  MADS-box transcription factor 7-like               197   1e-57    
emb|CDY26462.1|  BnaC09g42060D                                          197   1e-57    
gb|AHC54144.1|  sepallata-like MADS box transcription factor 3          194   2e-57    
gb|EEE69055.1|  hypothetical protein OsJ_28057                          199   2e-57    
ref|XP_009117898.1|  PREDICTED: developmental protein SEPALLATA 2       197   2e-57    
ref|XP_009608615.1|  PREDICTED: developmental protein SEPALLATA 1...    197   2e-57    
gb|AAQ01163.1|  MADS box protein                                        197   2e-57    
gb|AHC54171.1|  sepallata-like MADS box transcription factor 3          194   3e-57    
emb|CDY34718.1|  BnaA01g33070D                                          196   3e-57    
ref|XP_009121545.1|  PREDICTED: developmental protein SEPALLATA 1       196   3e-57    
ref|XP_010470619.1|  PREDICTED: developmental protein SEPALLATA 2...    196   5e-57    
ref|XP_006298399.1|  hypothetical protein CARUB_v10014470mg             196   5e-57    
ref|NP_001105525.1|  MADS27                                             196   6e-57    
ref|XP_011099040.1|  PREDICTED: developmental protein SEPALLATA 1...    196   6e-57    
gb|AAO45880.1|  MADS8                                                   195   6e-57    
ref|XP_004957288.1|  PREDICTED: MADS-box transcription factor 8-l...    195   8e-57    
gb|AAL14197.1|  SEPELLATA3-like MADS-box protein                        192   8e-57    
gb|ADC79707.1|  SEPALLATA1-like protein                                 195   1e-56    
ref|XP_006400104.1|  hypothetical protein EUTSA_v10014493mg             195   1e-56    
ref|XP_011099041.1|  PREDICTED: developmental protein SEPALLATA 1...    195   1e-56    
ref|XP_010549963.1|  PREDICTED: developmental protein SEPALLATA 1       195   1e-56    
gb|AGT20512.1|  SEP2.b                                                  195   1e-56    
gb|AFO68782.1|  floral-binding protein 9                                193   2e-56    
gb|AAA32732.1|  transcription factor                                    194   2e-56    
ref|XP_002884314.1|  SEPALLATA2                                         194   2e-56    
gb|AFO68773.1|  agamous-like protein 2                                  192   2e-56    
ref|XP_009757151.1|  PREDICTED: developmental protein SEPALLATA 1...    194   2e-56    
gb|KGN53780.1|  hypothetical protein Csa_4G126990                       192   2e-56    
ref|XP_010936438.1|  PREDICTED: agamous-like MADS-box protein AGL...    194   3e-56    
emb|CAM59054.1|  MIKC-type MADS-box transcription factor WM10B          194   3e-56    
dbj|BAM34481.1|  MADS-box transcription factor                          194   3e-56    
ref|XP_002263410.2|  PREDICTED: MADS-box protein CMB1                   193   3e-56    
ref|XP_009147359.1|  PREDICTED: developmental protein SEPALLATA 2...    194   4e-56    
gb|ABD60322.1|  SEP2                                                    194   4e-56    
ref|XP_002263039.1|  PREDICTED: MADS-box protein CMB1 isoform X2        193   4e-56    
ref|XP_010233642.1|  PREDICTED: MADS-box transcription factor 7-l...    193   5e-56    
gb|AHH28303.1|  MADS-box transcription factor                           192   5e-56    
gb|ADJ67241.1|  MADS box transcription factor 11                        193   5e-56    
ref|XP_009131500.1|  PREDICTED: developmental protein SEPALLATA 1...    193   6e-56    
gb|AHC54174.1|  sepallata-like MADS box transcription factor 3          190   8e-56    
gb|AAT37486.1|  MADS7 protein                                           192   8e-56    
gb|AAT37484.1|  MADS5 protein                                           192   9e-56    
gb|AAT37483.1|  MADS4 protein                                           192   9e-56    
gb|EMS49687.1|  MADS-box transcription factor 7                         192   9e-56    
gb|AHC54190.1|  sepallata-like MADS box transcription factor 3          190   1e-55    
gb|AHM92068.1|  MADS-box protein 8                                      192   1e-55    
gb|AHC54154.1|  sepallata-like MADS box transcription factor 3          189   1e-55    
gb|AHC54180.1|  sepallata-like MADS box transcription factor 3          188   1e-55    
gb|AHC54161.1|  sepallata-like MADS box transcription factor 3          189   1e-55    
gb|AHC54147.1|  sepallata-like MADS box transcription factor 3          189   1e-55    
gb|AHC54191.1|  sepallata-like MADS box transcription factor 3          189   1e-55    
gb|AHC54175.1|  sepallata-like MADS box transcription factor 3          189   1e-55    
ref|XP_009608617.1|  PREDICTED: developmental protein SEPALLATA 1...    192   2e-55    
gb|AHC54157.1|  sepallata-like MADS box transcription factor 3          189   2e-55    
ref|XP_002873742.1|  hypothetical protein ARALYDRAFT_909555             192   2e-55    
gb|AAU82031.1|  SEPALLATA2                                              191   2e-55    
tpg|DAA40489.1|  TPA: zea mays MADS7                                    194   3e-55    
gb|ADN37684.1|  SEP3                                                    187   3e-55    
gb|ABF57929.1|  MADS-box transcription factor TaAGL28                   191   3e-55    
gb|AFK36561.1|  unknown                                                 189   3e-55    
emb|CDX69499.1|  BnaA10g18480D                                          192   3e-55    
gb|ADN37685.1|  SEP3                                                    187   3e-55    
gb|KFK25803.1|  hypothetical protein AALP_AA8G163200                    191   5e-55    
gb|AAT37485.1|  MADS6 protein                                           191   5e-55    
ref|XP_002445814.1|  hypothetical protein SORBIDRAFT_07g026200          190   6e-55    
ref|XP_009757152.1|  PREDICTED: developmental protein SEPALLATA 1...    190   7e-55    
gb|AAT37482.1|  MADS3 protein                                           190   7e-55    
emb|CDP02339.1|  unnamed protein product                                190   9e-55    
gb|AHC54189.1|  sepallata-like MADS box transcription factor 3          187   1e-54    
gb|EMT12289.1|  MADS-box transcription factor 8                         190   1e-54    
gb|AEW50208.1|  SEP1                                                    189   1e-54    
gb|AAK21248.1|AF335235_1  MADS-box transcription factor FBP5            189   1e-54    
ref|XP_009589584.1|  PREDICTED: developmental protein SEPALLATA 1...    189   1e-54    
dbj|BAD10944.1|  SEPALLATA1 homologous protein                          189   2e-54    
ref|NP_001105153.1|  MADS6                                              189   2e-54    
gb|ADD10733.1|  MADS-domain transcription factor                        189   2e-54    
emb|CAN84110.1|  hypothetical protein VITISV_036170                     189   2e-54    
gb|AHC54188.1|  sepallata-like MADS box transcription factor 3          186   2e-54    
emb|CAA70485.1|  putative MADS-domain transcription factor              188   3e-54    
gb|ACG32829.1|  SRF-type transcription factor family protein            188   4e-54    
gb|AHC54155.1|  sepallata-like MADS box transcription factor 3          186   4e-54    
ref|XP_009757345.1|  PREDICTED: developmental protein SEPALLATA 1...    188   4e-54    
gb|AAP83397.1|  SEPALLATA1-like MADS-box                                187   4e-54    
ref|XP_010453727.1|  PREDICTED: developmental protein SEPALLATA 1       188   7e-54    
ref|XP_008379876.1|  PREDICTED: developmental protein SEPALLATA 1...    186   7e-54    
gb|AGW23594.1|  MADS1                                                   187   8e-54    
ref|XP_010532442.1|  PREDICTED: developmental protein SEPALLATA 3...    185   9e-54    
ref|XP_010420253.1|  PREDICTED: developmental protein SEPALLATA 1...    187   9e-54    
gb|AFO68788.1|  floral-binding protein 9                                186   1e-53    
gb|AEX58640.1|  AGL2-2                                                  187   1e-53    
gb|AHC54173.1|  sepallata-like MADS box transcription factor 3          182   2e-53    
gb|KCW48935.1|  hypothetical protein EUGRSUZ_K02546                     186   2e-53    
ref|XP_006288512.1|  hypothetical protein CARUB_v10001783mg             186   2e-53    
gb|AEY68241.1|  SEPALLATA3                                              182   2e-53    
gb|ADD25178.1|  SEP1-2                                                  186   2e-53    
gb|AHC54169.1|  sepallata-like MADS box transcription factor 3          182   2e-53    



>gb|ADU56817.1| MADS-box protein AGL2 subfamily [Coffea arabica]
 emb|CDP13360.1| unnamed protein product [Coffea canephora]
Length=241

 Score =   355 bits (912),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 183/193 (95%), Gaps = 4/193 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ+MLDQLTDLQRKEHALNEANK+L
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQVMLDQLTDLQRKEHALNEANKTL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--A  410
            KQRLMEGNQ+NL WNPNAQD+GYGRQ A H+QGD FFHPL+CEPTLQIGY  DPITV  A
Sbjct  170  KQRLMEGNQVNLQWNPNAQDVGYGRQPA-HAQGDGFFHPLDCEPTLQIGYQNDPITVAAA  228

Query  409  GPSVNNYMPGWLP  371
            GPSVNNYM GWLP
Sbjct  229  GPSVNNYMAGWLP  241



>ref|NP_001289529.1| agamous-like MADS-box protein AGL9 homolog [Nicotiana sylvestris]
 gb|AAD39034.1|AF068722_1 MADS-box protein MADS3 [Nicotiana sylvestris]
 gb|AFY06679.1| sepallata3-like MADS-box [Nicotiana tabacum]
Length=241

 Score =   348 bits (894),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 179/193 (93%), Gaps = 4/193 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NISTREAL EISSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREAL-EISSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ+MLDQLTDLQRKEHALNEAN++L
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDLQRKEHALNEANRTL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--A  410
            KQRLMEG+QLNL W  NAQDMGYGRQT   +QGD FFHPLECEPTLQIGY  DPITV  A
Sbjct  170  KQRLMEGSQLNLQWQQNAQDMGYGRQTT-QTQGDGFFHPLECEPTLQIGYQNDPITVGGA  228

Query  409  GPSVNNYMPGWLP  371
            GPSVNNYM GWLP
Sbjct  229  GPSVNNYMAGWLP  241



>gb|AAP83377.1| SEPALLATA3-like MADS-box [Solanum lycopersicum]
Length=210

 Score =   345 bits (886),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 179/193 (93%), Gaps = 4/193 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL EISSQQEYLKLK RYEALQRS
Sbjct  20   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL-EISSQQEYLKLKGRYEALQRS  78

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ+MLDQLTD QRKEHALNEAN++L
Sbjct  79   QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDYQRKEHALNEANRTL  138

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--A  410
            KQRLMEG+QLNL W PNAQD+GYGRQT   +QGD FFHPL+CEPTLQIGY  DPITV  A
Sbjct  139  KQRLMEGSQLNLQWQPNAQDVGYGRQTT-QTQGDGFFHPLDCEPTLQIGYQNDPITVGGA  197

Query  409  GPSVNNYMPGWLP  371
            GPSVNNYM GWLP
Sbjct  198  GPSVNNYMAGWLP  210



>ref|NP_001234384.1| agamous-like MADS-box protein AGL9 homolog [Solanum lycopersicum]
 gb|AAP57413.1| MADS-box protein 5 [Solanum lycopersicum]
Length=241

 Score =   347 bits (889),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 179/193 (93%), Gaps = 4/193 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL EISSQQEYLKLK RYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL-EISSQQEYLKLKGRYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ+MLDQLTD QRKEHALNEAN++L
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDYQRKEHALNEANRTL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--A  410
            KQRLMEG+QLNL W PNAQD+GYGRQT   +QGD FFHPL+CEPTLQIGY  DPITV  A
Sbjct  170  KQRLMEGSQLNLQWQPNAQDVGYGRQTT-QTQGDGFFHPLDCEPTLQIGYQNDPITVGGA  228

Query  409  GPSVNNYMPGWLP  371
            GPSVNNYM GWLP
Sbjct  229  GPSVNNYMAGWLP  241



>gb|AHW58034.1| SEP3 [Coffea arabica]
Length=246

 Score =   347 bits (889),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 182/198 (92%), Gaps = 9/198 (5%)
 Frame = -3

Query  943  RGKLYEFCSSS-----SMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYE  779
            RGKLYEFCSSS     SMLKTLERYQKCNYGAPEPNISTREAL E+SSQQEYLKLKARYE
Sbjct  51   RGKLYEFCSSSRVTLYSMLKTLERYQKCNYGAPEPNISTREAL-ELSSQQEYLKLKARYE  109

Query  778  ALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNE  599
            ALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ+MLDQLTDLQRKEHALNE
Sbjct  110  ALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQVMLDQLTDLQRKEHALNE  169

Query  598  ANKSLKQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPI  419
            ANK+LKQRLMEGNQ+NL WNPNAQD+GYGRQ A H+QGD FFHPL+CEP LQIGY  DPI
Sbjct  170  ANKTLKQRLMEGNQVNLQWNPNAQDVGYGRQPA-HAQGDGFFHPLDCEPPLQIGYQNDPI  228

Query  418  TV--AGPSVNNYMPGWLP  371
            TV  AGPSVNNYM GWLP
Sbjct  229  TVAAAGPSVNNYMAGWLP  246



>ref|XP_006352168.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Solanum 
tuberosum]
Length=241

 Score =   345 bits (885),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 179/193 (93%), Gaps = 4/193 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL EISSQQEYLKLK RYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL-EISSQQEYLKLKGRYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ+MLDQLTD QRKEHALNEAN++L
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDHQRKEHALNEANRTL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--A  410
            KQRLMEG+QLNL W PNAQD+GYGRQT  + QGD FFHPL+CEPTLQIGY  DPITV  A
Sbjct  170  KQRLMEGSQLNLQWQPNAQDVGYGRQTTQN-QGDGFFHPLDCEPTLQIGYQNDPITVGGA  228

Query  409  GPSVNNYMPGWLP  371
            GPSVNNYM GWLP
Sbjct  229  GPSVNNYMAGWLP  241



>gb|ADP09004.1| SEP3-like protein [Lycium barbarum]
Length=241

 Score =   345 bits (884),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 179/193 (93%), Gaps = 4/193 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYE CSSSSMLKTLERYQKCNYGAPE NISTREAL EISSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYESCSSSSMLKTLERYQKCNYGAPETNISTREAL-EISSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSK+LESLERQLDMSLKQIRSTRTQ+MLDQLTDLQRKEHALNEAN++L
Sbjct  110  QRNLLGEDLGPLNSKDLESLERQLDMSLKQIRSTRTQLMLDQLTDLQRKEHALNEANRTL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--A  410
            KQRLMEG+QLNL W PNAQD+GYGRQT   +QGD FFHPLECEPTLQIGY  DPITV  A
Sbjct  170  KQRLMEGSQLNLQWQPNAQDVGYGRQTT-QTQGDGFFHPLECEPTLQIGYQNDPITVGGA  228

Query  409  GPSVNNYMPGWLP  371
            GPSVNNYM GWLP
Sbjct  229  GPSVNNYMAGWLP  241



>ref|XP_009600809.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Nicotiana 
tomentosiformis]
Length=242

 Score =   343 bits (879),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 177/194 (91%), Gaps = 5/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NISTREAL EISSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREAL-EISSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ+MLDQLTDLQRKEHALNEAN++L
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDLQRKEHALNEANRTL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV---  413
            KQRLMEG+QLNL W  NAQD+GYGRQT   +QGD FFHPLECEPTLQIGY  DPI     
Sbjct  170  KQRLMEGSQLNLQWQQNAQDVGYGRQTT-QTQGDGFFHPLECEPTLQIGYQNDPIITVGG  228

Query  412  AGPSVNNYMPGWLP  371
            AGPSVNNYM GWLP
Sbjct  229  AGPSVNNYMAGWLP  242



>gb|AEA76419.1| putative SEP3, partial [Catharanthus roseus]
Length=223

 Score =   341 bits (875),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 177/193 (92%), Gaps = 4/193 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSS LKTLERYQKCNYGAPEPN+STREAL EISSQQEYLKLKARYEALQRS
Sbjct  33   RGKLYEFCSSSSTLKTLERYQKCNYGAPEPNVSTREAL-EISSQQEYLKLKARYEALQRS  91

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ+MLDQLTDLQRKE ALNEANKSL
Sbjct  92   QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDLQRKEQALNEANKSL  151

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--A  410
            KQRLMEGNQ++L WNPN QD+GYGRQ     QGD FFHPLECEPTLQIGY  DPITV  A
Sbjct  152  KQRLMEGNQISLQWNPNPQDVGYGRQ-GGQPQGDGFFHPLECEPTLQIGYQNDPITVAAA  210

Query  409  GPSVNNYMPGWLP  371
            GPS+NNYM GWLP
Sbjct  211  GPSMNNYMAGWLP  223



>sp|Q03489.2|AGL9_PETHY RecName: Full=Agamous-like MADS-box protein AGL9 homolog; AltName: 
Full=Floral homeotic protein FBP2; AltName: Full=Floral-binding 
protein 2 [Petunia x hybrida]
 gb|AAA86854.1| transcription factor [Petunia x hybrida]
Length=241

 Score =   342 bits (876),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 177/193 (92%), Gaps = 4/193 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NISTREAL EISSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREAL-EISSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ+MLDQL DLQRKEHALNEAN++L
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--A  410
            KQRLMEG+ LNL W  NAQD+GYGRQ A  +QGD FFHPLECEPTLQIGY  DPITV  A
Sbjct  170  KQRLMEGSTLNLQWQQNAQDVGYGRQ-ATQTQGDGFFHPLECEPTLQIGYQNDPITVGGA  228

Query  409  GPSVNNYMPGWLP  371
            GPSVNNYM GWLP
Sbjct  229  GPSVNNYMAGWLP  241



>gb|AAP83395.1| SEPALLATA3-like MADS-box [Petunia x hybrida]
Length=210

 Score =   340 bits (873),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 177/193 (92%), Gaps = 4/193 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NISTREAL EISSQQEYLKLKARYEALQRS
Sbjct  20   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREAL-EISSQQEYLKLKARYEALQRS  78

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ+MLDQL DLQRKEHALNEAN++L
Sbjct  79   QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTL  138

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--A  410
            KQRLMEG+ LNL W  NAQD+GYGRQ A  +QGD FFHPLECEPTLQIGY  DPITV  A
Sbjct  139  KQRLMEGSTLNLQWQQNAQDVGYGRQ-ATQTQGDGFFHPLECEPTLQIGYQNDPITVGGA  197

Query  409  GPSVNNYMPGWLP  371
            GPSVNNYM GWLP
Sbjct  198  GPSVNNYMAGWLP  210



>dbj|BAG55316.1| transcription factor [Petunia integrifolia subsp. inflata]
 dbj|BAG55317.1| transcription factor [Petunia integrifolia subsp. inflata]
Length=240

 Score =   339 bits (870),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 170/192 (89%), Positives = 176/192 (92%), Gaps = 4/192 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NISTREAL EISSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREAL-EISSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ+MLDQL DLQRKEHALNEAN++L
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--A  410
            KQRLMEG+ LNL W  NAQD+GYGRQ A  +QGD FFHPLECEPTLQIGY  DPITV  A
Sbjct  170  KQRLMEGSTLNLQWQQNAQDVGYGRQ-ATQTQGDGFFHPLECEPTLQIGYQNDPITVGGA  228

Query  409  GPSVNNYMPGWL  374
            GPSVNNYM GWL
Sbjct  229  GPSVNNYMAGWL  240



>emb|CBI27678.3| unnamed protein product [Vitis vinifera]
Length=242

 Score =   335 bits (860),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 178/194 (92%), Gaps = 5/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL++KELESLERQLD+SLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSTKELESLERQLDVSLKQIRSTRTQYMLDQLTDLQRKEHMLNEANKTL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            KQRL+EG Q+N L WNPNAQD+GYGRQ A   QGD FFHPLECEPTLQIGY  DPITV  
Sbjct  170  KQRLLEGTQVNQLQWNPNAQDVGYGRQQA-QPQGDGFFHPLECEPTLQIGYQPDPITVAA  228

Query  412  AGPSVNNYMPGWLP  371
            AGPSVNNYMPGWLP
Sbjct  229  AGPSVNNYMPGWLP  242



>ref|NP_001268114.1| MADS-box protein 4 [Vitis vinifera]
 gb|AAM21344.1|AF373603_1 MADS-box protein 4 [Vitis vinifera]
Length=242

 Score =   332 bits (851),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 177/194 (91%), Gaps = 5/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQ S
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQLS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL++KELESLERQLD+SLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSTKELESLERQLDVSLKQIRSTRTQYMLDQLTDLQRKEHMLNEANKTL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            KQRL+EG Q+N L WNPNAQD+GYGRQ A   QGD FFHPLECEPTLQIGY  DPITV  
Sbjct  170  KQRLLEGTQVNQLQWNPNAQDVGYGRQQA-QPQGDGFFHPLECEPTLQIGYQPDPITVAA  228

Query  412  AGPSVNNYMPGWLP  371
            AGPSVNNYMPGWLP
Sbjct  229  AGPSVNNYMPGWLP  242



>dbj|BAN89460.1| sepallata 3 [Shorea beccariana]
Length=242

 Score =   330 bits (845),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 178/194 (92%), Gaps = 5/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S+REAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSSREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            Q+NLLGEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+L
Sbjct  110  QKNLLGEDLGPLSSKELESLERQLDSSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTL  169

Query  583  KQRLMEGNQL-NLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            KQRL+EG Q+ ++H NPNA+D+GYGRQ     QGD FFHPLECEPTLQIGYPTDPI+V  
Sbjct  170  KQRLVEGYQVSSMHLNPNAEDVGYGRQPV-QPQGDAFFHPLECEPTLQIGYPTDPISVVT  228

Query  412  AGPSVNNYMPGWLP  371
            AGPSVNNYM GWLP
Sbjct  229  AGPSVNNYMGGWLP  242



>gb|AAP83366.1| SEPALLATA3-like MADS-box [Antirrhinum majus]
Length=204

 Score =   322 bits (825),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 176/195 (90%), Gaps = 6/195 (3%)
 Frame = -3

Query  943  RGKLYEFCSSS-SMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  767
            RGKLYEFCS+S +MLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQR
Sbjct  12   RGKLYEFCSNSGTMLKTLERYQKCNYGAPEANVSTREAL-ELSSQQEYLKLKARYEALQR  70

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LTDLQRKEHALNEAN+S
Sbjct  71   SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANRS  130

Query  586  LKQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            LK RLMEG+Q++L WNPNA DMGYGRQ A   QGD FFHPLECEPTLQ+G+ ++ ITV  
Sbjct  131  LKHRLMEGSQISLQWNPNAHDMGYGRQAAAQPQGDGFFHPLECEPTLQMGFQSE-ITVGA  189

Query  412  AGPSVNNY-MPGWLP  371
            AGPSVNNY M GWLP
Sbjct  190  AGPSVNNYNMTGWLP  204



>emb|CAA64742.1| DEFH72 [Antirrhinum majus]
Length=243

 Score =   323 bits (828),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 176/195 (90%), Gaps = 6/195 (3%)
 Frame = -3

Query  943  RGKLYEFCSSS-SMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  767
            RGKLYEFCS+S +MLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQR
Sbjct  51   RGKLYEFCSNSGTMLKTLERYQKCNYGAPEANVSTREAL-ELSSQQEYLKLKARYEALQR  109

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LTDLQRKEHALNEAN+S
Sbjct  110  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANRS  169

Query  586  LKQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            LK RLMEG+Q++L WNPNA DMGYGRQ A   QGD FFHPLECEPTLQ+G+ ++ ITV  
Sbjct  170  LKHRLMEGSQISLQWNPNAHDMGYGRQAAAQPQGDGFFHPLECEPTLQMGFQSE-ITVGA  228

Query  412  AGPSVNNY-MPGWLP  371
            AGPSVNNY M GWLP
Sbjct  229  AGPSVNNYNMTGWLP  243



>ref|XP_007043947.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
 gb|EOX99778.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
Length=242

 Score =   323 bits (827),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 175/194 (90%), Gaps = 5/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM+KTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMIKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDSSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            KQRL+EG Q+N L  NPNA+D+GYGRQ A   QGD FFHPLECEPTLQIGY  DPI+V  
Sbjct  170  KQRLVEGYQVNSLQLNPNAEDVGYGRQPA-QPQGDGFFHPLECEPTLQIGYQPDPISVVN  228

Query  412  AGPSVNNYMPGWLP  371
            AGPSVNNYM GWLP
Sbjct  229  AGPSVNNYMTGWLP  242



>gb|ABQ59277.2| sepallata 3-like MADS box protein [Eustoma exaltatum subsp. russellianum]
Length=204

 Score =   321 bits (823),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 172/193 (89%), Gaps = 8/193 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  17   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNMSTREAL-ELSSQQEYLKLKARYEALQRS  75

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ+MLDQLTDLQRKEHALNEAN +L
Sbjct  76   QRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQVMLDQLTDLQRKEHALNEANTTL  135

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--A  410
            K RLME   LNL WNPNAQD+GYGRQ    +Q D FF PL+ EPTL IGYP DP+ V  A
Sbjct  136  KHRLME---LNLQWNPNAQDVGYGRQP--QTQADAFFQPLDGEPTLHIGYPNDPMAVAAA  190

Query  409  GPSVNNYMPGWLP  371
            GPSVNNYM GWLP
Sbjct  191  GPSVNNYMAGWLP  203



>ref|XP_011086825.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Sesamum 
indicum]
Length=242

 Score =   322 bits (824),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 176/195 (90%), Gaps = 7/195 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPE-PNISTREALQEISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSMLKTLERYQKCNYGAP+  N+STREAL E+SSQQEYLKLKARYEALQR
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPDQTNVSTREAL-ELSSQQEYLKLKARYEALQR  109

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LTDLQRKEHALNEAN+S
Sbjct  110  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANRS  169

Query  586  LKQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            LKQRL+EG+Q++L WNPNAQD+GYGR  A   Q D FFHPL+CEPTLQIGY  DPITV  
Sbjct  170  LKQRLIEGSQVSLQWNPNAQDVGYGR--AAQPQPDGFFHPLDCEPTLQIGYQPDPITVAA  227

Query  412  AGPSV-NNYMPGWLP  371
            AGPSV NNY+ GWLP
Sbjct  228  AGPSVNNNYISGWLP  242



>emb|CAL36578.1| deficiens H200 homologue [Misopates orontium]
Length=241

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 173/193 (90%), Gaps = 4/193 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKL EFCSS+SMLKTLERYQKCNYG PE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLCEFCSSTSMLKTLERYQKCNYGPPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LTDLQRKEHALNEAN+SL
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANRSL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--A  410
            K RLM+G+Q++L WNPNA+D+GYGRQ +  S  D F+HPLECEPTL IG+  DPITV  A
Sbjct  170  KHRLMDGSQISLQWNPNAEDVGYGRQPSQPS-ADGFYHPLECEPTLHIGFQADPITVAGA  228

Query  409  GPSVNNYMPGWLP  371
            GPSVNNY+ GWLP
Sbjct  229  GPSVNNYISGWLP  241



>ref|XP_004140534.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Cucumis 
sativus]
Length=242

 Score =   319 bits (818),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 174/194 (90%), Gaps = 5/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            KQRL+EG Q+N L  N +A DM YGRQ A    GD FFHPL+CEPTLQIGY  DPITV  
Sbjct  170  KQRLVEGYQVNALQLNQSADDMMYGRQQAQPP-GDAFFHPLDCEPTLQIGYQPDPITVVT  228

Query  412  AGPSVNNYMPGWLP  371
            AGPS+NN++PGWLP
Sbjct  229  AGPSMNNFLPGWLP  242



>gb|AAP83410.1| SEPALLATA3-like MADS-box [Syringa vulgaris]
Length=232

 Score =   318 bits (815),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 172/191 (90%), Gaps = 2/191 (1%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSML+TLERY+KCNYGAPEP++S+REAL E+SSQQEYLKLKARYEALQRS
Sbjct  42   RGKLYEFCSSSSMLRTLERYEKCNYGAPEPHVSSREAL-ELSSQQEYLKLKARYEALQRS  100

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LTDLQRKEHALNEAN+SL
Sbjct  101  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANQSL  160

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVAGP  404
            KQRLMEGN ++L WN + +++GYGR+   H Q   FFHPLECEPTLQIGY  DP+  AGP
Sbjct  161  KQRLMEGNHISLQWNQDPEEVGYGREPTQH-QPHGFFHPLECEPTLQIGYQNDPMAAAGP  219

Query  403  SVNNYMPGWLP  371
            S+NN+M GWLP
Sbjct  220  SLNNFMSGWLP  230



>gb|AEQ75503.1| MADS-domain transcription factor, partial [Davidia involucrata]
Length=212

 Score =   317 bits (813),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 174/203 (86%), Gaps = 14/203 (7%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+STREAL E+SSQQEYLKLKARYE LQRS
Sbjct  12   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSTREAL-ELSSQQEYLKLKARYEGLQRS  70

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKEHALNEANK+L
Sbjct  71   QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHALNEANKTL  130

Query  583  KQR----LMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPI  419
            KQR    L+EGNQ+N L WNPNAQ++ Y RQ A     D FFH LECEPTLQIGY TDPI
Sbjct  131  KQRFSMQLLEGNQVNSLQWNPNAQEVEYVRQPA-EPHADAFFHQLECEPTLQIGYQTDPI  189

Query  418  T-------VAGPSVNNYMPGWLP  371
            T        AGPSVNNYM GWLP
Sbjct  190  TAAAAAAAAAGPSVNNYMAGWLP  212



>ref|NP_001284431.1| agamous-like MADS-box protein AGL9 homolog [Cucumis melo]
 gb|AGZ03887.1| sepallata 3-like MADS-box protein [Cucumis melo]
Length=242

 Score =   317 bits (813),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 174/194 (90%), Gaps = 5/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE+LERQLDMSLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKELENLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            KQRL+EG Q+N L  N +A DM YGRQ A    GD FFHPL+CEPTLQIGY  DPITV  
Sbjct  170  KQRLVEGYQVNALQLNQSADDMMYGRQQAQPP-GDAFFHPLDCEPTLQIGYQPDPITVVT  228

Query  412  AGPSVNNYMPGWLP  371
            AGPS+NN++PGWLP
Sbjct  229  AGPSMNNFLPGWLP  242



>ref|XP_007043949.1| K-box region and MADS-box transcription factor family protein 
isoform 3 [Theobroma cacao]
 gb|EOX99780.1| K-box region and MADS-box transcription factor family protein 
isoform 3 [Theobroma cacao]
Length=247

 Score =   317 bits (812),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 175/199 (88%), Gaps = 10/199 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM+KTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMIKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDSSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTL  169

Query  583  KQR-----LMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDP  422
            KQR     L+EG Q+N L  NPNA+D+GYGRQ A   QGD FFHPLECEPTLQIGY  DP
Sbjct  170  KQRAGALQLVEGYQVNSLQLNPNAEDVGYGRQPA-QPQGDGFFHPLECEPTLQIGYQPDP  228

Query  421  ITV--AGPSVNNYMPGWLP  371
            I+V  AGPSVNNYM GWLP
Sbjct  229  ISVVNAGPSVNNYMTGWLP  247



>gb|AEL33633.1| SEPALLATA3 [Gossypium hirsutum]
Length=243

 Score =   315 bits (808),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 171/194 (88%), Gaps = 4/194 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM+KTLERYQKC++GAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMMKTLERYQKCSHGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELESLERQLD SLK IRSTRTQ MLDQLTDLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDSSLKLIRSTRTQYMLDQLTDLQRKEHLLNEANKNL  169

Query  583  KQRLMEGNQL-NLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA-  410
            KQRLMEG Q+ +L  NPNA D+GYGRQ  H  QGDVFFHPL+CEPTLQIGY  D I+   
Sbjct  170  KQRLMEGYQVHSLQLNPNADDVGYGRQPTHQPQGDVFFHPLDCEPTLQIGYQPDTISAVT  229

Query  409  -GPSVNNYMPGWLP  371
             GPSVNNYM GWLP
Sbjct  230  GGPSVNNYMTGWLP  243



>gb|KDP26829.1| hypothetical protein JCGZ_17987 [Jatropha curcas]
Length=257

 Score =   316 bits (809),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 174/208 (84%), Gaps = 18/208 (9%)
 Frame = -3

Query  943  RGKLYEFCSSSS--------------MLKTLERYQKCNYGAPEPNISTREALQEISSQQE  806
            RGKLYEFCSSSS              MLKTLERYQKCNYGAPE N+STREALQE+SSQQE
Sbjct  51   RGKLYEFCSSSSCLTREKETPKNDQCMLKTLERYQKCNYGAPETNVSTREALQELSSQQE  110

Query  805  YLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDL  626
            YLKLKARYEALQRSQRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQLTDL
Sbjct  111  YLKLKARYEALQRSQRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQYMLDQLTDL  170

Query  625  QRKEHALNEANKSLKQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPT  449
            QRK H LNEANK+LKQRL+EG  +N +  N  A+D+G+GRQ A   QGD FFHPLECEPT
Sbjct  171  QRKVHMLNEANKTLKQRLVEGYHVNTMQLNLGAEDVGFGRQAA-QPQGDGFFHPLECEPT  229

Query  448  LQIGYPTDPITV--AGPSVNNYMPGWLP  371
            LQIGY  DPITV  AGPSVNNYMPGWLP
Sbjct  230  LQIGYQPDPITVVTAGPSVNNYMPGWLP  257



>gb|AAP83364.1| SEPALLATA3-like MADS-box [Antirrhinum majus]
Length=212

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 173/194 (89%), Gaps = 5/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSS+SML TLERYQKCNYG PE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  21   RGKLYEFCSSTSMLNTLERYQKCNYGPPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  79

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LTDLQRKEHALNEAN+SL
Sbjct  80   QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANRSL  139

Query  583  KQRLMEGNQLNLHWNPNAQD-MGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            K RLM+G+Q++L WNPNA+D +GYGRQ +  S  D F+HPLECEPTL IG+ +D ITV  
Sbjct  140  KHRLMDGSQISLQWNPNAEDHVGYGRQPSQPS-ADGFYHPLECEPTLHIGFQSDQITVAG  198

Query  412  AGPSVNNYMPGWLP  371
            AGPSVNNY+ GWLP
Sbjct  199  AGPSVNNYISGWLP  212



>gb|AEJ76840.1| MADS16 [Gossypium hirsutum]
 gb|KHG22181.1| Agamous-like MADS-box protein AGL9 [Gossypium arboreum]
Length=243

 Score =   314 bits (805),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 172/194 (89%), Gaps = 4/194 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM+KTLERYQKC++GAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMMKTLERYQKCSHGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELESLERQLD SLK IRSTRTQ MLDQLTDLQRKEH LNEANKSL
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDSSLKLIRSTRTQYMLDQLTDLQRKEHLLNEANKSL  169

Query  583  KQRLMEGNQL-NLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPIT-VA  410
            KQRLMEG Q+ +L  NPNA D+GYGRQ  H  QGDVFFHPL+CEPTLQIGY  D I+ V 
Sbjct  170  KQRLMEGYQVHSLQLNPNADDVGYGRQPTHQPQGDVFFHPLDCEPTLQIGYQPDTISAVT  229

Query  409  G-PSVNNYMPGWLP  371
            G PSVNNYM GWLP
Sbjct  230  GCPSVNNYMTGWLP  243



>gb|KHG25284.1| Agamous-like MADS-box protein AGL9 [Gossypium arboreum]
Length=246

 Score =   314 bits (805),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 173/196 (88%), Gaps = 5/196 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM+KTLERYQKCNYGAPEPN+S+REA  E+SS+QEYLKLKARY+ALQRS
Sbjct  51   RGKLYEFCSSSSMIKTLERYQKCNYGAPEPNVSSREAALELSSRQEYLKLKARYDALQRS  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELESLE+QLD SLK IRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  111  QRNLLGEDLGPLSSKELESLEKQLDSSLKLIRSTRTQYMLDQLNDLQRKEHLLNEANKTL  170

Query  583  KQRLMEGNQLN-LHWNPNA-QDMGYGRQTAHHS-QGDVFFHPLECEPTLQIGYPTDPITV  413
            KQRL+EG Q+N L  NPNA +D+GYGRQ  HH   GD FFHPL+CEPTLQIGY  DP++V
Sbjct  171  KQRLVEGYQVNSLQLNPNATEDVGYGRQQVHHQPHGDAFFHPLDCEPTLQIGYQHDPMSV  230

Query  412  --AGPSVNNYMPGWLP  371
              AGPSVNNYM GWLP
Sbjct  231  VTAGPSVNNYMTGWLP  246



>emb|CAA64743.1| DEFH200 [Antirrhinum majus]
Length=242

 Score =   314 bits (804),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 173/194 (89%), Gaps = 5/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSS+SML TLERYQKCNYG PE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSTSMLNTLERYQKCNYGPPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LTDLQRKEHALNEAN+SL
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANRSL  169

Query  583  KQRLMEGNQLNLHWNPNAQD-MGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            K RLM+G+Q++L WNPNA+D +GYGRQ +  S  D F+HPLECEPTL IG+ +D ITV  
Sbjct  170  KHRLMDGSQISLQWNPNAEDHVGYGRQPSQPS-ADGFYHPLECEPTLHIGFQSDQITVAG  228

Query  412  AGPSVNNYMPGWLP  371
            AGPSVNNY+ GWLP
Sbjct  229  AGPSVNNYISGWLP  242



>gb|AHA87180.1| sepallata 3, partial [Sesamum indicum]
Length=209

 Score =   311 bits (797),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 169/186 (91%), Gaps = 6/186 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPE-PNISTREALQEISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSMLKTLERYQKCNYGAP+  N+STREAL E+SSQQEYLKLKARYEALQR
Sbjct  27   RGKLYEFCSSSSMLKTLERYQKCNYGAPDQTNVSTREAL-ELSSQQEYLKLKARYEALQR  85

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LTDLQRKEHALNEAN+S
Sbjct  86   SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANRS  145

Query  586  LKQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            LKQRL+EG+Q++L WNPNAQD+GYGR  A   Q D FFHPL+CEPTLQIGY  DPITV  
Sbjct  146  LKQRLIEGSQVSLQWNPNAQDVGYGR--AAQPQPDGFFHPLDCEPTLQIGYQPDPITVAA  203

Query  412  AGPSVN  395
            AGPSVN
Sbjct  204  AGPSVN  209



>gb|ADU15477.1| SEP3 [Actinidia chinensis]
Length=245

 Score =   310 bits (795),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 173/196 (88%), Gaps = 6/196 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKL+EFCS+SSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLK RYEALQRS
Sbjct  51   RGKLHEFCSTSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKGRYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKEHALNEANK+L
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHALNEANKTL  169

Query  583  KQRLMEGNQLN-LHWNPNAQD-MGYGRQTAHHSQGDVFFHPLECEPTLQIGY-PTDPITV  413
            KQRL   +Q+N L W+PNAQD + Y RQ A    G+ FFHPL+CEP+LQIGY   DPITV
Sbjct  170  KQRLWGDSQVNSLQWHPNAQDHVDYSRQPAQPQGGEAFFHPLDCEPSLQIGYQQNDPITV  229

Query  412  --AGPSVNNYMPGWLP  371
              AGPS+NNYMPGWLP
Sbjct  230  GGAGPSLNNYMPGWLP  245



>gb|AEN75254.1| transcription factor MADS3 [Prunus avium]
 gb|AIU94282.1| agamous-like MADS-box protein [Prunus pseudocerasus]
Length=240

 Score =   308 bits (790),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 170/194 (88%), Gaps = 7/194 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REAL E+SSQQEYLKLKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSAREAL-ELSSQQEYLKLKARYEALQRN  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHMLNEANKTL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            KQRL EG  +N L  NPNA +  YGRQ A  + GD FFHPL+CEPTLQIGY  DPI+V  
Sbjct  170  KQRLFEGYHVNSLQMNPNADE--YGRQQA-QAHGDGFFHPLDCEPTLQIGYQNDPISVVT  226

Query  412  AGPSVNNYMPGWLP  371
            AGPSV+NYM GWLP
Sbjct  227  AGPSVSNYMAGWLP  240



>ref|XP_008222191.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Prunus 
mume]
Length=240

 Score =   308 bits (790),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 170/194 (88%), Gaps = 7/194 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REAL E+SSQQEYLKLKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSAREAL-ELSSQQEYLKLKARYEALQRN  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHMLNEANKTL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            KQRL EG  +N L  NPNA +  YGRQ A  + GD FFHPL+CEPTLQIGY  DPI+V  
Sbjct  170  KQRLFEGYHVNSLQMNPNADE--YGRQQA-QAHGDGFFHPLDCEPTLQIGYQNDPISVVT  226

Query  412  AGPSVNNYMPGWLP  371
            AGPSV+NYM GWLP
Sbjct  227  AGPSVSNYMAGWLP  240



>ref|NP_001289232.1| agamous-like MADS-box protein AGL9 homolog [Pyrus x bretschneideri]
 ref|XP_009343139.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Pyrus 
x bretschneideri]
 ref|XP_009343141.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Pyrus 
x bretschneideri]
 dbj|BAF44101.1| transcription factor MADS [Pyrus x bretschneideri]
 dbj|BAM71398.1| transcription factor [Pyrus pyrifolia]
Length=239

 Score =   308 bits (789),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 170/193 (88%), Gaps = 6/193 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKAR+EALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARFEALQRN  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SK+LESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKDLESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHMLNEANKTL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--A  410
            K+RL EG    L  N NA +  YGRQ A  +QGDVFFHPL+CEPTLQIGY  DPI+V  A
Sbjct  170  KERLFEGYH-ALQLNANADE--YGRQQAQAAQGDVFFHPLDCEPTLQIGYQNDPISVVTA  226

Query  409  GPSVNNYMPGWLP  371
            GPS++NYM GWLP
Sbjct  227  GPSLSNYMGGWLP  239



>ref|NP_001280756.1| agamous-like MADS-box protein AGL9 homolog [Malus domestica]
 ref|XP_008389896.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Malus 
domestica]
 ref|XP_008350960.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Malus 
domestica]
 gb|ADL36740.1| MADS domain class transcription factor [Malus domestica]
Length=239

 Score =   308 bits (789),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 169/193 (88%), Gaps = 6/193 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSS LKTLERYQKCNYGAPE NISTREAL E+SSQQEYLKLKAR+EALQR+
Sbjct  51   RGKLYEFCSSSSTLKTLERYQKCNYGAPETNISTREAL-ELSSQQEYLKLKARFEALQRN  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SK+LESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKDLESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHMLNEANKTL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--A  410
            K+RL EG    L  N NA +  YGRQ A  +QGDVFFHPL+CEPTLQIGY  DPI+V  A
Sbjct  170  KERLFEGYHA-LQLNANADE--YGRQQAQAAQGDVFFHPLDCEPTLQIGYQNDPISVVTA  226

Query  409  GPSVNNYMPGWLP  371
            GPSV+NYM GWLP
Sbjct  227  GPSVSNYMGGWLP  239



>ref|XP_007223808.1| hypothetical protein PRUPE_ppa010679mg [Prunus persica]
 gb|ABO27621.1| transcription factor MADS5 [Prunus persica]
 gb|EMJ25007.1| hypothetical protein PRUPE_ppa010679mg [Prunus persica]
Length=240

 Score =   307 bits (786),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 169/194 (87%), Gaps = 7/194 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REAL E+SSQQEYLKLKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSAREAL-ELSSQQEYLKLKARYEALQRN  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHMLNEANKTL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            KQRL EG  +N L  NPNA +  YGRQ    + GD FFHPL+CEPTLQIGY  DPI+V  
Sbjct  170  KQRLFEGYHVNSLQMNPNADE--YGRQQT-QAHGDGFFHPLDCEPTLQIGYQNDPISVVT  226

Query  412  AGPSVNNYMPGWLP  371
            AGPSV+NYM GWLP
Sbjct  227  AGPSVSNYMAGWLP  240



>dbj|BAM36705.1| MADS transcriptional factor SEP3 homolog, partial [Rosa hybrid 
cultivar]
Length=244

 Score =   307 bits (786),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 171/196 (87%), Gaps = 7/196 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRN  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKEH LNEAN++L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHMLNEANRTL  169

Query  583  KQRLMEG-NQLNLHWNPNAQDMGYGRQTAHHS-QGDVFFHPLECEPTLQIGY-PTDPITV  413
            KQRL EG N   L  N NA+D+GYGRQ AHH  QG+ FF PLECEPTLQIGY   DPI V
Sbjct  170  KQRLFEGYNVHQLQLNANAEDVGYGRQQAHHQPQGEGFFQPLECEPTLQIGYHQNDPIQV  229

Query  412  --AGPSVNNYMPGWLP  371
              AGPSV NYM GWLP
Sbjct  230  VTAGPSV-NYMGGWLP  244



>ref|XP_006437995.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
 ref|XP_006484144.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X3 [Citrus sinensis]
 gb|ESR51235.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
Length=244

 Score =   306 bits (785),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 171/195 (88%), Gaps = 6/195 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LT+LQ KE  L+EANK+L
Sbjct  110  QRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGY-PTDPITV-  413
            KQRLMEG Q+N L  NP+A+D GYG + A   QGD FFH LECEPTLQIGY P DPI+V 
Sbjct  170  KQRLMEGYQVNTLQLNPSAEDCGYGLKPA-QPQGDTFFHALECEPTLQIGYQPADPISVV  228

Query  412  -AGPSVNNYMPGWLP  371
             AGPS+NNYM GWLP
Sbjct  229  TAGPSLNNYMQGWLP  243



>dbj|BAF34912.1| MADS-box protein [Citrus unshiu]
Length=245

 Score =   306 bits (785),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 171/195 (88%), Gaps = 6/195 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQRS
Sbjct  52   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRS  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LT+LQ KE  L+EANK+L
Sbjct  111  QRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTL  170

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGY-PTDPITV-  413
            KQRLMEG Q+N L  NP+A+D GYG + A   QGD FFH LECEPTLQIGY P DPI+V 
Sbjct  171  KQRLMEGYQVNTLQLNPSAEDCGYGLKPA-QPQGDTFFHALECEPTLQIGYQPADPISVV  229

Query  412  -AGPSVNNYMPGWLP  371
             AGPS+NNYM GWLP
Sbjct  230  TAGPSLNNYMQGWLP  244



>ref|XP_007043948.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 gb|EOX99779.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
Length=258

 Score =   307 bits (786),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 175/210 (83%), Gaps = 21/210 (10%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM+KTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMIKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDSSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTL  169

Query  583  KQR-----LMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIG-----  437
            KQR     L+EG Q+N L  NPNA+D+GYGRQ A   QGD FFHPLECEPTLQIG     
Sbjct  170  KQRAGALQLVEGYQVNSLQLNPNAEDVGYGRQPA-QPQGDGFFHPLECEPTLQIGENNNL  228

Query  436  ------YPTDPITV--AGPSVNNYMPGWLP  371
                  Y  DPI+V  AGPSVNNYM GWLP
Sbjct  229  PYHCDRYQPDPISVVNAGPSVNNYMTGWLP  258



>dbj|BAJ11578.1| transcription factor [Pyrus pyrifolia var. culta]
Length=235

 Score =   306 bits (783),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 169/192 (88%), Gaps = 6/192 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKAR+EALQR+
Sbjct  48   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARFEALQRN  106

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SK+LESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+L
Sbjct  107  QRNLLGEDLGPLSSKDLESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHMLNEANKTL  166

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--A  410
            K+RL EG    L  N NA +  YGRQ A  +QGDVFFHPL+CEPTLQIGY  DPI+V  A
Sbjct  167  KERLFEGYH-ALQLNANADE--YGRQQAQAAQGDVFFHPLDCEPTLQIGYQNDPISVVTA  223

Query  409  GPSVNNYMPGWL  374
            GPS++NYM GWL
Sbjct  224  GPSLSNYMGGWL  235



>gb|ADF49576.1| transcription factor MADS-box 2 [Fragaria chiloensis]
Length=242

 Score =   306 bits (783),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 167/194 (86%), Gaps = 5/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRN  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKEH LNEAN++L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHLLNEANRTL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGY-PTDPITV--  413
            KQRL EG    L  N NA+++ YGRQ AH  QGD FF  LECEPTLQIGY   DPI V  
Sbjct  170  KQRLFEGYHHQLQLNANAEEVAYGRQEAHQPQGDGFFQALECEPTLQIGYHQNDPIQVVT  229

Query  412  AGPSVNNYMPGWLP  371
            AGPSV NYM GWLP
Sbjct  230  AGPSV-NYMGGWLP  242



>gb|AAX13298.1| MADS box protein SEP3 [Lotus japonicus]
Length=243

 Score =   305 bits (781),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 170/195 (87%), Gaps = 6/195 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPLNSKELESLERQLD SLKQIRSTRTQ MLDQL+DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLNSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHMLSEANRSL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            +QR +EG QLN L  NP  +DMGYGR  A  + GD F+H +ECEPTLQIGY  DP++V  
Sbjct  170  RQRQLEGYQLNSLQLNPGVEDMGYGRHPA-QTHGDAFYHSIECEPTLQIGYQPDPVSVVT  228

Query  412  AGPSV-NNYMPGWLP  371
            AGPS+ NNYM GWLP
Sbjct  229  AGPSMNNNYMAGWLP  243



>ref|XP_004171788.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog, partial 
[Cucumis sativus]
Length=196

 Score =   301 bits (770),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 166/188 (88%), Gaps = 5/188 (3%)
 Frame = -3

Query  925  FCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRSQRNLLG  746
             C+ SSMLKTLERYQKCNYGAPEPN+STREAL E+SSQQEYLKLKARYEALQRSQRNLLG
Sbjct  11   LCAKSSMLKTLERYQKCNYGAPEPNVSTREAL-ELSSQQEYLKLKARYEALQRSQRNLLG  69

Query  745  EDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSLKQRLME  566
            EDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+LKQRL+E
Sbjct  70   EDLGPLSSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTLKQRLVE  129

Query  565  GNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--AGPSVN  395
            G Q+N L  N +A DM YGRQ A    GD FFHPL+CEPTLQIGY  DPITV  AGPS+N
Sbjct  130  GYQVNALQLNQSADDMMYGRQQAQPP-GDAFFHPLDCEPTLQIGYQPDPITVVTAGPSMN  188

Query  394  NYMPGWLP  371
            N++PGWLP
Sbjct  189  NFLPGWLP  196



>gb|AAO22982.1| MADS-box transcription factor CDM44 [Chrysanthemum x morifolium]
Length=249

 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 170/198 (86%), Gaps = 10/198 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSAREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLN KELESLERQLD SLKQIRS RTQ MLD LTDLQ+KEHALN+AN++L
Sbjct  110  QRNLLGEDLGPLNCKELESLERQLDTSLKQIRSARTQFMLDTLTDLQKKEHALNDANRTL  169

Query  583  KQRLMEGNQL-NLHWNPNA-QDMGYGRQ-TAHHSQGDVFFHPLECEPTLQIGYPTDPIT-  416
            KQRLMEG+Q+ +LHWNP+  Q+MGY +Q    H  G+ FFHPL+C PTLQ+GYP+D +T 
Sbjct  170  KQRLMEGHQVTSLHWNPHVQQEMGYDQQHEPQHQNGEAFFHPLDCGPTLQMGYPSDSLTA  229

Query  415  -----VAGPSVNNYMPGW  377
                 VAGPS +NYMPGW
Sbjct  230  EAAASVAGPSCSNYMPGW  247



>gb|AGA61758.1| sepallata 3, partial [Cornus kousa]
Length=237

 Score =   302 bits (774),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 175/204 (86%), Gaps = 16/204 (8%)
 Frame = -3

Query  943  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSS MLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQR
Sbjct  35   RGKLYEFCSSSSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQR  93

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LTDLQRKEHALNEAN S
Sbjct  94   SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTDLQRKEHALNEANNS  153

Query  586  LKQRLMEGNQL-NLHWNPN-AQDMGYGRQTAHHSQGDV-FFHPLECEPTLQIGY-PTDPI  419
            LKQRLMEGNQ+ +L+WN + AQD+GYGRQ A  SQG+  FFH LECEPTLQIGY  TDP+
Sbjct  154  LKQRLMEGNQVSSLNWNASHAQDLGYGRQPA-QSQGEANFFHHLECEPTLQIGYHQTDPM  212

Query  418  ---------TVAGPSVNNYMPGWL  374
                       AGPSVNNYM GWL
Sbjct  213  AAAAAAAAAAAAGPSVNNYMLGWL  236



>gb|AEO45959.1| SEPALLATA3-like protein [Mangifera indica]
Length=244

 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 170/196 (87%), Gaps = 7/196 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSS SMLKTLERYQ+CNYGAPEPN+STREAL EISSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSPSMLKTLERYQRCNYGAPEPNVSTREAL-EISSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGE+LGPL+SKELESLE+QLDMSLKQIRSTRTQ MLDQL +LQ KE  L+E NK+L
Sbjct  110  QRNLLGEELGPLSSKELESLEKQLDMSLKQIRSTRTQYMLDQLMELQHKEQVLSETNKTL  169

Query  583  KQRLMEGNQLN--LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIG-YPTDPITV  413
            KQRLMEG Q++  L  NP+A++MGYGRQ A    GD FFHPLECEPTLQIG Y  + IT 
Sbjct  170  KQRLMEGYQVSSVLQLNPSAEEMGYGRQPAQL-HGDTFFHPLECEPTLQIGSYQHEQITA  228

Query  412  --AGPSVNNYMPGWLP  371
              AGPSVNNYMPGWLP
Sbjct  229  VSAGPSVNNYMPGWLP  244



>ref|XP_009372256.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Pyrus x bretschneideri]
Length=250

 Score =   301 bits (772),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 169/201 (84%), Gaps = 11/201 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTL+RYQKCNYGAPE N+STREAL E+SSQQEYLKLKA +EALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLDRYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKAHFEALQRN  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLG L+SKELESLERQLD+SLKQIRSTRTQ MLD+LTDLQR EH LNEANK+L
Sbjct  110  QRNLLGEDLGHLSSKELESLERQLDISLKQIRSTRTQCMLDKLTDLQRNEHVLNEANKTL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMG-------YGRQTAHHSQGDVFFHPLECEPTLQIGYPT  428
            KQRL EG  +N L  N NA + G       YGRQ A  +QGD FFHPL+CEPTLQIGY  
Sbjct  170  KQRLFEGYHVNSLQLNANADEYGHQQAADEYGRQQAQAAQGDGFFHPLDCEPTLQIGYQN  229

Query  427  DPITV--AGPSVNNYMPGWLP  371
            DPI+V  AGPSV+NYM GWLP
Sbjct  230  DPISVVTAGPSVSNYMGGWLP  250



>gb|AAP83365.1| SEPALLATA3-like MADS-box [Antirrhinum majus]
Length=207

 Score =   300 bits (767),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 161/197 (82%), Positives = 173/197 (88%), Gaps = 8/197 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSS-MLKTLERYQKCNYGAPE-PNISTREALQEISSQQEYLKLKARYEALQ  770
            RGKLYEFCSSSS ML TLERYQKCNYGAP+  NISTREA+ E+SSQQEYLKLKARYEALQ
Sbjct  13   RGKLYEFCSSSSSMLTTLERYQKCNYGAPDHANISTREAM-ELSSQQEYLKLKARYEALQ  71

Query  769  RSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANK  590
            RSQRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LTDLQRKEHALNEAN+
Sbjct  72   RSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANR  131

Query  589  SLKQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV-  413
            +LK RLMEG+Q+ L WN NAQDMGYGRQ     QGD FFHPLECEPTLQ+G+ +D I+V 
Sbjct  132  NLKHRLMEGSQIGLQWNLNAQDMGYGRQPT-QPQGDGFFHPLECEPTLQMGFHSDQISVA  190

Query  412  --AGPSV-NNYMPGWLP  371
              AGPSV NNYM GWLP
Sbjct  191  AXAGPSVNNNYMSGWLP  207



>ref|XP_010653929.1| PREDICTED: MADS-box protein 4 isoform X1 [Vitis vinifera]
Length=258

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 164/185 (89%), Gaps = 3/185 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL++KELESLERQLD+SLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSTKELESLERQLDVSLKQIRSTRTQYMLDQLTDLQRKEHMLNEANKTL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVAG  407
            KQRL+EG Q+N L WNPNAQD+GYGRQ A   QGD FFHPLECEPTLQIGY    I+ + 
Sbjct  170  KQRLLEGTQVNQLQWNPNAQDVGYGRQQA-QPQGDGFFHPLECEPTLQIGYIVLSISFSF  228

Query  406  PSVNN  392
             S  N
Sbjct  229  VSFPN  233



>ref|XP_006437994.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
 ref|XP_006484145.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X4 [Citrus sinensis]
 gb|ESR51234.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
Length=242

 Score =   299 bits (766),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 170/195 (87%), Gaps = 8/195 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LT+LQ K   L+EANK+L
Sbjct  110  QRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHK--LLSEANKTL  167

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGY-PTDPITV-  413
            KQRLMEG Q+N L  NP+A+D GYG + A   QGD FFH LECEPTLQIGY P DPI+V 
Sbjct  168  KQRLMEGYQVNTLQLNPSAEDCGYGLKPA-QPQGDTFFHALECEPTLQIGYQPADPISVV  226

Query  412  -AGPSVNNYMPGWLP  371
             AGPS+NNYM GWLP
Sbjct  227  TAGPSLNNYMQGWLP  241



>gb|AIC33052.1| flower development transporter SEP3 [Chrysanthemum lavandulifolium]
Length=250

 Score =   298 bits (763),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 170/199 (85%), Gaps = 11/199 (6%)
 Frame = -3

Query  943  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSS MLKTLERYQKCNYGAPE N+S REAL E+SSQQEYLKLKARYEALQR
Sbjct  51   RGKLYEFCSSSSSMLKTLERYQKCNYGAPETNVSAREAL-ELSSQQEYLKLKARYEALQR  109

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            SQRNLLGEDLGPLN KELESLERQLD SLKQIRS RTQ MLD LTDLQ+KEHALN+AN++
Sbjct  110  SQRNLLGEDLGPLNCKELESLERQLDTSLKQIRSARTQFMLDTLTDLQKKEHALNDANRT  169

Query  586  LKQRLMEGNQL-NLHWNPNA-QDMGYGRQ-TAHHSQGDVFFHPLECEPTLQIGYPTDPIT  416
            LKQRLMEG+Q+ +LHWNP+  Q+MGY +Q    H  G+ FFHPL+C PTLQ+GYP+D +T
Sbjct  170  LKQRLMEGHQVTSLHWNPHVQQEMGYDQQHEPQHQTGEAFFHPLDCGPTLQMGYPSDSLT  229

Query  415  ------VAGPSVNNYMPGW  377
                  VAGPS +NYMPGW
Sbjct  230  AEAAASVAGPSCSNYMPGW  248



>ref|XP_006437997.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
 ref|XP_006484142.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Citrus sinensis]
 gb|ESR51237.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
Length=257

 Score =   298 bits (762),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 171/208 (82%), Gaps = 19/208 (9%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LT+LQ KE  L+EANK+L
Sbjct  110  QRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTL  169

Query  583  KQR-------------LMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTL  446
            KQR             LMEG Q+N L  NP+A+D GYG + A   QGD FFH LECEPTL
Sbjct  170  KQRTMTLRHADFAGLQLMEGYQVNTLQLNPSAEDCGYGLKPA-QPQGDTFFHALECEPTL  228

Query  445  QIGY-PTDPITV--AGPSVNNYMPGWLP  371
            QIGY P DPI+V  AGPS+NNYM GWLP
Sbjct  229  QIGYQPADPISVVTAGPSLNNYMQGWLP  256



>ref|XP_006579433.1| PREDICTED: uncharacterized protein LOC100805078 isoform X1 [Glycine 
max]
Length=244

 Score =   296 bits (759),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 168/195 (86%), Gaps = 5/195 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL-QEISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL  E+SSQQEYLKLKARYEALQR
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREALVMELSSQQEYLKLKARYEALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            SQRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL+DLQRKEH L+EAN+S
Sbjct  111  SQRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRS  170

Query  586  LKQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV-  413
            L+QR +EG Q+N L  NP  ++MGYGR  A  + G+  F  +ECEPTLQIGY  DP++V 
Sbjct  171  LRQRQLEGYQINPLQLNPGVEEMGYGRHPA-QTHGEALFQQMECEPTLQIGYQPDPVSVV  229

Query  412  -AGPSVNNYMPGWLP  371
             AGPS++NYM GWLP
Sbjct  230  TAGPSMSNYMAGWLP  244



>ref|XP_011036099.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Populus 
euphratica]
Length=242

 Score =   296 bits (759),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 165/193 (85%), Gaps = 5/193 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRT  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGE+LGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQL DLQ KEH L  ANKSL
Sbjct  110  QRNLLGEELGPLSSKELESLERQLDMSLKQIRSTRTQYMLDQLNDLQHKEHMLTAANKSL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            K+RLMEG  LN L  NP+A+D+ Y RQ A   QGD FFH LECEPTLQIGY  + IT+  
Sbjct  170  KERLMEGYHLNSLQLNPSAEDVEYARQQA-QPQGDGFFHALECEPTLQIGYQPENITMVT  228

Query  412  AGPSVNNYMPGWL  374
            AGPS+  YMPGWL
Sbjct  229  AGPSMTTYMPGWL  241



>ref|XP_006579435.1| PREDICTED: uncharacterized protein LOC100805078 isoform X3 [Glycine 
max]
Length=242

 Score =   296 bits (759),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 168/194 (87%), Gaps = 5/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL+DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            +QR +EG Q+N L  NP  ++MGYGR  A  + G+  F  +ECEPTLQIGY  DP++V  
Sbjct  170  RQRQLEGYQINPLQLNPGVEEMGYGRHPA-QTHGEALFQQMECEPTLQIGYQPDPVSVVT  228

Query  412  AGPSVNNYMPGWLP  371
            AGPS++NYM GWLP
Sbjct  229  AGPSMSNYMAGWLP  242



>ref|XP_002514893.1| mads box protein, putative [Ricinus communis]
 gb|EEF47447.1| mads box protein, putative [Ricinus communis]
Length=182

 Score =   293 bits (751),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 163/182 (90%), Gaps = 4/182 (2%)
 Frame = -3

Query  910  SMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGP  731
            SMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQRSQRNLLGEDLGP
Sbjct  3    SMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRSQRNLLGEDLGP  61

Query  730  LNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSLKQRLMEGNQLN  551
            L+SK+LESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+LKQRL+EG Q+N
Sbjct  62   LSSKDLESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHMLNEANKTLKQRLVEGYQVN  121

Query  550  -LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV-AGPSVNNYMPGW  377
             +  NP+A+D+G+GRQ A   QGD FFHPL+CEPTLQIGY  D I V AGPSVNNYM GW
Sbjct  122  AMQLNPSAEDVGFGRQAA-QPQGDGFFHPLDCEPTLQIGYHPDQIVVTAGPSVNNYMSGW  180

Query  376  LP  371
            LP
Sbjct  181  LP  182



>dbj|BAK09620.1| MADS-box transcription factor [Cyclamen persicum]
Length=247

 Score =   295 bits (756),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 168/198 (85%), Gaps = 8/198 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS+ S+LKTLERYQKCNYGAPEPN+STREALQE++SQQEYLKLKARYEALQR+
Sbjct  51   RGKLYEFCSNPSILKTLERYQKCNYGAPEPNMSTREALQELNSQQEYLKLKARYEALQRT  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKEHALNEAN+SL
Sbjct  111  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHALNEANRSL  170

Query  583  KQRLMEG-NQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIG-YPTD---PI  419
            +QRLMEG N   L WN   QD+ YG+Q A   Q   FFHPL+CEPTLQIG YPT    P+
Sbjct  171  RQRLMEGSNVATLQWNMGGQDVDYGQQQA-QPQAHGFFHPLDCEPTLQIGSYPTHDQLPV  229

Query  418  TVAGPS-VNNY-MPGWLP  371
              AGPS  NNY M  WLP
Sbjct  230  AAAGPSGTNNYSMLEWLP  247



>ref|XP_006585131.1| PREDICTED: MADS-box transcription factor 1-like isoform X3 [Glycine 
max]
Length=242

 Score =   295 bits (755),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 168/194 (87%), Gaps = 5/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYE+LQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREAL-ELSSQQEYLKLKARYESLQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL+DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            +QR +EG Q+N L  NP  ++MGYGR  A  + G+  F  +ECEPTLQIGY  DP++V  
Sbjct  170  RQRQLEGYQINPLQLNPGVEEMGYGRNPA-QTHGEALFQQMECEPTLQIGYQPDPVSVVT  228

Query  412  AGPSVNNYMPGWLP  371
            AGPS++NYM GWLP
Sbjct  229  AGPSMSNYMAGWLP  242



>ref|XP_006585129.1| PREDICTED: MADS-box transcription factor 1-like isoform X1 [Glycine 
max]
Length=244

 Score =   295 bits (755),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 168/195 (86%), Gaps = 5/195 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL-QEISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL  E+SSQQEYLKLKARYE+LQR
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREALVMELSSQQEYLKLKARYESLQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            SQRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL+DLQRKEH L+EAN+S
Sbjct  111  SQRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRS  170

Query  586  LKQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV-  413
            L+QR +EG Q+N L  NP  ++MGYGR  A  + G+  F  +ECEPTLQIGY  DP++V 
Sbjct  171  LRQRQLEGYQINPLQLNPGVEEMGYGRNPA-QTHGEALFQQMECEPTLQIGYQPDPVSVV  229

Query  412  -AGPSVNNYMPGWLP  371
             AGPS++NYM GWLP
Sbjct  230  TAGPSMSNYMAGWLP  244



>gb|KGN46460.1| hypothetical protein Csa_6G095270 [Cucumis sativus]
Length=180

 Score =   292 bits (748),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 162/182 (89%), Gaps = 5/182 (3%)
 Frame = -3

Query  907  MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGPL  728
            MLKTLERYQKCNYGAPEPN+STREAL E+SSQQEYLKLKARYEALQRSQRNLLGEDLGPL
Sbjct  1    MLKTLERYQKCNYGAPEPNVSTREAL-ELSSQQEYLKLKARYEALQRSQRNLLGEDLGPL  59

Query  727  NSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSLKQRLMEGNQLN-  551
            +SKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+LKQRL+EG Q+N 
Sbjct  60   SSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTLKQRLVEGYQVNA  119

Query  550  LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--AGPSVNNYMPGW  377
            L  N +A DM YGRQ A    GD FFHPL+CEPTLQIGY  DPITV  AGPS+NN++PGW
Sbjct  120  LQLNQSADDMMYGRQQAQPP-GDAFFHPLDCEPTLQIGYQPDPITVVTAGPSMNNFLPGW  178

Query  376  LP  371
            LP
Sbjct  179  LP  180



>ref|XP_006437996.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
 gb|ESR51236.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
Length=256

 Score =   295 bits (755),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 170/208 (82%), Gaps = 20/208 (10%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REAL  +SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL--LSSQQEYLKLKARYEALQRS  108

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LT+LQ KE  L+EANK+L
Sbjct  109  QRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTL  168

Query  583  KQR-------------LMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTL  446
            KQR             LMEG Q+N L  NP+A+D GYG + A   QGD FFH LECEPTL
Sbjct  169  KQRTMTLRHADFAGLQLMEGYQVNTLQLNPSAEDCGYGLKPA-QPQGDTFFHALECEPTL  227

Query  445  QIGY-PTDPITV--AGPSVNNYMPGWLP  371
            QIGY P DPI+V  AGPS+NNYM GWLP
Sbjct  228  QIGYQPADPISVVTAGPSLNNYMQGWLP  255



>ref|XP_010090648.1| Agamous-like MADS-box protein AGL9-like protein [Morus notabilis]
 gb|EXB40312.1| Agamous-like MADS-box protein AGL9-like protein [Morus notabilis]
Length=244

 Score =   294 bits (753),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 166/196 (85%), Gaps = 7/196 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQK NYGAPEPN+S REAL E+SSQQEYLKLKARYE L R+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKSNYGAPEPNVSAREAL-ELSSQQEYLKLKARYETLLRN  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
             RNL+GE+LG L+SKELESLERQLD+SLKQIRSTRTQ MLDQLTDLQRKEH LNE N++L
Sbjct  110  HRNLMGEELGALSSKELESLERQLDISLKQIRSTRTQTMLDQLTDLQRKEHMLNETNRTL  169

Query  583  KQRLMEGNQL-NLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTD---PIT  416
            KQRL+EG QL +L  NP A D+GY RQ    +QGD+F+HPLECEPTLQIGY  D    + 
Sbjct  170  KQRLVEGYQLSSLQLNPAADDVGYCRQPV-QAQGDIFYHPLECEPTLQIGYQADSTISVV  228

Query  415  VAGPSVNNYMP-GWLP  371
             AGPSVNNYMP GWLP
Sbjct  229  TAGPSVNNYMPAGWLP  244



>gb|ABE02212.1| SEP-like [Populus tomentosa]
Length=243

 Score =   294 bits (753),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS SSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYE LQR+
Sbjct  51   RGKLYEFCSGSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEGLQRT  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGE+LGPL+SK+LESLERQLDMSLKQIRSTRTQ MLDQL DLQ KEH L  ANKSL
Sbjct  110  QRNLLGEELGPLSSKDLESLERQLDMSLKQIRSTRTQYMLDQLNDLQHKEHMLTAANKSL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            K+RLMEG QLN L  NP+A+D+ Y RQ A    GD FFH LECEPTLQIGY  + IT+  
Sbjct  170  KERLMEGYQLNSLQMNPSAEDVEYARQQAQPQPGDGFFHALECEPTLQIGYQPENITMVT  229

Query  412  AGPSVNNYMPGWL  374
            AGPS+  YMPGWL
Sbjct  230  AGPSMTTYMPGWL  242



>gb|ADC79704.1| SEPALLATA3-like protein [Pachysandra terminalis]
Length=244

 Score =   294 bits (752),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 164/194 (85%), Gaps = 5/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS+SSM KTLERYQKCNYGAPEPN+S RE L E++SQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSTSSMFKTLERYQKCNYGAPEPNVSARETL-ELASQQEYLKLKARVEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SK+LESLE QLDMSLKQI+S RTQ MLDQLTDLQR+E  L EANK+L
Sbjct  110  QRNLMGEDLGPLDSKDLESLEMQLDMSLKQIKSIRTQYMLDQLTDLQRREQVLTEANKTL  169

Query  583  KQRLMEGNQLNL-HWNPNAQDMGYGRQTAHHS-QGDVFFHPLECEPTLQIGYPTDPITV-  413
            K+RL EG+Q+N   W+ +A    YGRQ AHH   GD FFHPLECEPTLQIGY  + ITV 
Sbjct  170  KRRLDEGSQVNAQQWDLSAHVADYGRQVAHHQPHGDGFFHPLECEPTLQIGYQPEQITVA  229

Query  412  -AGPSVNNYMPGWL  374
             AGPSVNN+MPGWL
Sbjct  230  AAGPSVNNFMPGWL  243



>ref|XP_006579436.1| PREDICTED: uncharacterized protein LOC100805078 isoform X4 [Glycine 
max]
Length=241

 Score =   294 bits (752),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 168/194 (87%), Gaps = 6/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL+DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            +QRL EG Q+N L  NP  ++MGYGR  A  + G+  F  +ECEPTLQIGY  DP++V  
Sbjct  170  RQRL-EGYQINPLQLNPGVEEMGYGRHPA-QTHGEALFQQMECEPTLQIGYQPDPVSVVT  227

Query  412  AGPSVNNYMPGWLP  371
            AGPS++NYM GWLP
Sbjct  228  AGPSMSNYMAGWLP  241



>gb|AAR01779.1| MADS-box protein [Prunus dulcis]
Length=247

 Score =   294 bits (752),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 164/190 (86%), Gaps = 7/190 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REAL E+SSQQEYLKLKARYEALQR+
Sbjct  42   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSAREAL-ELSSQQEYLKLKARYEALQRN  100

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKEH LNEANK+L
Sbjct  101  QRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHMLNEANKTL  160

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            KQRL EG  +N L  NPNA +  YGRQ    + GD FFHPL+CEPTLQIGY  DPI+V  
Sbjct  161  KQRLFEGYHVNSLQMNPNADE--YGRQQT-QAHGDGFFHPLDCEPTLQIGYQNDPISVVT  217

Query  412  AGPSVNNYMP  383
            AG SV+NYM 
Sbjct  218  AGXSVSNYMA  227



>gb|ABD17387.1| MADS-box protein SEP3 [Taihangia rupestris]
Length=249

 Score =   294 bits (752),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 170/200 (85%), Gaps = 10/200 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSS MLKTLERYQKCNY  PE ++STREAL E+SSQQEYL+LKARYEALQR
Sbjct  51   RGKLYEFCSSSSSMLKTLERYQKCNYSTPETHVSTREAL-ELSSQQEYLRLKARYEALQR  109

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKE  LNEAN+S
Sbjct  110  NQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEQMLNEANRS  169

Query  586  LKQRLMEGNQLN-LH---WNPNAQDMGYGR-QTAHHSQGDVFFHPLECEPTLQIGY-PTD  425
            LKQRL EG  +N LH    N NA+D+GYGR Q AH    DVF+HPLE EPTLQIGY  +D
Sbjct  170  LKQRLFEGYNVNQLHQFQLNANAEDVGYGRHQQAHQPHSDVFYHPLELEPTLQIGYHQSD  229

Query  424  PITV--AGPSVNNYMPGWLP  371
            PI V  AGPSV+N+M GWLP
Sbjct  230  PIQVVAAGPSVSNFMGGWLP  249



>gb|KHN34832.1| MADS-box transcription factor 1 [Glycine soja]
Length=241

 Score =   293 bits (751),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 168/194 (87%), Gaps = 6/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL+DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            +QRL EG Q+N L  NP  ++MGYGR  A  + G+  F  +ECEPTLQIGY  DP++V  
Sbjct  170  RQRL-EGYQINPLQLNPGVEEMGYGRNPA-QTHGEALFQQMECEPTLQIGYQPDPVSVVT  227

Query  412  AGPSVNNYMPGWLP  371
            AGPS++NYM GWLP
Sbjct  228  AGPSMSNYMAGWLP  241



>ref|XP_006579434.1| PREDICTED: uncharacterized protein LOC100805078 isoform X2 [Glycine 
max]
Length=243

 Score =   293 bits (751),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 168/195 (86%), Gaps = 6/195 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL-QEISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL  E+SSQQEYLKLKARYEALQR
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREALVMELSSQQEYLKLKARYEALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            SQRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL+DLQRKEH L+EAN+S
Sbjct  111  SQRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRS  170

Query  586  LKQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV-  413
            L+QRL EG Q+N L  NP  ++MGYGR  A  + G+  F  +ECEPTLQIGY  DP++V 
Sbjct  171  LRQRL-EGYQINPLQLNPGVEEMGYGRHPA-QTHGEALFQQMECEPTLQIGYQPDPVSVV  228

Query  412  -AGPSVNNYMPGWLP  371
             AGPS++NYM GWLP
Sbjct  229  TAGPSMSNYMAGWLP  243



>ref|XP_011020782.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Populus 
euphratica]
Length=243

 Score =   293 bits (751),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 166/195 (85%), Gaps = 6/195 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRT  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQL DLQ KEH L  ANKSL
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQYMLDQLNDLQHKEHMLTAANKSL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGY-PTDPITV-  413
            K+RLMEG ++N L  N +A+D+G+ RQ A   QG  FFHPLECEPTLQIGY P   ITV 
Sbjct  170  KERLMEGYEVNSLQLNLSAEDVGFSRQQA-QPQGYGFFHPLECEPTLQIGYQPDSAITVV  228

Query  412  -AGPSVNNYMPGWLP  371
             +GPS+  YMP WLP
Sbjct  229  TSGPSMTAYMPDWLP  243



>gb|ABD19719.1| SEP3-like MADS-box protein [Taihangia rupestris]
Length=249

 Score =   294 bits (752),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 170/200 (85%), Gaps = 10/200 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSS MLKTLERYQKCNY  PE ++STREAL E+SSQQEYL+LKARYEALQR
Sbjct  51   RGKLYEFCSSSSSMLKTLERYQKCNYSTPETHVSTREAL-ELSSQQEYLRLKARYEALQR  109

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKE  LNEAN+S
Sbjct  110  NQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEQMLNEANRS  169

Query  586  LKQRLMEGNQLN-LH---WNPNAQDMGYGR-QTAHHSQGDVFFHPLECEPTLQIGY-PTD  425
            LKQRL EG  +N LH    N NA+D+GYGR Q AH    DVF+HPLE EPTLQIGY  +D
Sbjct  170  LKQRLFEGYNVNQLHQFQLNANAEDVGYGRHQQAHQPHSDVFYHPLELEPTLQIGYHQSD  229

Query  424  PITV--AGPSVNNYMPGWLP  371
            PI V  AGPSV+N+M GWLP
Sbjct  230  PIQVVAAGPSVSNFMGGWLP  249



>gb|AAO49811.1| SEP3-related MADS-box protein [Populus tremuloides]
Length=242

 Score =   293 bits (751),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 164/193 (85%), Gaps = 5/193 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS SSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYE LQR+
Sbjct  51   RGKLYEFCSGSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEGLQRT  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGE+LGPL+SK+LESLERQLDMSLKQIRSTRTQ MLDQL DLQ KEH L  ANKSL
Sbjct  110  QRNLLGEELGPLSSKDLESLERQLDMSLKQIRSTRTQYMLDQLNDLQHKEHMLTAANKSL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            K+RLMEG QLN L  NP+A+D+ Y RQ A   QGD FFH LECEPTLQIGY  + IT+  
Sbjct  170  KERLMEGYQLNSLQLNPSAEDVEYARQQA-QPQGDGFFHALECEPTLQIGYQPENITMVT  228

Query  412  AGPSVNNYMPGWL  374
            AGPS+  YMPGWL
Sbjct  229  AGPSMTTYMPGWL  241



>ref|XP_006585132.1| PREDICTED: MADS-box transcription factor 1-like isoform X4 [Glycine 
max]
 gb|KHN12377.1| MADS-box transcription factor 1 [Glycine soja]
Length=241

 Score =   292 bits (748),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 168/194 (87%), Gaps = 6/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYE+LQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREAL-ELSSQQEYLKLKARYESLQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL+DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            +QRL EG Q+N L  NP  ++MGYGR  A  + G+  F  +ECEPTLQIGY  DP++V  
Sbjct  170  RQRL-EGYQINPLQLNPGVEEMGYGRNPA-QTHGEALFQQMECEPTLQIGYQPDPVSVVT  227

Query  412  AGPSVNNYMPGWLP  371
            AGPS++NYM GWLP
Sbjct  228  AGPSMSNYMAGWLP  241



>ref|XP_006585130.1| PREDICTED: MADS-box transcription factor 1-like isoform X2 [Glycine 
max]
Length=243

 Score =   292 bits (748),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 168/195 (86%), Gaps = 6/195 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL-QEISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL  E+SSQQEYLKLKARYE+LQR
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREALVMELSSQQEYLKLKARYESLQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            SQRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL+DLQRKEH L+EAN+S
Sbjct  111  SQRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRS  170

Query  586  LKQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV-  413
            L+QRL EG Q+N L  NP  ++MGYGR  A  + G+  F  +ECEPTLQIGY  DP++V 
Sbjct  171  LRQRL-EGYQINPLQLNPGVEEMGYGRNPA-QTHGEALFQQMECEPTLQIGYQPDPVSVV  228

Query  412  -AGPSVNNYMPGWLP  371
             AGPS++NYM GWLP
Sbjct  229  TAGPSMSNYMAGWLP  243



>gb|AGH61294.1| sepallata 3 [Paeonia lactiflora]
Length=243

 Score =   292 bits (748),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 165/195 (85%), Gaps = 6/195 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAP+  +S REAL E+SSQQEYLKLK RYE+LQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPDTTVSAREAL-ELSSQQEYLKLKQRYESLQRN  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SK+LE LERQLD SLKQIRSTRTQ MLD LTDLQRKEH LNEAN+SL
Sbjct  110  QRNLLGEDLGPLSSKDLELLERQLDSSLKQIRSTRTQSMLDTLTDLQRKEHMLNEANQSL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIG-YPTDPITV-  413
            KQRLMEGN +N L WNPN+ +M Y R  A   QGD F+HPL+CEPTLQIG Y  D I V 
Sbjct  170  KQRLMEGNHVNSLPWNPNSHEMDYSRHQA-QPQGDAFYHPLDCEPTLQIGSYQPDSIGVA  228

Query  412  -AGPSVNNYMPGWLP  371
             AGPSVNNYM GWLP
Sbjct  229  AAGPSVNNYMGGWLP  243



>emb|CAX65571.1| GRCD5 protein [Gerbera hybrid cultivar]
Length=252

 Score =   291 bits (746),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 168/202 (83%), Gaps = 12/202 (6%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPE-PNISTREALQEISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSMLKTLERYQKCNYGAP+  N+S REAL E+SSQQEYLKLKARYEALQR
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPDQTNVSAREAL-ELSSQQEYLKLKARYEALQR  109

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            SQRNLLGEDLGPLN KELESLERQLD SLK IRS RTQ+MLD LTDLQ+KEHALNEAN++
Sbjct  110  SQRNLLGEDLGPLNCKELESLERQLDTSLKHIRSARTQLMLDTLTDLQKKEHALNEANRT  169

Query  586  LKQRLMEGNQLN-LHWNPNA-QDMGY-GRQTA-HHSQGDVFFHPLECEPTLQIGYPTDPI  419
            LKQRL+EG Q+N LHW P A Q++ Y  RQ A  H   + FFHPL+C PTLQIGY TDPI
Sbjct  170  LKQRLIEGTQINSLHWYPQAPQEVCYDDRQHAPQHQTDEAFFHPLDCGPTLQIGYQTDPI  229

Query  418  ------TVAGPSVNNYMPGWLP  371
                   VAGPS+NNYM GWLP
Sbjct  230  NVAGAEAVAGPSMNNYMQGWLP  251



>gb|AEE60891.1| MADS-box protein 5 [Paeonia suffruticosa]
Length=243

 Score =   291 bits (744),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 165/195 (85%), Gaps = 6/195 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAP+  +S REAL E+SSQQEYLKLK RYE+LQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPDTTVSAREAL-ELSSQQEYLKLKQRYESLQRN  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SK+LE LERQLD SLKQIRSTRTQ MLD LT LQRKEH LNEAN+SL
Sbjct  110  QRNLLGEDLGPLSSKDLELLERQLDSSLKQIRSTRTQSMLDTLTGLQRKEHMLNEANQSL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIG-YPTDPITV-  413
            KQRL+EGN +N L WNPN+ +MGY R  A   QGD F+HPL+CEPTLQIG Y  D I V 
Sbjct  170  KQRLLEGNHINSLPWNPNSHEMGYSRHQA-QPQGDAFYHPLDCEPTLQIGSYQPDSIGVA  228

Query  412  -AGPSVNNYMPGWLP  371
             AGPSVNNYM GWLP
Sbjct  229  AAGPSVNNYMGGWLP  243



>gb|ABQ85951.1| MADS-box transcription factor SEP-like 2 [Trochodendron aralioides]
Length=244

 Score =   291 bits (744),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 162/194 (84%), Gaps = 5/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM KTLERYQKCNY APE +IS RE L++ SS QEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMFKTLERYQKCNYTAPETDISARETLEQ-SSYQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KELESLERQLD+SLKQIRS RTQ MLDQLTDLQR E  L+E+NK+L
Sbjct  110  QRNLLGEDLGPLSGKELESLERQLDVSLKQIRSIRTQCMLDQLTDLQRTEQMLSESNKNL  169

Query  583  KQRLMEGNQLNLH-WNPNAQDMGYGRQTAH-HSQGDVFFHPLECEPTLQIGYPTDPITVA  410
             +RL EG+Q N H W+PNA  M YG+Q AH H QGD FFHPLECEPTLQIGY  D I V 
Sbjct  170  ARRLEEGSQANAHQWDPNAHGMRYGQQPAHAHPQGDGFFHPLECEPTLQIGYQPDQIAVM  229

Query  409  --GPSVNNYMPGWL  374
              GPSVNNYMPGWL
Sbjct  230  APGPSVNNYMPGWL  243



>ref|XP_009372255.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Pyrus x bretschneideri]
Length=264

 Score =   291 bits (745),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 169/215 (79%), Gaps = 25/215 (12%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTL+RYQKCNYGAPE N+STREAL E+SSQQEYLKLKA +EALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLDRYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKAHFEALQRN  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLG L+SKELESLERQLD+SLKQIRSTRTQ MLD+LTDLQR EH LNEANK+L
Sbjct  110  QRNLLGEDLGHLSSKELESLERQLDISLKQIRSTRTQCMLDKLTDLQRNEHVLNEANKTL  169

Query  583  KQR--------------LMEGNQLN-LHWNPNAQDMG-------YGRQTAHHSQGDVFFH  470
            KQR              L EG  +N L  N NA + G       YGRQ A  +QGD FFH
Sbjct  170  KQRTLHVPDFLSDHALQLFEGYHVNSLQLNANADEYGHQQAADEYGRQQAQAAQGDGFFH  229

Query  469  PLECEPTLQIGYPTDPITV--AGPSVNNYMPGWLP  371
            PL+CEPTLQIGY  DPI+V  AGPSV+NYM GWLP
Sbjct  230  PLDCEPTLQIGYQNDPISVVTAGPSVSNYMGGWLP  264



>ref|XP_008340236.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Malus domestica]
Length=250

 Score =   290 bits (743),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 165/201 (82%), Gaps = 11/201 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTL+RYQK +Y APE N+STREAL E+SSQQEYLKLKA +EALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLDRYQKXSYAAPETNVSTREAL-ELSSQQEYLKLKAHFEALQRN  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLG L+SKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQR EH LNEANK+L
Sbjct  110  QRNLLGEDLGHLSSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRNEHVLNEANKTL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMG-------YGRQTAHHSQGDVFFHPLECEPTLQIGYPT  428
            KQRL EG  +N L  N  A + G       Y RQ A  +QGD FFHPL+CEPTLQIGY  
Sbjct  170  KQRLYEGYHVNSLQLNAXADEYGRQQAADEYNRQQAQXAQGDGFFHPLDCEPTLQIGYQN  229

Query  427  DPITV--AGPSVNNYMPGWLP  371
            DPI+V  AGPSV+NYM GWLP
Sbjct  230  DPISVVTAGPSVSNYMGGWLP  250



>ref|XP_006484143.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Citrus sinensis]
Length=255

 Score =   290 bits (743),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 170/208 (82%), Gaps = 21/208 (10%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LT+LQ K   L+EANK+L
Sbjct  110  QRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHK--LLSEANKTL  167

Query  583  KQR-------------LMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTL  446
            KQR             LMEG Q+N L  NP+A+D GYG + A   QGD FFH LECEPTL
Sbjct  168  KQRTMTLRHADFAGLQLMEGYQVNTLQLNPSAEDCGYGLKPA-QPQGDTFFHALECEPTL  226

Query  445  QIGY-PTDPITV--AGPSVNNYMPGWLP  371
            QIGY P DPI+V  AGPS+NNYM GWLP
Sbjct  227  QIGYQPADPISVVTAGPSLNNYMQGWLP  254



>gb|AET04966.2| MADS-box transcription factor [Medicago truncatula]
Length=242

 Score =   289 bits (740),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 165/194 (85%), Gaps = 5/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSAREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL+DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHMLSEANRSL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDP--ITV  413
            +QR +EG QLN L  N   ++MGYGR  +  +QGD  +  LECEPTLQIGY  DP  +  
Sbjct  170  RQRQLEGYQLNQLQMNACVEEMGYGRHPS-QTQGDGLYQQLECEPTLQIGYQPDPGSVCT  228

Query  412  AGPSVNNYMPGWLP  371
            AGPS++NYM GWLP
Sbjct  229  AGPSMSNYMGGWLP  242



>gb|AAN15182.1| MADS box protein GHMADS-1 [Gossypium hirsutum]
Length=236

 Score =   289 bits (739),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 162/185 (88%), Gaps = 5/185 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM+K LERYQKCNYGAPEPN+S+REA  E+SS+QEYLKLKARY+ALQRS
Sbjct  51   RGKLYEFCSSSSMIKILERYQKCNYGAPEPNVSSREAALELSSRQEYLKLKARYDALQRS  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELESLE+QLD SLK IRSTRTQ MLDQL DLQRKEH LNEAN++L
Sbjct  111  QRNLLGEDLGPLSSKELESLEKQLDSSLKLIRSTRTQYMLDQLNDLQRKEHLLNEANRTL  170

Query  583  KQRLMEGNQLN-LHWNPNA-QDMGYGRQTAHHS-QGDVFFHPLECEPTLQIGYPTDPITV  413
            KQRL+EG Q+N L  NPNA +D+GYGRQ  HH   GD FFHPL+CEPTLQIGY  DP++V
Sbjct  171  KQRLVEGYQVNSLQLNPNATEDVGYGRQQVHHQPHGDAFFHPLDCEPTLQIGYQHDPMSV  230

Query  412  --AGP  404
              AGP
Sbjct  231  VTAGP  235



>ref|XP_004504397.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Cicer arietinum]
Length=242

 Score =   287 bits (735),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 164/194 (85%), Gaps = 5/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SKELESLERQLD SL+QIRSTRTQ MLDQL+DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDTSLQQIRSTRTQFMLDQLSDLQRKEHMLSEANRSL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDP--ITV  413
            +QR +E  QLN L  N   ++MGYGR  +  + GD  F  +ECEPTLQIGY  DP  +  
Sbjct  170  RQRQLERYQLNQLQMNHCVEEMGYGRHPS-QTHGDGLFQQMECEPTLQIGYQADPGSVVA  228

Query  412  AGPSVNNYMPGWLP  371
            AGPS++NYM GWLP
Sbjct  229  AGPSMSNYMAGWLP  242



>gb|ADC79703.1| SEPALLATA3-like protein [Pachysandra terminalis]
Length=243

 Score =   287 bits (734),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 162/194 (84%), Gaps = 6/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSML+TLERYQKCNYG PEPN+S RE L++ SSQQEYLKLKAR+++LQRS
Sbjct  51   RGKLYEFCSSSSMLETLERYQKCNYGTPEPNVSARETLEQ-SSQQEYLKLKARFDSLQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQR+E  L E N +L
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRREQMLAEVNNTL  169

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            K+RL EG+Q+N H  W+PN    GY R  A    GD FFHPL+CEPTLQIGY  + ITV 
Sbjct  170  KRRLDEGSQVNAHEMWDPNGHGAGYERSQA-QPHGDGFFHPLDCEPTLQIGYRPEQITVV  228

Query  409  --GPSVNNYMPGWL  374
              GPSVNNYMPGWL
Sbjct  229  APGPSVNNYMPGWL  242



>gb|ADC79706.1| SEPALLATA3-like protein [Euptelea pleiosperma]
Length=243

 Score =   287 bits (734),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 166/194 (86%), Gaps = 6/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSS+SM KTLERYQKCNYGAPE  +STRE LQE SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSTSMFKTLERYQKCNYGAPETTVSTRE-LQEQSSQQEYLKLKARVEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KELESLERQLDMSLKQIRSTRTQ MLDQLTDLQR+E  L+E+NK+L
Sbjct  110  QRNLLGEDLGPLSGKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRREQVLSESNKNL  169

Query  583  KQRLMEGNQLNLH-WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA-  410
            ++RL EG+Q N H W+ +A  +GYGRQ    +QG+ F+HPLECEPTLQIGY  D ITVA 
Sbjct  170  RRRLEEGSQANPHQWDLSAHGVGYGRQQP-QAQGEGFYHPLECEPTLQIGYHPDQITVAA  228

Query  409  -GPSVNNY-MPGWL  374
             GPSVNNY MPGWL
Sbjct  229  PGPSVNNYNMPGWL  242



>ref|XP_010682728.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=240

 Score =   285 bits (730),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 162/193 (84%), Gaps = 5/193 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKL+EFCSS SMLKTLERYQK NYGAP+  +STREAL+E+SSQQEYLKLKAR+EALQR+
Sbjct  51   RGKLFEFCSSPSMLKTLERYQKSNYGAPDNTVSTREALKELSSQQEYLKLKARHEALQRT  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
             RNL+GEDLGPL+SKELESLERQLDMSLKQIRSTRTQ M+DQLTDLQRKEH LNEAN++L
Sbjct  111  HRNLMGEDLGPLSSKELESLERQLDMSLKQIRSTRTQYMVDQLTDLQRKEHMLNEANRTL  170

Query  583  KQRLMEGNQL-NLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPI-TVA  410
            KQRL+E NQ  +L W  N  D+GY RQ A     D FFHPL+CEPTLQ+GY  D +   A
Sbjct  171  KQRLIEANQASSLQW--NVHDIGYDRQPA-QPHDDSFFHPLDCEPTLQMGYQNDAVNAAA  227

Query  409  GPSVNNYMPGWLP  371
            G SVNN+MP WLP
Sbjct  228  GGSVNNFMPNWLP  240



>ref|XP_004504398.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Cicer arietinum]
Length=241

 Score =   285 bits (728),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 164/194 (85%), Gaps = 6/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SKELESLERQLD SL+QIRSTRTQ MLDQL+DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDTSLQQIRSTRTQFMLDQLSDLQRKEHMLSEANRSL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDP--ITV  413
            +QRL E  QLN L  N   ++MGYGR  +  + GD  F  +ECEPTLQIGY  DP  +  
Sbjct  170  RQRL-ERYQLNQLQMNHCVEEMGYGRHPS-QTHGDGLFQQMECEPTLQIGYQADPGSVVA  227

Query  412  AGPSVNNYMPGWLP  371
            AGPS++NYM GWLP
Sbjct  228  AGPSMSNYMAGWLP  241



>ref|XP_008459849.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Cucumis melo]
Length=228

 Score =   284 bits (727),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 161/194 (83%), Gaps = 19/194 (10%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE+LERQLDMSLKQIRSTRTQ MLDQLTDLQRK           
Sbjct  110  QRNLLGEDLGPLSSKELENLERQLDMSLKQIRSTRTQYMLDQLTDLQRK-----------  158

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
               L+EG Q+N L  N +A DM YGRQ A    GD FFHPL+CEPTLQIGY  DPITV  
Sbjct  159  ---LVEGYQVNALQLNQSADDMMYGRQQAQPP-GDAFFHPLDCEPTLQIGYQPDPITVVT  214

Query  412  AGPSVNNYMPGWLP  371
            AGPS+NN++PGWLP
Sbjct  215  AGPSMNNFLPGWLP  228



>gb|AFU81296.1| SEPALLATA3 [Medicago polyceratia]
Length=244

 Score =   285 bits (728),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 165/196 (84%), Gaps = 7/196 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSAREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL+DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHMLSEANRSL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIG-YPTDP---I  419
            +QR +EG QLN L  N   ++MGYGR  +  +QGD  +  LECEPTLQIG Y  DP   +
Sbjct  170  RQRQLEGYQLNQLQMNACVEEMGYGRHPS-QAQGDGLYQQLECEPTLQIGSYQPDPGSVV  228

Query  418  TVAGPSVNNYMPGWLP  371
              AGPS++NYM GWLP
Sbjct  229  CTAGPSMSNYMGGWLP  244



>emb|CAB95648.1| MADS box protein [Betula pendula]
Length=251

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 168/204 (82%), Gaps = 16/204 (8%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKL EFCSS SMLKTLERYQKCN+GAPEPN+S REAL E+SSQQEYLKLKARYEALQR+
Sbjct  51   RGKLCEFCSSPSMLKTLERYQKCNFGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRT  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SKELE LERQL+MSLKQIRS RTQ MLDQLTDLQRKEH LNEAN++L
Sbjct  110  QRNLMGEDLGPLSSKELELLERQLNMSLKQIRSIRTQCMLDQLTDLQRKEHMLNEANRTL  169

Query  583  KQRLMEGNQLN--LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTD-PITV  413
            KQRL++G  ++  L  + +A D+GYGRQ A  +Q D FFHPL CEPTLQIGY  D P+TV
Sbjct  170  KQRLVDGYHIDTVLQLDQSANDVGYGRQPA-QTQDDCFFHPL-CEPTLQIGYQHDHPMTV  227

Query  412  ----------AGPSVNNYMPGWLP  371
                      AGPSVNNYM GW+P
Sbjct  228  VTAGSGSVVTAGPSVNNYMSGWMP  251



>gb|AFL03390.1| MADS box transcription factor SEP3, partial [Sinofranchetia chinensis]
Length=200

 Score =   282 bits (721),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 162/193 (84%), Gaps = 5/193 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM KTLERYQKCN+GAPEPN+STREA QE SS QEYLKLKAR E LQRS
Sbjct  9    RGKLYEFCSSSSMFKTLERYQKCNFGAPEPNVSTREA-QEHSSHQEYLKLKARVEGLQRS  67

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KELESLERQLDMSLKQIRSTRTQ MLDQLTD QR+E  L+EANK+L
Sbjct  68   QRNLLGEDLGPLSGKELESLERQLDMSLKQIRSTRTQYMLDQLTDYQRREQMLSEANKTL  127

Query  583  KQRLMEGNQLNLH-WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            ++RL EG+Q N H W+PN Q + YGRQ A  +QG+ FF  +ECEPTL IGY  D ITV  
Sbjct  128  RRRLEEGSQPNPHQWDPNVQVVNYGRQQA-PAQGEGFFQHIECEPTLHIGYQQDQITVAA  186

Query  412  AGPSVNNYMPGWL  374
            AGPS+NNYM GW+
Sbjct  187  AGPSMNNYMQGWI  199



>ref|XP_010250667.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Nelumbo 
nucifera]
Length=239

 Score =   283 bits (723),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 163/193 (84%), Gaps = 8/193 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM+KTLERYQKCNYGAPE  ISTRE+ +E+S QQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMIKTLERYQKCNYGAPETTISTRES-EELSCQQEYLKLKARVEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KELESLERQLDMSLKQIRSTRTQ MLDQL DLQR+E  L+EAN++L
Sbjct  110  QRNLLGEDLGPLSGKELESLERQLDMSLKQIRSTRTQYMLDQLADLQRREQMLSEANRAL  169

Query  583  KQRLMEGNQLNLH-WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA-  410
            K+R  EG+Q N H W+PN    GYGR  A  +QG+ FFHP+ECEPTLQIGY  D ITVA 
Sbjct  170  KRRFEEGSQANAHQWDPNVH--GYGRHPA-QTQGEGFFHPVECEPTLQIGYQPDQITVAA  226

Query  409  -GPSVNNYMPGWL  374
             GPSV +YMPGWL
Sbjct  227  PGPSV-SYMPGWL  238



>gb|ADD25191.1| SEP3, partial [Nelumbo nucifera]
Length=226

 Score =   282 bits (721),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 163/193 (84%), Gaps = 8/193 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM+KTLERYQKCNYGAPE  ISTRE+ +E+S QQEYLKLKAR EALQRS
Sbjct  38   RGKLYEFCSSSSMIKTLERYQKCNYGAPETTISTRES-EELSCQQEYLKLKARVEALQRS  96

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KELESLERQLDMSLKQIRSTRTQ MLDQL DLQR+E  L+EAN++L
Sbjct  97   QRNLLGEDLGPLSGKELESLERQLDMSLKQIRSTRTQYMLDQLADLQRREQMLSEANRAL  156

Query  583  KQRLMEGNQLNLH-WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA-  410
            K+R  EG+Q N H W+PN    GYGR  A  +QG+ FFHP+ECEPTLQIGY  D ITVA 
Sbjct  157  KRRFEEGSQANAHQWDPNVH--GYGRHPA-QTQGEGFFHPVECEPTLQIGYQPDQITVAA  213

Query  409  -GPSVNNYMPGWL  374
             GPSV +YMPGWL
Sbjct  214  PGPSV-SYMPGWL  225



>ref|XP_004502275.1| PREDICTED: MADS-box transcription factor 1-like isoform X2 [Cicer 
arietinum]
Length=241

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 163/194 (84%), Gaps = 6/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS+SSMLKTLERYQKCNYGAPE N++T+EAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSTSSMLKTLERYQKCNYGAPEANVATKEAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SK+LE+LERQLD SLKQIRSTRTQ MLDQL DLQRKEH L EAN++L
Sbjct  110  QRNLMGEDLGPLSSKDLETLERQLDSSLKQIRSTRTQFMLDQLGDLQRKEHLLCEANRAL  169

Query  583  KQRLMEGNQL-NLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDP--ITV  413
            +QR MEG Q+ +L  N +A+DMGY R     + GD  F  LECEPTLQIGY  DP  +  
Sbjct  170  RQR-MEGYQISSLQLNLSAEDMGYDRHPG-QTHGDALFQQLECEPTLQIGYQNDPGSVVT  227

Query  412  AGPSVNNYMPGWLP  371
            AGPS+NNYM GWLP
Sbjct  228  AGPSMNNYMGGWLP  241



>ref|XP_007163780.1| hypothetical protein PHAVU_001G263400g [Phaseolus vulgaris]
 gb|ESW35774.1| hypothetical protein PHAVU_001G263400g [Phaseolus vulgaris]
Length=241

 Score =   282 bits (721),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 157/193 (81%), Gaps = 4/193 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS+SSMLKTLERYQKCNYGAPE N ST+EAL E+SSQQEYLKLKARYEALQR 
Sbjct  51   RGKLYEFCSTSSMLKTLERYQKCNYGAPENNASTKEAL-ELSSQQEYLKLKARYEALQRF  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+S ELESLERQLD SLKQIRSTRTQ MLDQL+D QRKEH L EAN +L
Sbjct  110  QRNLMGEDLGPLSSNELESLERQLDSSLKQIRSTRTQFMLDQLSDSQRKEHLLGEANTAL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--A  410
            +QRL E        NP+ +DMGY R    H QGD  F PLECEPTLQ+GY  DP++V   
Sbjct  170  RQRLEEYQINQFQLNPSGEDMGYDRHPGQH-QGDALFQPLECEPTLQMGYRPDPVSVITG  228

Query  409  GPSVNNYMPGWLP  371
            GPS+NNYM GWLP
Sbjct  229  GPSMNNYMAGWLP  241



>gb|KHN24051.1| MADS-box transcription factor 1 [Glycine soja]
Length=241

 Score =   282 bits (721),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 159/193 (82%), Gaps = 4/193 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGK YEFCS SSMLKTLERYQKCNYGAPE N++T+EAL E+SSQQEYL+LKARYEALQRS
Sbjct  51   RGKQYEFCSGSSMLKTLERYQKCNYGAPEDNVATKEAL-ELSSQQEYLRLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRS RTQ MLDQL+DLQRKEH L E+N+ L
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSIRTQFMLDQLSDLQRKEHFLGESNRDL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA--  410
            +QRL E     L  NP+A+DMGYGR      QG   F PLECEPTLQIGY  DP++V   
Sbjct  170  RQRLEEFQINPLQLNPSAEDMGYGRHPG-QPQGHALFQPLECEPTLQIGYHPDPVSVVTE  228

Query  409  GPSVNNYMPGWLP  371
            GPS+NNYM GWLP
Sbjct  229  GPSMNNYMAGWLP  241



>ref|XP_004502274.1| PREDICTED: MADS-box transcription factor 1-like isoform X1 [Cicer 
arietinum]
Length=243

 Score =   282 bits (721),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 163/195 (84%), Gaps = 6/195 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCS+SSMLKTLERYQKCNYGAPE N++T+EAL  E+SSQQEYLKLKARYEALQR
Sbjct  51   RGKLYEFCSTSSMLKTLERYQKCNYGAPEANVATKEALVLELSSQQEYLKLKARYEALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            SQRNL+GEDLGPL+SK+LE+LERQLD SLKQIRSTRTQ MLDQL DLQRKEH L EAN++
Sbjct  111  SQRNLMGEDLGPLSSKDLETLERQLDSSLKQIRSTRTQFMLDQLGDLQRKEHLLCEANRA  170

Query  586  LKQRLMEGNQL-NLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDP--IT  416
            L+QR MEG Q+ +L  N +A+DMGY R     + GD  F  LECEPTLQIGY  DP  + 
Sbjct  171  LRQR-MEGYQISSLQLNLSAEDMGYDRHPG-QTHGDALFQQLECEPTLQIGYQNDPGSVV  228

Query  415  VAGPSVNNYMPGWLP  371
             AGPS+NNYM GWLP
Sbjct  229  TAGPSMNNYMGGWLP  243



>ref|NP_001236390.1| MADS transcription factor [Glycine max]
 emb|CAI47596.1| MADS transcription factor [Glycine max]
 gb|ACU23250.1| unknown [Glycine max]
Length=243

 Score =   281 bits (719),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 159/194 (82%), Gaps = 4/194 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGK YEFCS SSMLKTLERYQKCNYGAPE N++T+EAL  E+SSQQEYL+LKARYEALQR
Sbjct  51   RGKQYEFCSGSSMLKTLERYQKCNYGAPEDNVATKEALVLELSSQQEYLRLKARYEALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            SQRNL+GEDLGPL+SKELESLERQLD SLKQIRS RTQ MLDQL+DLQRKEH L E+N+ 
Sbjct  111  SQRNLMGEDLGPLSSKELESLERQLDSSLKQIRSIRTQFMLDQLSDLQRKEHFLGESNRD  170

Query  586  LKQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA-  410
            L+QRL E     L  NP+A+DMGYGR      QG   F PLECEPTLQIGY  DP++V  
Sbjct  171  LRQRLEEFQINPLQLNPSAEDMGYGRHPG-QPQGHALFQPLECEPTLQIGYHPDPVSVVT  229

Query  409  -GPSVNNYMPGWLP  371
             GPS+NNYM GWLP
Sbjct  230  EGPSMNNYMAGWLP  243



>ref|XP_007163779.1| hypothetical protein PHAVU_001G263400g [Phaseolus vulgaris]
 gb|ESW35773.1| hypothetical protein PHAVU_001G263400g [Phaseolus vulgaris]
Length=243

 Score =   281 bits (719),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 157/194 (81%), Gaps = 4/194 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCS+SSMLKTLERYQKCNYGAPE N ST+EAL  E+SSQQEYLKLKARYEALQR
Sbjct  51   RGKLYEFCSTSSMLKTLERYQKCNYGAPENNASTKEALVLELSSQQEYLKLKARYEALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
             QRNL+GEDLGPL+S ELESLERQLD SLKQIRSTRTQ MLDQL+D QRKEH L EAN +
Sbjct  111  FQRNLMGEDLGPLSSNELESLERQLDSSLKQIRSTRTQFMLDQLSDSQRKEHLLGEANTA  170

Query  586  LKQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            L+QRL E        NP+ +DMGY R    H QGD  F PLECEPTLQ+GY  DP++V  
Sbjct  171  LRQRLEEYQINQFQLNPSGEDMGYDRHPGQH-QGDALFQPLECEPTLQMGYRPDPVSVIT  229

Query  412  AGPSVNNYMPGWLP  371
             GPS+NNYM GWLP
Sbjct  230  GGPSMNNYMAGWLP  243



>gb|ABD17386.1| MADS-box protein SEP3-1 [Taihangia rupestris]
Length=325

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 165/194 (85%), Gaps = 9/194 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNY  PE ++ST EAL E+SSQQEYL+LKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYSTPETHVSTGEAL-ELSSQQEYLRLKARYEALQRN  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKE  LNEAN+SL
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEQMLNEANRSL  169

Query  583  KQRLMEGNQLN-LH---WNPNAQDMGYGR-QTAHHSQGDVFFHPLECEPTLQIGY-PTDP  422
            KQRL EG  +N LH    N NA+D+GYGR Q AH    DVF+HPLE EPTLQIGY  +DP
Sbjct  170  KQRLFEGYNVNQLHQFQLNANAEDVGYGRHQQAHQPHSDVFYHPLELEPTLQIGYHQSDP  229

Query  421  ITV--AGPSVNNYM  386
            I V  AGPSV+N+M
Sbjct  230  IQVVAAGPSVSNFM  243



>ref|XP_003601749.1| MADS-box transcription factor [Medicago truncatula]
 gb|AES72000.1| MADS-box transcription factor [Medicago truncatula]
Length=244

 Score =   281 bits (718),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 164/196 (84%), Gaps = 7/196 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS+SSMLKTLERYQKCNYGAPE N  ++EAL E+SSQQEYLKLKARYE+LQR+
Sbjct  51   RGKLYEFCSTSSMLKTLERYQKCNYGAPEANAHSKEAL-ELSSQQEYLKLKARYESLQRT  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SK+LE+LERQLD SLKQIRSTRTQ MLDQL DLQRKEH L EAN++L
Sbjct  110  QRNLMGEDLGPLSSKDLETLERQLDSSLKQIRSTRTQFMLDQLGDLQRKEHLLCEANRAL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGD-VFFHPLECEPTLQIGYPTDP---I  419
            +QR MEG Q+N L  N +A+DMGYGR     +QGD   F P+ECEPTLQIGY  DP   +
Sbjct  170  RQR-MEGYQINSLQLNLSAEDMGYGRHHPGQNQGDHDVFQPIECEPTLQIGYQADPGSVV  228

Query  418  TVAGPSVNNYMPGWLP  371
              AGPS+NNYM GWLP
Sbjct  229  VTAGPSMNNYMGGWLP  244



>ref|XP_004310096.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Fragaria 
vesca subsp. vesca]
Length=180

 Score =   278 bits (712),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 155/182 (85%), Gaps = 5/182 (3%)
 Frame = -3

Query  907  MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGPL  728
            MLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQR+QRNLLGEDLGPL
Sbjct  1    MLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRNQRNLLGEDLGPL  59

Query  727  NSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSLKQRLMEGNQLNL  548
            +SKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQRKEH LNEAN++LKQRL EG    L
Sbjct  60   SSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHLLNEANRTLKQRLFEGYHHQL  119

Query  547  HWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGY-PTDPITV--AGPSVNNYMPGW  377
              N NA+++ YGRQ AH  QGD FF  LECEPTLQIGY   DPI V  AGPSV NYM GW
Sbjct  120  QLNANAEEVAYGRQEAHQPQGDGFFQALECEPTLQIGYHQNDPIQVVTAGPSV-NYMGGW  178

Query  376  LP  371
            LP
Sbjct  179  LP  180



>ref|XP_010682729.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=239

 Score =   280 bits (717),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 161/193 (83%), Gaps = 6/193 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKL+EFCSS SMLKTLERYQK NYGAP+  +STREAL E+SSQQEYLKLKAR+EALQR+
Sbjct  51   RGKLFEFCSSPSMLKTLERYQKSNYGAPDNTVSTREAL-ELSSQQEYLKLKARHEALQRT  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
             RNL+GEDLGPL+SKELESLERQLDMSLKQIRSTRTQ M+DQLTDLQRKEH LNEAN++L
Sbjct  110  HRNLMGEDLGPLSSKELESLERQLDMSLKQIRSTRTQYMVDQLTDLQRKEHMLNEANRTL  169

Query  583  KQRLMEGNQL-NLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPI-TVA  410
            KQRL+E NQ  +L W  N  D+GY RQ A     D FFHPL+CEPTLQ+GY  D +   A
Sbjct  170  KQRLIEANQASSLQW--NVHDIGYDRQPA-QPHDDSFFHPLDCEPTLQMGYQNDAVNAAA  226

Query  409  GPSVNNYMPGWLP  371
            G SVNN+MP WLP
Sbjct  227  GGSVNNFMPNWLP  239



>sp|O65874.1|MTF1_PEA RecName: Full=MADS-box transcription factor 1 [Pisum sativum]
 emb|CAA11258.1| MADS-box transcription factor [Pisum sativum]
Length=247

 Score =   280 bits (717),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 166/198 (84%), Gaps = 8/198 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCS+SSMLKTLERYQKCNYGAPE N++++EAL  E+SSQQEYLKLKARYE+LQR
Sbjct  51   RGKLYEFCSTSSMLKTLERYQKCNYGAPEGNVTSKEALVLELSSQQEYLKLKARYESLQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            SQRNL+GEDLGPL+SK+LE+LERQLD SLKQIRSTRTQ MLDQL DLQRKEH L EAN++
Sbjct  111  SQRNLMGEDLGPLSSKDLETLERQLDSSLKQIRSTRTQFMLDQLGDLQRKEHLLCEANRA  170

Query  586  LKQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFF--HPLECEPTLQIGY-PTDP-  422
            L+QR MEG Q+N L  N +A+DMGYGR    H+ GD  F   P+ECEPTLQIGY   DP 
Sbjct  171  LRQR-MEGYQINSLQLNLSAEDMGYGRHHQGHTHGDELFQVQPIECEPTLQIGYHQGDPG  229

Query  421  -ITVAGPSVNNYMPGWLP  371
             +  AGPS+NNYM GWLP
Sbjct  230  SVVTAGPSMNNYMGGWLP  247



>gb|AAR06665.1| transcription factor SEP3 [Chloranthus spicatus]
Length=204

 Score =   279 bits (713),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 156/194 (80%), Gaps = 8/194 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAP+  +STRE     SSQQEYLKLKAR EALQRS
Sbjct  14   RGKLYEFCSSSSMLKTLERYQKCNYGAPDTTVSTREMQ---SSQQEYLKLKARVEALQRS  70

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRN LGEDLGPL+ KELE LERQLDMSLKQIRSTRTQ MLDQLTDLQR+E  L E NK+L
Sbjct  71   QRNFLGEDLGPLSGKELEQLERQLDMSLKQIRSTRTQYMLDQLTDLQRREQMLCETNKAL  130

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            K+RL E    N H  W+PN   + YGRQ A   QGD FFHPLECEPTLQIGY  D IT+A
Sbjct  131  KRRLDEVTPANPHQGWDPNPHGVSYGRQAAQQ-QGDGFFHPLECEPTLQIGYQHDQITIA  189

Query  409  --GPSVNNYMPGWL  374
              GPSV+NYMPGWL
Sbjct  190  APGPSVSNYMPGWL  203



>ref|XP_008340234.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Malus domestica]
 ref|XP_008340235.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Malus domestica]
Length=264

 Score =   280 bits (717),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 165/215 (77%), Gaps = 25/215 (12%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTL+RYQK +Y APE N+STREAL E+SSQQEYLKLKA +EALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLDRYQKXSYAAPETNVSTREAL-ELSSQQEYLKLKAHFEALQRN  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLG L+SKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQR EH LNEANK+L
Sbjct  110  QRNLLGEDLGHLSSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRNEHVLNEANKTL  169

Query  583  KQR--------------LMEGNQLN-LHWNPNAQDMG-------YGRQTAHHSQGDVFFH  470
            KQR              L EG  +N L  N  A + G       Y RQ A  +QGD FFH
Sbjct  170  KQRTLHVPDFLGDHALQLYEGYHVNSLQLNAXADEYGRQQAADEYNRQQAQXAQGDGFFH  229

Query  469  PLECEPTLQIGYPTDPITV--AGPSVNNYMPGWLP  371
            PL+CEPTLQIGY  DPI+V  AGPSV+NYM GWLP
Sbjct  230  PLDCEPTLQIGYQNDPISVVTAGPSVSNYMGGWLP  264



>gb|AAT46095.1| SEPALLATA-like protein [Akebia trifoliata]
Length=242

 Score =   278 bits (712),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 162/193 (84%), Gaps = 5/193 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM KTLERYQKCN+GAPEPN+STREAL E SS QEYLKLKAR E LQRS
Sbjct  51   RGKLYEFCSSSSMFKTLERYQKCNFGAPEPNVSTREAL-EHSSHQEYLKLKARVEGLQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KELE+LERQLDMSLKQIRSTRTQ MLDQL+D QR+E  L+EANK+L
Sbjct  110  QRNLLGEDLGPLSGKELETLERQLDMSLKQIRSTRTQYMLDQLSDYQRREQMLSEANKAL  169

Query  583  KQRLMEGNQLNLH-WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            ++RL EG+Q N H W+PN Q + +GRQ A  +QG+ FF  +ECEPTL IGY  D ITV  
Sbjct  170  RRRLEEGSQPNPHQWDPNVQVVNFGRQQA-PAQGEGFFQHIECEPTLHIGYQPDQITVAA  228

Query  412  AGPSVNNYMPGWL  374
            AGPS+NNYM GW+
Sbjct  229  AGPSMNNYMQGWI  241



>ref|XP_006415783.1| hypothetical protein EUTSA_v10008591mg [Eutrema salsugineum]
 gb|ESQ34136.1| hypothetical protein EUTSA_v10008591mg [Eutrema salsugineum]
Length=247

 Score =   277 bits (708),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 155/193 (80%), Gaps = 4/193 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR+
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQRT  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL++KELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+L
Sbjct  111  QRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTL  170

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGY--PTDPITVA  410
            + RL +G Q+ L  NPN +D+ YGR    HSQ   FF PLECEP LQIGY    D    A
Sbjct  171  RLRLADGYQMPLQLNPNQEDVDYGRHQQQHSQA--FFQPLECEPILQIGYQGQQDHGMGA  228

Query  409  GPSVNNYMPGWLP  371
            GPSVNNYM GWLP
Sbjct  229  GPSVNNYMLGWLP  241



>gb|ABQ85953.1| MADS-box transcription factor SEP-like 4 [Trochodendron aralioides]
Length=229

 Score =   276 bits (705),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 157/193 (81%), Gaps = 5/193 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM KTLERYQKCNY APE N+STRE L++ SS QEYLKLKAR++ LQR+
Sbjct  38   RGKLYEFCSSSSMFKTLERYQKCNYAAPETNVSTRETLEQ-SSYQEYLKLKARHDDLQRT  96

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
             RN +GEDLGPL+ KELESLERQL++SLKQIRS RTQ MLDQLTDLQR+E  L+E+NK+L
Sbjct  97   HRNFMGEDLGPLSGKELESLERQLNVSLKQIRSIRTQYMLDQLTDLQRREQMLSESNKTL  156

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPIT--V  413
             +RL EGNQ N L W+PNAQ MGY RQ A H QGD FFHPLECEPTLQIGY  D      
Sbjct  157  ARRLEEGNQANALQWDPNAQGMGYDRQPA-HPQGDGFFHPLECEPTLQIGYQHDQTAGMA  215

Query  412  AGPSVNNYMPGWL  374
             GPS NNYM GWL
Sbjct  216  PGPSGNNYMAGWL  228



>gb|AAX15920.1| AGL9 [Liriodendron tulipifera]
Length=242

 Score =   275 bits (704),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 158/195 (81%), Gaps = 9/195 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS+SSM KTLERYQKCNYGAPE  ++TRE     SS QEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSTSSMFKTLERYQKCNYGAPEAAVTTREIQ---SSHQEYLKLKARVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLN KEL++LERQLD+SLKQIRSTRTQ MLDQLTDLQR+E  L+EANK+L
Sbjct  108  QRNLLGEDLGPLNGKELDTLERQLDVSLKQIRSTRTQYMLDQLTDLQRREQMLSEANKAL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            K+RL EG Q N H  WN N   M Y RQ     QGD FFHPL+CEPTLQIGY TD IT++
Sbjct  168  KRRLDEGMQANPHQGWNHNPHAMEYVRQQG-PPQGDGFFHPLDCEPTLQIGYQTDQITMS  226

Query  409  ---GPSVNNYMPGWL  374
               GPS+NNYMPGWL
Sbjct  227  TAPGPSLNNYMPGWL  241



>ref|XP_008801852.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X3 [Phoenix dactylifera]
Length=242

 Score =   275 bits (704),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 156/195 (80%), Gaps = 9/195 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIVSRETQ---SSQQEYLKLKARVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANKSL
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            K+RL E NQ      W+PNA  +GYGRQ     QGD F+ P+ECEPTL IGY  + IT+A
Sbjct  168  KRRLEESNQATQQQVWDPNAHAVGYGRQPP-QPQGDGFYQPIECEPTLHIGYHPEQITIA  226

Query  409  ---GPSVNNYMPGWL  374
               GPSV+NYMPGWL
Sbjct  227  AGPGPSVSNYMPGWL  241



>gb|AEF59026.1| MADS-2 [Fragaria x ananassa]
Length=180

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 155/182 (85%), Gaps = 5/182 (3%)
 Frame = -3

Query  907  MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGPL  728
            MLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARY+ALQR+QRNLLGEDLGPL
Sbjct  1    MLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYDALQRNQRNLLGEDLGPL  59

Query  727  NSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSLKQRLMEGNQLNL  548
            +SKELESLERQLDMSLKQIRSTRTQ MLDQLTDLQ+KEH LNEAN++LKQRL +G    L
Sbjct  60   SSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQQKEHLLNEANRTLKQRLFDGYNHQL  119

Query  547  HWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGY-PTDPITV--AGPSVNNYMPGW  377
              N NA+++ YGRQ AH  +GD FF  LECEPTLQIGY   DPI V  AGPSV NYM GW
Sbjct  120  QLNANAEEVAYGRQQAHQPRGDGFFQALECEPTLQIGYHQNDPIQVVTAGPSV-NYMGGW  178

Query  376  LP  371
            LP
Sbjct  179  LP  180



>ref|XP_010913017.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Elaeis guineensis]
 gb|AAQ03226.1|AF411845_1 MADS box transcription factor [Elaeis guineensis]
Length=242

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 156/195 (80%), Gaps = 9/195 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     +SQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIVSRETQ---TSQQEYLKLKARVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLG+DLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANKSL
Sbjct  108  QRNLLGDDLGPLSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            KQRL E NQ      W+PNA  +GYGRQ     QGD F+  +EC+PTL IGYP + IT+A
Sbjct  168  KQRLEESNQATQQQVWDPNAPAVGYGRQPP-QPQGDGFYQQIECDPTLHIGYPPEQITIA  226

Query  409  ---GPSVNNYMPGWL  374
               GPSV+NYMPGWL
Sbjct  227  AAPGPSVSNYMPGWL  241



>ref|XP_003538541.1| PREDICTED: MADS-box transcription factor 1-like isoform X1 [Glycine 
max]
 gb|KHN44454.1| MADS-box transcription factor 1 [Glycine soja]
Length=241

 Score =   273 bits (698),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 157/193 (81%), Gaps = 4/193 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGK YEFCS SSMLKTLERYQKCNYGAPE N++T EAL E+SSQQEYL+LKARYEALQRS
Sbjct  51   RGKQYEFCSGSSMLKTLERYQKCNYGAPEDNVATNEAL-ELSSQQEYLRLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRS RTQ MLDQL+DLQRKEH L E+N+ L
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSIRTQFMLDQLSDLQRKEHFLGESNRDL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA--  410
             QRL E     L  NP+A++MG+GR      QG   F PL+CEPTLQIGY  DP++V   
Sbjct  170  IQRLEEFQINPLQLNPSAEEMGHGRYPG-QPQGHALFQPLDCEPTLQIGYHPDPVSVVSE  228

Query  409  GPSVNNYMPGWLP  371
            GPS+NNYM GWLP
Sbjct  229  GPSMNNYMAGWLP  241



>gb|KDO81856.1| hypothetical protein CISIN_1g047287mg [Citrus sinensis]
Length=210

 Score =   271 bits (694),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 160/197 (81%), Gaps = 19/197 (10%)
 Frame = -3

Query  910  SMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGP  731
            SM+KTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQRSQRNLLGE+LGP
Sbjct  15   SMVKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRSQRNLLGEELGP  73

Query  730  LNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSLKQR--------  575
            LNSKELESLERQLDMSLKQIRSTRTQ MLD LT+LQ KE  L+EANK+LKQR        
Sbjct  74   LNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRTMTLRHAD  133

Query  574  -----LMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGY-PTDPIT  416
                 LMEG Q+N L  NP+A+D GYG + A   QGD FFH LECEPTLQIGY P DPI+
Sbjct  134  FAGLQLMEGYQVNTLQLNPSAEDCGYGLKPA-QPQGDTFFHALECEPTLQIGYQPADPIS  192

Query  415  V--AGPSVNNYMPGWLP  371
            V  AGPS+NNYM GWLP
Sbjct  193  VVTAGPSLNNYMQGWLP  209



>ref|XP_006591442.1| PREDICTED: MADS-box transcription factor 1-like isoform X2 [Glycine 
max]
Length=243

 Score =   273 bits (697),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 157/194 (81%), Gaps = 4/194 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGK YEFCS SSMLKTLERYQKCNYGAPE N++T EAL  E+SSQQEYL+LKARYEALQR
Sbjct  51   RGKQYEFCSGSSMLKTLERYQKCNYGAPEDNVATNEALVLELSSQQEYLRLKARYEALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            SQRNL+GEDLGPL+SKELESLERQLD SLKQIRS RTQ MLDQL+DLQRKEH L E+N+ 
Sbjct  111  SQRNLMGEDLGPLSSKELESLERQLDSSLKQIRSIRTQFMLDQLSDLQRKEHFLGESNRD  170

Query  586  LKQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA-  410
            L QRL E     L  NP+A++MG+GR      QG   F PL+CEPTLQIGY  DP++V  
Sbjct  171  LIQRLEEFQINPLQLNPSAEEMGHGRYPG-QPQGHALFQPLDCEPTLQIGYHPDPVSVVS  229

Query  409  -GPSVNNYMPGWLP  371
             GPS+NNYM GWLP
Sbjct  230  EGPSMNNYMAGWLP  243



>dbj|BAB70747.1| putative MADS-domain transcription factor MpMADS13 [Magnolia 
praecocissima]
Length=231

 Score =   270 bits (691),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 156/195 (80%), Gaps = 9/195 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE  +STRE     S  QEYLKLKAR EALQRS
Sbjct  40   RGKLYEFCSSSSMLKTLERYQKCNYGAPELPVSTRETQ---SYHQEYLKLKARVEALQRS  96

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KELE+LERQLD+SL+QIRSTRTQ MLDQL DLQR+EH L+EANK+L
Sbjct  97   QRNLLGEDLGPLSGKELETLERQLDISLRQIRSTRTQCMLDQLGDLQRREHMLSEANKTL  156

Query  583  KQRLMEGNQLNLH--WNPNAQDM-GYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV  413
             +RL EG Q N +  W PNA  +  Y RQ     QGD FFHPLECEPTL IGY  D IT+
Sbjct  157  TRRLEEGAQANQNQVWEPNAHAVDSYNRQQPQQ-QGDGFFHPLECEPTLHIGYQPDQITI  215

Query  412  A--GPSVNNYMPGWL  374
            A  GPSVNNYMPGWL
Sbjct  216  AAPGPSVNNYMPGWL  230



>gb|AAX15924.1| AGL9.2 [Persea americana]
Length=242

 Score =   271 bits (692),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 157/195 (81%), Gaps = 9/195 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE  +STRE     SS QEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETTVSTRETQ---SSHQEYLKLKARVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL SKEL++LE+QLD SLKQIRSTRTQ MLDQL DLQR+E  L+EANK+L
Sbjct  108  QRNLLGEDLGPLTSKELDTLEKQLDASLKQIRSTRTQYMLDQLADLQRREQMLSEANKNL  167

Query  583  KQRLMEGNQLNLH-WNPNAQDMGYGRQTAHHSQGDVFFHPLE-CEPTLQIGY-PTDPITV  413
            K+RL EG Q N   W+PN   + YGRQ A   Q D FFHPL+ CEPTL IGY P D IT+
Sbjct  168  KRRLEEGMQANPQVWDPNGHPVTYGRQQA-PPQSDGFFHPLDTCEPTLHIGYQPADQITI  226

Query  412  A--GPSVNNYMPGWL  374
            A  GPSVNNYMPGWL
Sbjct  227  AAPGPSVNNYMPGWL  241



>dbj|BAO74164.1| MADS-box transcription factor SEP3.2 [Torenia fournieri]
Length=253

 Score =   270 bits (691),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 166/204 (81%), Gaps = 16/204 (8%)
 Frame = -3

Query  943  RGKLYEFCSSSS-MLKTLERYQKCNYGAPE-PNISTREALQEISSQQEYLKLKARYEALQ  770
            RGKLYEFCSSSS M KTLERYQKCNYGAP+ PN+S REAL E+SSQQEYLKLK RYEALQ
Sbjct  51   RGKLYEFCSSSSSMPKTLERYQKCNYGAPDQPNVSAREALVELSSQQEYLKLKGRYEALQ  110

Query  769  RSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANK  590
            RSQRNLLGEDLGPLN KELE+LERQLDMSLKQIRSTRTQ+MLD LTDLQ+KE+ALNEANK
Sbjct  111  RSQRNLLGEDLGPLNLKELETLERQLDMSLKQIRSTRTQVMLDTLTDLQKKEYALNEANK  170

Query  589  SLKQRLMEGNQLNLHWNPNAQDMGYGR------QTAHHSQGDVFFHPLECEPTLQIGYPT  428
            SLKQRLMEG+ ++L W  N  +M YGR         HH    VFFHPLECEPTLQIGY  
Sbjct  171  SLKQRLMEGSHISLQWQAN--EMDYGRHVQPHHHHHHHHPDHVFFHPLECEPTLQIGYQA  228

Query  427  DP-ITV----AGPSV-NNYMPGWL  374
            DP IT     AGPSV NNY+ GWL
Sbjct  229  DPAITAAEAEAGPSVNNNYLSGWL  252



>gb|ABI60898.1| MADS-box transcription factor [Arachis hypogaea]
Length=243

 Score =   270 bits (689),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 160/195 (82%), Gaps = 6/195 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLER QKCNYGAPE N+STREAL E+SSQQEYLK KARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERCQKCNYGAPETNVSTREAL-ELSSQQEYLKPKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SKELESLERQLD SLK IRSTRTQ MLDQL++LQRKEH L+EAN++L
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKLIRSTRTQFMLDQLSELQRKEHLLSEANRAL  169

Query  583  KQRLMEGNQLN-LHWNP-NAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV-  413
            +QR +EG Q+N +  NP    DMGY R      Q D  F  L+CEPTLQIGY  DP++V 
Sbjct  170  RQRQLEGYQINPMQLNPGGVDDMGYARHPP-QPQPDPLFQQLDCEPTLQIGYQPDPVSVV  228

Query  412  -AGPSVNNYMPGWLP  371
             AGPS+ NYM GWLP
Sbjct  229  TAGPSMGNYMGGWLP  243



>gb|AJC01941.1| MADS-box protein, partial [Ficus carica]
Length=199

 Score =   266 bits (681),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 151/169 (89%), Gaps = 3/169 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQK NYGAPEPN+S REAL E+SSQQEYLKLKARYE+L R+
Sbjct  33   RGKLYEFCSSSSMLKTLERYQKSNYGAPEPNVSAREAL-ELSSQQEYLKLKARYESLLRN  91

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
             RNL+GE+LG L+SKELESLERQLDMSLKQIRSTRTQ MLDQLTDL+RKEH LNE N++L
Sbjct  92   HRNLMGEELGALSSKELESLERQLDMSLKQIRSTRTQTMLDQLTDLRRKEHLLNETNRTL  151

Query  583  KQRLMEGNQL-NLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQI  440
            KQRL+EG QL +L  NP A D+GYGRQ A  +QGD+FFHP+ECEPTLQ+
Sbjct  152  KQRLVEGYQLSSLQLNPGADDVGYGRQPA-QAQGDIFFHPIECEPTLQL  199



>gb|ABK41485.1| putative MADS box protein [Elaeis guineensis]
Length=242

 Score =   267 bits (682),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 153/195 (78%), Gaps = 9/195 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM+KTLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMMKTLERYQKCNYGAPETNIISRETQ---SSQQEYLKLKARAEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQRKE  L EANKSL
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRKEQMLCEANKSL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            ++RL E NQ      W+P A  +GYGRQ     Q D F+  ++ EPTLQIGYP + IT+A
Sbjct  168  RRRLEESNQAGQQQVWDPTAHAVGYGRQPP-QPQSDGFYQQIDSEPTLQIGYPPEQITIA  226

Query  409  ---GPSVNNYMPGWL  374
               GPSVN YMPGWL
Sbjct  227  AAPGPSVNTYMPGWL  241



>ref|XP_010025292.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Eucalyptus grandis]
 gb|KCW61919.1| hypothetical protein EUGRSUZ_H04617 [Eucalyptus grandis]
Length=253

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 162/204 (79%), Gaps = 14/204 (7%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGA EPN+S RE+L E+S QQEYL+LKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGALEPNVSARESL-ELSCQQEYLRLKARYEALQRT  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGE+LG L+SKELESLERQLD SLKQIRS RTQ MLDQLTDLQ +E  L+EAN++L
Sbjct  110  QRNLLGEELGQLSSKELESLERQLDGSLKQIRSRRTQYMLDQLTDLQHREQLLHEANRTL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDM-GYGR--------QTAHHSQGDVFFHPLECEPTLQIGY  434
             QRLMEG Q+N L  N +A+++ GYG         Q       + FFHPLECEPTLQ+GY
Sbjct  170  NQRLMEGYQVNALQLNQHAEEVGGYGHPPPPPLPPQPLAQPHSEAFFHPLECEPTLQMGY  229

Query  433  PTDPIT---VAGPSVNNYMPGWLP  371
              DP++     GPS+NN+MPGWLP
Sbjct  230  QPDPVSSVITGGPSINNFMPGWLP  253



>ref|XP_003630490.1| MADS-box transcription factor [Medicago truncatula]
Length=330

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 167/231 (72%), Gaps = 40/231 (17%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSAREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTR-------------------------  659
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRSTR                         
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRGLKHGYLPVQFLFLLVVAGLDGSMN  169

Query  658  ---------TQMMLDQLTDLQRKEHALNEANKSLKQRLMEGNQLN-LHWNPNAQDMGYGR  509
                     TQ MLDQL+DLQRKEH L+EAN+SL+QRL EG QLN L  N   ++MGYGR
Sbjct  170  QTISLLTRETQFMLDQLSDLQRKEHMLSEANRSLRQRL-EGYQLNQLQMNACVEEMGYGR  228

Query  508  QTAHHSQGDVFFHPLECEPTLQIGYPTDP--ITVAGPSVNNYMPGWLP*KL  362
              +  +QGD  +  LECEPTLQIGY  DP  +  AGPS++NYM GWLP K+
Sbjct  229  HPS-QTQGDGLYQQLECEPTLQIGYQPDPGSVCTAGPSMSNYMGGWLPYKI  278



>ref|XP_010917558.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Elaeis 
guineensis]
 gb|AAQ03224.1|AF411843_1 MADS box transcription factor [Elaeis guineensis]
Length=242

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 153/195 (78%), Gaps = 9/195 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM+KTLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMMKTLERYQKCNYGAPETNIISRETQ---SSQQEYLKLKARAEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQRKE  L EANKSL
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRKEQMLCEANKSL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            ++RL E NQ      W+P A  +GYGRQ     Q D F+  ++ EPTLQIGYP + IT+A
Sbjct  168  RRRLEESNQAGQQQVWDPTAHAVGYGRQPP-QPQSDGFYQQIDSEPTLQIGYPPEQITIA  226

Query  409  ---GPSVNNYMPGWL  374
               GPSVN YMPGWL
Sbjct  227  AAPGPSVNTYMPGWL  241



>gb|AFX72879.1| MADS-box protein SEP3 [Aquilegia coerulea]
Length=244

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 162/195 (83%), Gaps = 7/195 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKC+YG PEPN+S REA QE SS QEYL+LK + E+LQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCSYGGPEPNVSAREA-QEHSSHQEYLRLKGKVESLQRT  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KELE+LERQLD SL+QIRSTRTQ MLDQLTDLQR+E  L+EANK+L
Sbjct  110  QRNLLGEDLGPLSGKELETLERQLDSSLRQIRSTRTQYMLDQLTDLQRREQMLSEANKNL  169

Query  583  KQRLMEGNQLN-LHWNPNAQD-MGYGRQTAHHSQGDVFFHPLECEPTLQIG-YPTDPITV  413
            ++RL EG Q N  HW+PN  + + + RQ A  +QG+ FFHPLECEPTLQIG Y  + I+V
Sbjct  170  RRRLEEGTQPNHHHWDPNMHNGVTFARQQA-QAQGEGFFHPLECEPTLQIGSYQNEQISV  228

Query  412  --AGPSVNNYMPGWL  374
              AGPS+NNYM GWL
Sbjct  229  ATAGPSMNNYMQGWL  243



>ref|XP_010499199.1| PREDICTED: developmental protein SEPALLATA 3 isoform X4 [Camelina 
sativa]
Length=250

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 151/194 (78%), Gaps = 3/194 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR+
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQRT  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+L
Sbjct  111  QRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTL  170

Query  583  KQRLMEGNQLNLHWNPNAQDM--GYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV-  413
            + RL +G Q+ L  NPN +D    YGR          FF PLECEP LQIGY      + 
Sbjct  171  RLRLADGYQMPLQLNPNPEDHLDPYGRHHHQQQHSQAFFQPLECEPILQIGYQGQQDGMG  230

Query  412  AGPSVNNYMPGWLP  371
            AGPSVNNYM GWLP
Sbjct  231  AGPSVNNYMLGWLP  244



>gb|AAX15918.1| AGL9 [Eschscholzia californica]
Length=241

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 158/193 (82%), Gaps = 10/193 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM KTLERYQK NYGAPE N+S RE+ QE SS QEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMFKTLERYQKSNYGAPETNVSVRES-QEHSSHQEYLKLKARVEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KELESLERQLDMSLKQIRSTRTQ MLDQLTDLQR+E  L++ANK+L
Sbjct  110  QRNLLGEDLGPLSGKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRREQMLSDANKTL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV---  413
            ++RL EG      W    Q+M YG+Q A H+QG+ FFHP+ECEPTLQ+GY  D ITV   
Sbjct  170  RRRLEEGTVTCHQWE---QNMQYGQQQA-HAQGEGFFHPIECEPTLQMGYQQDQITVAAA  225

Query  412  AGPS--VNNYMPG  380
            AGPS  +N+YMPG
Sbjct  226  AGPSMTMNSYMPG  238



>ref|XP_009415892.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   266 bits (679),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 154/196 (79%), Gaps = 10/196 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     +SQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIISREIQ---TSQQEYLKLKARVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KELE LERQLD SL+QIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLSIKELEQLERQLDASLRQIRSTRTQCMLDQLADLQRREQMLCEANKAL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            K R+ EGNQ N    W+PNAQ + Y R      QGD FF P+ECEPTLQIGY  D + +A
Sbjct  168  KIRMDEGNQANQQQLWDPNAQAVAYCRHQP-QPQGDGFFQPIECEPTLQIGYHPDQMAIA  226

Query  409  ----GPSVNNYMPGWL  374
                GPSV++Y+PGWL
Sbjct  227  AAAPGPSVSSYVPGWL  242



>dbj|BAD10945.1| SEPALLATA3 homologous protein [Silene latifolia]
Length=244

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 155/194 (80%), Gaps = 5/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN-ISTREALQEISSQQEYLKLKARYEALQR  767
            RGKLYEFCSS SMLKTLERYQK NYG P+   +S+REAL EISS QEY++LKARYEALQR
Sbjct  51   RGKLYEFCSSPSMLKTLERYQKSNYGPPDNTAVSSREAL-EISSHQEYIRLKARYEALQR  109

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            + RNL+GEDLGPL+SKELESLERQLDMSLK IRSTRTQ MLDQL DLQRKEH LNEAN +
Sbjct  110  THRNLMGEDLGPLSSKELESLERQLDMSLKHIRSTRTQYMLDQLADLQRKEHVLNEANIT  169

Query  586  LKQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDP--ITV  413
            LKQRL+E +Q++        ++ YGRQ        VFFHPLECEPTLQIGY  +   +T 
Sbjct  170  LKQRLIEADQVS-SAQCYGHELDYGRQNPQAQADHVFFHPLECEPTLQIGYQPEQMNVTA  228

Query  412  AGPSVNNYMPGWLP  371
            AGPS+NN+M GWLP
Sbjct  229  AGPSINNFMTGWLP  242



>dbj|BAM34478.1| MADS-box transcription factor [Alstroemeria ligtu subsp. ligtu]
Length=244

 Score =   265 bits (678),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 154/196 (79%), Gaps = 10/196 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM+KTLERYQKCNYGAPE N+ +RE     SSQQEYLKLKAR EALQR 
Sbjct  51   RGKLYEFCSSSSMMKTLERYQKCNYGAPETNVISRETQ---SSQQEYLKLKARVEALQRY  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQRKE  L EANKSL
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDASLKQIRSTRTQFMLDQLADLQRKEQMLCEANKSL  167

Query  583  KQRLMEGNQLNLH--WNPNAQD-MGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV  413
            ++RL E +  N    W+ NA    GY R+ A   QGD FFHPLECEPTLQIGY  D IT+
Sbjct  168  RRRLEESSHPNQQQVWDHNAHSAAGYAREQA-QPQGDGFFHPLECEPTLQIGYHPDQITI  226

Query  412  A---GPSVNNYMPGWL  374
            A   GPS ++YMPGWL
Sbjct  227  ASAPGPSASSYMPGWL  242



>gb|KFK44483.1| developmental protein sepallata 3 [Arabis alpina]
Length=249

 Score =   265 bits (678),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 155/196 (79%), Gaps = 8/196 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL++KELESLERQLD SLKQIR  RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSTKELESLERQLDSSLKQIRGLRTQFMLDQLNDLQSKERMLTETNKT  170

Query  586  LKQRLMEGNQLNLHWNPNAQDMG-YGRQTAHHSQGDVFFHPLECEPTLQIGYPT---DPI  419
            L+ RL +G Q+ L  NPN +D+  Y R    HSQ   FF PLECEP LQIGY T   D +
Sbjct  171  LRLRLADGYQMPLQLNPNQEDIDHYARHQHQHSQA--FFQPLECEPILQIGYQTQQQDGM  228

Query  418  TVAGPSVNNYMPGWLP  371
              AGPSVNNYM GWLP
Sbjct  229  G-AGPSVNNYMLGWLP  243



>gb|AAX15923.1| AGL9.1 [Persea americana]
Length=237

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 159/194 (82%), Gaps = 12/194 (6%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS++SMLKTLERYQKCNYGAPE  +S+RE LQ  SS QEY+KLKAR EALQRS
Sbjct  51   RGKLYEFCSTASMLKTLERYQKCNYGAPETTVSSRE-LQ--SSHQEYMKLKARVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL  KEL++LE+QLD+SLK IRSTRTQ MLDQL DLQR+EH L+EANKSL
Sbjct  108  QRNLLGEDLGPLTGKELDTLEKQLDVSLKHIRSTRTQYMLDQLGDLQRREHMLSEANKSL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            ++RL EG Q N +  W+PN    GY RQ A   Q D FFHP+ECEPTLQIGY +  IT+A
Sbjct  168  RRRLEEGMQENPNHAWDPN----GYVRQQA-PPQSDGFFHPIECEPTLQIGYQSSQITIA  222

Query  409  --GPSVNNYMPGWL  374
              GP+VNNYMPGWL
Sbjct  223  APGPNVNNYMPGWL  236



>ref|XP_010530562.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X2 
[Tarenaya hassleriana]
Length=248

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 157/198 (79%), Gaps = 11/198 (6%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKC+YGAPEPN+ +REAL+E+SSQQEYLKLK R++ALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCSYGAPEPNVPSREALEELSSQQEYLKLKQRFDALQRT  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLN+KELE+LERQLD SLKQIR+ RTQ MLDQ  +LQRKE  L E NK+L
Sbjct  111  QRNLLGEDLGPLNTKELEALERQLDSSLKQIRALRTQYMLDQRNELQRKEQMLTETNKAL  170

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV---  413
            + RL EG Q+ L  NP+ +++GYGRQ  H    D FFHPL+ EP LQIGY      +   
Sbjct  171  RIRLSEGYQMPLQLNPHPEEIGYGRQPQH----DAFFHPLDSEPILQIGYQQQQDVMNAA  226

Query  412  ----AGPSVNNYMPGWLP  371
                AGPSVNNYM GWLP
Sbjct  227  AAAGAGPSVNNYMLGWLP  244



>gb|AIU94433.1| MADS-box transcription factor 2 isoform 1, partial [Musa balbisiana]
Length=243

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 153/196 (78%), Gaps = 10/196 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     +SQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIISREIQ---TSQQEYLKLKARVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KELE LERQLD SL+QIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLSIKELEQLERQLDASLRQIRSTRTQCMLDQLADLQRREQMLCEANKAL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            K RL EGNQ N    W+PNA  + Y R      QGD FF P+ECEPTLQIGY  D + +A
Sbjct  168  KIRLDEGNQANQQQLWDPNAHAVAYCRHQP-QPQGDGFFQPIECEPTLQIGYHPDQMAIA  226

Query  409  ----GPSVNNYMPGWL  374
                GPSV++Y+PGWL
Sbjct  227  AAAPGPSVSSYVPGWL  242



>gb|ACJ64678.1| MADS-box protein MADS2 [Musa acuminata AAA Group]
 gb|AIU94429.1| MADS-box transcription factor 2 isoform 1 [Musa acuminata]
Length=243

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 153/196 (78%), Gaps = 10/196 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     +SQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIISREIQ---TSQQEYLKLKARVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KELE LERQLD SL+QIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLSIKELEQLERQLDASLRQIRSTRTQCMLDQLADLQRREQMLCEANKAL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            K R+ EGNQ N    W+PNA  + Y R      QGD FF P+ECEPTLQIGY  D + +A
Sbjct  168  KIRMDEGNQANQQQLWDPNAHAVAYCRHQP-QPQGDGFFQPIECEPTLQIGYHPDQMAIA  226

Query  409  ----GPSVNNYMPGWL  374
                GPSV++Y+PGWL
Sbjct  227  AAAPGPSVSSYVPGWL  242



>ref|XP_002890717.1| hypothetical protein ARALYDRAFT_472923 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66976.1| hypothetical protein ARALYDRAFT_472923 [Arabidopsis lyrata subsp. 
lyrata]
Length=247

 Score =   263 bits (672),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 154/194 (79%), Gaps = 6/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKDRYDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL++KELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKT  170

Query  586  LKQRLMEGNQLNLHWNPNAQDMG-YGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV-  413
            L+ RL +G Q+ L  NPN +++  YGR   HH     FF PLECEP LQIGY      + 
Sbjct  171  LRLRLADGYQMPLQLNPNQEEVDHYGR---HHQHSQAFFQPLECEPILQIGYQGQQDGMG  227

Query  412  AGPSVNNYMPGWLP  371
            AGPS+NNYM GWLP
Sbjct  228  AGPSLNNYMLGWLP  241



>ref|NP_850953.1| MADs box transcription factor SEPALLATA3 [Arabidopsis thaliana]
 gb|AAM65812.1| putative floral homeotic protein, AGL9 [Arabidopsis thaliana]
 gb|AEE30502.1| MADs box transcription factor SEPALLATA3 [Arabidopsis thaliana]
Length=250

 Score =   263 bits (672),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 152/194 (78%), Gaps = 3/194 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR+
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQRT  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL++KELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+L
Sbjct  111  QRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTL  170

Query  583  KQRLMEGNQLNLHWNPNAQDMG-YGR-QTAHHSQGDVFFHPLECEPTLQIGYPTDPITV-  413
            + RL +G Q+ L  NPN +++  YGR           FF PLECEP LQIGY      + 
Sbjct  171  RLRLADGYQMPLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQGQQDGMG  230

Query  412  AGPSVNNYMPGWLP  371
            AGPSVNNYM GWLP
Sbjct  231  AGPSVNNYMLGWLP  244



>ref|XP_010499198.1| PREDICTED: developmental protein SEPALLATA 3 isoform X3 [Camelina 
sativa]
Length=251

 Score =   262 bits (670),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 151/195 (77%), Gaps = 4/195 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKT  170

Query  586  LKQRLMEGNQLNLHWNPNAQDM--GYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV  413
            L+ RL +G Q+ L  NPN +D    YGR          FF PLECEP LQIGY      +
Sbjct  171  LRLRLADGYQMPLQLNPNPEDHLDPYGRHHHQQQHSQAFFQPLECEPILQIGYQGQQDGM  230

Query  412  -AGPSVNNYMPGWLP  371
             AGPSVNNYM GWLP
Sbjct  231  GAGPSVNNYMLGWLP  245



>ref|XP_010460483.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X4 
[Camelina sativa]
Length=254

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 152/198 (77%), Gaps = 7/198 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR+
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQRT  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+L
Sbjct  111  QRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTL  170

Query  583  KQRLMEGNQLNLHWNPNAQDMG--YGR----QTAHHSQGDVFFHPLECEPTLQIGYPTDP  422
            + RL +G Q+ L  NPN +D    YGR    Q         FF PLECEP LQIGY    
Sbjct  171  RLRLADGYQMPLQLNPNPEDHVDLYGRHHQQQQQQQQHSQAFFQPLECEPILQIGYQAQQ  230

Query  421  ITV-AGPSVNNYMPGWLP  371
              + AGPSVNNYM GWLP
Sbjct  231  DGMGAGPSVNNYMLGWLP  248



>ref|XP_010499197.1| PREDICTED: developmental protein SEPALLATA 3 isoform X2 [Camelina 
sativa]
Length=251

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 151/195 (77%), Gaps = 4/195 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSS ML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSSMLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKT  170

Query  586  LKQRLMEGNQLNLHWNPNAQDM--GYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV  413
            L+ RL +G Q+ L  NPN +D    YGR          FF PLECEP LQIGY      +
Sbjct  171  LRLRLADGYQMPLQLNPNPEDHLDPYGRHHHQQQHSQAFFQPLECEPILQIGYQGQQDGM  230

Query  412  -AGPSVNNYMPGWLP  371
             AGPSVNNYM GWLP
Sbjct  231  GAGPSVNNYMLGWLP  245



>gb|AAZ95252.1| MADS box protein SEP1 [Dendrobium crumenatum]
Length=243

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 155/197 (79%), Gaps = 12/197 (6%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNY  PE NI +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYEGPETNIISRETQ---SSQQEYLKLKARVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLSSKELEHLERQLDASLKQIRSTRTQFMLDQLADLQRREQMLCEANKAL  167

Query  583  KQRLMEGNQLNLH--WNPN-AQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV  413
            K+R  E NQ      W+P+    +GYGRQ A H  GD F+HPLECEPTLQIGY +D IT+
Sbjct  168  KRRFEESNQTAHQQVWDPSTTHAVGYGRQPAQH-HGDAFYHPLECEPTLQIGYHSD-ITM  225

Query  412  A---GPSVNNYM-PGWL  374
            A    P+V+NYM PGWL
Sbjct  226  APTTAPNVSNYMPPGWL  242



>ref|XP_009113783.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Brassica rapa]
Length=252

 Score =   261 bits (666),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 151/196 (77%), Gaps = 5/196 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGK YEFCSSSSML+TL+RYQKCNYGAPEPN+ +REAL E++SQQEYLKLK RY+ALQR+
Sbjct  51   RGKQYEFCSSSSMLRTLDRYQKCNYGAPEPNVPSREALAELNSQQEYLKLKERYDALQRT  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL++KELE LERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+L
Sbjct  111  QRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLAETNKTL  170

Query  583  KQRLMEGNQLNLHWNPNAQD---MGYGRQTAHHSQGDVFFHPLECEPTLQIGY--PTDPI  419
            + RL +G Q+ L  NPN +D   + YGR   H      FF PLECEP LQ+GY    D  
Sbjct  171  RLRLADGYQMPLQLNPNPEDHHHVDYGRHQQHEHSHQAFFQPLECEPILQMGYQGQQDHG  230

Query  418  TVAGPSVNNYMPGWLP  371
              AGPSVNNYM GWLP
Sbjct  231  MGAGPSVNNYMLGWLP  246



>gb|AIU94765.1| class E MADS-domain transcription factor, partial [Hypoxis villosa]
Length=218

 Score =   259 bits (662),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 153/192 (80%), Gaps = 5/192 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSS+SMLKTLERYQKC+YGAP+ ++  RE     SS QEYLKLKAR E LQRS
Sbjct  29   RGKLYEFCSSNSMLKTLERYQKCSYGAPDTSVQLRETQMLQSSHQEYLKLKARVETLQRS  88

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE+LERQLD SL+QIRSTRTQ MLDQLTDLQRKE  L EAN++L
Sbjct  89   QRNLLGEDLGPLSSKELENLERQLDSSLRQIRSTRTQYMLDQLTDLQRKEQMLCEANRNL  148

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            ++RL + NQ +    W  NA  +GYGRQ     QG+ FFHPLEC+PTLQIG+   P  +A
Sbjct  149  RKRLEDSNQAHHQQVWESNANALGYGRQPTQQ-QGEEFFHPLECQPTLQIGFT--PDQMA  205

Query  409  GPSVNNYMPGWL  374
            GPSV+ YMPGWL
Sbjct  206  GPSVSTYMPGWL  217



>gb|ADJ67238.1| MADS box transcription factor 6 [Oncidium hybrid cultivar]
Length=243

 Score =   260 bits (664),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 154/196 (79%), Gaps = 10/196 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS++SMLKTLERYQKCNYGAPE N+ +RE     SSQQEYLKLK R E LQRS
Sbjct  51   RGKLYEFCSTNSMLKTLERYQKCNYGAPETNVISRETQ---SSQQEYLKLKGRVETLQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLNSKELEQLERQLDNSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTL  167

Query  583  KQRLMEGNQLNLH--WNPN-AQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPIT-  416
            K+RL E NQ N    W+P+ A  MGY RQ A    GD F+HPLECEPTLQIGY +D    
Sbjct  168  KRRLEESNQANPQQMWDPSTAHAMGYDRQPA-QPHGDAFYHPLECEPTLQIGYQSDLTMA  226

Query  415  -VAGPSVNNYM-PGWL  374
             +A P+V+NYM PGWL
Sbjct  227  PMAAPNVHNYMPPGWL  242



>gb|AIU94434.1| MADS-box transcription factor 2 isoform 2, partial [Musa balbisiana]
Length=247

 Score =   260 bits (664),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 153/200 (77%), Gaps = 14/200 (7%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     +SQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIISREIQ---TSQQEYLKLKARVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KELE LERQLD SL+QIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLSIKELEQLERQLDASLRQIRSTRTQCMLDQLADLQRREQMLCEANKAL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPI---  419
            K R+ EGNQ N    W+PNAQ + Y R      QGD FF P++CEPTLQIGY  D +   
Sbjct  168  KIRMDEGNQANQQQLWDPNAQAVAYCRHQP-QPQGDGFFQPIDCEPTLQIGYHPDQMAIA  226

Query  418  -----TVAGPSVNNYMPGWL  374
                   AGPSV+NY+PGWL
Sbjct  227  AAAAAAAAGPSVSNYVPGWL  246



>ref|XP_010025293.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Eucalyptus grandis]
 gb|KCW61920.1| hypothetical protein EUGRSUZ_H04617 [Eucalyptus grandis]
Length=251

 Score =   260 bits (665),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 161/204 (79%), Gaps = 16/204 (8%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGA EPN+S RE+L E+S QQEYL+LKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGALEPNVSARESL-ELSCQQEYLRLKARYEALQRT  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGE+LG L+SKELESLERQLD SLKQIRS RTQ MLDQLTDLQ +   L+EAN++L
Sbjct  110  QRNLLGEELGQLSSKELESLERQLDGSLKQIRSRRTQYMLDQLTDLQHR--LLHEANRTL  167

Query  583  KQRLMEGNQLN-LHWNPNAQDM-GYGR--------QTAHHSQGDVFFHPLECEPTLQIGY  434
             QRLMEG Q+N L  N +A+++ GYG         Q       + FFHPLECEPTLQ+GY
Sbjct  168  NQRLMEGYQVNALQLNQHAEEVGGYGHPPPPPLPPQPLAQPHSEAFFHPLECEPTLQMGY  227

Query  433  PTDPIT---VAGPSVNNYMPGWLP  371
              DP++     GPS+NN+MPGWLP
Sbjct  228  QPDPVSSVITGGPSINNFMPGWLP  251



>ref|XP_010530561.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X1 
[Tarenaya hassleriana]
Length=249

 Score =   260 bits (664),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 157/199 (79%), Gaps = 12/199 (6%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSMLKTLERYQKC+YGAPEPN+ +REAL+ E+SSQQEYLKLK R++ALQR
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCSYGAPEPNVPSREALEVELSSQQEYLKLKQRFDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPLN+KELE+LERQLD SLKQIR+ RTQ MLDQ  +LQRKE  L E NK+
Sbjct  111  TQRNLLGEDLGPLNTKELEALERQLDSSLKQIRALRTQYMLDQRNELQRKEQMLTETNKA  170

Query  586  LKQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV--  413
            L+ RL EG Q+ L  NP+ +++GYGRQ  H    D FFHPL+ EP LQIGY      +  
Sbjct  171  LRIRLSEGYQMPLQLNPHPEEIGYGRQPQH----DAFFHPLDSEPILQIGYQQQQDVMNA  226

Query  412  -----AGPSVNNYMPGWLP  371
                 AGPSVNNYM GWLP
Sbjct  227  AAAAGAGPSVNNYMLGWLP  245



>dbj|BAC80253.1| MADS-box transcription factor [Houttuynia cordata]
Length=243

 Score =   259 bits (662),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 154/197 (78%), Gaps = 10/197 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSS M+KT+ERYQKCNYGAPE  +ST+E     SS QEY+KLKAR E+LQRS
Sbjct  51   RGKLYEFCSSSGMMKTIERYQKCNYGAPEATVSTKEIQ---SSYQEYMKLKARVESLQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL  KELE LERQLDMSLKQIRSTRTQ MLDQL+DLQR+E  L+EANK+L
Sbjct  108  QRNLLGEDLGPLTGKELEQLERQLDMSLKQIRSTRTQCMLDQLSDLQRREQMLSEANKAL  167

Query  583  KQRLM---EGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPI  419
            ++RL+   +G+Q N H  W+PNA  +GY R      QG+V F PL+CEPTL IGY  D I
Sbjct  168  RRRLLQLDDGSQTNPHHSWDPNAHGVGYSRHPG-QPQGEVIFDPLDCEPTLHIGYQPDQI  226

Query  418  TVAGPSVN-NYMPGWLP  371
            T+A P  N NYM GWLP
Sbjct  227  TIAAPGPNGNYMQGWLP  243



>gb|AIU94764.1| class E MADS-domain transcription factor, partial [Hypoxis villosa]
Length=211

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 153/195 (78%), Gaps = 11/195 (6%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSS SMLKTLERYQKCNYGAPE ++ TRE     SSQQEY+KLKAR EALQRS
Sbjct  22   RGKLYEFCSSPSMLKTLERYQKCNYGAPETSVVTRETQ---SSQQEYMKLKARVEALQRS  78

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL++KELE LERQLD SL+QIRSTRTQ MLDQL DLQRKE  L EANK+L
Sbjct  79   QRNLLGEDLGPLSTKELEHLERQLDASLRQIRSTRTQYMLDQLQDLQRKEQMLCEANKAL  138

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            ++RL E N  N    W+ NA  MGYGRQ     QGD FFHPLE EPTLQIGY  D IT+A
Sbjct  139  RRRLEESNHANQQHVWDHNAPGMGYGRQP--QPQGDGFFHPLE-EPTLQIGYQPDQITIA  195

Query  409  GP---SVNNYMPGWL  374
                 +VNN++PGWL
Sbjct  196  AAPVQNVNNFLPGWL  210



>emb|CDY27603.1| BnaA09g28040D [Brassica napus]
Length=253

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 152/197 (77%), Gaps = 6/197 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGK YEFCSSSSML+TL+RYQKCNYGAPEPN+ +REAL  E++SQQEYLKLK RY+ALQR
Sbjct  51   RGKQYEFCSSSSMLRTLDRYQKCNYGAPEPNVPSREALAVELNSQQEYLKLKERYDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL++KELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLAETNKT  170

Query  586  LKQRLMEGNQLNLHWNPNAQD---MGYGRQTAHHSQGDVFFHPLECEPTLQIGY--PTDP  422
            L+ RL +G Q+ L  NPN +D   + YGR   H      FF PLECEP LQ+GY    D 
Sbjct  171  LRLRLADGYQMPLQLNPNPEDHHHVDYGRHQQHEHSHQAFFQPLECEPILQMGYQGQQDH  230

Query  421  ITVAGPSVNNYMPGWLP  371
               AGPSVNNYM GWLP
Sbjct  231  GMGAGPSVNNYMLGWLP  247



>gb|AIU94432.1| MADS-box transcription factor 2 isoform 3, partial [Musa acuminata]
Length=243

 Score =   258 bits (659),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 153/200 (77%), Gaps = 18/200 (9%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKL+EFCSSSSMLKTLERYQKCNYGAPE N+ +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLFEFCSSSSMLKTLERYQKCNYGAPETNVISRETQ---SSQQEYLKLKARVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLN KELE LERQLD SL+QIRSTRTQ MLDQLTDLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLNIKELEQLERQLDASLRQIRSTRTQYMLDQLTDLQRREQMLCEANKAL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPI---  419
            K+RL E NQ N    W+PN     YGRQ     QGD FF P++CEPTLQIGY  D +   
Sbjct  168  KRRLEESNQANQQQLWDPNT----YGRQQP-QPQGDGFFQPIDCEPTLQIGYHPDQMAIA  222

Query  418  -----TVAGPSVNNYMPGWL  374
                   AGPSV+NY+PGWL
Sbjct  223  AAAAAAAAGPSVSNYVPGWL  242



>gb|AIU94762.1| class E MADS-domain transcription factor, partial [Gongora galeata]
Length=225

 Score =   258 bits (658),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 158/201 (79%), Gaps = 16/201 (8%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS++SMLKTLERYQKCNYGAPE N+ +RE     SSQQEYLKLK R EALQRS
Sbjct  29   RGKLYEFCSTNSMLKTLERYQKCNYGAPETNVISRETQ---SSQQEYLKLKGRVEALQRS  85

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  86   QRNLLGEDLGPLSSKELEQLERQLDNSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTL  145

Query  583  KQRLM----EGNQLNLH--WNPN-AQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTD  425
            K+RL+    E NQ N    W+P+ A  MGY RQ A    GD F+HPLECEPTLQIGY +D
Sbjct  146  KRRLIRILEESNQANPQQMWDPSTAHAMGYDRQPA-QPHGDAFYHPLECEPTLQIGYQSD  204

Query  424  PITV---AGPSVNNYM-PGWL  374
             +T+   A P+VNNYM PGWL
Sbjct  205  -LTIAPMAAPNVNNYMPPGWL  224



>ref|NP_564214.2| MADs box transcription factor SEPALLATA3 [Arabidopsis thaliana]
 sp|O22456.1|SEP3_ARATH RecName: Full=Developmental protein SEPALLATA 3; AltName: Full=Agamous-like 
MADS-box protein AGL9 [Arabidopsis thaliana]
 gb|AAB67832.1| AGL9 [Arabidopsis thaliana]
 gb|AAC00586.1| AGL9 [Arabidopsis thaliana]
 gb|ACF75546.1| At1g24260 [Arabidopsis thaliana]
 gb|AEE30503.1| MADs box transcription factor SEPALLATA3 [Arabidopsis thaliana]
Length=251

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 152/195 (78%), Gaps = 4/195 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL++KELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKT  170

Query  586  LKQRLMEGNQLNLHWNPNAQDMG-YGR-QTAHHSQGDVFFHPLECEPTLQIGYPTDPITV  413
            L+ RL +G Q+ L  NPN +++  YGR           FF PLECEP LQIGY      +
Sbjct  171  LRLRLADGYQMPLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQGQQDGM  230

Query  412  -AGPSVNNYMPGWLP  371
             AGPSVNNYM GWLP
Sbjct  231  GAGPSVNNYMLGWLP  245



>gb|ACA24481.1| agamous-like 9 protein 1 [Glycine max]
Length=223

 Score =   257 bits (657),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 145/175 (83%), Gaps = 2/175 (1%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGK YEFCS SSMLKTLERYQKCNYGAPE N++T+EAL E+SSQQEYL+LKARYEALQRS
Sbjct  51   RGKQYEFCSGSSMLKTLERYQKCNYGAPEDNVATKEAL-ELSSQQEYLRLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRS RTQ MLDQL+DLQRKEH L E+N+ L
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSIRTQFMLDQLSDLQRKEHFLGESNRDL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPI  419
            +QRL E     L  NP+A+DMGYGR      QG   F PLECEPTLQIGY  DP+
Sbjct  170  RQRLEEFQINPLQLNPSAEDMGYGRHPG-QPQGHALFQPLECEPTLQIGYHPDPV  223



>ref|XP_008801850.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Phoenix dactylifera]
Length=271

 Score =   259 bits (661),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 156/224 (70%), Gaps = 38/224 (17%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIVSRETQ---SSQQEYLKLKARVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRK-----------  617
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+           
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRRVWLMQSNSFKK  167

Query  616  ------------------EHALNEANKSLKQRLMEGNQLNLH--WNPNAQDMGYGRQTAH  497
                              E  L EANKSLK+RL E NQ      W+PNA  +GYGRQ   
Sbjct  168  HLFFIPPFPSYYHCSFLQEQMLCEANKSLKRRLEESNQATQQQVWDPNAHAVGYGRQPPQ  227

Query  496  HSQGDVFFHPLECEPTLQIGYPTDPITVA---GPSVNNYMPGWL  374
              QGD F+ P+ECEPTL IGY  + IT+A   GPSV+NYMPGWL
Sbjct  228  -PQGDGFYQPIECEPTLHIGYHPEQITIAAGPGPSVSNYMPGWL  270



>ref|XP_010478051.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X4 
[Camelina sativa]
Length=253

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 151/197 (77%), Gaps = 6/197 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR+
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQRT  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+L
Sbjct  111  QRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTL  170

Query  583  KQRLMEGNQLNLHWNPNAQDM--GYGR--QTAHHSQGDVFFHPLECEPTLQIG-YPTDPI  419
            + RL +G Q+ L  NPN +D    YGR            FF PLECEP LQIG Y     
Sbjct  171  RLRLADGYQMPLQLNPNPEDHIDPYGRHHHQQQQQHSQAFFQPLECEPILQIGSYQAQQD  230

Query  418  TV-AGPSVNNYMPGWLP  371
             + AGPSVNNYM GWLP
Sbjct  231  GMGAGPSVNNYMLGWLP  247



>gb|AAP83398.1| SEPALLATA3-like MADS-box [Papaver nudicaule]
Length=215

 Score =   256 bits (655),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 152/196 (78%), Gaps = 7/196 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSS+SM KT ERYQKCNYG PEPN+S RE+L E +S QEYLKLKAR EALQRS
Sbjct  20   RGKLYEFCSSNSMFKTXERYQKCNYGQPEPNVSARESL-EHASHQEYLKLKARVEALQRS  78

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KELE LE+QLD SLKQIRSTRTQ MLDQLTDLQR+E  L++ANK+L
Sbjct  79   QRNLLGEDLGPLSGKELEFLEKQLDSSLKQIRSTRTQYMLDQLTDLQRREQMLSDANKTL  138

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGR--QTAHHSQGD---VFFHPLECEPTLQIGYPTDPI  419
            ++RL EG Q +         +GY R  Q+ HH   D    FFHPLECEPTLQIGY  D I
Sbjct  139  RRRLEEGAQASQQQWDMQHGVGYSRQQQSXHHQAADHNQGFFHPLECEPTLQIGYQQDQI  198

Query  418  TVA-GPSVNNYMPGWL  374
            TVA G  + +YMPGWL
Sbjct  199  TVAQGAPMGSYMPGWL  214



>ref|XP_010531079.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X2 
[Tarenaya hassleriana]
Length=249

 Score =   258 bits (658),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 155/195 (79%), Gaps = 4/195 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSML+TLERYQKC+YGAPEPN+ +REAL+E+SSQQEYLKLK R++AL RS
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCSYGAPEPNVPSREALEELSSQQEYLKLKQRHDALLRS  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDL PLN+KELE+LERQLD SLKQIR+ RTQ MLDQL DL  KE  L E NK+L
Sbjct  111  QRNLLGEDLAPLNTKELEALERQLDSSLKQIRALRTQYMLDQLNDLHHKEQMLTETNKTL  170

Query  583  KQRLMEG-NQL-NLHWNPNAQDMGYGRQTAHH-SQGDVFFHPLECEPTLQIGYPTDPITV  413
            + RL EG +Q+  L  NP+ +++GYGRQ     +Q D FFHPL  EP LQIGY      +
Sbjct  171  RIRLSEGYDQMPPLQLNPHPEELGYGRQPQQQLAQADAFFHPLASEPILQIGYQQQQEAM  230

Query  412  A-GPSVNNYMPGWLP  371
            A GPSVNNYM GWLP
Sbjct  231  AGGPSVNNYMLGWLP  245



>gb|ABC70706.1| MADS-box transcription factor [Asparagus virgatus]
Length=239

 Score =   257 bits (657),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 153/192 (80%), Gaps = 6/192 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKC+YGAP+ ++  RE+    SS QEYL+LKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCSYGAPDTSVQIRESQMLQSSHQEYLRLKARVEALQRS  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EAN+SL
Sbjct  111  QRNLLGEDLGPLSSKELEQLERQLDSSLKQIRSTRTQYMLDQLADLQRREQMLCEANRSL  170

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            ++RL E +Q N    W  +A  MGY RQ  +  QGD FFHPLEC+PTLQIG+   P  + 
Sbjct  171  RKRLEESSQANQQQVWE-DANAMGYNRQ-PNQPQGDQFFHPLECQPTLQIGF--QPDQMP  226

Query  409  GPSVNNYMPGWL  374
            GPSV+NYMPGWL
Sbjct  227  GPSVSNYMPGWL  238



>ref|XP_010499195.1| PREDICTED: developmental protein SEPALLATA 3 isoform X1 [Camelina 
sativa]
Length=252

 Score =   258 bits (658),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 151/196 (77%), Gaps = 5/196 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQ  770
            RGKLYEFCSSSS ML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQ
Sbjct  51   RGKLYEFCSSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQ  110

Query  769  RSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANK  590
            R+QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK
Sbjct  111  RTQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNK  170

Query  589  SLKQRLMEGNQLNLHWNPNAQDM--GYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPIT  416
            +L+ RL +G Q+ L  NPN +D    YGR          FF PLECEP LQIGY      
Sbjct  171  TLRLRLADGYQMPLQLNPNPEDHLDPYGRHHHQQQHSQAFFQPLECEPILQIGYQGQQDG  230

Query  415  V-AGPSVNNYMPGWLP  371
            + AGPSVNNYM GWLP
Sbjct  231  MGAGPSVNNYMLGWLP  246



>ref|XP_010460482.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X3 
[Camelina sativa]
Length=255

 Score =   258 bits (658),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 152/199 (76%), Gaps = 8/199 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKT  170

Query  586  LKQRLMEGNQLNLHWNPNAQDMG--YGR----QTAHHSQGDVFFHPLECEPTLQIGYPTD  425
            L+ RL +G Q+ L  NPN +D    YGR    Q         FF PLECEP LQIGY   
Sbjct  171  LRLRLADGYQMPLQLNPNPEDHVDLYGRHHQQQQQQQQHSQAFFQPLECEPILQIGYQAQ  230

Query  424  PITV-AGPSVNNYMPGWLP  371
               + AGPSVNNYM GWLP
Sbjct  231  QDGMGAGPSVNNYMLGWLP  249



>ref|XP_010917559.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Elaeis 
guineensis]
 gb|AAQ03225.1|AF411844_1 MADS box transcription factor [Elaeis guineensis]
 gb|AAY96424.1| putative MADS box protein [Elaeis guineensis]
Length=242

 Score =   257 bits (657),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 151/195 (77%), Gaps = 9/195 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM+KTLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMMKTLERYQKCNYGAPETNIISRETQ---SSQQEYLKLKARVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANKSL
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            ++RL E NQ      W+P A  +GYGRQ     Q D F+  ++ EPTLQI YP + IT+A
Sbjct  168  RRRLEESNQAGQQQVWDPTAHAVGYGRQPP-QPQSDGFYQQIDGEPTLQIRYPPEQITIA  226

Query  409  ---GPSVNNYMPGWL  374
               G SV+ YMPGWL
Sbjct  227  AAPGSSVSTYMPGWL  241



>ref|XP_010460481.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X2 
[Camelina sativa]
Length=255

 Score =   258 bits (658),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 152/199 (76%), Gaps = 8/199 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSS ML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSSMLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKT  170

Query  586  LKQRLMEGNQLNLHWNPNAQDMG--YGR----QTAHHSQGDVFFHPLECEPTLQIGYPTD  425
            L+ RL +G Q+ L  NPN +D    YGR    Q         FF PLECEP LQIGY   
Sbjct  171  LRLRLADGYQMPLQLNPNPEDHVDLYGRHHQQQQQQQQHSQAFFQPLECEPILQIGYQAQ  230

Query  424  PITV-AGPSVNNYMPGWLP  371
               + AGPSVNNYM GWLP
Sbjct  231  QDGMGAGPSVNNYMLGWLP  249



>gb|ABQ85950.1| MADS-box transcription factor SEP-like 1 [Trochodendron aralioides]
Length=217

 Score =   256 bits (654),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 154/192 (80%), Gaps = 8/192 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERY+KCNY  P+ N+STRE  Q  S   EYLKLKARYEAL++S
Sbjct  31   RGKLYEFCSSSSMLKTLERYEKCNYAGPKTNMSTRET-QVNSGYHEYLKLKARYEALRQS  89

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
             RNL+GEDLGPL+SKELESLER L++SLKQIRSTRTQ MLDQL+DLQR+E  L+EAN++L
Sbjct  90   HRNLMGEDLGPLSSKELESLERALNVSLKQIRSTRTQYMLDQLSDLQRREQMLSEANRTL  149

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQ-TAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            +Q L EG Q N L WNP+ QD+ YGRQ T   S G  FFHPLECEPTLQIGY  D     
Sbjct  150  RQSLDEGRQANVLQWNPSEQDVEYGRQPTQPQSHG--FFHPLECEPTLQIGYQPD---AP  204

Query  409  GPSVNNYMPGWL  374
             PSV+NYMPGWL
Sbjct  205  EPSVSNYMPGWL  216



>gb|AIU94430.1| MADS-box transcription factor 2 isoform 2 [Musa acuminata]
 gb|AIU94431.1| MADS-box transcription factor 2 isoform 2 [Musa acuminata]
Length=244

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 153/201 (76%), Gaps = 19/201 (9%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKL+EFCSSSSMLKTLERYQKCNYGAPE N+ +RE     +SQQEYLKLKAR EALQRS
Sbjct  51   RGKLFEFCSSSSMLKTLERYQKCNYGAPETNVMSRETQ---NSQQEYLKLKARVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLN KELE LERQLD SL+QIRSTRTQ MLDQLTDLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLNIKELEQLERQLDASLRQIRSTRTQYMLDQLTDLQRREQMLCEANKAL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPI---  419
            K+RL E NQ N    W+PN     YGRQ     QGD FF P++CEPTLQIGY  D +   
Sbjct  168  KRRLEESNQANQQQLWDPNT----YGRQQP-QPQGDGFFQPIDCEPTLQIGYHPDKMAIA  222

Query  418  ------TVAGPSVNNYMPGWL  374
                    AGPSV+NY+PGWL
Sbjct  223  AAAAAAAAAGPSVSNYVPGWL  243



>gb|AHW52536.1| SEPALLATA-like MADS-box protein 1 [Phalaenopsis equestris]
Length=244

 Score =   256 bits (654),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 153/196 (78%), Gaps = 9/196 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQK NYGAPE NI +RE     SSQQEYLKLK+R EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKNNYGAPETNIISRETQ---SSQQEYLKLKSRVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLNSKELEQLERQLDNSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTL  167

Query  583  KQRLMEGNQLNLH--WNPN-AQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTD--PI  419
            K+RL E NQ N    W+P+ A  MGY ++      G+ F+HPLECEPTL IGY +D    
Sbjct  168  KRRLEESNQANPQQIWDPSTAHAMGYDQRQPVQPHGEAFYHPLECEPTLHIGYHSDLSIA  227

Query  418  TVAGPSVNNYM-PGWL  374
             +A P+VNNYM PGWL
Sbjct  228  PMAAPNVNNYMPPGWL  243



>gb|AAP20094.1| MADS4 [Vitis vinifera]
Length=153

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 140/155 (90%), Gaps = 5/155 (3%)
 Frame = -3

Query  847  STREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIR  668
            STREAL E+SSQQEYLKLKARYEALQRSQRNLLGEDLGPL++KELESLERQLD+SLKQIR
Sbjct  1    STREAL-ELSSQQEYLKLKARYEALQRSQRNLLGEDLGPLSTKELESLERQLDVSLKQIR  59

Query  667  STRTQMMLDQLTDLQRKEHALNEANKSLKQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHS  491
            STRTQ MLDQLTDLQRKEH LNEANK+LKQRL+EG Q+N L WNPNAQD+GYGRQ A   
Sbjct  60   STRTQYMLDQLTDLQRKEHMLNEANKTLKQRLLEGTQVNQLQWNPNAQDVGYGRQQA-QP  118

Query  490  QGDVFFHPLECEPTLQIGYPTDPITV--AGPSVNN  392
            QGD FFHPLECEPTLQIGY  DPITV  AGPSVNN
Sbjct  119  QGDGFFHPLECEPTLQIGYQPDPITVAAAGPSVNN  153



>gb|AAX53102.1| AGL9-like protein [Eupomatia bennettii]
Length=222

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 155/199 (78%), Gaps = 13/199 (7%)
 Frame = -3

Query  943  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSS M KTLERYQKCNYGAPE  ++TRE     SS QEYLKLKAR EALQR
Sbjct  27   RGKLYEFCSSSSSMFKTLERYQKCNYGAPETVVTTREIQ---SSHQEYLKLKARVEALQR  83

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            SQRNLLGEDLGPL+ KEL++LERQLDMSLKQIRSTRTQ MLDQLTDLQR+E  L+EANK+
Sbjct  84   SQRNLLGEDLGPLSGKELDTLERQLDMSLKQIRSTRTQYMLDQLTDLQRREQMLSEANKT  143

Query  586  LKQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIG---YPTDP  422
            LK+RL EG + N +  W+ N   MG+ RQ     Q D FFHPL+CEPTLQIG   Y TD 
Sbjct  144  LKRRLEEGMEANPNHAWDHNPHAMGFVRQQG-PPQDDGFFHPLDCEPTLQIGLCRYQTDQ  202

Query  421  I---TVAGPSVNNYMPGWL  374
            +   T  GPS NNYMPGWL
Sbjct  203  MQMTTAPGPSANNYMPGWL  221



>sp|Q38694.1|AGL9_ARADE RecName: Full=Agamous-like MADS-box protein AGL9 homolog; AltName: 
Full=OM1 [x Aranda deborah]
 emb|CAA48859.1| MADS-box protein [x Aranda deborah]
Length=250

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 151/196 (77%), Gaps = 10/196 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSS+SMLKTLE+YQKCN+G+PE  I +RE     SSQQEYLKLK R EALQRS
Sbjct  51   RGKLYEFCSSTSMLKTLEKYQKCNFGSPESTIISRETQ---SSQQEYLKLKNRVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL SKELE LERQLD SL+QIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLGSKELEQLERQLDSSLRQIRSTRTQFMLDQLADLQRREQMLCEANKTL  167

Query  583  KQRLMEGNQLNLH--WNP-NAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPI--  419
            K+R  E +Q N    W+P N   +GYGRQ A H  G+ F+HPLECEPTLQIGY +D    
Sbjct  168  KRRFEESSQANQQQVWDPSNTHAVGYGRQPAQH-HGEAFYHPLECEPTLQIGYHSDITMA  226

Query  418  TVAGPSVNNYM-PGWL  374
            T    +VNNYM PGWL
Sbjct  227  TATASTVNNYMPPGWL  242



>gb|AHM92084.1| MADS-box protein 8 [Erycina pusilla]
Length=243

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 155/197 (79%), Gaps = 12/197 (6%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS++SMLKTLERYQKCNYGAPE N+ +RE     SSQQEYLKLK R E LQRS
Sbjct  51   RGKLYEFCSTNSMLKTLERYQKCNYGAPETNVISRETQ---SSQQEYLKLKGRVENLQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLNSKELEQLERQLDNSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTL  167

Query  583  KQRLMEGNQLN--LHWNPN-AQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV  413
            K+RL E NQ N    W+P+ A  MGY RQ      GD F+HPLECEPTLQIGY +D +T+
Sbjct  168  KRRLEESNQANPPQMWDPSTAHAMGYDRQPP-QPHGDAFYHPLECEPTLQIGYQSD-LTI  225

Query  412  ---AGPSVNNYM-PGWL  374
               A P+V+NYM PGWL
Sbjct  226  APMAAPNVHNYMPPGWL  242



>ref|XP_009113782.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Brassica rapa]
Length=253

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 151/197 (77%), Gaps = 6/197 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGK YEFCSSSSML+TL+RYQKCNYGAPEPN+ +REAL  E++SQQEYLKLK RY+ALQR
Sbjct  51   RGKQYEFCSSSSMLRTLDRYQKCNYGAPEPNVPSREALAVELNSQQEYLKLKERYDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL++KELE LERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLAETNKT  170

Query  586  LKQRLMEGNQLNLHWNPNAQD---MGYGRQTAHHSQGDVFFHPLECEPTLQIGY--PTDP  422
            L+ RL +G Q+ L  NPN +D   + YGR   H      FF PLECEP LQ+GY    D 
Sbjct  171  LRLRLADGYQMPLQLNPNPEDHHHVDYGRHQQHEHSHQAFFQPLECEPILQMGYQGQQDH  230

Query  421  ITVAGPSVNNYMPGWLP  371
               AGPSVNNYM GWLP
Sbjct  231  GMGAGPSVNNYMLGWLP  247



>gb|AAQ83834.1| MADS box protein [Asparagus officinalis]
 gb|ABC70709.1| MADS-box transcription factor [Asparagus officinalis]
Length=239

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 152/192 (79%), Gaps = 6/192 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKC+YGAP+ ++  RE+    SS QEYL+LKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCSYGAPDTSVQIRESQMLQSSHQEYLRLKARVEALQRS  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EAN+SL
Sbjct  111  QRNLLGEDLGPLSSKELEQLERQLDSSLKQIRSTRTQYMLDQLADLQRREQMLCEANRSL  170

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            ++RL E +Q N    W  +A  MGY RQ  +   GD FFHPLEC+PTLQIG+   P  + 
Sbjct  171  RKRLEESSQANQQQVWE-DANAMGYNRQ-PNQPHGDQFFHPLECQPTLQIGF--QPDQMP  226

Query  409  GPSVNNYMPGWL  374
            GPSV+NYMPGWL
Sbjct  227  GPSVSNYMPGWL  238



>gb|ADD25199.1| SEP3 [Nuphar advena]
Length=215

 Score =   254 bits (650),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 151/198 (76%), Gaps = 11/198 (6%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS+S+M K LERYQKCNYG  E  ++T+E     SS QEYLKLKAR E LQRS
Sbjct  20   RGKLYEFCSTSNMYKALERYQKCNYGTLETTVTTKETQ---SSHQEYLKLKARLENLQRS  76

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDL PL+ KEL+ LERQLD SL+QIRSTRTQ MLDQL DLQRKE  L EANKSL
Sbjct  77   QRNLLGEDLXPLSGKELDQLERQLDASLRQIRSTRTQYMLDQLGDLQRKEQMLIEANKSL  136

Query  583  KQRLMEGNQLNLH---WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPT---DP  422
            ++RL E N  N H   W+PNA ++GY RQ A   QG+ FFHPL+CE TLQIGY +   D 
Sbjct  137  RRRLEEENVANAHQAVWDPNAHNVGYARQPAQAPQGEGFFHPLDCELTLQIGYQSGCPDQ  196

Query  421  ITV--AGPSVNNYMPGWL  374
            IT+  AGPSV NYMPGWL
Sbjct  197  ITISAAGPSVTNYMPGWL  214



>sp|O04067.1|AGL9_SINAL RecName: Full=Agamous-like MADS-box protein AGL9 homolog; AltName: 
Full=MADS D [Sinapis alba]
 emb|CAA69916.1| MADS D [Sinapis alba]
Length=254

 Score =   255 bits (651),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 155/202 (77%), Gaps = 15/202 (7%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSM++TLERYQKCNYG PEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSMIRTLERYQKCNYGPPEPNVPSREALAVELSSQQEYLKLKERYDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL++KELE LERQLD SLKQIR+ RTQ MLDQL DLQ KE  LNE NK+
Sbjct  111  TQRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLNETNKT  170

Query  586  LKQRLMEGNQLNLHWNPNAQD--MGYGR------QTAHHSQGDVFFHPLECEPTLQIGY-  434
            L+ RL +G Q+ L  NPN +D  + YGR      Q +HH+    FF PLECEP LQ+GY 
Sbjct  171  LRLRLADGYQMPLQLNPNQEDHHVDYGRHDQQQQQNSHHA----FFQPLECEPILQMGYQ  226

Query  433  -PTDPITVAGPSVNNYMPGWLP  371
               D    AGPS NNYM GWLP
Sbjct  227  GQQDHGMEAGPSENNYMLGWLP  248



>gb|AGT20513.1| SEP3 [Brassica oleracea var. viridis]
Length=250

 Score =   254 bits (650),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 151/194 (78%), Gaps = 3/194 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGK YEFCSSSSML+TL+RYQKCNYGAPEPN+ +REAL E++SQQEYLKLK RY+ALQR+
Sbjct  51   RGKQYEFCSSSSMLRTLDRYQKCNYGAPEPNVPSREALAELNSQQEYLKLKERYDALQRT  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL++KELESLERQLD SLK IR+ RTQ MLDQL DLQ KE  L E NK+L
Sbjct  111  QRNLLGEDLGPLSTKELESLERQLDSSLKHIRALRTQFMLDQLNDLQSKERMLAETNKTL  170

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGR-QTAHHSQGDVFFHPLECEPTLQIGY--PTDPITV  413
            + RL +G Q+ L  NPN +D  YGR Q   HS    FF PLECEP LQ+G     D    
Sbjct  171  RLRLADGYQMPLQLNPNPEDHDYGRHQQHEHSHHQAFFQPLECEPILQMGCQGQQDHGMG  230

Query  412  AGPSVNNYMPGWLP  371
            AGPSVNNYM GWLP
Sbjct  231  AGPSVNNYMLGWLP  244



>ref|XP_004504399.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X3 [Cicer arietinum]
Length=228

 Score =   254 bits (648),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 151/194 (78%), Gaps = 19/194 (10%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SKELESLERQLD SL+QIRSTR              EH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDTSLQQIRSTR--------------EHMLSEANRSL  155

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDP--ITV  413
            +QR +E  QLN L  N   ++MGYGR  +  + GD  F  +ECEPTLQIGY  DP  +  
Sbjct  156  RQRQLERYQLNQLQMNHCVEEMGYGRHPS-QTHGDGLFQQMECEPTLQIGYQADPGSVVA  214

Query  412  AGPSVNNYMPGWLP  371
            AGPS++NYM GWLP
Sbjct  215  AGPSMSNYMAGWLP  228



>ref|XP_010682730.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=226

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 149/193 (77%), Gaps = 19/193 (10%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKL+EFCSS SMLKTLERYQK NYGAP+  +STREAL+E+SSQQEYLKLKAR+EALQR+
Sbjct  51   RGKLFEFCSSPSMLKTLERYQKSNYGAPDNTVSTREALKELSSQQEYLKLKARHEALQRT  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
             RNL+GEDLGPL+SKELESLERQLDMSLKQIRSTRTQ M+DQLTDLQRK           
Sbjct  111  HRNLMGEDLGPLSSKELESLERQLDMSLKQIRSTRTQYMVDQLTDLQRK-----------  159

Query  583  KQRLMEGNQL-NLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPI-TVA  410
               L+E NQ  +L W  N  D+GY RQ A     D FFHPL+CEPTLQ+GY  D +   A
Sbjct  160  ---LIEANQASSLQW--NVHDIGYDRQPA-QPHDDSFFHPLDCEPTLQMGYQNDAVNAAA  213

Query  409  GPSVNNYMPGWLP  371
            G SVNN+MP WLP
Sbjct  214  GGSVNNFMPNWLP  226



>gb|AHJ80843.1| SEPALLATA3 [Cymbidium goeringii]
Length=243

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 156/197 (79%), Gaps = 12/197 (6%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS++SM+KT+E+YQK NYGAPE N+ +RE     SSQQEYLKLK+R EALQRS
Sbjct  51   RGKLYEFCSNNSMMKTIEKYQKSNYGAPETNVISRETQ---SSQQEYLKLKSRVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDSSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTL  167

Query  583  KQRLMEGNQLNLH--WNPN-AQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV  413
            K+RL E NQ N    W+P+ A  MGY RQ A    GD F+HPLECEPTLQIGY +D +T+
Sbjct  168  KRRLEESNQANPQQIWDPSTAHAMGYDRQPA-QPHGDAFYHPLECEPTLQIGYQSD-LTI  225

Query  412  ---AGPSVNNYM-PGWL  374
               A  +VNNYM PGWL
Sbjct  226  APMAAANVNNYMPPGWL  242



>ref|XP_010913018.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Elaeis guineensis]
Length=234

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 149/195 (76%), Gaps = 17/195 (9%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     +SQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIVSRETQ---TSQQEYLKLKARVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLG+DLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANKSL
Sbjct  108  QRNLLGDDLGPLSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            KQRL E NQ      W+PNA  +GYGRQ     QGD F+         QI YP + IT+A
Sbjct  168  KQRLEESNQATQQQVWDPNAPAVGYGRQPP-QPQGDGFYQ--------QIEYPPEQITIA  218

Query  409  ---GPSVNNYMPGWL  374
               GPSV+NYMPGWL
Sbjct  219  AAPGPSVSNYMPGWL  233



>ref|XP_010478049.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X2 
[Camelina sativa]
Length=254

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 151/198 (76%), Gaps = 7/198 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKT  170

Query  586  LKQRLMEGNQLNLHWNPNAQDM--GYGR--QTAHHSQGDVFFHPLECEPTLQIG-YPTDP  422
            L+ RL +G Q+ L  NPN +D    YGR            FF PLECEP LQIG Y    
Sbjct  171  LRLRLADGYQMPLQLNPNPEDHIDPYGRHHHQQQQQHSQAFFQPLECEPILQIGSYQAQQ  230

Query  421  ITV-AGPSVNNYMPGWLP  371
              + AGPSVNNYM GWLP
Sbjct  231  DGMGAGPSVNNYMLGWLP  248



>gb|AFH66785.1| SEP-like MADS-box protein [Cymbidium ensifolium]
Length=243

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 156/197 (79%), Gaps = 12/197 (6%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS++SM+KT+E+YQK NYGAPE N+ +RE     SSQQEYLKLK+R EALQRS
Sbjct  51   RGKLYEFCSNNSMMKTIEKYQKSNYGAPETNVISRETQ---SSQQEYLKLKSRVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDSSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTL  167

Query  583  KQRLMEGNQLNLH--WNPN-AQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV  413
            K+RL E NQ N    W+P+ A  MGY RQ A    GD F+HPLECEPTL IGY +D +T+
Sbjct  168  KRRLEESNQANPQQMWDPSTAHAMGYDRQPA-QPHGDAFYHPLECEPTLLIGYQSD-LTI  225

Query  412  ---AGPSVNNYM-PGWL  374
               A P+VNNYM PGWL
Sbjct  226  APMAAPNVNNYMPPGWL  242



>ref|XP_010478050.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X3 
[Camelina sativa]
Length=254

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 151/198 (76%), Gaps = 7/198 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSS ML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSSMLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKT  170

Query  586  LKQRLMEGNQLNLHWNPNAQDM--GYGR--QTAHHSQGDVFFHPLECEPTLQIG-YPTDP  422
            L+ RL +G Q+ L  NPN +D    YGR            FF PLECEP LQIG Y    
Sbjct  171  LRLRLADGYQMPLQLNPNPEDHIDPYGRHHHQQQQQHSQAFFQPLECEPILQIGSYQAQQ  230

Query  421  ITV-AGPSVNNYMPGWLP  371
              + AGPSVNNYM GWLP
Sbjct  231  DGMGAGPSVNNYMLGWLP  248



>ref|XP_008801853.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X4 [Phoenix dactylifera]
Length=234

 Score =   253 bits (645),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 147/192 (77%), Gaps = 11/192 (6%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIVSRETQ---SSQQEYLKLKARVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANKSL
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            K+RL E NQ      W+PNA  +GYGRQ     QGD F+ P+E  P  QI     P    
Sbjct  168  KRRLEESNQATQQQVWDPNAHAVGYGRQPP-QPQGDGFYQPIEYHPE-QITIAAGP----  221

Query  409  GPSVNNYMPGWL  374
            GPSV+NYMPGWL
Sbjct  222  GPSVSNYMPGWL  233



>ref|XP_009419371.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Musa acuminata 
subsp. malaccensis]
Length=245

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 153/202 (76%), Gaps = 20/202 (10%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKL+EFCSSSSMLKTLERYQKCNYGAPE N+ +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLFEFCSSSSMLKTLERYQKCNYGAPETNVISRETQ---SSQQEYLKLKARVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLN KELE LERQLD SL+QIRSTRTQ MLDQLTDLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLNIKELEQLERQLDASLRQIRSTRTQYMLDQLTDLQRREQMLCEANKAL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPI---  419
            K+RL E NQ N    W+PN     YGRQ     QGD FF P++CEPTLQIGY  D +   
Sbjct  168  KRRLEESNQANQQQLWDPNT----YGRQQP-QPQGDGFFQPIDCEPTLQIGYHPDQMAIA  222

Query  418  ------TVAGPSVNNYMP-GWL  374
                    AGPSV+NY+P GWL
Sbjct  223  AAAAAAAAAGPSVSNYVPGGWL  244



>ref|XP_010531071.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X1 
[Tarenaya hassleriana]
Length=250

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 155/196 (79%), Gaps = 5/196 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSML+TLERYQKC+YGAPEPN+ +REAL+ E+SSQQEYLKLK R++AL R
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCSYGAPEPNVPSREALEVELSSQQEYLKLKQRHDALLR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            SQRNLLGEDL PLN+KELE+LERQLD SLKQIR+ RTQ MLDQL DL  KE  L E NK+
Sbjct  111  SQRNLLGEDLAPLNTKELEALERQLDSSLKQIRALRTQYMLDQLNDLHHKEQMLTETNKT  170

Query  586  LKQRLMEG-NQL-NLHWNPNAQDMGYGRQTAHH-SQGDVFFHPLECEPTLQIGYPTDPIT  416
            L+ RL EG +Q+  L  NP+ +++GYGRQ     +Q D FFHPL  EP LQIGY      
Sbjct  171  LRIRLSEGYDQMPPLQLNPHPEELGYGRQPQQQLAQADAFFHPLASEPILQIGYQQQQEA  230

Query  415  VA-GPSVNNYMPGWLP  371
            +A GPSVNNYM GWLP
Sbjct  231  MAGGPSVNNYMLGWLP  246



>gb|AIU94763.1| class E MADS-domain transcription factor, partial [Vanilla planifolia]
Length=220

 Score =   252 bits (643),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 157/198 (79%), Gaps = 14/198 (7%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE ++ +RE     SSQQEYLKLKAR EALQRS
Sbjct  28   RGKLYEFCSSSSMLKTLERYQKCNYGAPETSMISRETQ---SSQQEYLKLKARVEALQRS  84

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  85   QRNLLGEDLGPLSSKELEQLERQLDASLKQIRSTRTQFMLDQLADLQRREQMLCEANKAL  144

Query  583  KQRLMEGNQLNLH--WNP-NAQDMGYGRQTA-HHSQGDVFFHPLECEPTLQIGYPTDPIT  416
            K+RL E +Q+N    W+P +A  +GY RQ A  HS  D  +HPLECEPTLQ+GY  D IT
Sbjct  145  KRRLEESSQVNPQQVWDPSSAHAVGYSRQPALPHS--DAXYHPLECEPTLQVGYHPD-IT  201

Query  415  ---VAGPSVNNYMP-GWL  374
               VA P+ +NY+P GWL
Sbjct  202  MAPVAAPNASNYLPSGWL  219



>ref|XP_010460480.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X1 
[Camelina sativa]
Length=256

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 152/200 (76%), Gaps = 9/200 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQ  770
            RGKLYEFCSSSS ML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQ
Sbjct  51   RGKLYEFCSSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQ  110

Query  769  RSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANK  590
            R+QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK
Sbjct  111  RTQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNK  170

Query  589  SLKQRLMEGNQLNLHWNPNAQDMG--YGR----QTAHHSQGDVFFHPLECEPTLQIGYPT  428
            +L+ RL +G Q+ L  NPN +D    YGR    Q         FF PLECEP LQIGY  
Sbjct  171  TLRLRLADGYQMPLQLNPNPEDHVDLYGRHHQQQQQQQQHSQAFFQPLECEPILQIGYQA  230

Query  427  DPITV-AGPSVNNYMPGWLP  371
                + AGPSVNNYM GWLP
Sbjct  231  QQDGMGAGPSVNNYMLGWLP  250



>gb|ABD62860.1| SEP3.2 [Persea borbonia]
Length=225

 Score =   252 bits (643),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 149/187 (80%), Gaps = 9/187 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE  +STRE     SS QEYLKLKAR EALQRS
Sbjct  43   RGKLYEFCSSSSMLKTLERYQKCNYGAPETTVSTRETQ---SSHQEYLKLKARVEALQRS  99

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL SKEL++LE+QLD SLKQIRSTRTQ MLDQL DLQR+E  L+EANK+L
Sbjct  100  QRNLLGEDLGPLTSKELDTLEKQLDASLKQIRSTRTQYMLDQLADLQRREQMLSEANKNL  159

Query  583  KQRLMEGNQLNLH-WNPNAQDMGYGRQTAHHSQGDVFFHPLE-CEPTLQIGY-PTDPITV  413
            K+RL EG Q N   W+PN   + YGRQ A   Q D FFHPL+ CEPTL IGY P D IT+
Sbjct  160  KRRLEEGMQANPQVWDPNGHPVTYGRQQA-PPQSDGFFHPLDTCEPTLHIGYQPADQITI  218

Query  412  A--GPSV  398
            A  GPSV
Sbjct  219  AAPGPSV  225



>ref|XP_006415782.1| hypothetical protein EUTSA_v10008591mg [Eutrema salsugineum]
 gb|ESQ34135.1| hypothetical protein EUTSA_v10008591mg [Eutrema salsugineum]
Length=185

 Score =   250 bits (638),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 143/181 (79%), Gaps = 4/181 (2%)
 Frame = -3

Query  907  MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGPL  728
            ML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR+QRNLLGEDLGPL
Sbjct  1    MLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQRTQRNLLGEDLGPL  60

Query  727  NSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSLKQRLMEGNQLNL  548
            ++KELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+L+ RL +G Q+ L
Sbjct  61   STKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRLADGYQMPL  120

Query  547  HWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGY--PTDPITVAGPSVNNYMPGWL  374
              NPN +D+ YGR    HSQ   FF PLECEP LQIGY    D    AGPSVNNYM GWL
Sbjct  121  QLNPNQEDVDYGRHQQQHSQ--AFFQPLECEPILQIGYQGQQDHGMGAGPSVNNYMLGWL  178

Query  373  P  371
            P
Sbjct  179  P  179



>ref|XP_009102995.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Brassica rapa]
Length=252

 Score =   252 bits (644),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 150/196 (77%), Gaps = 5/196 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSM++TLERYQKCNYG PEPN+ +REAL  E+SSQQEYLKLK RYEALQR
Sbjct  51   RGKLYEFCSSSSMIRTLERYQKCNYGPPEPNVPSREALAVELSSQQEYLKLKERYEALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL++KELE LERQLD SLKQIR+ RTQ MLDQL DLQ KE  LNE NK+
Sbjct  111  TQRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLNETNKT  170

Query  586  LKQRLMEGNQLNLHWNPNAQD--MGYGRQTAHHSQGDVFFHPLECEPTLQIGYP--TDPI  419
            L+ RL +G Q+ L  NP+ +D  + YGR          FF PLECEP LQ+GY    +  
Sbjct  171  LRLRLADGYQMPLQLNPSQEDHHVDYGRHDQQQHSHHAFFQPLECEPILQMGYQGHQNHG  230

Query  418  TVAGPSVNNYMPGWLP  371
              AGPS +NYM GWLP
Sbjct  231  MEAGPSASNYMLGWLP  246



>gb|ABF67487.1| MADS-domain transcription factor [Impatiens hawkeri]
Length=244

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 152/198 (77%), Gaps = 13/198 (7%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSS SMLKTLERYQKCNYGAPE NIS+R AL E+S QQEYLKLK RYE LQR+
Sbjct  51   RGKLYEFCSSPSMLKTLERYQKCNYGAPEANISSRGAL-ELSGQQEYLKLKQRYETLQRT  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KEL+++ERQLD SLK IRSTRTQ M+DQL DLQRKE  LNEAN++L
Sbjct  110  QRNLLGEDLGPLDGKELDTIERQLDTSLKHIRSTRTQHMVDQLEDLQRKEQILNEANRAL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQ--IGYPT--DPIT  416
            KQRL+E    + +W  N Q + Y    A     D  FHPLECEPTLQ  +GY T  DP +
Sbjct  170  KQRLLES---SFNWMQNGQHVDYS-GPAVQPNXDELFHPLECEPTLQMAMGYQTHHDPTS  225

Query  415  V----AGPSVNNYMPGWL  374
            V    AGPS+NNY PGWL
Sbjct  226  VEAAGAGPSMNNYFPGWL  243



>ref|XP_004504400.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X4 [Cicer arietinum]
Length=227

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 151/194 (78%), Gaps = 20/194 (10%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SKELESLERQLD SL+QIRSTR              EH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDTSLQQIRSTR--------------EHMLSEANRSL  155

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDP--ITV  413
            +QRL E  QLN L  N   ++MGYGR  +  + GD  F  +ECEPTLQIGY  DP  +  
Sbjct  156  RQRL-ERYQLNQLQMNHCVEEMGYGRHPS-QTHGDGLFQQMECEPTLQIGYQADPGSVVA  213

Query  412  AGPSVNNYMPGWLP  371
            AGPS++NYM GWLP
Sbjct  214  AGPSMSNYMAGWLP  227



>gb|ACB69510.1| SEPALLATA3-like MADS-box protein [Crocus sativus]
Length=239

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 147/192 (77%), Gaps = 6/192 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSS+LKTLERYQKC+YGAP+ N+  RE     SS QEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSILKTLERYQKCSYGAPDNNVQIRETQLLQSSHQEYLKLKARVEALQRS  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQRKEH L EAN+SL
Sbjct  111  QRNLLGEDLGPLSSKELEQLERQLDSSLKQIRSTRTQCMLDQLGDLQRKEHMLCEANRSL  170

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            ++ L E NQ N    W  NA  + Y RQ   + Q + F+ PL+C+PTL IG+  D +  A
Sbjct  171  RKTLEESNQANHQQVWESNANAIAYDRQA--NQQREEFYQPLDCQPTLHIGFQGDQM--A  226

Query  409  GPSVNNYMPGWL  374
            GPSV  YMPGWL
Sbjct  227  GPSVTTYMPGWL  238



>gb|ABS17562.1| SEPALLATA 3-like protein [Platanus x acerifolia]
Length=239

 Score =   250 bits (639),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 152/193 (79%), Gaps = 8/193 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGK  EFCS+SSM KTLERYQKC+YGAPE N STRE  QE +S QEYL+LKAR+EALQRS
Sbjct  51   RGKQSEFCSNSSMYKTLERYQKCSYGAPEKNASTRET-QEHNSYQEYLRLKARFEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KEL+SLERQL MSLK IRSTRTQ MLDQLTDLQ++E  L EAN +L
Sbjct  110  QRNLLGEDLGPLSGKELDSLERQLGMSLKHIRSTRTQYMLDQLTDLQKREQTLTEANMTL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAH-HSQGDVFFHPLECEPTLQIGYPTDPITVA-  410
            K+RL E +Q    WNP+A  +G G+Q +  HS G  FFHPL+CEPTLQIGY  + I V  
Sbjct  170  KRRLEEESQAT--WNPSAHGVGCGQQPSQPHSNG--FFHPLQCEPTLQIGYQPNQIAVTA  225

Query  409  -GPSVNNYMPGWL  374
             GP VNNYMP WL
Sbjct  226  PGPCVNNYMPVWL  238



>emb|CDY03905.1| BnaC07g11300D [Brassica napus]
Length=270

 Score =   251 bits (640),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 149/196 (76%), Gaps = 5/196 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSM++TLERYQKCNYG PEPN+ +REAL  E+SSQQEYLKLK RYEALQR
Sbjct  69   RGKLYEFCSSSSMIRTLERYQKCNYGPPEPNVPSREALAVELSSQQEYLKLKERYEALQR  128

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL++KELE LERQLD SLKQIR+ RTQ MLDQL DLQ KE  LNE NK+
Sbjct  129  TQRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLNETNKT  188

Query  586  LKQRLMEGNQLNLHWNPNAQD--MGYGRQTAHHSQGDVFFHPLECEPTLQIGYP--TDPI  419
            L+ RL +G Q+ L  NP+ +D  + YGR          FF PLECEP LQ+GY    +  
Sbjct  189  LRLRLADGYQMPLQLNPSQEDRHVDYGRHDQQQHSHHAFFQPLECEPILQMGYQGHQNHG  248

Query  418  TVAGPSVNNYMPGWLP  371
              AGPS  NYM GWLP
Sbjct  249  MEAGPSAINYMLGWLP  264



>emb|CDX84935.1| BnaC05g21200D [Brassica napus]
Length=251

 Score =   250 bits (638),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 150/195 (77%), Gaps = 4/195 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGK YEFCSSSSML+TL+RYQKCNYGAPEPN+ +REAL  E+ SQQEYLKLK RY+ALQR
Sbjct  51   RGKQYEFCSSSSMLRTLDRYQKCNYGAPEPNVPSREALAVELDSQQEYLKLKERYDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL++KELESLERQLD SLK IR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSTKELESLERQLDSSLKHIRALRTQFMLDQLNDLQSKERMLAETNKT  170

Query  586  LKQRLMEGNQLNLHWNPNAQDMGYGR-QTAHHSQGDVFFHPLECEPTLQIGY--PTDPIT  416
            L+ RL +G Q+ L  NPN +D  YGR Q   HS    FF PLECEP LQ+G     D   
Sbjct  171  LRLRLADGYQMPLQLNPNPEDHDYGRHQQHEHSHHQAFFQPLECEPILQMGCQGQQDHGM  230

Query  415  VAGPSVNNYMPGWLP  371
             AGPSVNNYM GWLP
Sbjct  231  GAGPSVNNYMLGWLP  245



>gb|ACB69509.1| SEPALLATA3-like MADS-box protein [Crocus sativus]
Length=238

 Score =   249 bits (636),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 148/191 (77%), Gaps = 5/191 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSS++KTLERYQKC+YGAP+  +  RE     SS QEYLKLKA  EALQRS
Sbjct  51   RGKLYEFCSSSSIMKTLERYQKCSYGAPDNIVQIRETQLLQSSHQEYLKLKAHVEALQRS  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQRKEH L EAN+SL
Sbjct  111  QRNLLGEDLGPLSSKELEQLERQLDSSLKQIRSTRTQCMLDQLGDLQRKEHMLCEANRSL  170

Query  583  KQRLMEGNQLNLH-WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVAG  407
            ++RL E +Q +   W  NA  + Y RQ   + Q + F+ PL+C+PTLQIG+  D +  AG
Sbjct  171  RKRLEESSQAHQQVWESNANAIAYARQA--NQQEEEFYQPLDCQPTLQIGFQADQM--AG  226

Query  406  PSVNNYMPGWL  374
            PSV NYMPGWL
Sbjct  227  PSVTNYMPGWL  237



>ref|XP_008801855.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X6 [Phoenix dactylifera]
Length=192

 Score =   247 bits (631),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 144/183 (79%), Gaps = 9/183 (5%)
 Frame = -3

Query  907  MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGPL  728
            MLKTLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR EALQRSQRNLLGEDLGPL
Sbjct  13   MLKTLERYQKCNYGAPETNIVSRETQ---SSQQEYLKLKARVEALQRSQRNLLGEDLGPL  69

Query  727  NSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSLKQRLMEGNQLNL  548
            +SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANKSLK+RL E NQ   
Sbjct  70   SSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSLKRRLEESNQATQ  129

Query  547  H--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA---GPSVNNYMP  383
               W+PNA  +GYGRQ     QGD F+ P+ECEPTL IGY  + IT+A   GPSV+NYMP
Sbjct  130  QQVWDPNAHAVGYGRQPP-QPQGDGFYQPIECEPTLHIGYHPEQITIAAGPGPSVSNYMP  188

Query  382  GWL  374
            GWL
Sbjct  189  GWL  191



>emb|CDY15724.1| BnaA07g08950D [Brassica napus]
Length=252

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 149/196 (76%), Gaps = 5/196 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSM++TLERYQKCNYG PEPN+ +REAL  E SSQQEYLKLK RYEALQR
Sbjct  51   RGKLYEFCSSSSMIRTLERYQKCNYGPPEPNVPSREALAVEFSSQQEYLKLKERYEALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL++KELE LERQLD SLKQIR+ RTQ MLDQL DLQ KE  LNE NK+
Sbjct  111  TQRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLNETNKT  170

Query  586  LKQRLMEGNQLNLHWNPNAQD--MGYGRQTAHHSQGDVFFHPLECEPTLQIGYP--TDPI  419
            L+ RL +G Q+ L  NP+ +D  + YGR          FF PLECEP LQ+GY    +  
Sbjct  171  LRLRLADGYQMPLQLNPSQEDYHVDYGRHDQQQHSHHPFFQPLECEPILQMGYQGHQNHG  230

Query  418  TVAGPSVNNYMPGWLP  371
              +GPS +NYM GWLP
Sbjct  231  MESGPSASNYMLGWLP  246



>gb|AIU94761.1| class E MADS-domain transcription factor, partial [Gongora galeata]
Length=228

 Score =   248 bits (633),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 155/197 (79%), Gaps = 12/197 (6%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSS+SMLKTLE+YQK N+GAPE    +RE     +SQQEYLKLK+R E+LQRS
Sbjct  29   RGKLYEFCSSTSMLKTLEKYQKSNFGAPEQPTISRETQ---TSQQEYLKLKSRVESLQRS  85

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  86   QRNLLGEDLGPLNSKELEQLERQLDASLKQIRSTRTQFMLDQLADLQRREQMLCEANKAL  145

Query  583  KQRLMEGNQLNLH--WN-PNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV  413
            K+R  E +Q N H  W+  N   +GYGRQ A H + D F+HPL+CEPTLQIG+ +D IT+
Sbjct  146  KRRFEESSQTNPHLVWDTSNTNGVGYGRQPAQHHE-DAFYHPLDCEPTLQIGFHSD-ITM  203

Query  412  ---AGPSVNNYMP-GWL  374
               A P+V+NYMP GWL
Sbjct  204  APAAAPNVSNYMPSGWL  220



>ref|XP_010478048.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X1 
[Camelina sativa]
Length=255

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 151/199 (76%), Gaps = 8/199 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQ  770
            RGKLYEFCSSSS ML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQ
Sbjct  51   RGKLYEFCSSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQ  110

Query  769  RSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANK  590
            R+QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK
Sbjct  111  RTQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNK  170

Query  589  SLKQRLMEGNQLNLHWNPNAQDM--GYGR--QTAHHSQGDVFFHPLECEPTLQIG-YPTD  425
            +L+ RL +G Q+ L  NPN +D    YGR            FF PLECEP LQIG Y   
Sbjct  171  TLRLRLADGYQMPLQLNPNPEDHIDPYGRHHHQQQQQHSQAFFQPLECEPILQIGSYQAQ  230

Query  424  PITV-AGPSVNNYMPGWLP  371
               + AGPSVNNYM GWLP
Sbjct  231  QDGMGAGPSVNNYMLGWLP  249



>gb|ACA24482.1| agamous-like 9 protein 2 [Glycine max]
Length=242

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 142/171 (83%), Gaps = 2/171 (1%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGK YEFCS SSMLKTLERYQKCNYGAPE N++T+EAL+ E+SSQQEYL+LKARYEALQR
Sbjct  51   RGKQYEFCSGSSMLKTLERYQKCNYGAPEDNVATKEALELELSSQQEYLRLKARYEALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            SQRNL+GEDLGPL+SKELESLERQLD SLKQIRS RTQ MLDQL+DLQRKEH L E+N+ 
Sbjct  111  SQRNLMGEDLGPLSSKELESLERQLDSSLKQIRSIRTQFMLDQLSDLQRKEHFLGESNRD  170

Query  586  LKQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGY  434
            L+QRL E     L  NP+A+DMGYGR      QG   F PLECEPTLQI Y
Sbjct  171  LRQRLEEFQINPLQLNPSAEDMGYGRHPG-QPQGHALFQPLECEPTLQIEY  220



>ref|XP_009102994.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Brassica rapa]
Length=253

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 149/197 (76%), Gaps = 6/197 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSM++TLERYQKCNYG PEPN+ +REAL  E+SSQQEYLKLK RYEALQR
Sbjct  51   RGKLYEFCSSSSMIRTLERYQKCNYGPPEPNVPSREALAVELSSQQEYLKLKERYEALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL++KELE LERQLD SLKQIR+ RTQ MLDQL DLQ KE  LNE NK+
Sbjct  111  TQRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLNETNKT  170

Query  586  LKQRLMEGNQLNLHWNPNAQD--MGYGRQTAHHSQGDVFFHPLECEPTLQIGY---PTDP  422
            L+ RL +G Q+ L  NP+ +D  + YGR          FF PLECEP LQ+G      + 
Sbjct  171  LRLRLADGYQMPLQLNPSQEDHHVDYGRHDQQQHSHHAFFQPLECEPILQMGRYQGHQNH  230

Query  421  ITVAGPSVNNYMPGWLP  371
               AGPS +NYM GWLP
Sbjct  231  GMEAGPSASNYMLGWLP  247



>dbj|BAG50409.1| MADS-box transcription factor [Cardamine sp. SIM-2007]
Length=219

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 151/194 (78%), Gaps = 5/194 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  22   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQR  81

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL++KELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L+E NK+
Sbjct  82   AQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLSETNKT  141

Query  586  LKQRLMEGNQLNLHWNPNAQDMG-YGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV-  413
            L+ RL +G  + L  NPN +++  Y R      Q      PLECEP LQIGY T    + 
Sbjct  142  LRLRLADGYLMPLQLNPNPEEVDHYARHQQQQQQAFF--QPLECEPILQIGYQTQQDGMG  199

Query  412  AGPSVNNYMPGWLP  371
            AGPSVNNYM GWLP
Sbjct  200  AGPSVNNYMLGWLP  213



>gb|AAX53104.1| AGL9-like protein [Magnolia grandiflora]
Length=206

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 144/182 (79%), Gaps = 7/182 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS SSMLKTLERYQKCNYGAPE  +STRE     S  QEYLKLKAR EALQRS
Sbjct  29   RGKLYEFCSGSSMLKTLERYQKCNYGAPELPVSTRETQ---SYHQEYLKLKARVEALQRS  85

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KELE+LERQLD+SL+QIRSTRTQ MLDQL DLQR+EH L+EANK+L
Sbjct  86   QRNLLGEDLGPLSGKELETLERQLDISLRQIRSTRTQCMLDQLGDLQRREHMLSEANKTL  145

Query  583  KQRLMEGNQLNLH--WNPNAQDM-GYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV  413
            ++RL EG Q N +  W PNA  +  Y RQ     QGD FFHPLECEPTL IGY  D IT+
Sbjct  146  RRRLEEGAQANHNQVWEPNAHAVDSYNRQQPQQ-QGDGFFHPLECEPTLHIGYQPDQITI  204

Query  412  AG  407
            A 
Sbjct  205  AA  206



>gb|ABD62861.1| SEP3.1 [Persea borbonia]
Length=220

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 149/185 (81%), Gaps = 10/185 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS++SMLKTLERYQKCNYGAPE  +S+RE LQ  SS QEY+KLKAR EALQRS
Sbjct  43   RGKLYEFCSTASMLKTLERYQKCNYGAPETTVSSRE-LQ--SSHQEYMKLKARVEALQRS  99

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL  KEL++LE+QLD+SLK IRSTRTQ MLDQL DLQR+EH L+EANKSL
Sbjct  100  QRNLLGEDLGPLTGKELDTLEKQLDVSLKHIRSTRTQYMLDQLGDLQRREHMLSEANKSL  159

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            ++RL EG Q N +  W+PN    GY RQ A   Q D FFHP+ECEPTLQIGY +  IT+A
Sbjct  160  RRRLEEGMQENPNHAWDPN----GYVRQQA-PPQSDGFFHPIECEPTLQIGYQSSQITIA  214

Query  409  GPSVN  395
             P  N
Sbjct  215  APGPN  219



>gb|ABC70710.1| MADS-box transcription factor [Asparagus officinalis]
Length=243

 Score =   247 bits (631),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 150/195 (77%), Gaps = 8/195 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSS SMLKTL+RYQKC+YGAP+ ++  RE     SS QEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSPSMLKTLDRYQKCSYGAPDTSVQIRENQMLQSSHQEYLKLKARVEALQRS  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LE+QLD SLKQIRSTRTQ MLDQL DLQRKE  L EAN+SL
Sbjct  111  QRNLLGEDLGPLSSKELEQLEKQLDSSLKQIRSTRTQYMLDQLGDLQRKEQMLCEANRSL  170

Query  583  KQR---LMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPI  419
            ++R   L E +Q N    W  NA  MGY RQ +   QG+ FFHPLEC+PTLQIG+   P 
Sbjct  171  RKRYAQLEETSQANQQQVWEANANAMGYSRQPS-QPQGEEFFHPLECQPTLQIGF--QPD  227

Query  418  TVAGPSVNNYMPGWL  374
             + GPS +++MPGWL
Sbjct  228  QMPGPSASSFMPGWL  242



>ref|NP_001242742.1| uncharacterized protein LOC100805078 [Glycine max]
 gb|ACU17977.1| unknown [Glycine max]
Length=226

 Score =   246 bits (629),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL+DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSL  169

Query  583  KQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIG  437
            +QR +EG Q+N L  NP  ++MGYGR  A  + G+  FH        ++G
Sbjct  170  RQRQLEGYQINPLQLNPGVEEMGYGRHPA-QTHGEALFHKWSVSQRYKLG  218



>sp|Q42464.1|AGL9_SOLLC RecName: Full=Agamous-like MADS-box protein AGL9 homolog; AltName: 
Full=TM5 [Solanum lycopersicum]
 emb|CAA43010.1| TDR5 [Solanum lycopersicum]
 emb|CAA43170.1| TDR5 [Solanum lycopersicum]
Length=224

 Score =   246 bits (628),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 129/133 (97%), Gaps = 1/133 (1%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL EISSQQEYLKLK RYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL-EISSQQEYLKLKGRYEALQRS  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ+MLDQLTD QRKEHALNEAN++L
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDYQRKEHALNEANRTL  169

Query  583  KQRLMEGNQLNLH  545
            KQRLMEG+QLNL 
Sbjct  170  KQRLMEGSQLNLQ  182



>gb|AGV31155.1| E-class MADS-box protein [Allium cepa]
Length=240

 Score =   246 bits (628),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 150/192 (78%), Gaps = 5/192 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEF S++S++KTLERYQK ++GAP+ ++  RE+    SS QEYLKLKAR EALQRS
Sbjct  51   RGKLYEFASNNSIMKTLERYQKSSFGAPDNSVQIRESQMLQSSHQEYLKLKARVEALQRS  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQLTDLQRKE  L EAN+SL
Sbjct  111  QRNLLGEDLGPLSSKELEQLERQLDSSLKQIRSTRTQYMLDQLTDLQRKEQMLCEANRSL  170

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            ++RL + NQ N    W  NA  MGY RQ  +  QG+ FFHPLEC+PTLQ+G+  D +  A
Sbjct  171  RKRLEDTNQANQQQVWEANANAMGYARQQ-NQPQGEDFFHPLECQPTLQMGFQQDQM--A  227

Query  409  GPSVNNYMPGWL  374
            GPS + +M GWL
Sbjct  228  GPSASTFMTGWL  239



>gb|AHM92085.1| MADS-box protein 9 [Erycina pusilla]
Length=250

 Score =   245 bits (625),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 155/197 (79%), Gaps = 12/197 (6%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSS+SMLKTL++YQK N+GAPEP   +RE     +SQQEYLKLK+R E+LQR 
Sbjct  51   RGKLYEFCSSTSMLKTLDKYQKSNFGAPEPTTISRETQ---TSQQEYLKLKSRVESLQRE  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL SKELE LERQLD SL+QIRSTRTQ MLDQL DLQR+E  L EANKSL
Sbjct  108  QRNLLGEDLGPLTSKELEHLERQLDASLRQIRSTRTQFMLDQLADLQRREQMLCEANKSL  167

Query  583  KQRLMEGNQLN--LHWNP-NAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV  413
            K++  E +Q N  L W+P N   +GYGRQ A H + D F+HPL+C+PTLQIGY +D +T+
Sbjct  168  KRKFEESSQTNPQLVWDPSNPNGVGYGRQPAQHHE-DAFYHPLDCQPTLQIGYHSD-MTM  225

Query  412  A---GPSVNNYMP-GWL  374
            A    P+V+NYMP GWL
Sbjct  226  APANTPNVSNYMPSGWL  242



>gb|ABC70707.1| MADS-box transcription factor [Asparagus virgatus]
Length=243

 Score =   244 bits (624),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 149/195 (76%), Gaps = 8/195 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSS SMLKTL+RYQKC+YGAP+ ++  RE     SS QEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSPSMLKTLDRYQKCSYGAPDTSVQIRENQMLQSSHQEYLKLKARVEALQRS  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LE+QLD SL+QIRSTRTQ MLDQL DLQR+E  L EAN+SL
Sbjct  111  QRNLLGEDLGPLSSKELEQLEKQLDSSLRQIRSTRTQYMLDQLGDLQREEQMLCEANRSL  170

Query  583  KQR---LMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPI  419
            ++R   L E +Q N    W  NA  MGY RQ +   QG+ FFHPLEC+PTLQIG+   P 
Sbjct  171  RKRYVQLEETSQTNQRQVWEANANAMGYNRQPS-QPQGEEFFHPLECQPTLQIGF--QPD  227

Query  418  TVAGPSVNNYMPGWL  374
             + GPS + YMPGWL
Sbjct  228  QMPGPSASTYMPGWL  242



>gb|AAX15916.1| AGL9, partial [Amborella trichopoda]
Length=194

 Score =   243 bits (619),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 149/195 (76%), Gaps = 14/195 (7%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGK YEFCSSSSMLKTLERYQKCNYG  E  +ST+E     SSQQEYL+LKA +EALQRS
Sbjct  4    RGKQYEFCSSSSMLKTLERYQKCNYGTQETTVSTKETQ---SSQQEYLRLKAHFEALQRS  60

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KELE LE+QLDMSLKQIRS +TQ M+DQL DLQRKE AL+E+N +L
Sbjct  61   QRNLLGEDLGPLSGKELEQLEQQLDMSLKQIRSIKTQYMIDQLADLQRKEQALSESNNAL  120

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPT---DPITV  413
            K++L         W+     M Y RQ A  +Q D FFHPLEC+PTLQIGYP+   +PITV
Sbjct  121  KRKLEAAG----GWDSTGHQMEYNRQPA-QAQADNFFHPLECDPTLQIGYPSGYPNPITV  175

Query  412  A--GPSVNNYMPGWL  374
            A  GPSV N+MP W+
Sbjct  176  AAPGPSVTNFMP-WM  189



>ref|XP_006848294.1| hypothetical protein AMTR_s00013p00103080 [Amborella trichopoda]
 gb|ERN09875.1| hypothetical protein AMTR_s00013p00103080 [Amborella trichopoda]
 gb|AIE44770.1| putative MADS-domain transcription factor AGL9 [Amborella trichopoda]
Length=241

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 149/195 (76%), Gaps = 14/195 (7%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGK YEFCSSSSMLKTLERYQKCNYG  E  +ST+E     SSQQEYL+LKA +EALQRS
Sbjct  51   RGKQYEFCSSSSMLKTLERYQKCNYGTQETTVSTKETQ---SSQQEYLRLKAHFEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+ KELE LE+QLDMSLKQIRS +TQ M+DQL DLQRKE AL+E+N +L
Sbjct  108  QRNLLGEDLGPLSGKELEQLEQQLDMSLKQIRSIKTQYMIDQLADLQRKEQALSESNNAL  167

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPT---DPITV  413
            K++L         W+     M Y RQ A  +Q D FFHPLEC+PTLQIGYP+   +PITV
Sbjct  168  KRKLEAAG----GWDSTGHQMEYNRQPA-QAQADNFFHPLECDPTLQIGYPSGYPNPITV  222

Query  412  A--GPSVNNYMPGWL  374
            A  GPSV N+MP W+
Sbjct  223  AAPGPSVTNFMP-WM  236



>gb|AEX92976.1| MADS box protein 1 [Agave tequilana]
Length=243

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 149/196 (76%), Gaps = 10/196 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSM+KTLERYQKC+YGAP+ ++  RE     SS QEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMMKTLERYQKCSYGAPDNSVQIRENQMLQSSHQEYLKLKARVEALQRS  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EAN+SL
Sbjct  111  QRNLLGEDLGPLSSKELEQLERQLDSSLKQIRSTRTQYMLDQLADLQRREQMLCEANRSL  170

Query  583  KQRLM------EGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDP  422
            ++R +      + NQ     NPNA  +GY RQ  +  QGD FFHPLEC+PTLQ+G    P
Sbjct  171  RKRCVQLEETSQANQQVWEANPNAM-VGYSRQ-PNQPQGDEFFHPLECQPTLQMG--VQP  226

Query  421  ITVAGPSVNNYMPGWL  374
               AGPSV+ +M GWL
Sbjct  227  DQNAGPSVSAFMLGWL  242



>gb|AHW52538.1| SEPALLATA-like MADS-box protein 3 [Phalaenopsis equestris]
Length=250

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 149/196 (76%), Gaps = 10/196 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS++SMLKTLE+YQKCN+G PE  I +RE     +SQQEYLKLK+R EALQRS
Sbjct  51   RGKLYEFCSNTSMLKTLEKYQKCNFGGPETTIISRETQ---NSQQEYLKLKSRVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDL PL+ KELE LERQ+D SLKQIRSTRTQ MLDQL DLQR+E  L EAN++L
Sbjct  108  QRNLLGEDLAPLSGKELEQLERQVDSSLKQIRSTRTQFMLDQLADLQRREQMLCEANRAL  167

Query  583  KQRLMEGNQLN--LHWNP-NAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPI--  419
            K R  EG+Q N    W+P N   +GYGRQ A H  G+ F+HPL+ EPTLQIGY +D    
Sbjct  168  KIRFEEGSQANQPQVWDPSNTHAVGYGRQPAQH-HGEAFYHPLDSEPTLQIGYHSDITMA  226

Query  418  TVAGPSVNNYM-PGWL  374
            T    +VNNYM PGWL
Sbjct  227  TATTSTVNNYMLPGWL  242



>gb|AHY82573.1| MADS-box protein 6 [Lilium formosanum]
Length=242

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 149/195 (76%), Gaps = 9/195 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEF S+SSM++TLERYQKCNYGAPE NI +RE     +SQQEYLKLKA+ EALQRS
Sbjct  51   RGKLYEFSSTSSMMRTLERYQKCNYGAPETNIVSRETQ---NSQQEYLKLKAKVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLN+KELE LERQLD SLK IRSTRTQ MLDQL+DLQR+E  L EANKSL
Sbjct  108  QRNLLGEDLGPLNTKELEQLERQLDTSLKLIRSTRTQFMLDQLSDLQRREQMLCEANKSL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            ++RL E +  N    W  N    GY  Q A       FFHPLECEPTLQIGYP D IT+A
Sbjct  168  RRRLEETSHANQQQVWEANVHAAGYAAQQAQPQGNG-FFHPLECEPTLQIGYPPDQITIA  226

Query  409  ---GPSVNNYMPGWL  374
               GPS ++Y+PGWL
Sbjct  227  SGPGPSGSSYLPGWL  241



>gb|ACJ64681.1| MADS-box protein MADS4 [Musa acuminata AAA Group]
Length=243

 Score =   242 bits (617),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 148/199 (74%), Gaps = 16/199 (8%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSML+TLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR + LQRS
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPETNIISRETQ---SSQQEYLKLKARVDGLQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLN KELE LERQLD SL+QIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLNIKELEQLERQLDASLRQIRSTRTQYMLDQLGDLQRREQMLCEANKAL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            K RL E ++ +    W+PN   + YGRQ     QGD FF  ++CEPTLQIGY  D + +A
Sbjct  168  KIRLEESSEADQQQLWDPNTHAVAYGRQQP-QPQGDGFFQSIDCEPTLQIGYHPDQMAIA  226

Query  409  -------GPSVNNYMPGWL  374
                   GPS   YMPGWL
Sbjct  227  AAAAAAPGPS---YMPGWL  242



>gb|ACB69511.1| SEPALLATA3-like MADS-box protein [Crocus sativus]
Length=234

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 148/191 (77%), Gaps = 7/191 (4%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQK +YGAP+  +  R+  Q + S QEYLKLKAR E+LQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKSSYGAPDHGVQIRDT-QLLQSHQEYLKLKARVESLQRT  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLG L++KELE LERQLD SL+QIRSTRTQ MLDQL+DLQR+EH L E+NKSL
Sbjct  110  QRNLLGEDLGQLSTKELEQLERQLDSSLRQIRSTRTQYMLDQLSDLQRQEHMLCESNKSL  169

Query  583  KQRLMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVAGP  404
            +++L E NQ    W  NA  +GYGRQ      G+ FFHPL C+PTLQ+G+ T+ +  +GP
Sbjct  170  RKKLEESNQ---AWESNANPLGYGRQQTQPQVGE-FFHPLACQPTLQMGFQTEQL--SGP  223

Query  403  SVNNYMPGWLP  371
            S + Y PGW P
Sbjct  224  SASTYTPGWFP  234



>dbj|BAM34479.1| MADS-box transcription factor [Alstroemeria ligtu subsp. ligtu]
Length=242

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 145/196 (74%), Gaps = 9/196 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS +SM KTLE+YQ  NY APE N  +RE L   SSQQEYLKLK+R EALQRS
Sbjct  51   RGKLYEFCSPASMTKTLEKYQNSNYSAPETNTISRETL---SSQQEYLKLKSRVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL+SK+L+ LERQLD+SLKQIRSTRTQ MLDQL+DLQRKE  L EANKS+
Sbjct  108  QRNLLGEDLGPLSSKDLDQLERQLDVSLKQIRSTRTQCMLDQLSDLQRKEQMLCEANKSM  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            ++RL E +  N    W  N Q   Y RQ      GD FFHPL+CEPTLQIGY  + ITVA
Sbjct  168  RRRLEESSIANQQQMWEHNVQAARYARQQV-QPLGDGFFHPLDCEPTLQIGYHQEHITVA  226

Query  409  ---GPSVNNYMPGWLP  371
               G S   YM GWLP
Sbjct  227  EVPGTSDRTYMEGWLP  242



>ref|XP_010499200.1| PREDICTED: developmental protein SEPALLATA 3 isoform X5 [Camelina 
sativa]
Length=237

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 142/195 (73%), Gaps = 18/195 (9%)
 Frame = -3

Query  943  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSS ML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSSMLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ K          
Sbjct  111  TQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSK----------  160

Query  586  LKQRLMEGNQLNLHWNPNAQDM--GYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV  413
                L +G Q+ L  NPN +D    YGR          FF PLECEP LQIGY      +
Sbjct  161  ----LADGYQMPLQLNPNPEDHLDPYGRHHHQQQHSQAFFQPLECEPILQIGYQGQQDGM  216

Query  412  -AGPSVNNYMPGWLP  371
             AGPSVNNYM GWLP
Sbjct  217  GAGPSVNNYMLGWLP  231



>ref|XP_010499201.1| PREDICTED: developmental protein SEPALLATA 3 isoform X6 [Camelina 
sativa]
Length=237

 Score =   239 bits (610),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 142/195 (73%), Gaps = 18/195 (9%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ K          
Sbjct  111  TQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSK----------  160

Query  586  LKQRLMEGNQLNLHWNPNAQDM--GYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV  413
                L +G Q+ L  NPN +D    YGR          FF PLECEP LQIGY      +
Sbjct  161  ----LADGYQMPLQLNPNPEDHLDPYGRHHHQQQHSQAFFQPLECEPILQIGYQGQQDGM  216

Query  412  -AGPSVNNYMPGWLP  371
             AGPSVNNYM GWLP
Sbjct  217  GAGPSVNNYMLGWLP  231



>dbj|BAL05005.1| putative MADS box protein [Zostera japonica]
 dbj|BAL05006.1| putative MADS box protein [Zostera japonica]
Length=246

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 149/198 (75%), Gaps = 11/198 (6%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSS SMLKTLERYQKCNY APE N+ TRE     SSQQEYLKLKAR E+LQR+
Sbjct  51   RGKLYEFCSSPSMLKTLERYQKCNYVAPETNVQTREIQ---SSQQEYLKLKARVESLQRN  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLG L+S++LE+LERQLD SL+QIRS RTQ MLDQL+DLQ++E AL EANK+L
Sbjct  108  QRNLLGEDLGSLSSRDLENLERQLDASLRQIRSIRTQYMLDQLSDLQKQEQALCEANKAL  167

Query  583  KQRLMEGNQLNLH--WNPNAQDMGYGR----QTAHHSQGDVFFHPLECEPTLQIGYPTDP  422
            ++RL E    +    W   A  M Y R    Q  HH Q D FFHPL+CEPTLQIGY  + 
Sbjct  168  RRRLEETTHPSQQQVWESEAHAMAYSRQQQSQQQHHHQSDAFFHPLDCEPTLQIGYHPEQ  227

Query  421  ITVA--GPSVNNYMPGWL  374
            ITVA  GPSV  Y+P WL
Sbjct  228  ITVAASGPSVGGYVPTWL  245



>gb|ACB69512.1| SEPALLATA3-like MADS-box protein [Crocus sativus]
Length=239

 Score =   236 bits (603),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 148/193 (77%), Gaps = 6/193 (3%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQK +YGAP+  +  R+  Q + S QEYLKLKAR E+LQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKSSYGAPDHGVQIRDT-QLLQSHQEYLKLKARVESLQRT  109

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLG L++KELE LERQLD SL+QIRSTRTQ MLDQL+DLQR+EH L E+NKSL
Sbjct  110  QRNLLGEDLGQLSTKELEQLERQLDSSLRQIRSTRTQYMLDQLSDLQRQEHMLCESNKSL  169

Query  583  KQR--LMEGNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITVA  410
            +++   M+  + N  W  NA  +GYGRQ      G+ FFHPL C+PTLQ+G+ T+ ++  
Sbjct  170  RKKSPFMQLEESNQAWESNANPLGYGRQQTQPQVGE-FFHPLACQPTLQMGFQTEQLS--  226

Query  409  GPSVNNYMPGWLP  371
            GPS + Y PGW P
Sbjct  227  GPSASTYTPGWFP  239



>ref|NP_001185081.1| MADs box transcription factor SEPALLATA3 [Arabidopsis thaliana]
 gb|AEE30504.1| MADs box transcription factor SEPALLATA3 [Arabidopsis thaliana]
Length=237

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 143/195 (73%), Gaps = 18/195 (9%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL++KELESLERQLD SLKQIR+ RTQ MLDQL DLQ K          
Sbjct  111  TQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSK----------  160

Query  586  LKQRLMEGNQLNLHWNPNAQDMG-YGR-QTAHHSQGDVFFHPLECEPTLQIGYPTDPITV  413
                L +G Q+ L  NPN +++  YGR           FF PLECEP LQIGY      +
Sbjct  161  ----LADGYQMPLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQGQQDGM  216

Query  412  -AGPSVNNYMPGWLP  371
             AGPSVNNYM GWLP
Sbjct  217  GAGPSVNNYMLGWLP  231



>ref|XP_008801851.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Phoenix dactylifera]
Length=263

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 147/221 (67%), Gaps = 40/221 (18%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIVSRETQ---SSQQEYLKLKARVEALQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRK-----------  617
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+           
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRRVWLMQSNSFKK  167

Query  616  ------------------EHALNEANKSLKQRLMEGNQLNLH--WNPNAQDMGYGRQTAH  497
                              E  L EANKSLK+RL E NQ      W+PNA  +GYGRQ   
Sbjct  168  HLFFIPPFPSYYHCSFLQEQMLCEANKSLKRRLEESNQATQQQVWDPNAHAVGYGRQPPQ  227

Query  496  HSQGDVFFHPLECEPTLQIGYPTDPITVAGPSVNNYMPGWL  374
              QGD F+ P+E  P  QI     P    GPSV+NYMPGWL
Sbjct  228  -PQGDGFYQPIEYHPE-QITIAAGP----GPSVSNYMPGWL  262



>ref|XP_009109826.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Brassica rapa]
Length=244

 Score =   234 bits (598),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 148/197 (75%), Gaps = 9/197 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKL+EFCS+SSMLKTLERYQKCNYG PEPN+ +REAL E+SSQQEYLKLK RY+ALQR+
Sbjct  51   RGKLFEFCSNSSMLKTLERYQKCNYGPPEPNVPSREALAELSSQQEYLKLKQRYDALQRT  110

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL++KELESLERQLD SLKQIR  RTQ MLDQL DLQ KE  L++ NK+L
Sbjct  111  QRNLLGEDLGPLSTKELESLERQLDSSLKQIRGLRTQFMLDQLNDLQSKERMLSDTNKTL  170

Query  583  KQRLMEGNQLNLHWNPNAQD--MGYGRQTAHHSQGDVFFHPLECEPTLQIGY----PTDP  422
            + RL +G Q+    NPN ++  + YG    H  Q   FF PLE EP  Q+GY      D 
Sbjct  171  RLRLADGYQMPFQLNPNQEEVHVDYGH---HQPQQQAFFQPLEYEPIFQMGYHQGQQQDH  227

Query  421  ITVAGPSVNNYMPGWLP  371
               AGPS NNYM GWLP
Sbjct  228  GMGAGPSANNYMLGWLP  244



>ref|XP_008801854.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X5 [Phoenix dactylifera]
Length=221

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 144/212 (68%), Gaps = 38/212 (18%)
 Frame = -3

Query  907  MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGPL  728
            MLKTLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR EALQRSQRNLLGEDLGPL
Sbjct  13   MLKTLERYQKCNYGAPETNIVSRETQ---SSQQEYLKLKARVEALQRSQRNLLGEDLGPL  69

Query  727  NSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRK-----------------------  617
            +SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+                       
Sbjct  70   SSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRRVWLMQSNSFKKHLFFIPPFPSYY  129

Query  616  ------EHALNEANKSLKQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLE  461
                  E  L EANKSLK+RL E NQ      W+PNA  +GYGRQ     QGD F+ P+E
Sbjct  130  HCSFLQEQMLCEANKSLKRRLEESNQATQQQVWDPNAHAVGYGRQPPQ-PQGDGFYQPIE  188

Query  460  CEPTLQIGYPTDPITVA---GPSVNNYMPGWL  374
            CEPTL IGY  + IT+A   GPSV+NYMPGWL
Sbjct  189  CEPTLHIGYHPEQITIAAGPGPSVSNYMPGWL  220



>emb|CDY11824.1| BnaC03g57540D [Brassica napus]
Length=245

 Score =   232 bits (591),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 148/198 (75%), Gaps = 10/198 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKL+EFCS+SSMLKTLERYQKCNYG PEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLFEFCSNSSMLKTLERYQKCNYGPPEPNVPSREALAVELSSQQEYLKLKQRYDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL++KELESLERQLD SLKQIR  RTQ MLDQL DLQ KE  L++ NK+
Sbjct  111  TQRNLLGEDLGPLSTKELESLERQLDSSLKQIRGLRTQFMLDQLNDLQSKERMLSDTNKT  170

Query  586  LKQRLMEGNQLNLHWNPNAQD--MGYGRQTAHHSQGDVFFHPLECEPTLQIGY----PTD  425
            L+ RL +G Q+    NPN ++  + YG    H  Q   FF PLE EP  QIGY      D
Sbjct  171  LRLRLADGYQMPFQLNPNQEEVHVDYGH---HQPQQQAFFQPLEYEPIFQIGYHQGQQQD  227

Query  424  PITVAGPSVNNYMPGWLP  371
                AGPS NNYM GWLP
Sbjct  228  HGMGAGPSANNYMLGWLP  245



>ref|XP_010260833.1| PREDICTED: MADS-box protein CMB1 [Nelumbo nucifera]
Length=243

 Score =   231 bits (590),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 148/198 (75%), Gaps = 14/198 (7%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTL+RYQKC+YGA E   +++ A +  SS QEYLKLKAR E LQRS
Sbjct  51   RGKLYEFCSSSSMLKTLDRYQKCSYGALE---TSQPAKETQSSYQEYLKLKARVEVLQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL +KELE LE QL+MSLKQIRST+TQ+MLDQL+DLQRKE  L EAN++L
Sbjct  108  QRNLLGEDLGPLTTKELEQLEHQLEMSLKQIRSTKTQLMLDQLSDLQRKEQMLQEANRTL  167

Query  583  KQRLMEG---NQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGY-PTDP--  422
            K++L E    N L L W    Q++ Y RQ A   Q + FF PLEC  TLQIGY P  P  
Sbjct  168  KRKLEESSCENPLRLTWEAGGQNISYSRQAA---QSEGFFQPLECNSTLQIGYNPVGPDQ  224

Query  421  ITVAGPS--VNNYMPGWL  374
            ITV  P+  VN ++PGW+
Sbjct  225  ITVTTPTQNVNGFIPGWM  242



>ref|XP_009109825.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Brassica rapa]
 emb|CDY66153.1| BnaAnng21750D [Brassica napus]
Length=245

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 148/198 (75%), Gaps = 10/198 (5%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  767
            RGKL+EFCS+SSMLKTLERYQKCNYG PEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLFEFCSNSSMLKTLERYQKCNYGPPEPNVPSREALAVELSSQQEYLKLKQRYDALQR  110

Query  766  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKS  587
            +QRNLLGEDLGPL++KELESLERQLD SLKQIR  RTQ MLDQL DLQ KE  L++ NK+
Sbjct  111  TQRNLLGEDLGPLSTKELESLERQLDSSLKQIRGLRTQFMLDQLNDLQSKERMLSDTNKT  170

Query  586  LKQRLMEGNQLNLHWNPNAQD--MGYGRQTAHHSQGDVFFHPLECEPTLQIGY----PTD  425
            L+ RL +G Q+    NPN ++  + YG    H  Q   FF PLE EP  Q+GY      D
Sbjct  171  LRLRLADGYQMPFQLNPNQEEVHVDYGH---HQPQQQAFFQPLEYEPIFQMGYHQGQQQD  227

Query  424  PITVAGPSVNNYMPGWLP  371
                AGPS NNYM GWLP
Sbjct  228  HGMGAGPSANNYMLGWLP  245



>ref|XP_006305560.1| hypothetical protein CARUB_v100101340mg, partial [Capsella rubella]
 gb|EOA38458.1| hypothetical protein CARUB_v100101340mg, partial [Capsella rubella]
Length=232

 Score =   229 bits (583),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 142/199 (71%), Gaps = 22/199 (11%)
 Frame = -3

Query  943  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQ  770
            RGKLYEFCSSSS ML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQ
Sbjct  42   RGKLYEFCSSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQ  101

Query  769  RSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANK  590
            R+QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ K         
Sbjct  102  RTQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSK---------  152

Query  589  SLKQRLMEGNQLNLHWNPNAQDM--GYGR--QTAHHSQGDVFFHPLECEPTLQIGY--PT  428
                 L +G Q+ L  NPN +D    Y R      H     FF PLECEP LQIGY    
Sbjct  153  -----LADGYQMPLQLNPNPEDHVDHYARHHHQQQHQHSQAFFQPLECEPILQIGYQGQQ  207

Query  427  DPITVAGPSVNNYMPGWLP  371
            D    AGPSVNNYM GWLP
Sbjct  208  DHGMGAGPSVNNYMLGWLP  226



>ref|XP_002299317.2| hypothetical protein POPTR_0001s13650g [Populus trichocarpa]
 gb|EEE84122.2| hypothetical protein POPTR_0001s13650g [Populus trichocarpa]
Length=169

 Score =   226 bits (576),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 132/163 (81%), Gaps = 4/163 (2%)
 Frame = -3

Query  853  NISTREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQ  674
            +I  R    E+SSQQEYLKLKARYEALQR+QRNLLGE+LGPL+SKELESLERQLDMSLKQ
Sbjct  7    SILKRHITVELSSQQEYLKLKARYEALQRTQRNLLGEELGPLSSKELESLERQLDMSLKQ  66

Query  673  IRSTRTQMMLDQLTDLQRKEHALNEANKSLKQRLMEGNQLN-LHWNPNAQDMGYGRQTAH  497
            IRSTRTQ MLDQL DLQ KEH L  ANKSLK+RLMEG QLN L  NP+A+D+ Y RQ A 
Sbjct  67   IRSTRTQYMLDQLNDLQHKEHMLTAANKSLKERLMEGYQLNSLQLNPSAEDVEYARQQA-  125

Query  496  HSQGDVFFHPLECEPTLQIGYPTDPITV--AGPSVNNYMPGWL  374
              QGD FFH LECEPTLQIGY  + IT+  AGPS+  YMPGWL
Sbjct  126  QPQGDGFFHALECEPTLQIGYQPENITMVTAGPSMTTYMPGWL  168



>gb|EPS62764.1| hypothetical protein M569_12026, partial [Genlisea aurea]
Length=141

 Score =   224 bits (572),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 123/141 (87%), Gaps = 2/141 (1%)
 Frame = -3

Query  826  EISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMM  647
            E+SSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ M
Sbjct  1    ELSSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAM  60

Query  646  LDQLTDLQRKEHALNEANKSLKQRLMEGNQLNLHWNPNAQDMG-YGRQTAHHSQGDVFFH  470
            LD LTDLQRKE+ALNEANK+LKQRLMEG+Q++L WNPNAQ+ G YGRQ AH    D FFH
Sbjct  61   LDTLTDLQRKEYALNEANKTLKQRLMEGSQISLQWNPNAQECGGYGRQ-AHQGHPDGFFH  119

Query  469  PLECEPTLQIGYPTDPITVAG  407
            PL+CEPTL IGY  D   VA 
Sbjct  120  PLDCEPTLHIGYQPDHFAVAA  140



>ref|NP_001268109.1| MADS-box protein 2 [Vitis vinifera]
 gb|AAM21342.1|AF373601_1 MADS-box protein 2 [Vitis vinifera]
Length=244

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 147/198 (74%), Gaps = 13/198 (7%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKC+YGA E +  ++E   E SS +EYLKLK+++EALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCSYGAVEVSRPSKEL--EQSSYREYLKLKSKFEALQRT  108

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLN+KELE LERQL+ SLKQ+RST+TQ MLDQL+DLQ KE  L E+NK+L
Sbjct  109  QRNLLGEDLGPLNTKELEQLERQLETSLKQVRSTKTQFMLDQLSDLQNKEQVLVESNKAL  168

Query  583  KQRLME---GNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGY-PTDPIT  416
             ++L E    N L L W    Q M YG Q A  SQG  FF PLEC PTLQIGY P     
Sbjct  169  TRKLDEISVKNHLQLSWESGEQSMPYGHQQA-QSQG--FFQPLECNPTLQIGYNPAGSSQ  225

Query  415  VAGPS----VNNYMPGWL  374
            ++ PS    VN ++PGW+
Sbjct  226  LSAPSNAQNVNGFIPGWM  243



>ref|XP_010257958.1| PREDICTED: developmental protein SEPALLATA 1 [Nelumbo nucifera]
Length=243

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 146/198 (74%), Gaps = 14/198 (7%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKC+YGA E +   +E     SS QEYLKLKAR E LQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCSYGALEASQPAKETQ---SSYQEYLKLKARVEVLQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPL++KELE LE QL+MSLKQIRST+TQ+MLDQL+DLQRKE  L EAN++L
Sbjct  108  QRNLLGEDLGPLSTKELEQLEHQLEMSLKQIRSTKTQLMLDQLSDLQRKEQMLQEANRAL  167

Query  583  KQRLMEG---NQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGY-PTDP--  422
            K++L E    N L L W    Q++ Y RQ    SQ + FF PLE   TLQIGY P  P  
Sbjct  168  KRKLDESSSENPLRLTWEAGGQNISYSRQP---SQSEGFFQPLEGNSTLQIGYNPVGPDQ  224

Query  421  ITVAGPS--VNNYMPGWL  374
            ITVA  +  VN Y+PGW+
Sbjct  225  ITVAASAQNVNGYIPGWM  242



>ref|XP_006385890.1| hypothetical protein POPTR_0003s16810g [Populus trichocarpa]
 gb|ERP63687.1| hypothetical protein POPTR_0003s16810g [Populus trichocarpa]
Length=203

 Score =   224 bits (572),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 132/158 (84%), Gaps = 5/158 (3%)
 Frame = -3

Query  832  LQEISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ  653
            LQE+SSQQEYLKLKARYEALQR+QRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ
Sbjct  47   LQELSSQQEYLKLKARYEALQRTQRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQ  106

Query  652  MMLDQLTDLQRKEHALNEANKSLKQRLMEGNQLN-LHWNPNAQDMGYGRQTAHHSQGDVF  476
             MLDQL DLQ KEH L  ANKSL++RLMEG ++N L  N +A+D+G+ RQ A   QG  F
Sbjct  107  YMLDQLNDLQHKEHMLTAANKSLRERLMEGYEVNSLQLNLSAEDVGFSRQQA-QPQGYGF  165

Query  475  FHPLECEPTLQIGY-PTDPITV--AGPSVNNYMPGWLP  371
            FHPLECEPTLQIGY P   ITV  +GPS+  YMPGWLP
Sbjct  166  FHPLECEPTLQIGYQPDSAITVVTSGPSMTAYMPGWLP  203



>ref|XP_006593703.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Glycine max]
 gb|KHN08352.1| Developmental protein SEPALLATA 2 [Glycine soja]
Length=249

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 144/203 (71%), Gaps = 18/203 (9%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS++SMLKTLERYQKC+YGA E +   +E   E SS +EYLKLKAR+E+LQR+
Sbjct  51   RGKLYEFCSTNSMLKTLERYQKCSYGAVEVSKPGKEL--EQSSYREYLKLKARFESLQRT  108

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLN+K+LE LERQLD SLKQ+RST+TQ MLDQL DLQ KEH L EAN+SL
Sbjct  109  QRNLLGEDLGPLNTKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSL  168

Query  583  KQRLMEGNQLNLH---WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIG--YPTDP-  422
              +L E N  N +   W    Q M YG Q A HSQG  FF PLEC PTLQIG  Y  +P 
Sbjct  169  TMKLEEINSRNQYRQTWEAGEQSMSYGTQNA-HSQG--FFQPLECNPTLQIGSDYRYNPE  225

Query  421  -------ITVAGPSVNNYMPGWL  374
                    T     VN ++PGW+
Sbjct  226  ASEQQLAATTQAQQVNGFIPGWM  248



>ref|XP_010660492.1| PREDICTED: MADS-box protein 2 isoform X1 [Vitis vinifera]
 emb|CBI16936.3| unnamed protein product [Vitis vinifera]
Length=243

 Score =   224 bits (571),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 146/198 (74%), Gaps = 14/198 (7%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSMLKTLERYQKC+YGA E +  ++E     SS +EYLKLK+++E+LQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCSYGAVEVSRPSKEL---ESSYREYLKLKSKFESLQRT  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLN+KELE LERQL+ SLKQ+RST+TQ MLDQL+DLQ KE  L E+NK+L
Sbjct  108  QRNLLGEDLGPLNTKELEQLERQLETSLKQVRSTKTQFMLDQLSDLQNKEQVLVESNKAL  167

Query  583  KQRLME---GNQLNLHWNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGY-PTDPIT  416
             ++L E    N L L W    Q M YG Q A  SQG  FF PLEC PTLQIGY P     
Sbjct  168  TRKLDEISVKNHLQLSWESGEQSMPYGHQQA-QSQG--FFQPLECNPTLQIGYNPAGSSQ  224

Query  415  VAGPS----VNNYMPGWL  374
            ++ PS    VN ++PGW+
Sbjct  225  LSAPSNAQNVNGFIPGWM  242



>gb|KCW86945.1| hypothetical protein EUGRSUZ_B03515, partial [Eucalyptus grandis]
Length=159

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 131/160 (82%), Gaps = 9/160 (6%)
 Frame = -3

Query  826  EISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMM  647
            E+SSQQEYLKLKARYEALQR+QRNLLGE+LGPL+SKELESLERQLD SLKQIRSTRTQ M
Sbjct  1    ELSSQQEYLKLKARYEALQRTQRNLLGEELGPLSSKELESLERQLDSSLKQIRSTRTQYM  60

Query  646  LDQLTDLQRKEHALNEANKSLKQRLMEGNQLN-LHWNP-NAQDMGY-GRQTA--HHSQGD  482
            LDQLTDLQRKE  LNEAN++LKQRLMEG Q   L  NP  A++M Y GR  A  HH   D
Sbjct  61   LDQLTDLQRKEQHLNEANRTLKQRLMEGYQATALQMNPAAAEEMVYGGRHLAPPHHGH-D  119

Query  481  VFFHPLECEPTLQIGYPTDP---ITVAGPSVNNYMPGWLP  371
             FFHPL+CEPTLQIGYP DP   +  AGPS ++YMPGWLP
Sbjct  120  AFFHPLDCEPTLQIGYPQDPSASVVTAGPSSSSYMPGWLP  159



>ref|XP_003544012.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Glycine max]
Length=248

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 143/203 (70%), Gaps = 19/203 (9%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS++SMLKTLERYQKC+YGA E +   +E     SS +EYLKLKAR+E+LQR+
Sbjct  51   RGKLYEFCSTNSMLKTLERYQKCSYGAVEVSKPGKEL---ESSYREYLKLKARFESLQRT  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLN+K+LE LERQLD SLKQ+RST+TQ MLDQL DLQ KEH L EAN+SL
Sbjct  108  QRNLLGEDLGPLNTKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSL  167

Query  583  KQRLMEGNQLNLH---WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIG--YPTDP-  422
              +L E N  N +   W    Q M YG Q A HSQG  FF PLEC PTLQIG  Y  +P 
Sbjct  168  TMKLEEINSRNQYRQTWEAGEQSMSYGTQNA-HSQG--FFQPLECNPTLQIGSDYRYNPE  224

Query  421  -------ITVAGPSVNNYMPGWL  374
                    T     VN ++PGW+
Sbjct  225  ASEQQLAATTQAQQVNGFIPGWM  247



>gb|EYU33465.1| hypothetical protein MIMGU_mgv1a0126182mg, partial [Erythranthe 
guttata]
 gb|EYU33466.1| hypothetical protein MIMGU_mgv1a0126182mg, partial [Erythranthe 
guttata]
Length=156

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 127/156 (81%), Gaps = 7/156 (4%)
 Frame = -3

Query  826  EISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMM  647
            E+SSQQEYLKLKARYEALQ SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ M
Sbjct  1    ELSSQQEYLKLKARYEALQHSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAM  60

Query  646  LDQLTDLQRKEHALNEANKSLKQRLMEGNQLNLHWNPN---AQDMGYGRQT-AHHSQGDV  479
            LD LTDLQRKEHALNEAN+SLK RLMEG+Q++L WN N     DMGYGR+      Q D 
Sbjct  61   LDTLTDLQRKEHALNEANRSLKHRLMEGSQISLEWNHNNNVDHDMGYGREAPPQPHQPDG  120

Query  478  FFHPLECEPTLQI-GYPTDPITVAGPSVNNYMPGWL  374
            FFHPL+C   LQI GY  D IT AGPSVNNY+  WL
Sbjct  121  FFHPLDC--GLQIGGYQADQITGAGPSVNNYITSWL  154



>gb|AAY21913.2| putative MADS box protein [Musa acuminata]
Length=244

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 143/200 (72%), Gaps = 17/200 (9%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCSSSSML+TLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR + LQRS
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPETNIISRETQ---SSQQEYLKLKARVDGLQRS  107

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQR-KEHALNEANKS  587
            QRNLLGEDLGPLN KELE LERQLD SL+QIRSTRTQ MLDQL DLQR   +A+    K 
Sbjct  108  QRNLLGEDLGPLNIKELEQLERQLDASLRQIRSTRTQYMLDQLGDLQRLGTNAMWSLIKP  167

Query  586  LKQRLMEGNQLNLH--WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIGYPTDPITV  413
             K RL E ++ +    W+PN   + YGRQ     QGD FF  ++CEPTLQIGY  D + +
Sbjct  168  WKIRLEESSEADQQQLWDPNTHAVAYGRQQP-QPQGDGFFQFIDCEPTLQIGYHPDQMAI  226

Query  412  A-------GPSVNNYMPGWL  374
            A       GPS   YMPGWL
Sbjct  227  AAAAAAAPGPS---YMPGWL  243



>ref|XP_006603756.1| PREDICTED: MADS-box protein isoform X1 [Glycine max]
Length=249

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 143/203 (70%), Gaps = 18/203 (9%)
 Frame = -3

Query  943  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  764
            RGKLYEFCS++SMLKTLERYQKC+YGA E +   +E   E SS +EYLKLKAR+E+LQR+
Sbjct  51   RGKLYEFCSTNSMLKTLERYQKCSYGAVEVSKPGKEL--EQSSYREYLKLKARFESLQRT  108

Query  763  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQMMLDQLTDLQRKEHALNEANKSL  584
            QRNLLGEDLGPLN+K+LE LERQLD SLKQ+RST+TQ MLDQL DLQ KEH L EAN+SL
Sbjct  109  QRNLLGEDLGPLNTKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSL  168

Query  583  KQRLMEGNQLNLH---WNPNAQDMGYGRQTAHHSQGDVFFHPLECEPTLQIG--YPTDP-  422
              +L E N  N +   W    Q M YG Q A HSQG  FF PLEC PTLQIG  Y   P 
Sbjct  169  TMKLEEINSRNQYRQTWEAGEQSMPYGTQNA-HSQG--FFQPLECNPTLQIGSDYRYIPE  225

Query  421  -------ITVAGPSVNNYMPGWL  374
                    T     VN ++PGW+
Sbjct  226  ASEQQLAATTQAQQVNGFIPGWM  248



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2033734698028