BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25011_g4_i1 len=712 path=[13563:0-330 11335:331-374 13936:375-418
10770:419-711]

Length=712
                                                                      Score     E

gb|ADU56817.1|  MADS-box protein AGL2 subfamily                         303   3e-100   
gb|AEA76419.1|  putative SEP3                                           295   2e-97    
ref|XP_009600809.1|  PREDICTED: agamous-like MADS-box protein AGL...    295   5e-97    
ref|NP_001234384.1|  agamous-like MADS-box protein AGL9 homolog         295   8e-97    
gb|AAP83377.1|  SEPALLATA3-like MADS-box                                293   1e-96    Solanum lycopersicum
gb|AHW58034.1|  SEP3                                                    294   2e-96    
ref|XP_006352168.1|  PREDICTED: agamous-like MADS-box protein AGL...    293   2e-96    
sp|Q03489.2|AGL9_PETHY  RecName: Full=Agamous-like MADS-box prote...    292   6e-96    Petunia x hybrida [garden petunia]
gb|AAP83395.1|  SEPALLATA3-like MADS-box                                291   8e-96    Petunia x hybrida [garden petunia]
emb|CBI27678.3|  unnamed protein product                                292   1e-95    
dbj|BAG55316.1|  transcription factor                                   290   5e-95    Petunia integrifolia subsp. inflata
ref|NP_001289529.1|  agamous-like MADS-box protein AGL9 homolog         290   6e-95    
gb|ADP09004.1|  SEP3-like protein                                       290   8e-95    
ref|NP_001268114.1|  MADS-box protein 4                                 289   2e-94    
gb|AAP83410.1|  SEPALLATA3-like MADS-box                                283   2e-92    Syringa vulgaris
ref|XP_011086825.1|  PREDICTED: agamous-like MADS-box protein AGL...    282   8e-92    
gb|AAP83366.1|  SEPALLATA3-like MADS-box                                280   9e-92    Antirrhinum majus [garden snapdragon]
emb|CAA64742.1|  DEFH72                                                 281   2e-91    Antirrhinum majus [garden snapdragon]
gb|AHA87180.1|  sepallata 3                                             278   8e-91    
gb|ADU15477.1|  SEP3                                                    279   9e-91    
ref|XP_004140534.1|  PREDICTED: agamous-like MADS-box protein AGL...    278   3e-90    
dbj|BAK09620.1|  MADS-box transcription factor                          278   5e-90    
emb|CAL36578.1|  deficiens H200 homologue                               277   7e-90    Misopates orontium
ref|NP_001284431.1|  agamous-like MADS-box protein AGL9 homolog         276   1e-89    
gb|KDP26829.1|  hypothetical protein JCGZ_17987                         276   2e-89    
dbj|BAN89460.1|  sepallata 3                                            276   2e-89    
ref|XP_007043947.1|  K-box region and MADS-box transcription fact...    276   2e-89    
gb|AAP83364.1|  SEPALLATA3-like MADS-box                                274   3e-89    Antirrhinum majus [garden snapdragon]
emb|CAA64743.1|  DEFH200                                                275   3e-89    Antirrhinum majus [garden snapdragon]
gb|ABQ59277.2|  sepallata 3-like MADS box protein                       274   3e-89    Eustoma exaltatum subsp. russellianum [bluebells]
gb|AEQ75503.1|  MADS-domain transcription factor                        272   2e-88    
gb|ADF49576.1|  transcription factor MADS-box 2                         273   4e-88    
gb|AEL33633.1|  SEPALLATA3                                              270   4e-87    
ref|XP_011020782.1|  PREDICTED: agamous-like MADS-box protein AGL...    270   5e-87    
ref|XP_007043949.1|  K-box region and MADS-box transcription fact...    270   5e-87    
gb|AEN75254.1|  transcription factor MADS3                              270   5e-87    
ref|XP_007223808.1|  hypothetical protein PRUPE_ppa010679mg             269   7e-87    
ref|XP_011036099.1|  PREDICTED: agamous-like MADS-box protein AGL...    269   7e-87    
ref|XP_008222191.1|  PREDICTED: agamous-like MADS-box protein AGL...    269   8e-87    
ref|XP_006437995.1|  hypothetical protein CICLE_v10032507mg             269   1e-86    
dbj|BAF34912.1|  MADS-box protein                                       269   1e-86    Citrus unshiu [satsuma mandarin]
dbj|BAM36705.1|  MADS transcriptional factor SEP3 homolog               268   2e-86    
gb|AGA61758.1|  sepallata 3                                             268   3e-86    
gb|AEJ76840.1|  MADS16                                                  268   3e-86    
gb|KHG25284.1|  Agamous-like MADS-box protein AGL9                      268   4e-86    
gb|ABE02212.1|  SEP-like                                                267   5e-86    Populus tomentosa [Chinese white poplar]
gb|AAO49811.1|  SEP3-related MADS-box protein                           265   4e-85    Populus tremuloides
gb|AEO45959.1|  SEPALLATA3-like protein                                 263   1e-84    
ref|XP_004171788.1|  PREDICTED: agamous-like MADS-box protein AGL...    261   3e-84    
gb|ADC79704.1|  SEPALLATA3-like protein                                 262   4e-84    Pachysandra terminalis
ref|XP_006437994.1|  hypothetical protein CICLE_v10032507mg             262   5e-84    
ref|NP_001289232.1|  agamous-like MADS-box protein AGL9 homolog         261   8e-84    
ref|NP_001280756.1|  agamous-like MADS-box protein AGL9 homolog         261   1e-83    
gb|AAR01779.1|  MADS-box protein                                        261   1e-83    Prunus dulcis [sweet almond]
ref|XP_007043948.1|  K-box region and MADS-box transcription fact...    261   2e-83    
ref|XP_010090648.1|  Agamous-like MADS-box protein AGL9-like protein    260   3e-83    
dbj|BAJ11578.1|  transcription factor                                   259   5e-83    
ref|XP_006437997.1|  hypothetical protein CICLE_v10032507mg             259   7e-83    
gb|AAX13298.1|  MADS box protein SEP3                                   258   2e-82    Lotus japonicus
ref|XP_009372256.1|  PREDICTED: agamous-like MADS-box protein AGL...    258   3e-82    
ref|XP_006437996.1|  hypothetical protein CICLE_v10032507mg             257   5e-82    
gb|AFL03390.1|  MADS box transcription factor SEP3                      254   1e-81    
gb|AGH61294.1|  sepallata 3                                             256   1e-81    
ref|XP_010653929.1|  PREDICTED: MADS-box protein 4 isoform X1           256   1e-81    
gb|KGN46460.1|  hypothetical protein Csa_6G095270                       252   5e-81    
ref|XP_002514893.1|  mads box protein, putative                         252   5e-81    Ricinus communis
gb|AAO22982.1|  MADS-box transcription factor CDM44                     254   7e-81    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010682728.1|  PREDICTED: agamous-like MADS-box protein AGL...    254   9e-81    
gb|AEE60891.1|  MADS-box protein 5                                      253   1e-80    
ref|XP_004504397.1|  PREDICTED: agamous-like MADS-box protein AGL...    253   2e-80    
ref|XP_006579433.1|  PREDICTED: uncharacterized protein LOC100805...    253   2e-80    
ref|XP_006579435.1|  PREDICTED: uncharacterized protein LOC100805...    253   2e-80    
gb|AAP83365.1|  SEPALLATA3-like MADS-box                                251   2e-80    Antirrhinum majus [garden snapdragon]
gb|AAT46095.1|  SEPALLATA-like protein                                  253   2e-80    Akebia trifoliata
ref|XP_006484143.1|  PREDICTED: agamous-like MADS-box protein AGL...    252   4e-80    
ref|XP_006585131.1|  PREDICTED: MADS-box transcription factor 1-l...    252   5e-80    
ref|XP_006585129.1|  PREDICTED: MADS-box transcription factor 1-l...    252   5e-80    
ref|XP_004504398.1|  PREDICTED: agamous-like MADS-box protein AGL...    251   1e-79    
gb|KHN34832.1|  MADS-box transcription factor 1                         251   1e-79    
ref|XP_006579434.1|  PREDICTED: uncharacterized protein LOC100805...    250   2e-79    
ref|XP_006579436.1|  PREDICTED: uncharacterized protein LOC100805...    250   2e-79    
gb|AET04966.2|  MADS-box transcription factor                           250   2e-79    
gb|AFU81296.1|  SEPALLATA3                                              250   3e-79    
gb|AIC33052.1|  flower development transporter SEP3                     250   4e-79    
ref|XP_006585130.1|  PREDICTED: MADS-box transcription factor 1-l...    249   4e-79    
ref|XP_006585132.1|  PREDICTED: MADS-box transcription factor 1-l...    249   5e-79    
ref|XP_010682729.1|  PREDICTED: agamous-like MADS-box protein AGL...    249   8e-79    
emb|CAB95648.1|  MADS box protein                                       249   8e-79    Betula pendula [white birch]
emb|CAX65571.1|  GRCD5 protein                                          249   1e-78    Gerbera hybrid cultivar
gb|ABD17387.1|  MADS-box protein SEP3                                   249   1e-78    Taihangia rupestris
gb|ABD19719.1|  SEP3-like MADS-box protein                              249   1e-78    Taihangia rupestris
gb|AAN15182.1|  MADS box protein GHMADS-1                               248   1e-78    Gossypium hirsutum [American cotton]
ref|XP_003601749.1|  MADS-box transcription factor                      248   2e-78    
ref|XP_004310096.1|  PREDICTED: agamous-like MADS-box protein AGL...    246   2e-78    
ref|XP_009372255.1|  PREDICTED: agamous-like MADS-box protein AGL...    248   3e-78    
ref|XP_008340236.1|  PREDICTED: agamous-like MADS-box protein AGL...    248   3e-78    
gb|ABQ85951.1|  MADS-box transcription factor SEP-like 2                247   5e-78    Trochodendron aralioides
gb|ADC79706.1|  SEPALLATA3-like protein                                 246   5e-78    Euptelea pleiosperma
ref|XP_008459849.1|  PREDICTED: agamous-like MADS-box protein AGL...    246   8e-78    
gb|AEF59026.1|  MADS-2                                                  244   9e-78    
gb|AAR06665.1|  transcription factor SEP3                               244   2e-77    Chloranthus spicatus [cha-ran]
gb|AAX15924.1|  AGL9.2                                                  243   2e-76    Persea americana
ref|XP_004504399.1|  PREDICTED: agamous-like MADS-box protein AGL...    242   2e-76    
ref|XP_004502275.1|  PREDICTED: MADS-box transcription factor 1-l...    242   4e-76    
gb|ABD17386.1|  MADS-box protein SEP3-1                                 244   5e-76    Taihangia rupestris
ref|XP_004502274.1|  PREDICTED: MADS-box transcription factor 1-l...    241   6e-76    
ref|XP_006415783.1|  hypothetical protein EUTSA_v10008591mg             241   9e-76    
dbj|BAO74164.1|  MADS-box transcription factor SEP3.2                   241   1e-75    
gb|ADD25191.1|  SEP3                                                    240   1e-75    Nelumbo nucifera [Indian lotus]
ref|XP_010250667.1|  PREDICTED: agamous-like MADS-box protein AGL...    240   2e-75    
gb|ADC79703.1|  SEPALLATA3-like protein                                 240   2e-75    Pachysandra terminalis
ref|XP_004504400.1|  PREDICTED: agamous-like MADS-box protein AGL...    239   3e-75    
ref|XP_010913017.1|  PREDICTED: agamous-like MADS-box protein AGL...    239   3e-75    
dbj|BAD10945.1|  SEPALLATA3 homologous protein                          239   6e-75    Silene latifolia
ref|XP_008801852.1|  PREDICTED: agamous-like MADS-box protein AGL...    238   8e-75    
ref|XP_008340234.1|  PREDICTED: agamous-like MADS-box protein AGL...    239   1e-74    
dbj|BAB70747.1|  putative MADS-domain transcription factor MpMADS13     237   2e-74    Magnolia praecocissima
gb|KHN24051.1|  MADS-box transcription factor 1                         237   2e-74    
ref|NP_001236390.1|  MADS transcription factor                          236   5e-74    
ref|NP_850953.1|  MADs box transcription factor SEPALLATA3              236   1e-73    Arabidopsis thaliana [mouse-ear cress]
gb|KDO81856.1|  hypothetical protein CISIN_1g047287mg                   234   1e-73    
gb|ABK41485.1|  putative MADS box protein                               235   1e-73    Elaeis guineensis
sp|O65874.1|MTF1_PEA  RecName: Full=MADS-box transcription factor 1     235   2e-73    Pisum sativum [garden pea]
ref|XP_010917558.1|  PREDICTED: agamous-like MADS-box protein AGL...    235   2e-73    
ref|XP_007163780.1|  hypothetical protein PHAVU_001G263400g             233   8e-73    
gb|ABQ85950.1|  MADS-box transcription factor SEP-like 1                231   2e-72    Trochodendron aralioides
ref|XP_007163779.1|  hypothetical protein PHAVU_001G263400g             232   2e-72    
ref|XP_003538541.1|  PREDICTED: MADS-box transcription factor 1-l...    232   2e-72    
ref|XP_006591442.1|  PREDICTED: MADS-box transcription factor 1-l...    232   4e-72    
gb|AAX15920.1|  AGL9                                                    231   5e-72    Liriodendron tulipifera
gb|AAX15923.1|  AGL9.1                                                  231   6e-72    Persea americana
ref|NP_564214.2|  MADs box transcription factor SEPALLATA3              231   6e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010530562.1|  PREDICTED: developmental protein SEPALLATA 3...    231   9e-72    
gb|ABD62860.1|  SEP3.2                                                  229   2e-71    Persea borbonia [red bay]
ref|XP_010025292.1|  PREDICTED: agamous-like MADS-box protein AGL...    230   2e-71    
gb|KFK44483.1|  developmental protein sepallata 3                       229   3e-71    
gb|AAX15918.1|  AGL9                                                    229   3e-71    Eschscholzia californica
gb|ABQ85953.1|  MADS-box transcription factor SEP-like 4                228   4e-71    Trochodendron aralioides
gb|ABI60898.1|  MADS-box transcription factor                           229   4e-71    Arachis hypogaea [goober]
gb|ABF67487.1|  MADS-domain transcription factor                        229   5e-71    Impatiens hawkeri
ref|XP_009415892.1|  PREDICTED: agamous-like MADS-box protein AGL...    229   5e-71    
gb|AFX72879.1|  MADS-box protein SEP3                                   228   1e-70    
ref|XP_010531079.1|  PREDICTED: developmental protein SEPALLATA 3...    228   2e-70    
ref|XP_003630490.1|  MADS-box transcription factor                      230   2e-70    
gb|AIU94433.1|  MADS-box transcription factor 2 isoform 1               227   2e-70    
gb|ACJ64678.1|  MADS-box protein MADS2                                  226   4e-70    Musa acuminata AAA Group [Cavendish banana]
ref|XP_010530561.1|  PREDICTED: developmental protein SEPALLATA 3...    226   6e-70    
ref|XP_002890717.1|  hypothetical protein ARALYDRAFT_472923             226   6e-70    
ref|XP_010499199.1|  PREDICTED: developmental protein SEPALLATA 3...    226   7e-70    
ref|XP_010682730.1|  PREDICTED: agamous-like MADS-box protein AGL...    225   1e-69    
ref|XP_010460483.1|  PREDICTED: developmental protein SEPALLATA 3...    226   1e-69    
gb|AJC01941.1|  MADS-box protein                                        224   1e-69    
ref|XP_010917559.1|  PREDICTED: agamous-like MADS-box protein AGL...    225   1e-69    
gb|AAP83398.1|  SEPALLATA3-like MADS-box                                223   4e-69    Papaver nudicaule [Arctic poppy]
gb|AIU94764.1|  class E MADS-domain transcription factor                223   5e-69    
dbj|BAM34478.1|  MADS-box transcription factor                          224   5e-69    
gb|AIU94762.1|  class E MADS-domain transcription factor                223   5e-69    
ref|XP_010025293.1|  PREDICTED: agamous-like MADS-box protein AGL...    224   7e-69    
gb|AGT20513.1|  SEP3                                                    223   8e-69    
ref|XP_010531071.1|  PREDICTED: developmental protein SEPALLATA 3...    223   1e-68    
ref|XP_009102995.1|  PREDICTED: agamous-like MADS-box protein AGL...    223   2e-68    
ref|XP_009113783.1|  PREDICTED: agamous-like MADS-box protein AGL...    222   2e-68    
gb|ABS17562.1|  SEPALLATA 3-like protein                                221   3e-68    Platanus x hispanica [London plane tree]
ref|XP_008801850.1|  PREDICTED: agamous-like MADS-box protein AGL...    223   4e-68    
sp|O04067.1|AGL9_SINAL  RecName: Full=Agamous-like MADS-box prote...    222   4e-68    Sinapis alba [bai jie]
ref|XP_010499198.1|  PREDICTED: developmental protein SEPALLATA 3...    221   4e-68    
ref|XP_010478051.1|  PREDICTED: developmental protein SEPALLATA 3...    221   4e-68    
ref|XP_010499197.1|  PREDICTED: developmental protein SEPALLATA 3...    221   5e-68    
dbj|BAG50409.1|  MADS-box transcription factor                          220   6e-68    Cardamine sp. SIM-2007
ref|XP_010913018.1|  PREDICTED: agamous-like MADS-box protein AGL...    221   6e-68    
ref|XP_010460481.1|  PREDICTED: developmental protein SEPALLATA 3...    221   7e-68    
ref|XP_010460482.1|  PREDICTED: developmental protein SEPALLATA 3...    221   7e-68    
gb|AAX53102.1|  AGL9-like protein                                       220   9e-68    Eupomatia bennettii
emb|CDY03905.1|  BnaC07g11300D                                          221   9e-68    
ref|XP_009102994.1|  PREDICTED: agamous-like MADS-box protein AGL...    221   1e-67    
gb|AIU94434.1|  MADS-box transcription factor 2 isoform 2               220   1e-67    
emb|CDY27603.1|  BnaA09g28040D                                          220   1e-67    
gb|ADJ67238.1|  MADS box transcription factor 6                         219   2e-67    
gb|AHM92084.1|  MADS-box protein 8                                      219   3e-67    
emb|CDY15724.1|  BnaA07g08950D                                          219   3e-67    
gb|AIU94432.1|  MADS-box transcription factor 2 isoform 3               219   4e-67    
gb|ADD25199.1|  SEP3                                                    218   5e-67    Nuphar advena
gb|ACA24481.1|  agamous-like 9 protein 1                                218   5e-67    
gb|ABD62861.1|  SEP3.1                                                  218   6e-67    Persea borbonia [red bay]
emb|CDX84935.1|  BnaC05g21200D                                          219   6e-67    
gb|AAP20094.1|  MADS4                                                   215   7e-67    Vitis vinifera
gb|AAZ95252.1|  MADS box protein SEP1                                   218   8e-67    Dendrobium crumenatum
ref|XP_008801853.1|  PREDICTED: agamous-like MADS-box protein AGL...    218   9e-67    
gb|AAX15916.1|  AGL9                                                    216   9e-67    Amborella trichopoda
ref|XP_009113782.1|  PREDICTED: agamous-like MADS-box protein AGL...    218   1e-66    
gb|AAX53104.1|  AGL9-like protein                                       216   2e-66    Magnolia grandiflora [southern magnolia]
ref|XP_010478049.1|  PREDICTED: developmental protein SEPALLATA 3...    217   2e-66    
gb|AIU94430.1|  MADS-box transcription factor 2 isoform 2               217   2e-66    
ref|XP_010478050.1|  PREDICTED: developmental protein SEPALLATA 3...    217   2e-66    
gb|ACB69509.1|  SEPALLATA3-like MADS-box protein                        217   2e-66    Crocus sativus [saffron crocus]
ref|XP_010499195.1|  PREDICTED: developmental protein SEPALLATA 3...    217   2e-66    
ref|XP_006848294.1|  hypothetical protein AMTR_s00013p00103080          216   3e-66    
ref|XP_006415782.1|  hypothetical protein EUTSA_v10008591mg             214   3e-66    
gb|AHW52536.1|  SEPALLATA-like MADS-box protein 1                       216   4e-66    
gb|AIU94765.1|  class E MADS-domain transcription factor                215   4e-66    
ref|XP_010460480.1|  PREDICTED: developmental protein SEPALLATA 3...    216   4e-66    
gb|ABC70706.1|  MADS-box transcription factor                           216   5e-66    Asparagus virgatus
ref|XP_009419371.1|  PREDICTED: agamous-like MADS-box protein AGL...    215   1e-65    
gb|AAQ83834.1|  MADS box protein                                        215   1e-65    Asparagus officinalis
gb|ACB69510.1|  SEPALLATA3-like MADS-box protein                        215   1e-65    Crocus sativus [saffron crocus]
ref|NP_001185081.1|  MADs box transcription factor SEPALLATA3           214   1e-65    
gb|AHJ80843.1|  SEPALLATA3                                              214   3e-65    
gb|AIU94763.1|  class E MADS-domain transcription factor                213   3e-65    
gb|AFH66785.1|  SEP-like MADS-box protein                               214   3e-65    
gb|AEX92976.1|  MADS box protein 1                                      213   5e-65    
gb|ACA24482.1|  agamous-like 9 protein 2                                213   5e-65    
gb|ACJ64681.1|  MADS-box protein MADS4                                  213   5e-65    Musa acuminata AAA Group [Cavendish banana]
ref|XP_008801855.1|  PREDICTED: agamous-like MADS-box protein AGL...    212   5e-65    
sp|Q42464.1|AGL9_SOLLC  RecName: Full=Agamous-like MADS-box prote...    213   7e-65    Solanum lycopersicum
ref|XP_010478048.1|  PREDICTED: developmental protein SEPALLATA 3...    213   2e-64    
dbj|BAC80253.1|  MADS-box transcription factor                          211   4e-64    Houttuynia cordata [chameleon-plant]
sp|Q38694.1|AGL9_ARADE  RecName: Full=Agamous-like MADS-box prote...    211   7e-64    x Aranda deborah
ref|NP_001242742.1|  uncharacterized protein LOC100805078               208   4e-63    
dbj|BAM34479.1|  MADS-box transcription factor                          208   8e-63    
ref|XP_009109826.1|  PREDICTED: agamous-like MADS-box protein AGL...    208   8e-63    
dbj|BAL05005.1|  putative MADS box protein                              207   2e-62    
gb|ABC70710.1|  MADS-box transcription factor                           207   2e-62    Asparagus officinalis
gb|AIU94761.1|  class E MADS-domain transcription factor                206   3e-62    
gb|AHY82573.1|  MADS-box protein 6                                      206   6e-62    
ref|XP_010499201.1|  PREDICTED: developmental protein SEPALLATA 3...    205   8e-62    
ref|XP_010499200.1|  PREDICTED: developmental protein SEPALLATA 3...    205   9e-62    
emb|CDY11824.1|  BnaC03g57540D                                          204   2e-61    
ref|XP_009109825.1|  PREDICTED: agamous-like MADS-box protein AGL...    203   5e-61    
gb|AHM92085.1|  MADS-box protein 9                                      203   6e-61    
gb|AGV31155.1|  E-class MADS-box protein                                202   1e-60    
gb|ACB69511.1|  SEPALLATA3-like MADS-box protein                        201   2e-60    Crocus sativus [saffron crocus]
gb|AAX15922.1|  AGL2                                                    201   2e-60    Acorus americanus [sweetflag]
gb|ABC70707.1|  MADS-box transcription factor                           201   3e-60    Asparagus virgatus
ref|XP_010260833.1|  PREDICTED: MADS-box protein CMB1                   201   4e-60    
ref|XP_008801851.1|  PREDICTED: agamous-like MADS-box protein AGL...    201   5e-60    
ref|XP_002299317.2|  hypothetical protein POPTR_0001s13650g             197   1e-59    Populus trichocarpa [western balsam poplar]
gb|ADD25197.1|  SEP2                                                    199   1e-59    Nuphar advena
ref|XP_006305560.1|  hypothetical protein CARUB_v100101340mg            199   2e-59    
ref|NP_001268109.1|  MADS-box protein 2                                 199   2e-59    
ref|XP_010257958.1|  PREDICTED: developmental protein SEPALLATA 1       199   2e-59    
gb|AIE44769.1|  putative MADS-domain transcription factor AGL2          199   2e-59    
gb|ACB69512.1|  SEPALLATA3-like MADS-box protein                        198   3e-59    Crocus sativus [saffron crocus]
ref|XP_006385890.1|  hypothetical protein POPTR_0003s16810g             197   4e-59    
ref|XP_008801854.1|  PREDICTED: agamous-like MADS-box protein AGL...    196   1e-58    
gb|EPS62764.1|  hypothetical protein M569_12026                         193   1e-58    
gb|ADD25177.1|  SEP1-1                                                  196   2e-58    Cabomba caroliniana
gb|AHW52538.1|  SEPALLATA-like MADS-box protein 3                       196   3e-58    
ref|XP_010660492.1|  PREDICTED: MADS-box protein 2 isoform X1           196   4e-58    
gb|AFO68778.1|  agamous-like protein 2                                  195   5e-58    
gb|ACD39982.1|  MADS1                                                   195   6e-58    Carica papaya [mamon]
gb|AAY21913.2|  putative MADS box protein                               194   2e-57    Musa acuminata [banana]
ref|XP_010694125.1|  PREDICTED: developmental protein SEPALLATA 1...    192   8e-57    
ref|XP_009405081.1|  PREDICTED: agamous-like MADS-box protein AGL...    191   2e-56    
ref|XP_010694117.1|  PREDICTED: developmental protein SEPALLATA 1...    191   2e-56    
gb|AAX15921.1|  AGL2                                                    189   3e-56    Nuphar advena
ref|XP_006856372.1|  hypothetical protein AMTR_s00047p00190220          190   5e-56    
gb|AFO68790.1|  agamous-like protein 234                                189   6e-56    
ref|XP_010694134.1|  PREDICTED: developmental protein SEPALLATA 1...    190   7e-56    
gb|ADD25207.1|  SEP1                                                    188   1e-55    Nymphaea odorata [American white water-lily]
ref|XP_006593703.1|  PREDICTED: developmental protein SEPALLATA 1...    189   1e-55    
ref|XP_006603756.1|  PREDICTED: MADS-box protein isoform X1             189   2e-55    
ref|XP_011021072.1|  PREDICTED: developmental protein SEPALLATA 2...    189   2e-55    
gb|KCW86945.1|  hypothetical protein EUGRSUZ_B03515                     186   2e-55    
ref|XP_007139420.1|  hypothetical protein PHAVU_008G027900g             187   6e-55    
ref|XP_009384296.1|  PREDICTED: MADS-box transcription factor 8-like    187   6e-55    
ref|XP_007032865.1|  K-box region and MADS-box transcription fact...    187   6e-55    
ref|XP_011014957.1|  PREDICTED: developmental protein SEPALLATA 2...    187   7e-55    
ref|XP_003544012.1|  PREDICTED: developmental protein SEPALLATA 1...    187   8e-55    
gb|ADD25178.1|  SEP1-2                                                  186   8e-55    Cabomba caroliniana
ref|XP_003621519.1|  MADS-box protein                                   187   1e-54    
ref|NP_001238296.1|  MADS-box protein                                   187   1e-54    
gb|KHN29767.1|  Developmental protein SEPALLATA 2                       187   1e-54    
ref|XP_004154725.1|  PREDICTED: developmental protein SEPALLATA 2...    186   2e-54    
gb|ADD25190.1|  SEP1                                                    186   2e-54    Nelumbo nucifera [Indian lotus]
emb|CAN59955.1|  hypothetical protein VITISV_006723                     186   2e-54    Vitis vinifera
ref|XP_003531877.1|  PREDICTED: developmental protein SEPALLATA 1...    186   2e-54    
gb|AET98846.1|  SEPALLATA1                                              186   3e-54    
gb|ACO72983.1|  SEP3-like MADS-box protein                              186   3e-54    Alpinia hainanensis [cao dou kou]
emb|CAE46179.1|  AGL2-like MADS box transcription factor                184   3e-54    Elaeis guineensis
ref|XP_006585806.1|  PREDICTED: developmental protein SEPALLATA 1...    185   5e-54    
gb|AAX53103.1|  AGL2-like protein                                       184   5e-54    
gb|ABQ85952.1|  MADS-box transcription factor SEP-like 3                184   6e-54    
gb|ADC79707.1|  SEPALLATA1-like protein                                 185   6e-54    
ref|NP_001267667.1|  developmental protein SEPALLATA 2-like             185   6e-54    
gb|ADR83588.1|  Sepallata 1-like protein                                184   8e-54    
gb|KEH25149.1|  MADS-box transcription factor                           185   8e-54    
gb|ADD25179.1|  SEP1-3                                                  184   9e-54    
gb|AHH28301.1|  MADS-box transcription factor                           183   2e-53    
ref|XP_004491903.1|  PREDICTED: developmental protein SEPALLATA 1...    184   2e-53    
gb|AFO68791.1|  agamous-like protein 234                                183   3e-53    
dbj|BAC80255.1|  MADS-box transcription factor                          183   3e-53    
ref|XP_007151389.1|  hypothetical protein PHAVU_004G042300g             183   4e-53    
gb|AGV54737.1|  developmental protein SEPALLATA 2-like protein          183   4e-53    
sp|Q0J466.2|MADS7_ORYSJ  RecName: Full=MADS-box transcription fac...    183   4e-53    
gb|AAQ83836.1|  MADS box protein                                        182   6e-53    
dbj|BAM34480.1|  MADS-box transcription factor                          182   6e-53    
gb|AAC49816.2|  MADS box protein                                        183   6e-53    
ref|XP_004507289.1|  PREDICTED: developmental protein SEPALLATA 1...    182   7e-53    
gb|AAD38370.1|  MADS-box protein FDRMADS1                               182   7e-53    
ref|XP_004507287.1|  PREDICTED: developmental protein SEPALLATA 1...    182   8e-53    
gb|AES77737.2|  MADS-box transcription factor                           182   1e-52    
gb|AFK42306.1|  unknown                                                 182   1e-52    
gb|AFU81295.1|  SEPALLATA1                                              182   1e-52    
ref|XP_002306051.2|  hypothetical protein POPTR_0004s11440g             182   1e-52    
ref|XP_006602962.1|  PREDICTED: developmental protein SEPALLATA 1...    182   1e-52    
gb|AHH28254.1|  MADS-box transcription factor                           181   1e-52    
gb|AHH28272.1|  MADS-box transcription factor                           181   1e-52    
ref|XP_008464576.1|  PREDICTED: developmental protein SEPALLATA 1...    181   1e-52    
ref|XP_004491904.1|  PREDICTED: developmental protein SEPALLATA 1...    181   2e-52    
emb|CAA75241.1|  M79 protein                                            181   3e-52    
gb|EYU33465.1|  hypothetical protein MIMGU_mgv1a0126182mg               177   3e-52    
gb|AHH28266.1|  MADS-box transcription factor                           180   4e-52    
ref|XP_009373783.1|  PREDICTED: developmental protein SEPALLATA 1...    180   4e-52    
ref|XP_004507288.1|  PREDICTED: developmental protein SEPALLATA 1...    180   6e-52    
gb|AAF12701.2|  Apetala 1 protein                                       179   6e-52    
gb|EEE69055.1|  hypothetical protein OsJ_28057                          182   7e-52    
ref|XP_009373782.1|  PREDICTED: developmental protein SEPALLATA 1...    180   7e-52    
gb|AAC25922.1|  MADS-box protein 1                                      179   8e-52    
ref|XP_003552609.1|  PREDICTED: developmental protein SEPALLATA 1...    179   9e-52    
gb|ADC79694.1|  SEPALLATA1-like protein                                 179   1e-51    
gb|AAQ01163.1|  MADS box protein                                        179   1e-51    
gb|AAL08423.2|AF185574_1  transcription factor MAGL4                    179   1e-51    
gb|AAX69068.1|  MADS box protein M6                                     179   1e-51    
gb|ABG78619.1|  MADS4                                                   179   2e-51    
gb|AAP83390.1|  SEPALLATA1-like MADS-box                                178   2e-51    
ref|XP_006659622.1|  PREDICTED: MADS-box transcription factor 7-like    178   2e-51    
ref|XP_007151388.1|  hypothetical protein PHAVU_004G042300g             177   3e-51    
ref|XP_007158666.1|  hypothetical protein PHAVU_002G1723001g            175   3e-51    
ref|NP_001280893.1|  developmental protein SEPALLATA 1                  178   3e-51    
ref|XP_007158665.1|  hypothetical protein PHAVU_002G1723001g            174   3e-51    
ref|XP_010558530.1|  PREDICTED: developmental protein SEPALLATA 1       177   4e-51    
emb|CAC37398.1|  MADS2 protein                                          176   6e-51    
ref|XP_008341807.1|  PREDICTED: developmental protein SEPALLATA 1...    177   6e-51    
emb|CDY34718.1|  BnaA01g33070D                                          177   7e-51    
ref|XP_008230291.1|  PREDICTED: developmental protein SEPALLATA 1...    176   1e-50    
ref|XP_007215876.1|  hypothetical protein PRUPE_ppa010548mg             176   1e-50    
gb|AAP83375.1|  SEPALLATA1-like MADS-box                                175   1e-50    
gb|ADC79693.1|  SEPALLATA1-like protein                                 176   1e-50    
ref|XP_006660815.1|  PREDICTED: MADS-box transcription factor 8-like    176   2e-50    
gb|ADN37686.1|  SEP3                                                    173   2e-50    
gb|AHC54178.1|  sepallata-like MADS box transcription factor 3          173   2e-50    
ref|XP_006408426.1|  hypothetical protein EUTSA_v10021390mg             176   2e-50    
gb|AHH28302.1|  MADS-box transcription factor                           175   2e-50    
ref|XP_008811033.1|  PREDICTED: agamous-like MADS-box protein AGL...    176   3e-50    
dbj|BAG50408.1|  MADS-box transcription factor                          174   4e-50    
ref|XP_009378252.1|  PREDICTED: developmental protein SEPALLATA 1...    175   4e-50    
gb|AEJ76841.1|  MADS17                                                  175   4e-50    
gb|AAQ72498.1|  MADS-box protein 12                                     175   5e-50    
ref|XP_008811035.1|  PREDICTED: agamous-like MADS-box protein AGL...    175   5e-50    
gb|ACB45304.1|  MIKC-type MADS-box transcription factor WM10A           175   5e-50    
ref|XP_008811034.1|  PREDICTED: agamous-like MADS-box protein AGL...    174   7e-50    
ref|XP_009117898.1|  PREDICTED: developmental protein SEPALLATA 2       174   8e-50    
dbj|BAC80254.1|  MADS-box transcription factor                          174   8e-50    
gb|AAC78282.1|  MADS box protein                                        172   1e-49    
gb|AAY30858.1|  MADS-box transcription factor                           174   1e-49    
ref|XP_008230292.1|  PREDICTED: developmental protein SEPALLATA 1...    174   1e-49    
gb|KHG17252.1|  Developmental SEPALLATA 2 -like protein                 174   1e-49    
gb|AGT20511.1|  SEP2.a                                                  174   1e-49    
ref|XP_010549963.1|  PREDICTED: developmental protein SEPALLATA 1       174   1e-49    
gb|KDP24297.1|  hypothetical protein JCGZ_25593                         174   2e-49    
ref|XP_010315869.1|  PREDICTED: MADS-box protein isoform X1             174   2e-49    
gb|AFM30904.1|  transcription factor MADS4                              173   2e-49    
ref|XP_006430949.1|  hypothetical protein CICLE_v10012593mg             173   2e-49    
gb|AHC54165.1|  sepallata-like MADS box transcription factor 3          171   2e-49    
gb|AEY68241.1|  SEPALLATA3                                              169   2e-49    
ref|XP_010485469.1|  PREDICTED: developmental protein SEPALLATA 2       173   3e-49    
ref|XP_008811037.1|  PREDICTED: agamous-like MADS-box protein AGL...    173   3e-49    
ref|XP_010463632.1|  PREDICTED: developmental protein SEPALLATA 2...    173   3e-49    
gb|AAZ77748.1|  AGL2-like MADS box 3                                    172   3e-49    
emb|CDY57524.1|  BnaA05g33600D                                          173   4e-49    
ref|NP_001234201.1|  TAGL2 transcription factor                         172   4e-49    
gb|AHC54144.1|  sepallata-like MADS box transcription factor 3          170   5e-49    
ref|XP_010532442.1|  PREDICTED: developmental protein SEPALLATA 3...    170   6e-49    
ref|XP_006482430.1|  PREDICTED: developmental protein SEPALLATA 1...    172   6e-49    
ref|XP_004957289.1|  PREDICTED: MADS-box transcription factor 8-l...    172   6e-49    
gb|AHC54171.1|  sepallata-like MADS box transcription factor 3          169   6e-49    
gb|AAL14197.1|  SEPELLATA3-like MADS-box protein                        169   6e-49    
ref|XP_008230289.1|  PREDICTED: developmental protein SEPALLATA 1...    172   7e-49    
ref|XP_010099309.1|  Developmental protein SEPALLATA 2                  172   7e-49    
gb|AHM92083.1|  MADS-box protein 7                                      172   8e-49    
gb|AAQ11687.1|  MADS box protein                                        172   8e-49    
ref|XP_007215877.1|  hypothetical protein PRUPE_ppa010548mg             172   9e-49    
gb|AAP83376.1|  SEPALLATA1-like MADS-box                                171   9e-49    
ref|XP_006338336.1|  PREDICTED: developmental protein SEPALLATA 1...    172   9e-49    
ref|XP_006298399.1|  hypothetical protein CARUB_v10014470mg             172   9e-49    
ref|XP_010029406.1|  PREDICTED: developmental protein SEPALLATA 1       171   1e-48    
emb|CAA04920.1|  MdMADS9                                                171   1e-48    
gb|ADL36751.1|  MADS domain class transcription factor                  171   1e-48    
ref|XP_004304204.1|  PREDICTED: developmental protein SEPALLATA 2...    171   1e-48    
gb|AGW23364.1|  MADS box protein MADS62                                 171   1e-48    
gb|AAU82009.1|  SEPALLATA2                                              171   1e-48    
gb|ADL36750.1|  MADS domain class transcription factor                  171   1e-48    
ref|XP_008357795.1|  PREDICTED: LOW QUALITY PROTEIN: developmenta...    171   1e-48    
ref|NP_001233911.1|  MADS-box protein                                   171   2e-48    
ref|NP_186880.1|  developmental protein SEPALLATA 2                     171   2e-48    
ref|XP_010470619.1|  PREDICTED: developmental protein SEPALLATA 2...    171   2e-48    
gb|AAO42085.1|  putative floral homeotic protein AGL4                   171   2e-48    
gb|ABD60322.1|  SEP2                                                    171   3e-48    
ref|XP_002884314.1|  SEPALLATA2                                         170   3e-48    
gb|EEC84853.1|  hypothetical protein OsI_31966                          170   4e-48    
gb|ACF78403.1|  unknown                                                 169   5e-48    
gb|AEF59025.1|  MADS-1                                                  170   5e-48    
ref|XP_008230290.1|  PREDICTED: developmental protein SEPALLATA 1...    169   6e-48    
gb|AAB53193.1|  MADS box protein                                        169   6e-48    
ref|XP_004957288.1|  PREDICTED: MADS-box transcription factor 8-l...    169   6e-48    
dbj|BAD10944.1|  SEPALLATA1 homologous protein                          170   6e-48    
gb|AHC54161.1|  sepallata-like MADS box transcription factor 3          167   6e-48    
ref|NP_001063613.1|  Os09g0507200                                       169   6e-48    
gb|AHC54154.1|  sepallata-like MADS box transcription factor 3          167   7e-48    
gb|AAU82031.1|  SEPALLATA2                                              169   7e-48    
gb|AHC54147.1|  sepallata-like MADS box transcription factor 3          167   7e-48    
ref|XP_008365428.1|  PREDICTED: developmental protein SEPALLATA 1...    169   1e-47    
ref|XP_009608616.1|  PREDICTED: developmental protein SEPALLATA 1...    169   1e-47    
dbj|BAM34481.1|  MADS-box transcription factor                          169   1e-47    
emb|CAM59053.1|  MIKC-type MADS-box transcription factor WM10A          169   2e-47    
ref|XP_009147359.1|  PREDICTED: developmental protein SEPALLATA 2...    168   2e-47    
gb|AFX72877.1|  MADS-box protein SEP2A                                  168   2e-47    
gb|ADU56818.1|  MADS-box protein AGL2 subfamily                         166   2e-47    
ref|XP_002460491.1|  hypothetical protein SORBIDRAFT_02g029310          168   2e-47    
gb|AAP83413.1|  SEPALLATA3-like MADS-box                                167   2e-47    
dbj|BAC79181.1|  MADS-box protein                                       167   2e-47    
ref|XP_010532441.1|  PREDICTED: developmental protein SEPALLATA 3...    166   3e-47    
gb|AFO68773.1|  agamous-like protein 2                                  166   5e-47    
gb|ADN37685.1|  SEP3                                                    164   5e-47    
gb|AHC54189.1|  sepallata-like MADS box transcription factor 3          164   5e-47    
gb|ADN37684.1|  SEP3                                                    164   6e-47    
ref|NP_001105525.1|  MADS27                                             167   8e-47    
gb|AHC54174.1|  sepallata-like MADS box transcription factor 3          164   1e-46    
gb|AAA32732.1|  transcription factor                                    166   1e-46    
ref|XP_010936438.1|  PREDICTED: agamous-like MADS-box protein AGL...    166   1e-46    
gb|AHC54180.1|  sepallata-like MADS box transcription factor 3          162   2e-46    
gb|AHC54190.1|  sepallata-like MADS box transcription factor 3          163   2e-46    
ref|XP_009121545.1|  PREDICTED: developmental protein SEPALLATA 1       166   2e-46    
gb|AHC54188.1|  sepallata-like MADS box transcription factor 3          163   2e-46    
ref|XP_009131500.1|  PREDICTED: developmental protein SEPALLATA 1...    166   2e-46    
emb|CDY26462.1|  BnaC09g42060D                                          166   2e-46    
gb|AHC54191.1|  sepallata-like MADS box transcription factor 3          163   3e-46    
gb|AHC54157.1|  sepallata-like MADS box transcription factor 3          163   3e-46    
ref|XP_002263410.2|  PREDICTED: MADS-box protein CMB1                   165   3e-46    
gb|AHC54175.1|  sepallata-like MADS box transcription factor 3          162   3e-46    
ref|XP_009608615.1|  PREDICTED: developmental protein SEPALLATA 1...    165   3e-46    
gb|AHC54155.1|  sepallata-like MADS box transcription factor 3          162   4e-46    
gb|AGT20512.1|  SEP2.b                                                  164   5e-46    
ref|XP_002263039.1|  PREDICTED: MADS-box protein CMB1 isoform X2        164   5e-46    
ref|XP_004974003.1|  PREDICTED: MADS-box transcription factor 7-like    164   6e-46    
ref|NP_001289804.1|  MADS-box transcription factor 8                    164   6e-46    
gb|AHH28303.1|  MADS-box transcription factor                           163   7e-46    
emb|CAM59054.1|  MIKC-type MADS-box transcription factor WM10B          164   7e-46    
dbj|BAF75017.1|  MADS-box protein                                       164   7e-46    
ref|XP_011099040.1|  PREDICTED: developmental protein SEPALLATA 1...    164   9e-46    
gb|KGN53780.1|  hypothetical protein Csa_4G126990                       162   9e-46    
tpg|DAA40489.1|  TPA: zea mays MADS7                                    166   1e-45    
dbj|BAF75018.1|  MADS-box protein                                       164   1e-45    
ref|XP_010233642.1|  PREDICTED: MADS-box transcription factor 7-l...    164   1e-45    
ref|NP_001288311.1|  MADS-box transcription factor 7-like               164   1e-45    
ref|XP_009757151.1|  PREDICTED: developmental protein SEPALLATA 1...    163   1e-45    
gb|AAO45877.1|  MADS5                                                   163   1e-45    
gb|AEW50208.1|  SEP1                                                    163   1e-45    
gb|AHC54173.1|  sepallata-like MADS box transcription factor 3          159   1e-45    
ref|XP_011099041.1|  PREDICTED: developmental protein SEPALLATA 1...    163   1e-45    
ref|XP_002873742.1|  hypothetical protein ARALYDRAFT_909555             163   1e-45    
ref|XP_007209505.1|  hypothetical protein PRUPE_ppa010391mg             163   2e-45    
gb|AFO68772.1|  agamous-like protein 2                                  162   2e-45    
dbj|BAF75016.1|  MADS-box protein                                       163   2e-45    
ref|NP_001062335.1|  Os08g0531700                                       165   2e-45    
gb|KCW48935.1|  hypothetical protein EUGRSUZ_K02546                     163   2e-45    
gb|KFK25803.1|  hypothetical protein AALP_AA8G163200                    163   2e-45    
gb|AHC54158.1|  sepallata-like MADS box transcription factor 3          159   2e-45    
emb|CAH04878.1|  MADS domain protein                                    163   2e-45    
gb|AHC54185.1|  sepallata-like MADS box transcription factor 3          159   2e-45    
gb|EMS49687.1|  MADS-box transcription factor 7                         163   3e-45    
gb|EYU33464.1|  hypothetical protein MIMGU_mgv1a0126182mg               159   3e-45    
gb|AHC54143.1|  sepallata-like MADS box transcription factor 3          158   3e-45    
gb|ADV90800.1|  SEP3-like protein                                       162   4e-45    
gb|AHC54146.1|  sepallata-like MADS box transcription factor 3          158   4e-45    
emb|CDP02339.1|  unnamed protein product                                162   4e-45    
gb|ABF57918.1|  MADS-box transcription factor TaAGL16                   162   4e-45    
emb|CAB97355.1|  MADS-box protein 9                                     162   4e-45    
gb|AFS60086.1|  MADS box transcription factor SEP1                      162   5e-45    
gb|AIU94287.1|  SEPALLATA1-like protein                                 162   5e-45    
gb|AHC54169.1|  sepallata-like MADS box transcription factor 3          158   5e-45    
gb|AHC54172.1|  sepallata-like MADS box transcription factor 3          157   5e-45    
gb|AFO68782.1|  floral-binding protein 9                                161   6e-45    
gb|AAK21248.1|AF335235_1  MADS-box transcription factor FBP5            162   6e-45    
gb|AHW58036.1|  SEP1/2                                                  162   6e-45    
gb|AHC54145.1|  sepallata-like MADS box transcription factor 3          157   6e-45    
gb|AHC54183.1|  sepallata-like MADS box transcription factor 3          157   6e-45    
gb|ABF57932.1|  MADS-box transcription factor TaAGL30                   161   7e-45    
gb|AHC54164.1|  sepallata-like MADS box transcription factor 3          157   7e-45    
gb|AHC54153.1|  sepallata-like MADS box transcription factor 3          157   8e-45    
gb|AHC54170.1|  sepallata-like MADS box transcription factor 3          157   8e-45    
gb|AAT37484.1|  MADS5 protein                                           161   9e-45    
ref|XP_004299281.1|  PREDICTED: MADS-box protein CMB1-like              161   9e-45    
gb|AHC54162.1|  sepallata-like MADS box transcription factor 3          157   1e-44    
gb|AAT37483.1|  MADS4 protein                                           161   1e-44    
gb|AAT37486.1|  MADS7 protein                                           161   1e-44    
ref|XP_006400104.1|  hypothetical protein EUTSA_v10014493mg             161   1e-44    
gb|AAO45880.1|  MADS8                                                   160   1e-44    
gb|AHC54177.1|  sepallata-like MADS box transcription factor 3          157   1e-44    
gb|AHC54152.1|  sepallata-like MADS box transcription factor 3          156   1e-44    



>gb|ADU56817.1| MADS-box protein AGL2 subfamily [Coffea arabica]
 emb|CDP13360.1| unnamed protein product [Coffea canephora]
Length=241

 Score =   303 bits (776),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 175/196 (89%), Gaps = 5/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ+MLDQL DLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQVMLDQLTDLQRKEHALNEANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRLME  N + L+WNP AQ+V YGRQ  H + GD GFFH L+CEPTLQIGYQ D  ITV
Sbjct  170  KQRLME-GNQVNLQWNPNAQDVGYGRQPAH-AQGD-GFFHPLDCEPTLQIGYQND-PITV  225

Query  170  AAAGPSVNNFMPEWYP  123
            AAAGPSVNN+M  W P
Sbjct  226  AAAGPSVNNYMAGWLP  241



>gb|AEA76419.1| putative SEP3, partial [Catharanthus roseus]
Length=223

 Score =   295 bits (756),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 172/196 (88%), Gaps = 5/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSS LKTLERYQKCNYGAPEPN+STREAL EISSQQEYLKLKARYEALQRS
Sbjct  33   RGKLYEFCSSSSTLKTLERYQKCNYGAPEPNVSTREAL-EISSQQEYLKLKARYEALQRS  91

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQL DLQRKE  LNEANKSL
Sbjct  92   QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDLQRKEQALNEANKSL  151

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRLME  N ++L+WNP  Q+V YGRQ   Q  GD GFFH LECEPTLQIGYQ D  ITV
Sbjct  152  KQRLME-GNQISLQWNPNPQDVGYGRQG-GQPQGD-GFFHPLECEPTLQIGYQND-PITV  207

Query  170  AAAGPSVNNFMPEWYP  123
            AAAGPS+NN+M  W P
Sbjct  208  AAAGPSMNNYMAGWLP  223



>ref|XP_009600809.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Nicotiana 
tomentosiformis]
Length=242

 Score =   295 bits (756),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 170/196 (87%), Gaps = 4/196 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NISTREAL EISSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREAL-EISSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQL DLQRKEH LNEAN++L
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDLQRKEHALNEANRTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRLME  + L L+W   AQ+V YGRQ   Q+ GD GFFH LECEPTLQIGYQ D  ITV
Sbjct  170  KQRLME-GSQLNLQWQQNAQDVGYGRQTT-QTQGD-GFFHPLECEPTLQIGYQNDPIITV  226

Query  170  AAAGPSVNNFMPEWYP  123
              AGPSVNN+M  W P
Sbjct  227  GGAGPSVNNYMAGWLP  242



>ref|NP_001234384.1| agamous-like MADS-box protein AGL9 homolog [Solanum lycopersicum]
 gb|AAP57413.1| MADS-box protein 5 [Solanum lycopersicum]
Length=241

 Score =   295 bits (754),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 170/196 (87%), Gaps = 5/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL EISSQQEYLKLK RYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL-EISSQQEYLKLKGRYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQL D QRKEH LNEAN++L
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDYQRKEHALNEANRTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRLME  + L L+W P AQ+V YGRQ   Q+ GD GFFH L+CEPTLQIGYQ D  ITV
Sbjct  170  KQRLME-GSQLNLQWQPNAQDVGYGRQTT-QTQGD-GFFHPLDCEPTLQIGYQND-PITV  225

Query  170  AAAGPSVNNFMPEWYP  123
              AGPSVNN+M  W P
Sbjct  226  GGAGPSVNNYMAGWLP  241



>gb|AAP83377.1| SEPALLATA3-like MADS-box [Solanum lycopersicum]
Length=210

 Score =   293 bits (750),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 170/196 (87%), Gaps = 5/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL EISSQQEYLKLK RYEALQRS
Sbjct  20   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL-EISSQQEYLKLKGRYEALQRS  78

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQL D QRKEH LNEAN++L
Sbjct  79   QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDYQRKEHALNEANRTL  138

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRLME  + L L+W P AQ+V YGRQ   Q+ GD GFFH L+CEPTLQIGYQ D  ITV
Sbjct  139  KQRLME-GSQLNLQWQPNAQDVGYGRQTT-QTQGD-GFFHPLDCEPTLQIGYQND-PITV  194

Query  170  AAAGPSVNNFMPEWYP  123
              AGPSVNN+M  W P
Sbjct  195  GGAGPSVNNYMAGWLP  210



>gb|AHW58034.1| SEP3 [Coffea arabica]
Length=246

 Score =   294 bits (752),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 174/201 (87%), Gaps = 10/201 (5%)
 Frame = -3

Query  710  RGKLYEFCSSS-----SMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYE  546
            RGKLYEFCSSS     SMLKTLERYQKCNYGAPEPNISTREAL E+SSQQEYLKLKARYE
Sbjct  51   RGKLYEFCSSSRVTLYSMLKTLERYQKCNYGAPEPNISTREAL-ELSSQQEYLKLKARYE  109

Query  545  ALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNE  366
            ALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ+MLDQL DLQRKEH LNE
Sbjct  110  ALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQVMLDQLTDLQRKEHALNE  169

Query  365  ANKSLKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTD  186
            ANK+LKQRLME  N + L+WNP AQ+V YGRQ  H + GD GFFH L+CEP LQIGYQ D
Sbjct  170  ANKTLKQRLME-GNQVNLQWNPNAQDVGYGRQPAH-AQGD-GFFHPLDCEPPLQIGYQND  226

Query  185  HHITVAAAGPSVNNFMPEWYP  123
              ITVAAAGPSVNN+M  W P
Sbjct  227  -PITVAAAGPSVNNYMAGWLP  246



>ref|XP_006352168.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Solanum 
tuberosum]
Length=241

 Score =   293 bits (751),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 170/196 (87%), Gaps = 5/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL EISSQQEYLKLK RYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL-EISSQQEYLKLKGRYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQL D QRKEH LNEAN++L
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDHQRKEHALNEANRTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRLME  + L L+W P AQ+V YGRQ   Q+ GD GFFH L+CEPTLQIGYQ D  ITV
Sbjct  170  KQRLME-GSQLNLQWQPNAQDVGYGRQTT-QNQGD-GFFHPLDCEPTLQIGYQND-PITV  225

Query  170  AAAGPSVNNFMPEWYP  123
              AGPSVNN+M  W P
Sbjct  226  GGAGPSVNNYMAGWLP  241



>sp|Q03489.2|AGL9_PETHY RecName: Full=Agamous-like MADS-box protein AGL9 homolog; AltName: 
Full=Floral homeotic protein FBP2; AltName: Full=Floral-binding 
protein 2 [Petunia x hybrida]
 gb|AAA86854.1| transcription factor [Petunia x hybrida]
Length=241

 Score =   292 bits (748),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 171/196 (87%), Gaps = 5/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NISTREAL EISSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREAL-EISSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQL DLQRKEH LNEAN++L
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRLME +  L L+W   AQ+V YGRQA  Q+ GD GFFH LECEPTLQIGYQ D  ITV
Sbjct  170  KQRLMEGST-LNLQWQQNAQDVGYGRQAT-QTQGD-GFFHPLECEPTLQIGYQND-PITV  225

Query  170  AAAGPSVNNFMPEWYP  123
              AGPSVNN+M  W P
Sbjct  226  GGAGPSVNNYMAGWLP  241



>gb|AAP83395.1| SEPALLATA3-like MADS-box [Petunia x hybrida]
Length=210

 Score =   291 bits (745),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 171/196 (87%), Gaps = 5/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NISTREAL EISSQQEYLKLKARYEALQRS
Sbjct  20   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREAL-EISSQQEYLKLKARYEALQRS  78

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQL DLQRKEH LNEAN++L
Sbjct  79   QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTL  138

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRLME +  L L+W   AQ+V YGRQA  Q+ GD GFFH LECEPTLQIGYQ D  ITV
Sbjct  139  KQRLMEGST-LNLQWQQNAQDVGYGRQAT-QTQGD-GFFHPLECEPTLQIGYQND-PITV  194

Query  170  AAAGPSVNNFMPEWYP  123
              AGPSVNN+M  W P
Sbjct  195  GGAGPSVNNYMAGWLP  210



>emb|CBI27678.3| unnamed protein product [Vitis vinifera]
Length=242

 Score =   292 bits (747),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 171/196 (87%), Gaps = 4/196 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL++KELESLERQLD+SLKQIRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSTKELESLERQLDVSLKQIRSTRTQYMLDQLTDLQRKEHMLNEANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRL+E      L+WNP AQ+V YGRQ   Q  GD GFFH LECEPTLQIGYQ D  ITV
Sbjct  170  KQRLLEGTQVNQLQWNPNAQDVGYGRQQ-AQPQGD-GFFHPLECEPTLQIGYQPD-PITV  226

Query  170  AAAGPSVNNFMPEWYP  123
            AAAGPSVNN+MP W P
Sbjct  227  AAAGPSVNNYMPGWLP  242



>dbj|BAG55316.1| transcription factor [Petunia integrifolia subsp. inflata]
 dbj|BAG55317.1| transcription factor [Petunia integrifolia subsp. inflata]
Length=240

 Score =   290 bits (742),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 170/194 (88%), Gaps = 5/194 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NISTREAL EISSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREAL-EISSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQL DLQRKEH LNEAN++L
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRLME +  L L+W   AQ+V YGRQA  Q+ GD GFFH LECEPTLQIGYQ D  ITV
Sbjct  170  KQRLMEGST-LNLQWQQNAQDVGYGRQAT-QTQGD-GFFHPLECEPTLQIGYQND-PITV  225

Query  170  AAAGPSVNNFMPEW  129
              AGPSVNN+M  W
Sbjct  226  GGAGPSVNNYMAGW  239



>ref|NP_001289529.1| agamous-like MADS-box protein AGL9 homolog [Nicotiana sylvestris]
 gb|AAD39034.1|AF068722_1 MADS-box protein MADS3 [Nicotiana sylvestris]
 gb|AFY06679.1| sepallata3-like MADS-box [Nicotiana tabacum]
Length=241

 Score =   290 bits (742),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 170/196 (87%), Gaps = 5/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NISTREAL EISSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREAL-EISSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQL DLQRKEH LNEAN++L
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDLQRKEHALNEANRTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRLME  + L L+W   AQ++ YGRQ   Q+ GD GFFH LECEPTLQIGYQ D  ITV
Sbjct  170  KQRLME-GSQLNLQWQQNAQDMGYGRQTT-QTQGD-GFFHPLECEPTLQIGYQND-PITV  225

Query  170  AAAGPSVNNFMPEWYP  123
              AGPSVNN+M  W P
Sbjct  226  GGAGPSVNNYMAGWLP  241



>gb|ADP09004.1| SEP3-like protein [Lycium barbarum]
Length=241

 Score =   290 bits (741),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 170/196 (87%), Gaps = 5/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYE CSSSSMLKTLERYQKCNYGAPE NISTREAL EISSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYESCSSSSMLKTLERYQKCNYGAPETNISTREAL-EISSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSK+LESLERQLDMSLKQIRSTRTQLMLDQL DLQRKEH LNEAN++L
Sbjct  110  QRNLLGEDLGPLNSKDLESLERQLDMSLKQIRSTRTQLMLDQLTDLQRKEHALNEANRTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRLME  + L L+W P AQ+V YGRQ   Q+ GD GFFH LECEPTLQIGYQ D  ITV
Sbjct  170  KQRLME-GSQLNLQWQPNAQDVGYGRQTT-QTQGD-GFFHPLECEPTLQIGYQND-PITV  225

Query  170  AAAGPSVNNFMPEWYP  123
              AGPSVNN+M  W P
Sbjct  226  GGAGPSVNNYMAGWLP  241



>ref|NP_001268114.1| MADS-box protein 4 [Vitis vinifera]
 gb|AAM21344.1|AF373603_1 MADS-box protein 4 [Vitis vinifera]
Length=242

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 170/196 (87%), Gaps = 4/196 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQ S
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQLS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL++KELESLERQLD+SLKQIRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSTKELESLERQLDVSLKQIRSTRTQYMLDQLTDLQRKEHMLNEANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRL+E      L+WNP AQ+V YGRQ   Q  GD GFFH LECEPTLQIGYQ D  ITV
Sbjct  170  KQRLLEGTQVNQLQWNPNAQDVGYGRQQ-AQPQGD-GFFHPLECEPTLQIGYQPD-PITV  226

Query  170  AAAGPSVNNFMPEWYP  123
            AAAGPSVNN+MP W P
Sbjct  227  AAAGPSVNNYMPGWLP  242



>gb|AAP83410.1| SEPALLATA3-like MADS-box [Syringa vulgaris]
Length=232

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 170/197 (86%), Gaps = 9/197 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSML+TLERY+KCNYGAPEP++S+REAL E+SSQQEYLKLKARYEALQRS
Sbjct  42   RGKLYEFCSSSSMLRTLERYEKCNYGAPEPHVSSREAL-ELSSQQEYLKLKARYEALQRS  100

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L DLQRKEH LNEAN+SL
Sbjct  101  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANQSL  160

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAI-HQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            KQRLME  NH++L+WN   +EV YGR+   HQ    HGFFH LECEPTLQIGYQ D    
Sbjct  161  KQRLME-GNHISLQWNQDPEEVGYGREPTQHQP---HGFFHPLECEPTLQIGYQND---P  213

Query  173  VAAAGPSVNNFMPEWYP  123
            +AAAGPS+NNFM  W P
Sbjct  214  MAAAGPSLNNFMSGWLP  230



>ref|XP_011086825.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Sesamum 
indicum]
Length=242

 Score =   282 bits (721),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 171/198 (86%), Gaps = 8/198 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPE-PNISTREALQEISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSMLKTLERYQKCNYGAP+  N+STREAL E+SSQQEYLKLKARYEALQR
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPDQTNVSTREAL-ELSSQQEYLKLKARYEALQR  109

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L DLQRKEH LNEAN+S
Sbjct  110  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANRS  169

Query  353  LKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            LKQRL+E  + ++L+WNP AQ+V YGR A  Q D   GFFH L+CEPTLQIGYQ D  IT
Sbjct  170  LKQRLIE-GSQVSLQWNPNAQDVGYGRAAQPQPD---GFFHPLDCEPTLQIGYQPD-PIT  224

Query  173  VAAAGPSV-NNFMPEWYP  123
            VAAAGPSV NN++  W P
Sbjct  225  VAAAGPSVNNNYISGWLP  242



>gb|AAP83366.1| SEPALLATA3-like MADS-box [Antirrhinum majus]
Length=204

 Score =   280 bits (717),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 171/198 (86%), Gaps = 7/198 (4%)
 Frame = -3

Query  710  RGKLYEFCSSS-SMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  534
            RGKLYEFCS+S +MLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQR
Sbjct  12   RGKLYEFCSNSGTMLKTLERYQKCNYGAPEANVSTREAL-ELSSQQEYLKLKARYEALQR  70

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L DLQRKEH LNEAN+S
Sbjct  71   SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANRS  130

Query  353  LKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            LK RLME  + ++L+WNP A ++ YGRQA  Q  GD GFFH LECEPTLQ+G+Q++  IT
Sbjct  131  LKHRLME-GSQISLQWNPNAHDMGYGRQAAAQPQGD-GFFHPLECEPTLQMGFQSE--IT  186

Query  173  VAAAGPSVNNF-MPEWYP  123
            V AAGPSVNN+ M  W P
Sbjct  187  VGAAGPSVNNYNMTGWLP  204



>emb|CAA64742.1| DEFH72 [Antirrhinum majus]
Length=243

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 171/198 (86%), Gaps = 7/198 (4%)
 Frame = -3

Query  710  RGKLYEFCSSS-SMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  534
            RGKLYEFCS+S +MLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQR
Sbjct  51   RGKLYEFCSNSGTMLKTLERYQKCNYGAPEANVSTREAL-ELSSQQEYLKLKARYEALQR  109

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L DLQRKEH LNEAN+S
Sbjct  110  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANRS  169

Query  353  LKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            LK RLME  + ++L+WNP A ++ YGRQA  Q  GD GFFH LECEPTLQ+G+Q++  IT
Sbjct  170  LKHRLME-GSQISLQWNPNAHDMGYGRQAAAQPQGD-GFFHPLECEPTLQMGFQSE--IT  225

Query  173  VAAAGPSVNNF-MPEWYP  123
            V AAGPSVNN+ M  W P
Sbjct  226  VGAAGPSVNNYNMTGWLP  243



>gb|AHA87180.1| sepallata 3, partial [Sesamum indicum]
Length=209

 Score =   278 bits (711),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 166/189 (88%), Gaps = 7/189 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPE-PNISTREALQEISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSMLKTLERYQKCNYGAP+  N+STREAL E+SSQQEYLKLKARYEALQR
Sbjct  27   RGKLYEFCSSSSMLKTLERYQKCNYGAPDQTNVSTREAL-ELSSQQEYLKLKARYEALQR  85

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L DLQRKEH LNEAN+S
Sbjct  86   SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANRS  145

Query  353  LKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            LKQRL+E  + ++L+WNP AQ+V YGR A  Q D   GFFH L+CEPTLQIGYQ D  IT
Sbjct  146  LKQRLIE-GSQVSLQWNPNAQDVGYGRAAQPQPD---GFFHPLDCEPTLQIGYQPD-PIT  200

Query  173  VAAAGPSVN  147
            VAAAGPSVN
Sbjct  201  VAAAGPSVN  209



>gb|ADU15477.1| SEP3 [Actinidia chinensis]
Length=245

 Score =   279 bits (714),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 167/197 (85%), Gaps = 3/197 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKL+EFCS+SSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLK RYEALQRS
Sbjct  51   RGKLHEFCSTSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKGRYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHALNEANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQE-VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            KQRL  D+   +L+W+P AQ+ V+Y RQ   Q  G   FFH L+CEP+LQIGYQ +  IT
Sbjct  170  KQRLWGDSQVNSLQWHPNAQDHVDYSRQPA-QPQGGEAFFHPLDCEPSLQIGYQQNDPIT  228

Query  173  VAAAGPSVNNFMPEWYP  123
            V  AGPS+NN+MP W P
Sbjct  229  VGGAGPSLNNYMPGWLP  245



>ref|XP_004140534.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Cucumis 
sativus]
Length=242

 Score =   278 bits (711),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 167/196 (85%), Gaps = 4/196 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRL+E      L+ N +A ++ YGRQ   Q  GD  FFH L+CEPTLQIGYQ D  ITV
Sbjct  170  KQRLVEGYQVNALQLNQSADDMMYGRQQ-AQPPGD-AFFHPLDCEPTLQIGYQPD-PITV  226

Query  170  AAAGPSVNNFMPEWYP  123
              AGPS+NNF+P W P
Sbjct  227  VTAGPSMNNFLPGWLP  242



>dbj|BAK09620.1| MADS-box transcription factor [Cyclamen persicum]
Length=247

 Score =   278 bits (710),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 169/199 (85%), Gaps = 5/199 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS+ S+LKTLERYQKCNYGAPEPN+STREALQE++SQQEYLKLKARYEALQR+
Sbjct  51   RGKLYEFCSNPSILKTLERYQKCNYGAPEPNMSTREALQELNSQQEYLKLKARYEALQRT  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLDQL DLQRKEH LNEAN+SL
Sbjct  111  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHALNEANRSL  170

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIG-YQTDHHIT  174
            +QRLME +N  TL+WN   Q+V+YG+Q        HGFFH L+CEPTLQIG Y T   + 
Sbjct  171  RQRLMEGSNVATLQWNMGGQDVDYGQQQAQPQ--AHGFFHPLDCEPTLQIGSYPTHDQLP  228

Query  173  VAAAGPS-VNNF-MPEWYP  123
            VAAAGPS  NN+ M EW P
Sbjct  229  VAAAGPSGTNNYSMLEWLP  247



>emb|CAL36578.1| deficiens H200 homologue [Misopates orontium]
Length=241

 Score =   277 bits (708),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 166/196 (85%), Gaps = 5/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKL EFCSS+SMLKTLERYQKCNYG PE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLCEFCSSTSMLKTLERYQKCNYGPPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L DLQRKEH LNEAN+SL
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANRSL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            K RLM D + ++L+WNP A++V YGRQ   Q   D GF+H LECEPTL IG+Q D  ITV
Sbjct  170  KHRLM-DGSQISLQWNPNAEDVGYGRQP-SQPSAD-GFYHPLECEPTLHIGFQAD-PITV  225

Query  170  AAAGPSVNNFMPEWYP  123
            A AGPSVNN++  W P
Sbjct  226  AGAGPSVNNYISGWLP  241



>ref|NP_001284431.1| agamous-like MADS-box protein AGL9 homolog [Cucumis melo]
 gb|AGZ03887.1| sepallata 3-like MADS-box protein [Cucumis melo]
Length=242

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 167/196 (85%), Gaps = 4/196 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE+LERQLDMSLKQIRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKELENLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRL+E      L+ N +A ++ YGRQ   Q  GD  FFH L+CEPTLQIGYQ D  ITV
Sbjct  170  KQRLVEGYQVNALQLNQSADDMMYGRQQ-AQPPGD-AFFHPLDCEPTLQIGYQPD-PITV  226

Query  170  AAAGPSVNNFMPEWYP  123
              AGPS+NNF+P W P
Sbjct  227  VTAGPSMNNFLPGWLP  242



>gb|KDP26829.1| hypothetical protein JCGZ_17987 [Jatropha curcas]
Length=257

 Score =   276 bits (707),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 170/210 (81%), Gaps = 17/210 (8%)
 Frame = -3

Query  710  RGKLYEFCSSSS--------------MLKTLERYQKCNYGAPEPNISTREALQEISSQQE  573
            RGKLYEFCSSSS              MLKTLERYQKCNYGAPE N+STREALQE+SSQQE
Sbjct  51   RGKLYEFCSSSSCLTREKETPKNDQCMLKTLERYQKCNYGAPETNVSTREALQELSSQQE  110

Query  572  YLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdl  393
            YLKLKARYEALQRSQRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQL DL
Sbjct  111  YLKLKARYEALQRSQRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQYMLDQLTDL  170

Query  392  QRKEHELNEANKSLKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEP  213
            QRK H LNEANK+LKQRL+E  +  T++ N  A++V +GRQA  Q  GD GFFH LECEP
Sbjct  171  QRKVHMLNEANKTLKQRLVEGYHVNTMQLNLGAEDVGFGRQA-AQPQGD-GFFHPLECEP  228

Query  212  TLQIGYQTDHHITVAAAGPSVNNFMPEWYP  123
            TLQIGYQ D  ITV  AGPSVNN+MP W P
Sbjct  229  TLQIGYQPD-PITVVTAGPSVNNYMPGWLP  257



>dbj|BAN89460.1| sepallata 3 [Shorea beccariana]
Length=242

 Score =   276 bits (705),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 167/196 (85%), Gaps = 4/196 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S+REAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSSREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            Q+NLLGEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  110  QKNLLGEDLGPLSSKELESLERQLDSSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRL+E     ++  NP A++V YGRQ + Q  GD  FFH LECEPTLQIGY TD  I+V
Sbjct  170  KQRLVEGYQVSSMHLNPNAEDVGYGRQPV-QPQGD-AFFHPLECEPTLQIGYPTD-PISV  226

Query  170  AAAGPSVNNFMPEWYP  123
              AGPSVNN+M  W P
Sbjct  227  VTAGPSVNNYMGGWLP  242



>ref|XP_007043947.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
 gb|EOX99778.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
Length=242

 Score =   276 bits (705),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 167/196 (85%), Gaps = 4/196 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM+KTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMIKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDSSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRL+E     +L+ NP A++V YGRQ   Q  GD GFFH LECEPTLQIGYQ D  I+V
Sbjct  170  KQRLVEGYQVNSLQLNPNAEDVGYGRQP-AQPQGD-GFFHPLECEPTLQIGYQPD-PISV  226

Query  170  AAAGPSVNNFMPEWYP  123
              AGPSVNN+M  W P
Sbjct  227  VNAGPSVNNYMTGWLP  242



>gb|AAP83364.1| SEPALLATA3-like MADS-box [Antirrhinum majus]
Length=212

 Score =   274 bits (701),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 167/197 (85%), Gaps = 6/197 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSS+SML TLERYQKCNYG PE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  21   RGKLYEFCSSTSMLNTLERYQKCNYGPPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  79

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L DLQRKEH LNEAN+SL
Sbjct  80   QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANRSL  139

Query  350  KQRLMEDANHLTLEWNPTAQE-VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            K RLM D + ++L+WNP A++ V YGRQ   Q   D GF+H LECEPTL IG+Q+D  IT
Sbjct  140  KHRLM-DGSQISLQWNPNAEDHVGYGRQP-SQPSAD-GFYHPLECEPTLHIGFQSD-QIT  195

Query  173  VAAAGPSVNNFMPEWYP  123
            VA AGPSVNN++  W P
Sbjct  196  VAGAGPSVNNYISGWLP  212



>emb|CAA64743.1| DEFH200 [Antirrhinum majus]
Length=242

 Score =   275 bits (704),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 167/197 (85%), Gaps = 6/197 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSS+SML TLERYQKCNYG PE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSTSMLNTLERYQKCNYGPPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L DLQRKEH LNEAN+SL
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANRSL  169

Query  350  KQRLMEDANHLTLEWNPTAQE-VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            K RLM D + ++L+WNP A++ V YGRQ   Q   D GF+H LECEPTL IG+Q+D  IT
Sbjct  170  KHRLM-DGSQISLQWNPNAEDHVGYGRQP-SQPSAD-GFYHPLECEPTLHIGFQSD-QIT  225

Query  173  VAAAGPSVNNFMPEWYP  123
            VA AGPSVNN++  W P
Sbjct  226  VAGAGPSVNNYISGWLP  242



>gb|ABQ59277.2| sepallata 3-like MADS box protein [Eustoma exaltatum subsp. russellianum]
Length=204

 Score =   274 bits (700),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 165/196 (84%), Gaps = 9/196 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  17   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNMSTREAL-ELSSQQEYLKLKARYEALQRS  75

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ+MLDQL DLQRKEH LNEAN +L
Sbjct  76   QRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQVMLDQLTDLQRKEHALNEANTTL  135

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            K RLME    L L+WNP AQ+V YGRQ   Q+D    FF  L+ EPTL IGY  D  + V
Sbjct  136  KHRLME----LNLQWNPNAQDVGYGRQPQTQAD---AFFQPLDGEPTLHIGYPND-PMAV  187

Query  170  AAAGPSVNNFMPEWYP  123
            AAAGPSVNN+M  W P
Sbjct  188  AAAGPSVNNYMAGWLP  203



>gb|AEQ75503.1| MADS-domain transcription factor, partial [Davidia involucrata]
Length=212

 Score =   272 bits (696),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 168/205 (82%), Gaps = 13/205 (6%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+STREAL E+SSQQEYLKLKARYE LQRS
Sbjct  12   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSTREAL-ELSSQQEYLKLKARYEGLQRS  70

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  71   QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHALNEANKTL  130

Query  350  KQR----LMEDANHLTLEWNPTAQEVEYGRQ-AIHQSDGDHGFFHHLECEPTLQIGYQTD  186
            KQR    L+E     +L+WNP AQEVEY RQ A   +D    FFH LECEPTLQIGYQTD
Sbjct  131  KQRFSMQLLEGNQVNSLQWNPNAQEVEYVRQPAEPHAD---AFFHQLECEPTLQIGYQTD  187

Query  185  ----HHITVAAAGPSVNNFMPEWYP  123
                     AAAGPSVNN+M  W P
Sbjct  188  PITAAAAAAAAAGPSVNNYMAGWLP  212



>gb|ADF49576.1| transcription factor MADS-box 2 [Fragaria chiloensis]
Length=242

 Score =   273 bits (697),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 164/196 (84%), Gaps = 4/196 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRN  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQL DLQRKEH LNEAN++L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHLLNEANRTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRL E  +H  L+ N  A+EV YGRQ  HQ  GD GFF  LECEPTLQIGY  +  I V
Sbjct  170  KQRLFEGYHH-QLQLNANAEEVAYGRQEAHQPQGD-GFFQALECEPTLQIGYHQNDPIQV  227

Query  170  AAAGPSVNNFMPEWYP  123
              AGPSV N+M  W P
Sbjct  228  VTAGPSV-NYMGGWLP  242



>gb|AEL33633.1| SEPALLATA3 [Gossypium hirsutum]
Length=243

 Score =   270 bits (690),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 163/196 (83%), Gaps = 3/196 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM+KTLERYQKC++GAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMMKTLERYQKCSHGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELESLERQLD SLK IRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDSSLKLIRSTRTQYMLDQLTDLQRKEHLLNEANKNL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRLME     +L+ NP A +V YGRQ  HQ  GD  FFH L+CEPTLQIGYQ D  I+ 
Sbjct  170  KQRLMEGYQVHSLQLNPNADDVGYGRQPTHQPQGDV-FFHPLDCEPTLQIGYQPD-TISA  227

Query  170  AAAGPSVNNFMPEWYP  123
               GPSVNN+M  W P
Sbjct  228  VTGGPSVNNYMTGWLP  243



>ref|XP_011020782.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Populus 
euphratica]
Length=243

 Score =   270 bits (689),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 164/196 (84%), Gaps = 3/196 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRT  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQL DLQ KEH L  ANKSL
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQYMLDQLNDLQHKEHMLTAANKSL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            K+RLME     +L+ N +A++V + RQ   Q  G +GFFH LECEPTLQIGYQ D  ITV
Sbjct  170  KERLMEGYEVNSLQLNLSAEDVGFSRQQ-AQPQG-YGFFHPLECEPTLQIGYQPDSAITV  227

Query  170  AAAGPSVNNFMPEWYP  123
              +GPS+  +MP+W P
Sbjct  228  VTSGPSMTAYMPDWLP  243



>ref|XP_007043949.1| K-box region and MADS-box transcription factor family protein 
isoform 3 [Theobroma cacao]
 gb|EOX99780.1| K-box region and MADS-box transcription factor family protein 
isoform 3 [Theobroma cacao]
Length=247

 Score =   270 bits (690),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 167/201 (83%), Gaps = 9/201 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM+KTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMIKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDSSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTL  169

Query  350  KQR-----LMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTD  186
            KQR     L+E     +L+ NP A++V YGRQ   Q  GD GFFH LECEPTLQIGYQ D
Sbjct  170  KQRAGALQLVEGYQVNSLQLNPNAEDVGYGRQP-AQPQGD-GFFHPLECEPTLQIGYQPD  227

Query  185  HHITVAAAGPSVNNFMPEWYP  123
              I+V  AGPSVNN+M  W P
Sbjct  228  -PISVVNAGPSVNNYMTGWLP  247



>gb|AEN75254.1| transcription factor MADS3 [Prunus avium]
 gb|AIU94282.1| agamous-like MADS-box protein [Prunus pseudocerasus]
Length=240

 Score =   270 bits (689),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 166/196 (85%), Gaps = 6/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REAL E+SSQQEYLKLKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSAREAL-ELSSQQEYLKLKARYEALQRN  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHMLNEANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRL E  +  +L+ NP A   EYGRQ   Q+ GD GFFH L+CEPTLQIGYQ D  I+V
Sbjct  170  KQRLFEGYHVNSLQMNPNAD--EYGRQQA-QAHGD-GFFHPLDCEPTLQIGYQND-PISV  224

Query  170  AAAGPSVNNFMPEWYP  123
              AGPSV+N+M  W P
Sbjct  225  VTAGPSVSNYMAGWLP  240



>ref|XP_007223808.1| hypothetical protein PRUPE_ppa010679mg [Prunus persica]
 gb|ABO27621.1| transcription factor MADS5 [Prunus persica]
 gb|EMJ25007.1| hypothetical protein PRUPE_ppa010679mg [Prunus persica]
Length=240

 Score =   269 bits (688),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 166/196 (85%), Gaps = 6/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REAL E+SSQQEYLKLKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSAREAL-ELSSQQEYLKLKARYEALQRN  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHMLNEANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRL E  +  +L+ NP A   EYGRQ   Q+ GD GFFH L+CEPTLQIGYQ D  I+V
Sbjct  170  KQRLFEGYHVNSLQMNPNAD--EYGRQQT-QAHGD-GFFHPLDCEPTLQIGYQND-PISV  224

Query  170  AAAGPSVNNFMPEWYP  123
              AGPSV+N+M  W P
Sbjct  225  VTAGPSVSNYMAGWLP  240



>ref|XP_011036099.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Populus 
euphratica]
Length=242

 Score =   269 bits (688),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 166/194 (86%), Gaps = 4/194 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRT  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGE+LGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQL DLQ KEH L  ANKSL
Sbjct  110  QRNLLGEELGPLSSKELESLERQLDMSLKQIRSTRTQYMLDQLNDLQHKEHMLTAANKSL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            K+RLME  +  +L+ NP+A++VEY RQ   Q  GD GFFH LECEPTLQIGYQ + +IT+
Sbjct  170  KERLMEGYHLNSLQLNPSAEDVEYARQQA-QPQGD-GFFHALECEPTLQIGYQPE-NITM  226

Query  170  AAAGPSVNNFMPEW  129
              AGPS+  +MP W
Sbjct  227  VTAGPSMTTYMPGW  240



>ref|XP_008222191.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Prunus 
mume]
Length=240

 Score =   269 bits (688),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 166/196 (85%), Gaps = 6/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REAL E+SSQQEYLKLKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSAREAL-ELSSQQEYLKLKARYEALQRN  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHMLNEANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRL E  +  +L+ NP A   EYGRQ   Q+ GD GFFH L+CEPTLQIGYQ D  I+V
Sbjct  170  KQRLFEGYHVNSLQMNPNAD--EYGRQQA-QAHGD-GFFHPLDCEPTLQIGYQND-PISV  224

Query  170  AAAGPSVNNFMPEWYP  123
              AGPSV+N+M  W P
Sbjct  225  VTAGPSVSNYMAGWLP  240



>ref|XP_006437995.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
 ref|XP_006484144.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X3 [Citrus sinensis]
 gb|ESR51235.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
Length=244

 Score =   269 bits (687),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 162/196 (83%), Gaps = 3/196 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L +LQ KE  L+EANK+L
Sbjct  110  QRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRLME     TL+ NP+A++  YG +   Q  GD  FFH LECEPTLQIGYQ    I+V
Sbjct  170  KQRLMEGYQVNTLQLNPSAEDCGYGLKP-AQPQGDT-FFHALECEPTLQIGYQPADPISV  227

Query  170  AAAGPSVNNFMPEWYP  123
              AGPS+NN+M  W P
Sbjct  228  VTAGPSLNNYMQGWLP  243



>dbj|BAF34912.1| MADS-box protein [Citrus unshiu]
Length=245

 Score =   269 bits (687),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 162/196 (83%), Gaps = 3/196 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQRS
Sbjct  52   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRS  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L +LQ KE  L+EANK+L
Sbjct  111  QRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTL  170

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRLME     TL+ NP+A++  YG +   Q  GD  FFH LECEPTLQIGYQ    I+V
Sbjct  171  KQRLMEGYQVNTLQLNPSAEDCGYGLKP-AQPQGDT-FFHALECEPTLQIGYQPADPISV  228

Query  170  AAAGPSVNNFMPEWYP  123
              AGPS+NN+M  W P
Sbjct  229  VTAGPSLNNYMQGWLP  244



>dbj|BAM36705.1| MADS transcriptional factor SEP3 homolog, partial [Rosa hybrid 
cultivar]
Length=244

 Score =   268 bits (685),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 160/196 (82%), Gaps = 2/196 (1%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRN  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQL DLQRKEH LNEAN++L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHMLNEANRTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRL E  N   L+ N  A++V YGRQ  H      GFF  LECEPTLQIGY  +  I V
Sbjct  170  KQRLFEGYNVHQLQLNANAEDVGYGRQQAHHQPQGEGFFQPLECEPTLQIGYHQNDPIQV  229

Query  170  AAAGPSVNNFMPEWYP  123
              AGPSV N+M  W P
Sbjct  230  VTAGPSV-NYMGGWLP  244



>gb|AGA61758.1| sepallata 3, partial [Cornus kousa]
Length=237

 Score =   268 bits (684),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 166/203 (82%), Gaps = 11/203 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSS MLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQR
Sbjct  35   RGKLYEFCSSSSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQR  93

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L DLQRKEH LNEAN S
Sbjct  94   SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTDLQRKEHALNEANNS  153

Query  353  LKQRLMEDANHLTLEWNPT-AQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGY-QTD--  186
            LKQRLME     +L WN + AQ++ YGRQ   QS G+  FFHHLECEPTLQIGY QTD  
Sbjct  154  LKQRLMEGNQVSSLNWNASHAQDLGYGRQPA-QSQGEANFFHHLECEPTLQIGYHQTDPM  212

Query  185  ----HHITVAAAGPSVNNFMPEW  129
                     AAAGPSVNN+M  W
Sbjct  213  AAAAAAAAAAAAGPSVNNYMLGW  235



>gb|AEJ76840.1| MADS16 [Gossypium hirsutum]
 gb|KHG22181.1| Agamous-like MADS-box protein AGL9 [Gossypium arboreum]
Length=243

 Score =   268 bits (684),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 162/196 (83%), Gaps = 3/196 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM+KTLERYQKC++GAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMMKTLERYQKCSHGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELESLERQLD SLK IRSTRTQ MLDQL DLQRKEH LNEANKSL
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDSSLKLIRSTRTQYMLDQLTDLQRKEHLLNEANKSL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRLME     +L+ NP A +V YGRQ  HQ  GD  FFH L+CEPTLQIGYQ D  I+ 
Sbjct  170  KQRLMEGYQVHSLQLNPNADDVGYGRQPTHQPQGDV-FFHPLDCEPTLQIGYQPD-TISA  227

Query  170  AAAGPSVNNFMPEWYP  123
                PSVNN+M  W P
Sbjct  228  VTGCPSVNNYMTGWLP  243



>gb|KHG25284.1| Agamous-like MADS-box protein AGL9 [Gossypium arboreum]
Length=246

 Score =   268 bits (684),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 163/197 (83%), Gaps = 2/197 (1%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM+KTLERYQKCNYGAPEPN+S+REA  E+SS+QEYLKLKARY+ALQRS
Sbjct  51   RGKLYEFCSSSSMIKTLERYQKCNYGAPEPNVSSREAALELSSRQEYLKLKARYDALQRS  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELESLE+QLD SLK IRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  111  QRNLLGEDLGPLSSKELESLEKQLDSSLKLIRSTRTQYMLDQLNDLQRKEHLLNEANKTL  170

Query  350  KQRLMEDANHLTLEWNPTAQE-VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            KQRL+E     +L+ NP A E V YGRQ +H       FFH L+CEPTLQIGYQ D  ++
Sbjct  171  KQRLVEGYQVNSLQLNPNATEDVGYGRQQVHHQPHGDAFFHPLDCEPTLQIGYQHD-PMS  229

Query  173  VAAAGPSVNNFMPEWYP  123
            V  AGPSVNN+M  W P
Sbjct  230  VVTAGPSVNNYMTGWLP  246



>gb|ABE02212.1| SEP-like [Populus tomentosa]
Length=243

 Score =   267 bits (683),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 162/194 (84%), Gaps = 3/194 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS SSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYE LQR+
Sbjct  51   RGKLYEFCSGSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEGLQRT  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGE+LGPL+SK+LESLERQLDMSLKQIRSTRTQ MLDQL DLQ KEH L  ANKSL
Sbjct  110  QRNLLGEELGPLSSKDLESLERQLDMSLKQIRSTRTQYMLDQLNDLQHKEHMLTAANKSL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            K+RLME     +L+ NP+A++VEY RQ      GD GFFH LECEPTLQIGYQ + +IT+
Sbjct  170  KERLMEGYQLNSLQMNPSAEDVEYARQQAQPQPGD-GFFHALECEPTLQIGYQPE-NITM  227

Query  170  AAAGPSVNNFMPEW  129
              AGPS+  +MP W
Sbjct  228  VTAGPSMTTYMPGW  241



>gb|AAO49811.1| SEP3-related MADS-box protein [Populus tremuloides]
Length=242

 Score =   265 bits (677),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 163/194 (84%), Gaps = 4/194 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS SSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYE LQR+
Sbjct  51   RGKLYEFCSGSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEGLQRT  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGE+LGPL+SK+LESLERQLDMSLKQIRSTRTQ MLDQL DLQ KEH L  ANKSL
Sbjct  110  QRNLLGEELGPLSSKDLESLERQLDMSLKQIRSTRTQYMLDQLNDLQHKEHMLTAANKSL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            K+RLME     +L+ NP+A++VEY RQ   Q  GD GFFH LECEPTLQIGYQ + +IT+
Sbjct  170  KERLMEGYQLNSLQLNPSAEDVEYARQQA-QPQGD-GFFHALECEPTLQIGYQPE-NITM  226

Query  170  AAAGPSVNNFMPEW  129
              AGPS+  +MP W
Sbjct  227  VTAGPSMTTYMPGW  240



>gb|AEO45959.1| SEPALLATA3-like protein [Mangifera indica]
Length=244

 Score =   263 bits (673),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 163/197 (83%), Gaps = 4/197 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSS SMLKTLERYQ+CNYGAPEPN+STREAL EISSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSPSMLKTLERYQRCNYGAPEPNVSTREAL-EISSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGE+LGPL+SKELESLE+QLDMSLKQIRSTRTQ MLDQLM+LQ KE  L+E NK+L
Sbjct  110  QRNLLGEELGPLSSKELESLEKQLDMSLKQIRSTRTQYMLDQLMELQHKEQVLSETNKTL  169

Query  350  KQRLMEDAN-HLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            KQRLME       L+ NP+A+E+ YGRQ   Q  GD  FFH LECEPTLQIG      IT
Sbjct  170  KQRLMEGYQVSSVLQLNPSAEEMGYGRQPA-QLHGDT-FFHPLECEPTLQIGSYQHEQIT  227

Query  173  VAAAGPSVNNFMPEWYP  123
              +AGPSVNN+MP W P
Sbjct  228  AVSAGPSVNNYMPGWLP  244



>ref|XP_004171788.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog, partial 
[Cucumis sativus]
Length=196

 Score =   261 bits (666),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 160/193 (83%), Gaps = 4/193 (2%)
 Frame = -3

Query  701  LYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRSQRN  522
            L   C+ SSMLKTLERYQKCNYGAPEPN+STREAL E+SSQQEYLKLKARYEALQRSQRN
Sbjct  8    LLLLCAKSSMLKTLERYQKCNYGAPEPNVSTREAL-ELSSQQEYLKLKARYEALQRSQRN  66

Query  521  LLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSLKQR  342
            LLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQL DLQRKEH LNEANK+LKQR
Sbjct  67   LLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTLKQR  126

Query  341  LMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITVAAA  162
            L+E      L+ N +A ++ YGRQ   Q  GD  FFH L+CEPTLQIGYQ D  ITV  A
Sbjct  127  LVEGYQVNALQLNQSADDMMYGRQQ-AQPPGD-AFFHPLDCEPTLQIGYQPD-PITVVTA  183

Query  161  GPSVNNFMPEWYP  123
            GPS+NNF+P W P
Sbjct  184  GPSMNNFLPGWLP  196



>gb|ADC79704.1| SEPALLATA3-like protein [Pachysandra terminalis]
Length=244

 Score =   262 bits (670),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 158/194 (81%), Gaps = 2/194 (1%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS+SSM KTLERYQKCNYGAPEPN+S RE L E++SQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSTSSMFKTLERYQKCNYGAPEPNVSARETL-ELASQQEYLKLKARVEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SK+LESLE QLDMSLKQI+S RTQ MLDQL DLQR+E  L EANK+L
Sbjct  110  QRNLMGEDLGPLDSKDLESLEMQLDMSLKQIKSIRTQYMLDQLTDLQRREQVLTEANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            K+RL E +     +W+ +A   +YGRQ  H      GFFH LECEPTLQIGYQ +  ITV
Sbjct  170  KRRLDEGSQVNAQQWDLSAHVADYGRQVAHHQPHGDGFFHPLECEPTLQIGYQPE-QITV  228

Query  170  AAAGPSVNNFMPEW  129
            AAAGPSVNNFMP W
Sbjct  229  AAAGPSVNNFMPGW  242



>ref|XP_006437994.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
 ref|XP_006484145.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X4 [Citrus sinensis]
 gb|ESR51234.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
Length=242

 Score =   262 bits (669),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 161/196 (82%), Gaps = 5/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L +LQ K   L+EANK+L
Sbjct  110  QRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHK--LLSEANKTL  167

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRLME     TL+ NP+A++  YG +   Q  GD  FFH LECEPTLQIGYQ    I+V
Sbjct  168  KQRLMEGYQVNTLQLNPSAEDCGYGLKP-AQPQGDT-FFHALECEPTLQIGYQPADPISV  225

Query  170  AAAGPSVNNFMPEWYP  123
              AGPS+NN+M  W P
Sbjct  226  VTAGPSLNNYMQGWLP  241



>ref|NP_001289232.1| agamous-like MADS-box protein AGL9 homolog [Pyrus x bretschneideri]
 ref|XP_009343139.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Pyrus 
x bretschneideri]
 ref|XP_009343141.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Pyrus 
x bretschneideri]
 dbj|BAF44101.1| transcription factor MADS [Pyrus x bretschneideri]
 dbj|BAM71398.1| transcription factor [Pyrus pyrifolia]
Length=239

 Score =   261 bits (668),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 162/196 (83%), Gaps = 7/196 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKAR+EALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARFEALQRN  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SK+LESLERQLDMSLKQIRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKDLESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHMLNEANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            K+RL E  + L L  N      EYGRQ    + GD  FFH L+CEPTLQIGYQ D  I+V
Sbjct  170  KERLFEGYHALQLNANAD----EYGRQQAQAAQGDV-FFHPLDCEPTLQIGYQND-PISV  223

Query  170  AAAGPSVNNFMPEWYP  123
              AGPS++N+M  W P
Sbjct  224  VTAGPSLSNYMGGWLP  239



>ref|NP_001280756.1| agamous-like MADS-box protein AGL9 homolog [Malus domestica]
 ref|XP_008389896.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Malus 
domestica]
 ref|XP_008350960.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Malus 
domestica]
 gb|ADL36740.1| MADS domain class transcription factor [Malus domestica]
Length=239

 Score =   261 bits (666),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 161/196 (82%), Gaps = 7/196 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSS LKTLERYQKCNYGAPE NISTREAL E+SSQQEYLKLKAR+EALQR+
Sbjct  51   RGKLYEFCSSSSTLKTLERYQKCNYGAPETNISTREAL-ELSSQQEYLKLKARFEALQRN  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SK+LESLERQLDMSLKQIRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKDLESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHMLNEANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            K+RL E  + L L  N      EYGRQ    + GD  FFH L+CEPTLQIGYQ D  I+V
Sbjct  170  KERLFEGYHALQLNANAD----EYGRQQAQAAQGDV-FFHPLDCEPTLQIGYQND-PISV  223

Query  170  AAAGPSVNNFMPEWYP  123
              AGPSV+N+M  W P
Sbjct  224  VTAGPSVSNYMGGWLP  239



>gb|AAR01779.1| MADS-box protein [Prunus dulcis]
Length=247

 Score =   261 bits (667),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 163/191 (85%), Gaps = 6/191 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REAL E+SSQQEYLKLKARYEALQR+
Sbjct  42   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSAREAL-ELSSQQEYLKLKARYEALQRN  100

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  101  QRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHMLNEANKTL  160

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRL E  +  +L+ NP A   EYGRQ   Q+ GD GFFH L+CEPTLQIGYQ D  I+V
Sbjct  161  KQRLFEGYHVNSLQMNPNAD--EYGRQQT-QAHGD-GFFHPLDCEPTLQIGYQND-PISV  215

Query  170  AAAGPSVNNFM  138
              AG SV+N+M
Sbjct  216  VTAGXSVSNYM  226



>ref|XP_007043948.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 gb|EOX99779.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
Length=258

 Score =   261 bits (667),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 167/211 (79%), Gaps = 18/211 (9%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM+KTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMIKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSSKELESLERQLDSSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTL  169

Query  350  KQR-----LMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIG----  198
            KQR     L+E     +L+ NP A++V YGRQ   Q  GD GFFH LECEPTLQIG    
Sbjct  170  KQRAGALQLVEGYQVNSLQLNPNAEDVGYGRQPA-QPQGD-GFFHPLECEPTLQIGENNN  227

Query  197  --YQTDHH----ITVAAAGPSVNNFMPEWYP  123
              Y  D +    I+V  AGPSVNN+M  W P
Sbjct  228  LPYHCDRYQPDPISVVNAGPSVNNYMTGWLP  258



>ref|XP_010090648.1| Agamous-like MADS-box protein AGL9-like protein [Morus notabilis]
 gb|EXB40312.1| Agamous-like MADS-box protein AGL9-like protein [Morus notabilis]
Length=244

 Score =   260 bits (664),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 162/197 (82%), Gaps = 4/197 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQK NYGAPEPN+S REAL E+SSQQEYLKLKARYE L R+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKSNYGAPEPNVSAREAL-ELSSQQEYLKLKARYETLLRN  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
             RNL+GE+LG L+SKELESLERQLD+SLKQIRSTRTQ MLDQL DLQRKEH LNE N++L
Sbjct  110  HRNLMGEELGALSSKELESLERQLDISLKQIRSTRTQTMLDQLTDLQRKEHMLNETNRTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRL+E     +L+ NP A +V Y RQ + Q+ GD  F+H LECEPTLQIGYQ D  I+V
Sbjct  170  KQRLVEGYQLSSLQLNPAADDVGYCRQPV-QAQGDI-FYHPLECEPTLQIGYQADSTISV  227

Query  170  AAAGPSVNNFMPE-WYP  123
              AGPSVNN+MP  W P
Sbjct  228  VTAGPSVNNYMPAGWLP  244



>dbj|BAJ11578.1| transcription factor [Pyrus pyrifolia var. culta]
Length=235

 Score =   259 bits (662),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 161/194 (83%), Gaps = 7/194 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKAR+EALQR+
Sbjct  48   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARFEALQRN  106

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SK+LESLERQLDMSLKQIRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  107  QRNLLGEDLGPLSSKDLESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHMLNEANKTL  166

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            K+RL E  + L L  N      EYGRQ    + GD  FFH L+CEPTLQIGYQ D  I+V
Sbjct  167  KERLFEGYHALQLNANAD----EYGRQQAQAAQGDV-FFHPLDCEPTLQIGYQND-PISV  220

Query  170  AAAGPSVNNFMPEW  129
              AGPS++N+M  W
Sbjct  221  VTAGPSLSNYMGGW  234



>ref|XP_006437997.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
 ref|XP_006484142.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Citrus sinensis]
 gb|ESR51237.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
Length=257

 Score =   259 bits (663),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 162/209 (78%), Gaps = 16/209 (8%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L +LQ KE  L+EANK+L
Sbjct  110  QRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTL  169

Query  350  KQR-------------LMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPT  210
            KQR             LME     TL+ NP+A++  YG +   Q  GD  FFH LECEPT
Sbjct  170  KQRTMTLRHADFAGLQLMEGYQVNTLQLNPSAEDCGYGLKP-AQPQGDT-FFHALECEPT  227

Query  209  LQIGYQTDHHITVAAAGPSVNNFMPEWYP  123
            LQIGYQ    I+V  AGPS+NN+M  W P
Sbjct  228  LQIGYQPADPISVVTAGPSLNNYMQGWLP  256



>gb|AAX13298.1| MADS box protein SEP3 [Lotus japonicus]
Length=243

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 164/197 (83%), Gaps = 5/197 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPLNSKELESLERQLD SLKQIRSTRTQ MLDQL DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLNSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHMLSEANRSL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            +QR +E     +L+ NP  +++ YGR    Q+ GD  F+H +ECEPTLQIGYQ D  ++V
Sbjct  170  RQRQLEGYQLNSLQLNPGVEDMGYGRHPA-QTHGD-AFYHSIECEPTLQIGYQPD-PVSV  226

Query  170  AAAGPSV-NNFMPEWYP  123
              AGPS+ NN+M  W P
Sbjct  227  VTAGPSMNNNYMAGWLP  243



>ref|XP_009372256.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Pyrus x bretschneideri]
Length=250

 Score =   258 bits (659),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 163/203 (80%), Gaps = 10/203 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTL+RYQKCNYGAPE N+STREAL E+SSQQEYLKLKA +EALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLDRYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKAHFEALQRN  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLG L+SKELESLERQLD+SLKQIRSTRTQ MLD+L DLQR EH LNEANK+L
Sbjct  110  QRNLLGEDLGHLSSKELESLERQLDISLKQIRSTRTQCMLDKLTDLQRNEHVLNEANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEV-------EYGRQAIHQSDGDHGFFHHLECEPTLQIGYQ  192
            KQRL E  +  +L+ N  A E        EYGRQ    + GD GFFH L+CEPTLQIGYQ
Sbjct  170  KQRLFEGYHVNSLQLNANADEYGHQQAADEYGRQQAQAAQGD-GFFHPLDCEPTLQIGYQ  228

Query  191  TDHHITVAAAGPSVNNFMPEWYP  123
             D  I+V  AGPSV+N+M  W P
Sbjct  229  ND-PISVVTAGPSVSNYMGGWLP  250



>ref|XP_006437996.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
 gb|ESR51236.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
Length=256

 Score =   257 bits (657),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 161/209 (77%), Gaps = 17/209 (8%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REAL  +SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL--LSSQQEYLKLKARYEALQRS  108

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L +LQ KE  L+EANK+L
Sbjct  109  QRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTL  168

Query  350  KQR-------------LMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPT  210
            KQR             LME     TL+ NP+A++  YG +   Q  GD  FFH LECEPT
Sbjct  169  KQRTMTLRHADFAGLQLMEGYQVNTLQLNPSAEDCGYGLKP-AQPQGDT-FFHALECEPT  226

Query  209  LQIGYQTDHHITVAAAGPSVNNFMPEWYP  123
            LQIGYQ    I+V  AGPS+NN+M  W P
Sbjct  227  LQIGYQPADPISVVTAGPSLNNYMQGWLP  255



>gb|AFL03390.1| MADS box transcription factor SEP3, partial [Sinofranchetia chinensis]
Length=200

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 158/195 (81%), Gaps = 6/195 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM KTLERYQKCN+GAPEPN+STREA QE SS QEYLKLKAR E LQRS
Sbjct  9    RGKLYEFCSSSSMFKTLERYQKCNFGAPEPNVSTREA-QEHSSHQEYLKLKARVEGLQRS  67

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KELESLERQLDMSLKQIRSTRTQ MLDQL D QR+E  L+EANK+L
Sbjct  68   QRNLLGEDLGPLSGKELESLERQLDMSLKQIRSTRTQYMLDQLTDYQRREQMLSEANKTL  127

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGR-QAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            ++RL E +     +W+P  Q V YGR QA  Q +   GFF H+ECEPTL IGYQ D  IT
Sbjct  128  RRRLEEGSQPNPHQWDPNVQVVNYGRQQAPAQGE---GFFQHIECEPTLHIGYQQD-QIT  183

Query  173  VAAAGPSVNNFMPEW  129
            VAAAGPS+NN+M  W
Sbjct  184  VAAAGPSMNNYMQGW  198



>gb|AGH61294.1| sepallata 3 [Paeonia lactiflora]
Length=243

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 164/199 (82%), Gaps = 9/199 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAP+  +S REAL E+SSQQEYLKLK RYE+LQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPDTTVSAREAL-ELSSQQEYLKLKQRYESLQRN  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SK+LE LERQLD SLKQIRSTRTQ MLD L DLQRKEH LNEAN+SL
Sbjct  110  QRNLLGEDLGPLSSKDLELLERQLDSSLKQIRSTRTQSMLDTLTDLQRKEHMLNEANQSL  169

Query  350  KQRLMEDANHL-TLEWNPTAQEVEYGR-QAIHQSDGDHGFFHHLECEPTLQIG-YQTDHH  180
            KQRLME  NH+ +L WNP + E++Y R QA  Q D    F+H L+CEPTLQIG YQ D  
Sbjct  170  KQRLME-GNHVNSLPWNPNSHEMDYSRHQAQPQGD---AFYHPLDCEPTLQIGSYQPD-S  224

Query  179  ITVAAAGPSVNNFMPEWYP  123
            I VAAAGPSVNN+M  W P
Sbjct  225  IGVAAAGPSVNNYMGGWLP  243



>ref|XP_010653929.1| PREDICTED: MADS-box protein 4 isoform X1 [Vitis vinifera]
Length=258

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 152/172 (88%), Gaps = 3/172 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL++KELESLERQLD+SLKQIRSTRTQ MLDQL DLQRKEH LNEANK+L
Sbjct  110  QRNLLGEDLGPLSTKELESLERQLDVSLKQIRSTRTQYMLDQLTDLQRKEHMLNEANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGY  195
            KQRL+E      L+WNP AQ+V YGRQ   Q  GD GFFH LECEPTLQIGY
Sbjct  170  KQRLLEGTQVNQLQWNPNAQDVGYGRQQ-AQPQGD-GFFHPLECEPTLQIGY  219



>gb|KGN46460.1| hypothetical protein Csa_6G095270 [Cucumis sativus]
Length=180

 Score =   252 bits (644),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 155/184 (84%), Gaps = 4/184 (2%)
 Frame = -3

Query  674  MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGPL  495
            MLKTLERYQKCNYGAPEPN+STREAL E+SSQQEYLKLKARYEALQRSQRNLLGEDLGPL
Sbjct  1    MLKTLERYQKCNYGAPEPNVSTREAL-ELSSQQEYLKLKARYEALQRSQRNLLGEDLGPL  59

Query  494  NSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSLKQRLMEDANHLT  315
            +SKELESLERQLDMSLKQIRSTRTQ MLDQL DLQRKEH LNEANK+LKQRL+E      
Sbjct  60   SSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTLKQRLVEGYQVNA  119

Query  314  LEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITVAAAGPSVNNFMP  135
            L+ N +A ++ YGRQ   Q  GD  FFH L+CEPTLQIGYQ D  ITV  AGPS+NNF+P
Sbjct  120  LQLNQSADDMMYGRQQA-QPPGD-AFFHPLDCEPTLQIGYQPD-PITVVTAGPSMNNFLP  176

Query  134  EWYP  123
             W P
Sbjct  177  GWLP  180



>ref|XP_002514893.1| mads box protein, putative [Ricinus communis]
 gb|EEF47447.1| mads box protein, putative [Ricinus communis]
Length=182

 Score =   252 bits (644),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 155/185 (84%), Gaps = 5/185 (3%)
 Frame = -3

Query  677  SMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGP  498
            SMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQRSQRNLLGEDLGP
Sbjct  3    SMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRSQRNLLGEDLGP  61

Query  497  LNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSLKQRLMEDANHL  318
            L+SK+LESLERQLDMSLKQIRSTRTQ MLDQL DLQRKEH LNEANK+LKQRL+E     
Sbjct  62   LSSKDLESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHMLNEANKTLKQRLVEGYQVN  121

Query  317  TLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITVAAAGPSVNNFM  138
             ++ NP+A++V +GRQA  Q  GD GFFH L+CEPTLQIGY  D    V  AGPSVNN+M
Sbjct  122  AMQLNPSAEDVGFGRQAA-QPQGD-GFFHPLDCEPTLQIGYHPDQ--IVVTAGPSVNNYM  177

Query  137  PEWYP  123
              W P
Sbjct  178  SGWLP  182



>gb|AAO22982.1| MADS-box transcription factor CDM44 [Chrysanthemum x morifolium]
Length=249

 Score =   254 bits (649),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 156/199 (78%), Gaps = 5/199 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSAREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLN KELESLERQLD SLKQIRS RTQ MLD L DLQ+KEH LN+AN++L
Sbjct  110  QRNLLGEDLGPLNCKELESLERQLDTSLKQIRSARTQFMLDTLTDLQKKEHALNDANRTL  169

Query  350  KQRLMEDANHLTLEWNP-TAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            KQRLME     +L WNP   QE+ Y +Q   Q      FFH L+C PTLQ+GY +D    
Sbjct  170  KQRLMEGHQVTSLHWNPHVQQEMGYDQQHEPQHQNGEAFFHPLDCGPTLQMGYPSDSLTA  229

Query  173  VAA---AGPSVNNFMPEWY  126
             AA   AGPS +N+MP WY
Sbjct  230  EAAASVAGPSCSNYMPGWY  248



>ref|XP_010682728.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=240

 Score =   254 bits (648),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 158/196 (81%), Gaps = 6/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKL+EFCSS SMLKTLERYQK NYGAP+  +STREAL+E+SSQQEYLKLKAR+EALQR+
Sbjct  51   RGKLFEFCSSPSMLKTLERYQKSNYGAPDNTVSTREALKELSSQQEYLKLKARHEALQRT  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
             RNL+GEDLGPL+SKELESLERQLDMSLKQIRSTRTQ M+DQL DLQRKEH LNEAN++L
Sbjct  111  HRNLMGEDLGPLSSKELESLERQLDMSLKQIRSTRTQYMVDQLTDLQRKEHMLNEANRTL  170

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRL+E     +L+WN    ++ Y RQ     D    FFH L+CEPTLQ+GYQ D     
Sbjct  171  KQRLIEANQASSLQWN--VHDIGYDRQPAQPHDD--SFFHPLDCEPTLQMGYQND--AVN  224

Query  170  AAAGPSVNNFMPEWYP  123
            AAAG SVNNFMP W P
Sbjct  225  AAAGGSVNNFMPNWLP  240



>gb|AEE60891.1| MADS-box protein 5 [Paeonia suffruticosa]
Length=243

 Score =   253 bits (647),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 162/199 (81%), Gaps = 9/199 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAP+  +S REAL E+SSQQEYLKLK RYE+LQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPDTTVSAREAL-ELSSQQEYLKLKQRYESLQRN  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SK+LE LERQLD SLKQIRSTRTQ MLD L  LQRKEH LNEAN+SL
Sbjct  110  QRNLLGEDLGPLSSKDLELLERQLDSSLKQIRSTRTQSMLDTLTGLQRKEHMLNEANQSL  169

Query  350  KQRLMEDANHL-TLEWNPTAQEVEYGR-QAIHQSDGDHGFFHHLECEPTLQIG-YQTDHH  180
            KQRL+E  NH+ +L WNP + E+ Y R QA  Q D    F+H L+CEPTLQIG YQ D  
Sbjct  170  KQRLLE-GNHINSLPWNPNSHEMGYSRHQAQPQGD---AFYHPLDCEPTLQIGSYQPD-S  224

Query  179  ITVAAAGPSVNNFMPEWYP  123
            I VAAAGPSVNN+M  W P
Sbjct  225  IGVAAAGPSVNNYMGGWLP  243



>ref|XP_004504397.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Cicer arietinum]
Length=242

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 161/196 (82%), Gaps = 4/196 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SKELESLERQLD SL+QIRSTRTQ MLDQL DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDTSLQQIRSTRTQFMLDQLSDLQRKEHMLSEANRSL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            +QR +E      L+ N   +E+ YGR    Q+ GD G F  +ECEPTLQIGYQ D   +V
Sbjct  170  RQRQLERYQLNQLQMNHCVEEMGYGRHP-SQTHGD-GLFQQMECEPTLQIGYQADPG-SV  226

Query  170  AAAGPSVNNFMPEWYP  123
             AAGPS++N+M  W P
Sbjct  227  VAAGPSMSNYMAGWLP  242



>ref|XP_006579433.1| PREDICTED: uncharacterized protein LOC100805078 isoform X1 [Glycine 
max]
Length=244

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 161/197 (82%), Gaps = 4/197 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL-QEISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL  E+SSQQEYLKLKARYEALQR
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREALVMELSSQQEYLKLKARYEALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            SQRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL DLQRKEH L+EAN+S
Sbjct  111  SQRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRS  170

Query  353  LKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            L+QR +E      L+ NP  +E+ YGR    Q+ G+   F  +ECEPTLQIGYQ D  ++
Sbjct  171  LRQRQLEGYQINPLQLNPGVEEMGYGRHP-AQTHGE-ALFQQMECEPTLQIGYQPD-PVS  227

Query  173  VAAAGPSVNNFMPEWYP  123
            V  AGPS++N+M  W P
Sbjct  228  VVTAGPSMSNYMAGWLP  244



>ref|XP_006579435.1| PREDICTED: uncharacterized protein LOC100805078 isoform X3 [Glycine 
max]
Length=242

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 161/196 (82%), Gaps = 4/196 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            +QR +E      L+ NP  +E+ YGR    Q+ G+   F  +ECEPTLQIGYQ D  ++V
Sbjct  170  RQRQLEGYQINPLQLNPGVEEMGYGRHPA-QTHGE-ALFQQMECEPTLQIGYQPD-PVSV  226

Query  170  AAAGPSVNNFMPEWYP  123
              AGPS++N+M  W P
Sbjct  227  VTAGPSMSNYMAGWLP  242



>gb|AAP83365.1| SEPALLATA3-like MADS-box [Antirrhinum majus]
Length=207

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 164/199 (82%), Gaps = 7/199 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSS-MLKTLERYQKCNYGAPE-PNISTREALQEISSQQEYLKLKARYEALQ  537
            RGKLYEFCSSSS ML TLERYQKCNYGAP+  NISTREA+ E+SSQQEYLKLKARYEALQ
Sbjct  13   RGKLYEFCSSSSSMLTTLERYQKCNYGAPDHANISTREAM-ELSSQQEYLKLKARYEALQ  71

Query  536  RSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANK  357
            RSQRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L DLQRKEH LNEAN+
Sbjct  72   RSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANR  131

Query  356  SLKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            +LK RLME  + + L+WN  AQ++ YGRQ   Q  GD GFFH LECEPTLQ+G+ +D   
Sbjct  132  NLKHRLME-GSQIGLQWNLNAQDMGYGRQPT-QPQGD-GFFHPLECEPTLQMGFHSDQIS  188

Query  176  TVAAAGPSV-NNFMPEWYP  123
              A AGPSV NN+M  W P
Sbjct  189  VAAXAGPSVNNNYMSGWLP  207



>gb|AAT46095.1| SEPALLATA-like protein [Akebia trifoliata]
Length=242

 Score =   253 bits (645),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 158/195 (81%), Gaps = 6/195 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM KTLERYQKCN+GAPEPN+STREAL E SS QEYLKLKAR E LQRS
Sbjct  51   RGKLYEFCSSSSMFKTLERYQKCNFGAPEPNVSTREAL-EHSSHQEYLKLKARVEGLQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KELE+LERQLDMSLKQIRSTRTQ MLDQL D QR+E  L+EANK+L
Sbjct  110  QRNLLGEDLGPLSGKELETLERQLDMSLKQIRSTRTQYMLDQLSDYQRREQMLSEANKAL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGR-QAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            ++RL E +     +W+P  Q V +GR QA  Q +   GFF H+ECEPTL IGYQ D  IT
Sbjct  170  RRRLEEGSQPNPHQWDPNVQVVNFGRQQAPAQGE---GFFQHIECEPTLHIGYQPD-QIT  225

Query  173  VAAAGPSVNNFMPEW  129
            VAAAGPS+NN+M  W
Sbjct  226  VAAAGPSMNNYMQGW  240



>ref|XP_006484143.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Citrus sinensis]
Length=255

 Score =   252 bits (644),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 161/209 (77%), Gaps = 18/209 (9%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L +LQ K   L+EANK+L
Sbjct  110  QRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHK--LLSEANKTL  167

Query  350  KQR-------------LMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPT  210
            KQR             LME     TL+ NP+A++  YG +   Q  GD  FFH LECEPT
Sbjct  168  KQRTMTLRHADFAGLQLMEGYQVNTLQLNPSAEDCGYGLKP-AQPQGDT-FFHALECEPT  225

Query  209  LQIGYQTDHHITVAAAGPSVNNFMPEWYP  123
            LQIGYQ    I+V  AGPS+NN+M  W P
Sbjct  226  LQIGYQPADPISVVTAGPSLNNYMQGWLP  254



>ref|XP_006585131.1| PREDICTED: MADS-box transcription factor 1-like isoform X3 [Glycine 
max]
Length=242

 Score =   252 bits (643),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 161/196 (82%), Gaps = 4/196 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYE+LQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREAL-ELSSQQEYLKLKARYESLQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            +QR +E      L+ NP  +E+ YGR    Q+ G+   F  +ECEPTLQIGYQ D  ++V
Sbjct  170  RQRQLEGYQINPLQLNPGVEEMGYGRNP-AQTHGE-ALFQQMECEPTLQIGYQPD-PVSV  226

Query  170  AAAGPSVNNFMPEWYP  123
              AGPS++N+M  W P
Sbjct  227  VTAGPSMSNYMAGWLP  242



>ref|XP_006585129.1| PREDICTED: MADS-box transcription factor 1-like isoform X1 [Glycine 
max]
Length=244

 Score =   252 bits (643),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 161/197 (82%), Gaps = 4/197 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL-QEISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL  E+SSQQEYLKLKARYE+LQR
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREALVMELSSQQEYLKLKARYESLQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            SQRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL DLQRKEH L+EAN+S
Sbjct  111  SQRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRS  170

Query  353  LKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            L+QR +E      L+ NP  +E+ YGR    Q+ G+   F  +ECEPTLQIGYQ D  ++
Sbjct  171  LRQRQLEGYQINPLQLNPGVEEMGYGRNP-AQTHGE-ALFQQMECEPTLQIGYQPD-PVS  227

Query  173  VAAAGPSVNNFMPEWYP  123
            V  AGPS++N+M  W P
Sbjct  228  VVTAGPSMSNYMAGWLP  244



>ref|XP_004504398.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Cicer arietinum]
Length=241

 Score =   251 bits (640),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 161/196 (82%), Gaps = 5/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SKELESLERQLD SL+QIRSTRTQ MLDQL DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDTSLQQIRSTRTQFMLDQLSDLQRKEHMLSEANRSL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            +QRL E      L+ N   +E+ YGR    Q+ GD G F  +ECEPTLQIGYQ D   +V
Sbjct  170  RQRL-ERYQLNQLQMNHCVEEMGYGRHP-SQTHGD-GLFQQMECEPTLQIGYQADPG-SV  225

Query  170  AAAGPSVNNFMPEWYP  123
             AAGPS++N+M  W P
Sbjct  226  VAAGPSMSNYMAGWLP  241



>gb|KHN34832.1| MADS-box transcription factor 1 [Glycine soja]
Length=241

 Score =   251 bits (640),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 161/196 (82%), Gaps = 5/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            +QRL E      L+ NP  +E+ YGR    Q+ G+   F  +ECEPTLQIGYQ D  ++V
Sbjct  170  RQRL-EGYQINPLQLNPGVEEMGYGRNP-AQTHGE-ALFQQMECEPTLQIGYQPD-PVSV  225

Query  170  AAAGPSVNNFMPEWYP  123
              AGPS++N+M  W P
Sbjct  226  VTAGPSMSNYMAGWLP  241



>ref|XP_006579434.1| PREDICTED: uncharacterized protein LOC100805078 isoform X2 [Glycine 
max]
Length=243

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 161/197 (82%), Gaps = 5/197 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL-QEISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL  E+SSQQEYLKLKARYEALQR
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREALVMELSSQQEYLKLKARYEALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            SQRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL DLQRKEH L+EAN+S
Sbjct  111  SQRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRS  170

Query  353  LKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            L+QRL E      L+ NP  +E+ YGR    Q+ G+   F  +ECEPTLQIGYQ D  ++
Sbjct  171  LRQRL-EGYQINPLQLNPGVEEMGYGRHP-AQTHGE-ALFQQMECEPTLQIGYQPD-PVS  226

Query  173  VAAAGPSVNNFMPEWYP  123
            V  AGPS++N+M  W P
Sbjct  227  VVTAGPSMSNYMAGWLP  243



>ref|XP_006579436.1| PREDICTED: uncharacterized protein LOC100805078 isoform X4 [Glycine 
max]
Length=241

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 161/196 (82%), Gaps = 5/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            +QRL E      L+ NP  +E+ YGR    Q+ G+   F  +ECEPTLQIGYQ D  ++V
Sbjct  170  RQRL-EGYQINPLQLNPGVEEMGYGRHPA-QTHGE-ALFQQMECEPTLQIGYQPD-PVSV  225

Query  170  AAAGPSVNNFMPEWYP  123
              AGPS++N+M  W P
Sbjct  226  VTAGPSMSNYMAGWLP  241



>gb|AET04966.2| MADS-box transcription factor [Medicago truncatula]
Length=242

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 159/196 (81%), Gaps = 4/196 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSAREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHMLSEANRSL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            +QR +E      L+ N   +E+ YGR    Q+ GD G +  LECEPTLQIGYQ D   +V
Sbjct  170  RQRQLEGYQLNQLQMNACVEEMGYGRHP-SQTQGD-GLYQQLECEPTLQIGYQPDPG-SV  226

Query  170  AAAGPSVNNFMPEWYP  123
              AGPS++N+M  W P
Sbjct  227  CTAGPSMSNYMGGWLP  242



>gb|AFU81296.1| SEPALLATA3 [Medicago polyceratia]
Length=244

 Score =   250 bits (638),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 158/197 (80%), Gaps = 4/197 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSAREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHMLSEANRSL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIG-YQTDHHIT  174
            +QR +E      L+ N   +E+ YGR    Q+ GD G +  LECEPTLQIG YQ D    
Sbjct  170  RQRQLEGYQLNQLQMNACVEEMGYGRHP-SQAQGD-GLYQQLECEPTLQIGSYQPDPGSV  227

Query  173  VAAAGPSVNNFMPEWYP  123
            V  AGPS++N+M  W P
Sbjct  228  VCTAGPSMSNYMGGWLP  244



>gb|AIC33052.1| flower development transporter SEP3 [Chrysanthemum lavandulifolium]
Length=250

 Score =   250 bits (638),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 156/200 (78%), Gaps = 6/200 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSS MLKTLERYQKCNYGAPE N+S REAL E+SSQQEYLKLKARYEALQR
Sbjct  51   RGKLYEFCSSSSSMLKTLERYQKCNYGAPETNVSAREAL-ELSSQQEYLKLKARYEALQR  109

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            SQRNLLGEDLGPLN KELESLERQLD SLKQIRS RTQ MLD L DLQ+KEH LN+AN++
Sbjct  110  SQRNLLGEDLGPLNCKELESLERQLDTSLKQIRSARTQFMLDTLTDLQKKEHALNDANRT  169

Query  353  LKQRLMEDANHLTLEWNP-TAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            LKQRLME     +L WNP   QE+ Y +Q   Q      FFH L+C PTLQ+GY +D   
Sbjct  170  LKQRLMEGHQVTSLHWNPHVQQEMGYDQQHEPQHQTGEAFFHPLDCGPTLQMGYPSDSLT  229

Query  176  TVAA---AGPSVNNFMPEWY  126
              AA   AGPS +N+MP WY
Sbjct  230  AEAAASVAGPSCSNYMPGWY  249



>ref|XP_006585130.1| PREDICTED: MADS-box transcription factor 1-like isoform X2 [Glycine 
max]
Length=243

 Score =   249 bits (637),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 161/197 (82%), Gaps = 5/197 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL-QEISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL  E+SSQQEYLKLKARYE+LQR
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREALVMELSSQQEYLKLKARYESLQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            SQRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL DLQRKEH L+EAN+S
Sbjct  111  SQRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRS  170

Query  353  LKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            L+QRL E      L+ NP  +E+ YGR    Q+ G+   F  +ECEPTLQIGYQ D  ++
Sbjct  171  LRQRL-EGYQINPLQLNPGVEEMGYGRNP-AQTHGE-ALFQQMECEPTLQIGYQPD-PVS  226

Query  173  VAAAGPSVNNFMPEWYP  123
            V  AGPS++N+M  W P
Sbjct  227  VVTAGPSMSNYMAGWLP  243



>ref|XP_006585132.1| PREDICTED: MADS-box transcription factor 1-like isoform X4 [Glycine 
max]
 gb|KHN12377.1| MADS-box transcription factor 1 [Glycine soja]
Length=241

 Score =   249 bits (636),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 161/196 (82%), Gaps = 5/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYE+LQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREAL-ELSSQQEYLKLKARYESLQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            +QRL E      L+ NP  +E+ YGR    Q+ G+   F  +ECEPTLQIGYQ D  ++V
Sbjct  170  RQRL-EGYQINPLQLNPGVEEMGYGRNP-AQTHGE-ALFQQMECEPTLQIGYQPD-PVSV  225

Query  170  AAAGPSVNNFMPEWYP  123
              AGPS++N+M  W P
Sbjct  226  VTAGPSMSNYMAGWLP  241



>ref|XP_010682729.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=239

 Score =   249 bits (635),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 157/196 (80%), Gaps = 7/196 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKL+EFCSS SMLKTLERYQK NYGAP+  +STREAL E+SSQQEYLKLKAR+EALQR+
Sbjct  51   RGKLFEFCSSPSMLKTLERYQKSNYGAPDNTVSTREAL-ELSSQQEYLKLKARHEALQRT  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
             RNL+GEDLGPL+SKELESLERQLDMSLKQIRSTRTQ M+DQL DLQRKEH LNEAN++L
Sbjct  110  HRNLMGEDLGPLSSKELESLERQLDMSLKQIRSTRTQYMVDQLTDLQRKEHMLNEANRTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            KQRL+E     +L+WN    ++ Y RQ     D    FFH L+CEPTLQ+GYQ D     
Sbjct  170  KQRLIEANQASSLQWN--VHDIGYDRQPAQPHDD--SFFHPLDCEPTLQMGYQND--AVN  223

Query  170  AAAGPSVNNFMPEWYP  123
            AAAG SVNNFMP W P
Sbjct  224  AAAGGSVNNFMPNWLP  239



>emb|CAB95648.1| MADS box protein [Betula pendula]
Length=251

 Score =   249 bits (636),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 161/206 (78%), Gaps = 15/206 (7%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKL EFCSS SMLKTLERYQKCN+GAPEPN+S REAL E+SSQQEYLKLKARYEALQR+
Sbjct  51   RGKLCEFCSSPSMLKTLERYQKCNFGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRT  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SKELE LERQL+MSLKQIRS RTQ MLDQL DLQRKEH LNEAN++L
Sbjct  110  QRNLMGEDLGPLSSKELELLERQLNMSLKQIRSIRTQCMLDQLTDLQRKEHMLNEANRTL  169

Query  350  KQRLMEDANHL--TLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            KQRL+ D  H+   L+ + +A +V YGRQ       D  FFH L CEPTLQIGYQ DH +
Sbjct  170  KQRLV-DGYHIDTVLQLDQSANDVGYGRQPAQTQ--DDCFFHPL-CEPTLQIGYQHDHPM  225

Query  176  T--------VAAAGPSVNNFMPEWYP  123
            T        V  AGPSVNN+M  W P
Sbjct  226  TVVTAGSGSVVTAGPSVNNYMSGWMP  251



>emb|CAX65571.1| GRCD5 protein [Gerbera hybrid cultivar]
Length=252

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 159/203 (78%), Gaps = 9/203 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPE-PNISTREALQEISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSMLKTLERYQKCNYGAP+  N+S REAL E+SSQQEYLKLKARYEALQR
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPDQTNVSAREAL-ELSSQQEYLKLKARYEALQR  109

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            SQRNLLGEDLGPLN KELESLERQLD SLK IRS RTQLMLD L DLQ+KEH LNEAN++
Sbjct  110  SQRNLLGEDLGPLNCKELESLERQLDTSLKHIRSARTQLMLDTLTDLQKKEHALNEANRT  169

Query  353  LKQRLMEDANHLTLEWNPTA-QEVEY-GRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            LKQRL+E     +L W P A QEV Y  RQ   Q   D  FFH L+C PTLQIGYQTD  
Sbjct  170  LKQRLIEGTQINSLHWYPQAPQEVCYDDRQHAPQHQTDEAFFHPLDCGPTLQIGYQTD-P  228

Query  179  ITV----AAAGPSVNNFMPEWYP  123
            I V    A AGPS+NN+M  W P
Sbjct  229  INVAGAEAVAGPSMNNYMQGWLP  251



>gb|ABD17387.1| MADS-box protein SEP3 [Taihangia rupestris]
Length=249

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 160/201 (80%), Gaps = 7/201 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSS MLKTLERYQKCNY  PE ++STREAL E+SSQQEYL+LKARYEALQR
Sbjct  51   RGKLYEFCSSSSSMLKTLERYQKCNYSTPETHVSTREAL-ELSSQQEYLRLKARYEALQR  109

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLDQL DLQRKE  LNEAN+S
Sbjct  110  NQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEQMLNEANRS  169

Query  353  LKQRLME--DANHL-TLEWNPTAQEVEYGR-QAIHQSDGDHGFFHHLECEPTLQIGYQTD  186
            LKQRL E  + N L   + N  A++V YGR Q  HQ   D  F+H LE EPTLQIGY   
Sbjct  170  LKQRLFEGYNVNQLHQFQLNANAEDVGYGRHQQAHQPHSD-VFYHPLELEPTLQIGYHQS  228

Query  185  HHITVAAAGPSVNNFMPEWYP  123
              I V AAGPSV+NFM  W P
Sbjct  229  DPIQVVAAGPSVSNFMGGWLP  249



>gb|ABD19719.1| SEP3-like MADS-box protein [Taihangia rupestris]
Length=249

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 160/201 (80%), Gaps = 7/201 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSS MLKTLERYQKCNY  PE ++STREAL E+SSQQEYL+LKARYEALQR
Sbjct  51   RGKLYEFCSSSSSMLKTLERYQKCNYSTPETHVSTREAL-ELSSQQEYLRLKARYEALQR  109

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLDQL DLQRKE  LNEAN+S
Sbjct  110  NQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEQMLNEANRS  169

Query  353  LKQRLME--DANHL-TLEWNPTAQEVEYGR-QAIHQSDGDHGFFHHLECEPTLQIGYQTD  186
            LKQRL E  + N L   + N  A++V YGR Q  HQ   D  F+H LE EPTLQIGY   
Sbjct  170  LKQRLFEGYNVNQLHQFQLNANAEDVGYGRHQQAHQPHSD-VFYHPLELEPTLQIGYHQS  228

Query  185  HHITVAAAGPSVNNFMPEWYP  123
              I V AAGPSV+NFM  W P
Sbjct  229  DPIQVVAAGPSVSNFMGGWLP  249



>gb|AAN15182.1| MADS box protein GHMADS-1 [Gossypium hirsutum]
Length=236

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 154/186 (83%), Gaps = 2/186 (1%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM+K LERYQKCNYGAPEPN+S+REA  E+SS+QEYLKLKARY+ALQRS
Sbjct  51   RGKLYEFCSSSSMIKILERYQKCNYGAPEPNVSSREAALELSSRQEYLKLKARYDALQRS  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELESLE+QLD SLK IRSTRTQ MLDQL DLQRKEH LNEAN++L
Sbjct  111  QRNLLGEDLGPLSSKELESLEKQLDSSLKLIRSTRTQYMLDQLNDLQRKEHLLNEANRTL  170

Query  350  KQRLMEDANHLTLEWNPTAQE-VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            KQRL+E     +L+ NP A E V YGRQ +H       FFH L+CEPTLQIGYQ D  ++
Sbjct  171  KQRLVEGYQVNSLQLNPNATEDVGYGRQQVHHQPHGDAFFHPLDCEPTLQIGYQHD-PMS  229

Query  173  VAAAGP  156
            V  AGP
Sbjct  230  VVTAGP  235



>ref|XP_003601749.1| MADS-box transcription factor [Medicago truncatula]
 gb|AES72000.1| MADS-box transcription factor [Medicago truncatula]
Length=244

 Score =   248 bits (633),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 159/196 (81%), Gaps = 2/196 (1%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS+SSMLKTLERYQKCNYGAPE N  ++EAL E+SSQQEYLKLKARYE+LQR+
Sbjct  51   RGKLYEFCSTSSMLKTLERYQKCNYGAPEANAHSKEAL-ELSSQQEYLKLKARYESLQRT  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SK+LE+LERQLD SLKQIRSTRTQ MLDQL DLQRKEH L EAN++L
Sbjct  110  QRNLMGEDLGPLSSKDLETLERQLDSSLKQIRSTRTQFMLDQLGDLQRKEHLLCEANRAL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            +QR ME     +L+ N +A+++ YGR    Q+ GDH  F  +ECEPTLQIGYQ D    V
Sbjct  170  RQR-MEGYQINSLQLNLSAEDMGYGRHHPGQNQGDHDVFQPIECEPTLQIGYQADPGSVV  228

Query  170  AAAGPSVNNFMPEWYP  123
              AGPS+NN+M  W P
Sbjct  229  VTAGPSMNNYMGGWLP  244



>ref|XP_004310096.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Fragaria 
vesca subsp. vesca]
Length=180

 Score =   246 bits (627),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 152/184 (83%), Gaps = 4/184 (2%)
 Frame = -3

Query  674  MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGPL  495
            MLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQR+QRNLLGEDLGPL
Sbjct  1    MLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRNQRNLLGEDLGPL  59

Query  494  NSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSLKQRLMEDANHLT  315
            +SKELESLERQLDMSLKQIRSTRTQ MLDQL DLQRKEH LNEAN++LKQRL E  +H  
Sbjct  60   SSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHLLNEANRTLKQRLFEGYHH-Q  118

Query  314  LEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITVAAAGPSVNNFMP  135
            L+ N  A+EV YGRQ  HQ  GD GFF  LECEPTLQIGY  +  I V  AGPSV N+M 
Sbjct  119  LQLNANAEEVAYGRQEAHQPQGD-GFFQALECEPTLQIGYHQNDPIQVVTAGPSV-NYMG  176

Query  134  EWYP  123
             W P
Sbjct  177  GWLP  180



>ref|XP_009372255.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Pyrus x bretschneideri]
Length=264

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 163/217 (75%), Gaps = 24/217 (11%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTL+RYQKCNYGAPE N+STREAL E+SSQQEYLKLKA +EALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLDRYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKAHFEALQRN  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLG L+SKELESLERQLD+SLKQIRSTRTQ MLD+L DLQR EH LNEANK+L
Sbjct  110  QRNLLGEDLGHLSSKELESLERQLDISLKQIRSTRTQCMLDKLTDLQRNEHVLNEANKTL  169

Query  350  KQRLMEDANHL--------------TLEWNPTAQEV-------EYGRQAIHQSDGDHGFF  234
            KQR +   + L              +L+ N  A E        EYGRQ    + GD GFF
Sbjct  170  KQRTLHVPDFLSDHALQLFEGYHVNSLQLNANADEYGHQQAADEYGRQQAQAAQGD-GFF  228

Query  233  HHLECEPTLQIGYQTDHHITVAAAGPSVNNFMPEWYP  123
            H L+CEPTLQIGYQ D  I+V  AGPSV+N+M  W P
Sbjct  229  HPLDCEPTLQIGYQND-PISVVTAGPSVSNYMGGWLP  264



>ref|XP_008340236.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Malus domestica]
Length=250

 Score =   248 bits (632),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 160/203 (79%), Gaps = 10/203 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTL+RYQK +Y APE N+STREAL E+SSQQEYLKLKA +EALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLDRYQKXSYAAPETNVSTREAL-ELSSQQEYLKLKAHFEALQRN  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLG L+SKELESLERQLDMSLKQIRSTRTQ MLDQL DLQR EH LNEANK+L
Sbjct  110  QRNLLGEDLGHLSSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRNEHVLNEANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEV-------EYGRQAIHQSDGDHGFFHHLECEPTLQIGYQ  192
            KQRL E  +  +L+ N  A E        EY RQ    + GD GFFH L+CEPTLQIGYQ
Sbjct  170  KQRLYEGYHVNSLQLNAXADEYGRQQAADEYNRQQAQXAQGD-GFFHPLDCEPTLQIGYQ  228

Query  191  TDHHITVAAAGPSVNNFMPEWYP  123
             D  I+V  AGPSV+N+M  W P
Sbjct  229  ND-PISVVTAGPSVSNYMGGWLP  250



>gb|ABQ85951.1| MADS-box transcription factor SEP-like 2 [Trochodendron aralioides]
Length=244

 Score =   247 bits (630),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 152/194 (78%), Gaps = 2/194 (1%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM KTLERYQKCNY APE +IS RE L++ SS QEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMFKTLERYQKCNYTAPETDISARETLEQ-SSYQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KELESLERQLD+SLKQIRS RTQ MLDQL DLQR E  L+E+NK+L
Sbjct  110  QRNLLGEDLGPLSGKELESLERQLDVSLKQIRSIRTQCMLDQLTDLQRTEQMLSESNKNL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
             +RL E +     +W+P A  + YG+Q  H      GFFH LECEPTLQIGYQ D  I V
Sbjct  170  ARRLEEGSQANAHQWDPNAHGMRYGQQPAHAHPQGDGFFHPLECEPTLQIGYQPD-QIAV  228

Query  170  AAAGPSVNNFMPEW  129
             A GPSVNN+MP W
Sbjct  229  MAPGPSVNNYMPGW  242



>gb|ADC79706.1| SEPALLATA3-like protein [Euptelea pleiosperma]
Length=243

 Score =   246 bits (629),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 160/195 (82%), Gaps = 5/195 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSS+SM KTLERYQKCNYGAPE  +STRE LQE SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSTSMFKTLERYQKCNYGAPETTVSTRE-LQEQSSQQEYLKLKARVEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KELESLERQLDMSLKQIRSTRTQ MLDQL DLQR+E  L+E+NK+L
Sbjct  110  QRNLLGEDLGPLSGKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRREQVLSESNKNL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            ++RL E +     +W+ +A  V YGRQ   Q+ G+ GF+H LECEPTLQIGY  D  ITV
Sbjct  170  RRRLEEGSQANPHQWDLSAHGVGYGRQQ-PQAQGE-GFYHPLECEPTLQIGYHPD-QITV  226

Query  170  AAAGPSVNNF-MPEW  129
            AA GPSVNN+ MP W
Sbjct  227  AAPGPSVNNYNMPGW  241



>ref|XP_008459849.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Cucumis melo]
Length=228

 Score =   246 bits (627),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 152/196 (78%), Gaps = 18/196 (9%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE+LERQLDMSLKQIRSTRT             ++ L++    L
Sbjct  110  QRNLLGEDLGPLSSKELENLERQLDMSLKQIRSTRT-------------QYMLDQLT-DL  155

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            +++L+E      L+ N +A ++ YGRQ   Q  GD  FFH L+CEPTLQIGYQ D  ITV
Sbjct  156  QRKLVEGYQVNALQLNQSADDMMYGRQQ-AQPPGD-AFFHPLDCEPTLQIGYQPD-PITV  212

Query  170  AAAGPSVNNFMPEWYP  123
              AGPS+NNF+P W P
Sbjct  213  VTAGPSMNNFLPGWLP  228



>gb|AEF59026.1| MADS-2 [Fragaria x ananassa]
Length=180

 Score =   244 bits (622),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 152/184 (83%), Gaps = 4/184 (2%)
 Frame = -3

Query  674  MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGPL  495
            MLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARY+ALQR+QRNLLGEDLGPL
Sbjct  1    MLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYDALQRNQRNLLGEDLGPL  59

Query  494  NSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSLKQRLMEDANHLT  315
            +SKELESLERQLDMSLKQIRSTRTQ MLDQL DLQ+KEH LNEAN++LKQRL +  NH  
Sbjct  60   SSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQQKEHLLNEANRTLKQRLFDGYNH-Q  118

Query  314  LEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITVAAAGPSVNNFMP  135
            L+ N  A+EV YGRQ  HQ  GD GFF  LECEPTLQIGY  +  I V  AGPSV N+M 
Sbjct  119  LQLNANAEEVAYGRQQAHQPRGD-GFFQALECEPTLQIGYHQNDPIQVVTAGPSV-NYMG  176

Query  134  EWYP  123
             W P
Sbjct  177  GWLP  180



>gb|AAR06665.1| transcription factor SEP3 [Chloranthus spicatus]
Length=204

 Score =   244 bits (622),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 153/195 (78%), Gaps = 7/195 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAP+  +STRE     SSQQEYLKLKAR EALQRS
Sbjct  14   RGKLYEFCSSSSMLKTLERYQKCNYGAPDTTVSTREMQ---SSQQEYLKLKARVEALQRS  70

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRN LGEDLGPL+ KELE LERQLDMSLKQIRSTRTQ MLDQL DLQR+E  L E NK+L
Sbjct  71   QRNFLGEDLGPLSGKELEQLERQLDMSLKQIRSTRTQYMLDQLTDLQRREQMLCETNKAL  130

Query  350  KQRLME-DANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            K+RL E    +    W+P    V YGRQA  Q  GD GFFH LECEPTLQIGYQ D  IT
Sbjct  131  KRRLDEVTPANPHQGWDPNPHGVSYGRQAAQQQ-GD-GFFHPLECEPTLQIGYQHD-QIT  187

Query  173  VAAAGPSVNNFMPEW  129
            +AA GPSV+N+MP W
Sbjct  188  IAAPGPSVSNYMPGW  202



>gb|AAX15924.1| AGL9.2 [Persea americana]
Length=242

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 152/196 (78%), Gaps = 8/196 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE  +STRE     SS QEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETTVSTRETQ---SSHQEYLKLKARVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL SKEL++LE+QLD SLKQIRSTRTQ MLDQL DLQR+E  L+EANK+L
Sbjct  108  QRNLLGEDLGPLTSKELDTLEKQLDASLKQIRSTRTQYMLDQLADLQRREQMLSEANKNL  167

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGR-QAIHQSDGDHGFFHHLE-CEPTLQIGYQTDHHI  177
            K+RL E        W+P    V YGR QA  QSD   GFFH L+ CEPTL IGYQ    I
Sbjct  168  KRRLEEGMQANPQVWDPNGHPVTYGRQQAPPQSD---GFFHPLDTCEPTLHIGYQPADQI  224

Query  176  TVAAAGPSVNNFMPEW  129
            T+AA GPSVNN+MP W
Sbjct  225  TIAAPGPSVNNYMPGW  240



>ref|XP_004504399.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X3 [Cicer arietinum]
Length=228

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 149/196 (76%), Gaps = 18/196 (9%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SKELESLERQLD SL+QIRSTR              EH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDTSLQQIRSTR--------------EHMLSEANRSL  155

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            +QR +E      L+ N   +E+ YGR    Q+ GD G F  +ECEPTLQIGYQ D   +V
Sbjct  156  RQRQLERYQLNQLQMNHCVEEMGYGRHP-SQTHGD-GLFQQMECEPTLQIGYQADPG-SV  212

Query  170  AAAGPSVNNFMPEWYP  123
             AAGPS++N+M  W P
Sbjct  213  VAAGPSMSNYMAGWLP  228



>ref|XP_004502275.1| PREDICTED: MADS-box transcription factor 1-like isoform X2 [Cicer 
arietinum]
Length=241

 Score =   242 bits (617),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 160/196 (82%), Gaps = 5/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS+SSMLKTLERYQKCNYGAPE N++T+EAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSTSSMLKTLERYQKCNYGAPEANVATKEAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SK+LE+LERQLD SLKQIRSTRTQ MLDQL DLQRKEH L EAN++L
Sbjct  110  QRNLMGEDLGPLSSKDLETLERQLDSSLKQIRSTRTQFMLDQLGDLQRKEHLLCEANRAL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            +QR ME     +L+ N +A+++ Y R    Q+ GD   F  LECEPTLQIGYQ D   +V
Sbjct  170  RQR-MEGYQISSLQLNLSAEDMGYDRHP-GQTHGD-ALFQQLECEPTLQIGYQNDPG-SV  225

Query  170  AAAGPSVNNFMPEWYP  123
              AGPS+NN+M  W P
Sbjct  226  VTAGPSMNNYMGGWLP  241



>gb|ABD17386.1| MADS-box protein SEP3-1 [Taihangia rupestris]
Length=325

 Score =   244 bits (624),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 157/195 (81%), Gaps = 6/195 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNY  PE ++ST EAL E+SSQQEYL+LKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYSTPETHVSTGEAL-ELSSQQEYLRLKARYEALQRN  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ MLDQL DLQRKE  LNEAN+SL
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEQMLNEANRSL  169

Query  350  KQRLME--DANHL-TLEWNPTAQEVEYGR-QAIHQSDGDHGFFHHLECEPTLQIGYQTDH  183
            KQRL E  + N L   + N  A++V YGR Q  HQ   D  F+H LE EPTLQIGY    
Sbjct  170  KQRLFEGYNVNQLHQFQLNANAEDVGYGRHQQAHQPHSD-VFYHPLELEPTLQIGYHQSD  228

Query  182  HITVAAAGPSVNNFM  138
             I V AAGPSV+NFM
Sbjct  229  PIQVVAAGPSVSNFM  243



>ref|XP_004502274.1| PREDICTED: MADS-box transcription factor 1-like isoform X1 [Cicer 
arietinum]
Length=243

 Score =   241 bits (616),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 160/197 (81%), Gaps = 5/197 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCS+SSMLKTLERYQKCNYGAPE N++T+EAL  E+SSQQEYLKLKARYEALQR
Sbjct  51   RGKLYEFCSTSSMLKTLERYQKCNYGAPEANVATKEALVLELSSQQEYLKLKARYEALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            SQRNL+GEDLGPL+SK+LE+LERQLD SLKQIRSTRTQ MLDQL DLQRKEH L EAN++
Sbjct  111  SQRNLMGEDLGPLSSKDLETLERQLDSSLKQIRSTRTQFMLDQLGDLQRKEHLLCEANRA  170

Query  353  LKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            L+QR ME     +L+ N +A+++ Y R    Q+ GD   F  LECEPTLQIGYQ D   +
Sbjct  171  LRQR-MEGYQISSLQLNLSAEDMGYDRHP-GQTHGD-ALFQQLECEPTLQIGYQNDPG-S  226

Query  173  VAAAGPSVNNFMPEWYP  123
            V  AGPS+NN+M  W P
Sbjct  227  VVTAGPSMNNYMGGWLP  243



>ref|XP_006415783.1| hypothetical protein EUTSA_v10008591mg [Eutrema salsugineum]
 gb|ESQ34136.1| hypothetical protein EUTSA_v10008591mg [Eutrema salsugineum]
Length=247

 Score =   241 bits (615),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 153/198 (77%), Gaps = 9/198 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR+
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQRT  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL++KELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+L
Sbjct  111  QRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTL  170

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQT--DHHI  177
            + RL  D   + L+ NP  ++V+YGR   HQ      FF  LECEP LQIGYQ   DH +
Sbjct  171  RLRL-ADGYQMPLQLNPNQEDVDYGR---HQQQHSQAFFQPLECEPILQIGYQGQQDHGM  226

Query  176  TVAAAGPSVNNFMPEWYP  123
                AGPSVNN+M  W P
Sbjct  227  ---GAGPSVNNYMLGWLP  241



>dbj|BAO74164.1| MADS-box transcription factor SEP3.2 [Torenia fournieri]
Length=253

 Score =   241 bits (615),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 160/204 (78%), Gaps = 13/204 (6%)
 Frame = -3

Query  710  RGKLYEFCSSSS-MLKTLERYQKCNYGAPE-PNISTREALQEISSQQEYLKLKARYEALQ  537
            RGKLYEFCSSSS M KTLERYQKCNYGAP+ PN+S REAL E+SSQQEYLKLK RYEALQ
Sbjct  51   RGKLYEFCSSSSSMPKTLERYQKCNYGAPDQPNVSAREALVELSSQQEYLKLKGRYEALQ  110

Query  536  RSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANK  357
            RSQRNLLGEDLGPLN KELE+LERQLDMSLKQIRSTRTQ+MLD L DLQ+KE+ LNEANK
Sbjct  111  RSQRNLLGEDLGPLNLKELETLERQLDMSLKQIRSTRTQVMLDTLTDLQKKEYALNEANK  170

Query  356  SLKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHH-----LECEPTLQIGYQ  192
            SLKQRLME  +H++L+W   A E++YGR         H    H     LECEPTLQIGYQ
Sbjct  171  SLKQRLME-GSHISLQWQ--ANEMDYGRHVQPHHHHHHHHPDHVFFHPLECEPTLQIGYQ  227

Query  191  TDHHITV--AAAGPSV-NNFMPEW  129
             D  IT   A AGPSV NN++  W
Sbjct  228  ADPAITAAEAEAGPSVNNNYLSGW  251



>gb|ADD25191.1| SEP3, partial [Nelumbo nucifera]
Length=226

 Score =   240 bits (612),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 157/194 (81%), Gaps = 7/194 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM+KTLERYQKCNYGAPE  ISTRE+ +E+S QQEYLKLKAR EALQRS
Sbjct  38   RGKLYEFCSSSSMIKTLERYQKCNYGAPETTISTRES-EELSCQQEYLKLKARVEALQRS  96

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KELESLERQLDMSLKQIRSTRTQ MLDQL DLQR+E  L+EAN++L
Sbjct  97   QRNLLGEDLGPLSGKELESLERQLDMSLKQIRSTRTQYMLDQLADLQRREQMLSEANRAL  156

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            K+R  E +     +W+P      YGR    Q+ G+ GFFH +ECEPTLQIGYQ D  ITV
Sbjct  157  KRRFEEGSQANAHQWDPNVH--GYGRHPA-QTQGE-GFFHPVECEPTLQIGYQPD-QITV  211

Query  170  AAAGPSVNNFMPEW  129
            AA GPSV ++MP W
Sbjct  212  AAPGPSV-SYMPGW  224



>ref|XP_010250667.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Nelumbo 
nucifera]
Length=239

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 157/194 (81%), Gaps = 7/194 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM+KTLERYQKCNYGAPE  ISTRE+ +E+S QQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMIKTLERYQKCNYGAPETTISTRES-EELSCQQEYLKLKARVEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KELESLERQLDMSLKQIRSTRTQ MLDQL DLQR+E  L+EAN++L
Sbjct  110  QRNLLGEDLGPLSGKELESLERQLDMSLKQIRSTRTQYMLDQLADLQRREQMLSEANRAL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            K+R  E +     +W+P      YGR    Q+ G+ GFFH +ECEPTLQIGYQ D  ITV
Sbjct  170  KRRFEEGSQANAHQWDPNVH--GYGRHPA-QTQGE-GFFHPVECEPTLQIGYQPD-QITV  224

Query  170  AAAGPSVNNFMPEW  129
            AA GPSV ++MP W
Sbjct  225  AAPGPSV-SYMPGW  237



>gb|ADC79703.1| SEPALLATA3-like protein [Pachysandra terminalis]
Length=243

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 155/195 (79%), Gaps = 5/195 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSML+TLERYQKCNYG PEPN+S RE L++ SSQQEYLKLKAR+++LQRS
Sbjct  51   RGKLYEFCSSSSMLETLERYQKCNYGTPEPNVSARETLEQ-SSQQEYLKLKARFDSLQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SKELESLERQLDMSLKQIRSTRTQ MLDQL DLQR+E  L E N +L
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRREQMLAEVNNTL  169

Query  350  KQRLMEDANHLTLE-WNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            K+RL E +     E W+P      Y R    Q  GD GFFH L+CEPTLQIGY+ +  IT
Sbjct  170  KRRLDEGSQVNAHEMWDPNGHGAGYERSQA-QPHGD-GFFHPLDCEPTLQIGYRPE-QIT  226

Query  173  VAAAGPSVNNFMPEW  129
            V A GPSVNN+MP W
Sbjct  227  VVAPGPSVNNYMPGW  241



>ref|XP_004504400.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X4 [Cicer arietinum]
Length=227

 Score =   239 bits (610),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 149/196 (76%), Gaps = 19/196 (10%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SKELESLERQLD SL+QIRSTR              EH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDTSLQQIRSTR--------------EHMLSEANRSL  155

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            +QRL E      L+ N   +E+ YGR    Q+ GD G F  +ECEPTLQIGYQ D   +V
Sbjct  156  RQRL-ERYQLNQLQMNHCVEEMGYGRHP-SQTHGD-GLFQQMECEPTLQIGYQADPG-SV  211

Query  170  AAAGPSVNNFMPEWYP  123
             AAGPS++N+M  W P
Sbjct  212  VAAGPSMSNYMAGWLP  227



>ref|XP_010913017.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Elaeis guineensis]
 gb|AAQ03226.1|AF411845_1 MADS box transcription factor [Elaeis guineensis]
Length=242

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 153/196 (78%), Gaps = 8/196 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     +SQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIVSRETQ---TSQQEYLKLKARVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLG+DLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANKSL
Sbjct  108  QRNLLGDDLGPLSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSL  167

Query  350  KQRLMEDANHLTLE--WNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            KQRL E++N  T +  W+P A  V YGRQ   Q  GD GF+  +EC+PTL IGY  +   
Sbjct  168  KQRL-EESNQATQQQVWDPNAPAVGYGRQP-PQPQGD-GFYQQIECDPTLHIGYPPEQIT  224

Query  176  TVAAAGPSVNNFMPEW  129
              AA GPSV+N+MP W
Sbjct  225  IAAAPGPSVSNYMPGW  240



>dbj|BAD10945.1| SEPALLATA3 homologous protein [Silene latifolia]
Length=244

 Score =   239 bits (609),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 158/197 (80%), Gaps = 6/197 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPN-ISTREALQEISSQQEYLKLKARYEALQR  534
            RGKLYEFCSS SMLKTLERYQK NYG P+   +S+REAL EISS QEY++LKARYEALQR
Sbjct  51   RGKLYEFCSSPSMLKTLERYQKSNYGPPDNTAVSSREAL-EISSHQEYIRLKARYEALQR  109

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            + RNL+GEDLGPL+SKELESLERQLDMSLK IRSTRTQ MLDQL DLQRKEH LNEAN +
Sbjct  110  THRNLMGEDLGPLSSKELESLERQLDMSLKHIRSTRTQYMLDQLADLQRKEHVLNEANIT  169

Query  353  LKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            LKQRL+E A+ ++        E++YGRQ   Q+  DH FFH LECEPTLQIGYQ +  + 
Sbjct  170  LKQRLIE-ADQVS-SAQCYGHELDYGRQN-PQAQADHVFFHPLECEPTLQIGYQPE-QMN  225

Query  173  VAAAGPSVNNFMPEWYP  123
            V AAGPS+NNFM  W P
Sbjct  226  VTAAGPSINNFMTGWLP  242



>ref|XP_008801852.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X3 [Phoenix dactylifera]
Length=242

 Score =   238 bits (608),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 152/196 (78%), Gaps = 8/196 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIVSRETQ---SSQQEYLKLKARVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANKSL
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSL  167

Query  350  KQRLMEDANHLTLE--WNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            K+RL E++N  T +  W+P A  V YGRQ   Q  GD GF+  +ECEPTL IGY  +   
Sbjct  168  KRRL-EESNQATQQQVWDPNAHAVGYGRQP-PQPQGD-GFYQPIECEPTLHIGYHPEQIT  224

Query  176  TVAAAGPSVNNFMPEW  129
              A  GPSV+N+MP W
Sbjct  225  IAAGPGPSVSNYMPGW  240



>ref|XP_008340234.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Malus domestica]
 ref|XP_008340235.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Malus domestica]
Length=264

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 160/217 (74%), Gaps = 24/217 (11%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTL+RYQK +Y APE N+STREAL E+SSQQEYLKLKA +EALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLDRYQKXSYAAPETNVSTREAL-ELSSQQEYLKLKAHFEALQRN  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLG L+SKELESLERQLDMSLKQIRSTRTQ MLDQL DLQR EH LNEANK+L
Sbjct  110  QRNLLGEDLGHLSSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRNEHVLNEANKTL  169

Query  350  KQRLMEDANHL--------------TLEWNPTAQEV-------EYGRQAIHQSDGDHGFF  234
            KQR +   + L              +L+ N  A E        EY RQ    + GD GFF
Sbjct  170  KQRTLHVPDFLGDHALQLYEGYHVNSLQLNAXADEYGRQQAADEYNRQQAQXAQGD-GFF  228

Query  233  HHLECEPTLQIGYQTDHHITVAAAGPSVNNFMPEWYP  123
            H L+CEPTLQIGYQ D  I+V  AGPSV+N+M  W P
Sbjct  229  HPLDCEPTLQIGYQND-PISVVTAGPSVSNYMGGWLP  264



>dbj|BAB70747.1| putative MADS-domain transcription factor MpMADS13 [Magnolia 
praecocissima]
Length=231

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 154/196 (79%), Gaps = 8/196 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE  +STRE     S  QEYLKLKAR EALQRS
Sbjct  40   RGKLYEFCSSSSMLKTLERYQKCNYGAPELPVSTRETQ---SYHQEYLKLKARVEALQRS  96

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KELE+LERQLD+SL+QIRSTRTQ MLDQL DLQR+EH L+EANK+L
Sbjct  97   QRNLLGEDLGPLSGKELETLERQLDISLRQIRSTRTQCMLDQLGDLQRREHMLSEANKTL  156

Query  350  KQRLMEDAN-HLTLEWNPTAQEVE-YGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
             +RL E A  +    W P A  V+ Y RQ   Q  GD GFFH LECEPTL IGYQ D  I
Sbjct  157  TRRLEEGAQANQNQVWEPNAHAVDSYNRQQPQQ-QGD-GFFHPLECEPTLHIGYQPD-QI  213

Query  176  TVAAAGPSVNNFMPEW  129
            T+AA GPSVNN+MP W
Sbjct  214  TIAAPGPSVNNYMPGW  229



>gb|KHN24051.1| MADS-box transcription factor 1 [Glycine soja]
Length=241

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 156/196 (80%), Gaps = 5/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGK YEFCS SSMLKTLERYQKCNYGAPE N++T+EAL E+SSQQEYL+LKARYEALQRS
Sbjct  51   RGKQYEFCSGSSMLKTLERYQKCNYGAPEDNVATKEAL-ELSSQQEYLRLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRS RTQ MLDQL DLQRKEH L E+N+ L
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSIRTQFMLDQLSDLQRKEHFLGESNRDL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            +QRL E+     L+ NP+A+++ YGR    Q  G H  F  LECEPTLQIGY  D  ++V
Sbjct  170  RQRL-EEFQINPLQLNPSAEDMGYGRHP-GQPQG-HALFQPLECEPTLQIGYHPD-PVSV  225

Query  170  AAAGPSVNNFMPEWYP  123
               GPS+NN+M  W P
Sbjct  226  VTEGPSMNNYMAGWLP  241



>ref|NP_001236390.1| MADS transcription factor [Glycine max]
 emb|CAI47596.1| MADS transcription factor [Glycine max]
 gb|ACU23250.1| unknown [Glycine max]
Length=243

 Score =   236 bits (603),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 156/197 (79%), Gaps = 5/197 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGK YEFCS SSMLKTLERYQKCNYGAPE N++T+EAL  E+SSQQEYL+LKARYEALQR
Sbjct  51   RGKQYEFCSGSSMLKTLERYQKCNYGAPEDNVATKEALVLELSSQQEYLRLKARYEALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            SQRNL+GEDLGPL+SKELESLERQLD SLKQIRS RTQ MLDQL DLQRKEH L E+N+ 
Sbjct  111  SQRNLMGEDLGPLSSKELESLERQLDSSLKQIRSIRTQFMLDQLSDLQRKEHFLGESNRD  170

Query  353  LKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            L+QRL E+     L+ NP+A+++ YGR    Q  G H  F  LECEPTLQIGY  D  ++
Sbjct  171  LRQRL-EEFQINPLQLNPSAEDMGYGRHP-GQPQG-HALFQPLECEPTLQIGYHPD-PVS  226

Query  173  VAAAGPSVNNFMPEWYP  123
            V   GPS+NN+M  W P
Sbjct  227  VVTEGPSMNNYMAGWLP  243



>ref|NP_850953.1| MADs box transcription factor SEPALLATA3 [Arabidopsis thaliana]
 gb|AAM65812.1| putative floral homeotic protein, AGL9 [Arabidopsis thaliana]
 gb|AEE30502.1| MADs box transcription factor SEPALLATA3 [Arabidopsis thaliana]
Length=250

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 149/197 (76%), Gaps = 4/197 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR+
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQRT  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL++KELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+L
Sbjct  111  QRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTL  170

Query  350  KQRLMEDANHLTLEWNPTAQEVE-YGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            + RL  D   + L+ NP  +EV+ YGR    Q      FF  LECEP LQIGYQ      
Sbjct  171  RLRL-ADGYQMPLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQGQQD--  227

Query  173  VAAAGPSVNNFMPEWYP  123
               AGPSVNN+M  W P
Sbjct  228  GMGAGPSVNNYMLGWLP  244



>gb|KDO81856.1| hypothetical protein CISIN_1g047287mg [Citrus sinensis]
Length=210

 Score =   234 bits (597),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 151/198 (76%), Gaps = 16/198 (8%)
 Frame = -3

Query  677  SMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGP  498
            SM+KTLERYQKCNYGAPEPN+S REAL E+SSQQEYLKLKARYEALQRSQRNLLGE+LGP
Sbjct  15   SMVKTLERYQKCNYGAPEPNVSAREAL-ELSSQQEYLKLKARYEALQRSQRNLLGEELGP  73

Query  497  LNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSLKQR--------  342
            LNSKELESLERQLDMSLKQIRSTRTQ MLD L +LQ KE  L+EANK+LKQR        
Sbjct  74   LNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRTMTLRHAD  133

Query  341  -----LMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
                 LME     TL+ NP+A++  YG +   Q  GD  FFH LECEPTLQIGYQ    I
Sbjct  134  FAGLQLMEGYQVNTLQLNPSAEDCGYGLKPA-QPQGDT-FFHALECEPTLQIGYQPADPI  191

Query  176  TVAAAGPSVNNFMPEWYP  123
            +V  AGPS+NN+M  W P
Sbjct  192  SVVTAGPSLNNYMQGWLP  209



>gb|ABK41485.1| putative MADS box protein [Elaeis guineensis]
Length=242

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 152/197 (77%), Gaps = 10/197 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM+KTLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMMKTLERYQKCNYGAPETNIISRETQ---SSQQEYLKLKARAEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQRKE  L EANKSL
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRKEQMLCEANKSL  167

Query  350  KQRLMEDANHLTLE--WNPTAQEVEYGRQAIH-QSDGDHGFFHHLECEPTLQIGYQTDHH  180
            ++RL E++N    +  W+PTA  V YGRQ    QSD   GF+  ++ EPTLQIGY  +  
Sbjct  168  RRRL-EESNQAGQQQVWDPTAHAVGYGRQPPQPQSD---GFYQQIDSEPTLQIGYPPEQI  223

Query  179  ITVAAAGPSVNNFMPEW  129
               AA GPSVN +MP W
Sbjct  224  TIAAAPGPSVNTYMPGW  240



>sp|O65874.1|MTF1_PEA RecName: Full=MADS-box transcription factor 1 [Pisum sativum]
 emb|CAA11258.1| MADS-box transcription factor [Pisum sativum]
Length=247

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 158/198 (80%), Gaps = 3/198 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCS+SSMLKTLERYQKCNYGAPE N++++EAL  E+SSQQEYLKLKARYE+LQR
Sbjct  51   RGKLYEFCSTSSMLKTLERYQKCNYGAPEGNVTSKEALVLELSSQQEYLKLKARYESLQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            SQRNL+GEDLGPL+SK+LE+LERQLD SLKQIRSTRTQ MLDQL DLQRKEH L EAN++
Sbjct  111  SQRNLMGEDLGPLSSKDLETLERQLDSSLKQIRSTRTQFMLDQLGDLQRKEHLLCEANRA  170

Query  353  LKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGF-FHHLECEPTLQIGYQTDHHI  177
            L+QR ME     +L+ N +A+++ YGR     + GD  F    +ECEPTLQIGY      
Sbjct  171  LRQR-MEGYQINSLQLNLSAEDMGYGRHHQGHTHGDELFQVQPIECEPTLQIGYHQGDPG  229

Query  176  TVAAAGPSVNNFMPEWYP  123
            +V  AGPS+NN+M  W P
Sbjct  230  SVVTAGPSMNNYMGGWLP  247



>ref|XP_010917558.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Elaeis 
guineensis]
 gb|AAQ03224.1|AF411843_1 MADS box transcription factor [Elaeis guineensis]
Length=242

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 152/197 (77%), Gaps = 10/197 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM+KTLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMMKTLERYQKCNYGAPETNIISRETQ---SSQQEYLKLKARAEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQRKE  L EANKSL
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRKEQMLCEANKSL  167

Query  350  KQRLMEDANHLTLE--WNPTAQEVEYGRQAIH-QSDGDHGFFHHLECEPTLQIGYQTDHH  180
            ++RL E++N    +  W+PTA  V YGRQ    QSD   GF+  ++ EPTLQIGY  +  
Sbjct  168  RRRL-EESNQAGQQQVWDPTAHAVGYGRQPPQPQSD---GFYQQIDSEPTLQIGYPPEQI  223

Query  179  ITVAAAGPSVNNFMPEW  129
               AA GPSVN +MP W
Sbjct  224  TIAAAPGPSVNTYMPGW  240



>ref|XP_007163780.1| hypothetical protein PHAVU_001G263400g [Phaseolus vulgaris]
 gb|ESW35774.1| hypothetical protein PHAVU_001G263400g [Phaseolus vulgaris]
Length=241

 Score =   233 bits (595),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 153/198 (77%), Gaps = 9/198 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS+SSMLKTLERYQKCNYGAPE N ST+EAL E+SSQQEYLKLKARYEALQR 
Sbjct  51   RGKLYEFCSTSSMLKTLERYQKCNYGAPENNASTKEAL-ELSSQQEYLKLKARYEALQRF  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+S ELESLERQLD SLKQIRSTRTQ MLDQL D QRKEH L EAN +L
Sbjct  110  QRNLMGEDLGPLSSNELESLERQLDSSLKQIRSTRTQFMLDQLSDSQRKEHLLGEANTAL  169

Query  350  KQRLME-DANHLTLEWNPTAQEVEYGRQ-AIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            +QRL E   N   L  NP+ +++ Y R    HQ D     F  LECEPTLQ+GY+ D  +
Sbjct  170  RQRLEEYQINQFQL--NPSGEDMGYDRHPGQHQGD---ALFQPLECEPTLQMGYRPD-PV  223

Query  176  TVAAAGPSVNNFMPEWYP  123
            +V   GPS+NN+M  W P
Sbjct  224  SVITGGPSMNNYMAGWLP  241



>gb|ABQ85950.1| MADS-box transcription factor SEP-like 1 [Trochodendron aralioides]
Length=217

 Score =   231 bits (590),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 150/194 (77%), Gaps = 9/194 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERY+KCNY  P+ N+STRE  Q  S   EYLKLKARYEAL++S
Sbjct  31   RGKLYEFCSSSSMLKTLERYEKCNYAGPKTNMSTRET-QVNSGYHEYLKLKARYEALRQS  89

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
             RNL+GEDLGPL+SKELESLER L++SLKQIRSTRTQ MLDQL DLQR+E  L+EAN++L
Sbjct  90   HRNLMGEDLGPLSSKELESLERALNVSLKQIRSTRTQYMLDQLSDLQRREQMLSEANRTL  149

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            +Q L E      L+WNP+ Q+VEYGRQ        HGFFH LECEPTLQIGYQ D     
Sbjct  150  RQSLDEGRQANVLQWNPSEQDVEYGRQPTQPQ--SHGFFHPLECEPTLQIGYQPD-----  202

Query  170  AAAGPSVNNFMPEW  129
             A  PSV+N+MP W
Sbjct  203  -APEPSVSNYMPGW  215



>ref|XP_007163779.1| hypothetical protein PHAVU_001G263400g [Phaseolus vulgaris]
 gb|ESW35773.1| hypothetical protein PHAVU_001G263400g [Phaseolus vulgaris]
Length=243

 Score =   232 bits (592),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 153/199 (77%), Gaps = 9/199 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCS+SSMLKTLERYQKCNYGAPE N ST+EAL  E+SSQQEYLKLKARYEALQR
Sbjct  51   RGKLYEFCSTSSMLKTLERYQKCNYGAPENNASTKEALVLELSSQQEYLKLKARYEALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
             QRNL+GEDLGPL+S ELESLERQLD SLKQIRSTRTQ MLDQL D QRKEH L EAN +
Sbjct  111  FQRNLMGEDLGPLSSNELESLERQLDSSLKQIRSTRTQFMLDQLSDSQRKEHLLGEANTA  170

Query  353  LKQRLME-DANHLTLEWNPTAQEVEYGRQ-AIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            L+QRL E   N   L  NP+ +++ Y R    HQ D     F  LECEPTLQ+GY+ D  
Sbjct  171  LRQRLEEYQINQFQL--NPSGEDMGYDRHPGQHQGD---ALFQPLECEPTLQMGYRPD-P  224

Query  179  ITVAAAGPSVNNFMPEWYP  123
            ++V   GPS+NN+M  W P
Sbjct  225  VSVITGGPSMNNYMAGWLP  243



>ref|XP_003538541.1| PREDICTED: MADS-box transcription factor 1-like isoform X1 [Glycine 
max]
 gb|KHN44454.1| MADS-box transcription factor 1 [Glycine soja]
Length=241

 Score =   232 bits (592),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 155/196 (79%), Gaps = 5/196 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGK YEFCS SSMLKTLERYQKCNYGAPE N++T EAL E+SSQQEYL+LKARYEALQRS
Sbjct  51   RGKQYEFCSGSSMLKTLERYQKCNYGAPEDNVATNEAL-ELSSQQEYLRLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRS RTQ MLDQL DLQRKEH L E+N+ L
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSIRTQFMLDQLSDLQRKEHFLGESNRDL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
             QRL E+     L+ NP+A+E+ +GR    Q  G H  F  L+CEPTLQIGY  D  ++V
Sbjct  170  IQRL-EEFQINPLQLNPSAEEMGHGRYP-GQPQG-HALFQPLDCEPTLQIGYHPD-PVSV  225

Query  170  AAAGPSVNNFMPEWYP  123
             + GPS+NN+M  W P
Sbjct  226  VSEGPSMNNYMAGWLP  241



>ref|XP_006591442.1| PREDICTED: MADS-box transcription factor 1-like isoform X2 [Glycine 
max]
Length=243

 Score =   232 bits (591),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 155/197 (79%), Gaps = 5/197 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGK YEFCS SSMLKTLERYQKCNYGAPE N++T EAL  E+SSQQEYL+LKARYEALQR
Sbjct  51   RGKQYEFCSGSSMLKTLERYQKCNYGAPEDNVATNEALVLELSSQQEYLRLKARYEALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            SQRNL+GEDLGPL+SKELESLERQLD SLKQIRS RTQ MLDQL DLQRKEH L E+N+ 
Sbjct  111  SQRNLMGEDLGPLSSKELESLERQLDSSLKQIRSIRTQFMLDQLSDLQRKEHFLGESNRD  170

Query  353  LKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            L QRL E+     L+ NP+A+E+ +GR    Q  G H  F  L+CEPTLQIGY  D  ++
Sbjct  171  LIQRL-EEFQINPLQLNPSAEEMGHGRYP-GQPQG-HALFQPLDCEPTLQIGYHPD-PVS  226

Query  173  VAAAGPSVNNFMPEWYP  123
            V + GPS+NN+M  W P
Sbjct  227  VVSEGPSMNNYMAGWLP  243



>gb|AAX15920.1| AGL9 [Liriodendron tulipifera]
Length=242

 Score =   231 bits (590),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 150/197 (76%), Gaps = 10/197 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS+SSM KTLERYQKCNYGAPE  ++TRE     SS QEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSTSSMFKTLERYQKCNYGAPEAAVTTREIQ---SSHQEYLKLKARVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLN KEL++LERQLD+SLKQIRSTRTQ MLDQL DLQR+E  L+EANK+L
Sbjct  108  QRNLLGEDLGPLNGKELDTLERQLDVSLKQIRSTRTQYMLDQLTDLQRREQMLSEANKAL  167

Query  350  KQRL---MEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            K+RL   M+   H    WN     +EY RQ      GD GFFH L+CEPTLQIGYQTD  
Sbjct  168  KRRLDEGMQANPHQG--WNHNPHAMEYVRQQ-GPPQGD-GFFHPLDCEPTLQIGYQTDQI  223

Query  179  ITVAAAGPSVNNFMPEW  129
                A GPS+NN+MP W
Sbjct  224  TMSTAPGPSLNNYMPGW  240



>gb|AAX15923.1| AGL9.1 [Persea americana]
Length=237

 Score =   231 bits (589),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 157/199 (79%), Gaps = 19/199 (10%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS++SMLKTLERYQKCNYGAPE  +S+RE LQ  SS QEY+KLKAR EALQRS
Sbjct  51   RGKLYEFCSTASMLKTLERYQKCNYGAPETTVSSRE-LQ--SSHQEYMKLKARVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL  KEL++LE+QLD+SLK IRSTRTQ MLDQL DLQR+EH L+EANKSL
Sbjct  108  QRNLLGEDLGPLTGKELDTLEKQLDVSLKHIRSTRTQYMLDQLGDLQRREHMLSEANKSL  167

Query  350  KQRL----MEDANHLTLEWNPTAQEVEYGR-QAIHQSDGDHGFFHHLECEPTLQIGYQTD  186
            ++RL     E+ NH    W+P      Y R QA  QSD   GFFH +ECEPTLQIGYQ+ 
Sbjct  168  RRRLEEGMQENPNH---AWDPNG----YVRQQAPPQSD---GFFHPIECEPTLQIGYQSS  217

Query  185  HHITVAAAGPSVNNFMPEW  129
              IT+AA GP+VNN+MP W
Sbjct  218  -QITIAAPGPNVNNYMPGW  235



>ref|NP_564214.2| MADs box transcription factor SEPALLATA3 [Arabidopsis thaliana]
 sp|O22456.1|SEP3_ARATH RecName: Full=Developmental protein SEPALLATA 3; AltName: Full=Agamous-like 
MADS-box protein AGL9 [Arabidopsis thaliana]
 gb|AAB67832.1| AGL9 [Arabidopsis thaliana]
 gb|AAC00586.1| AGL9 [Arabidopsis thaliana]
 gb|ACF75546.1| At1g24260 [Arabidopsis thaliana]
 gb|AEE30503.1| MADs box transcription factor SEPALLATA3 [Arabidopsis thaliana]
Length=251

 Score =   231 bits (590),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 149/198 (75%), Gaps = 5/198 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL++KELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKT  170

Query  353  LKQRLMEDANHLTLEWNPTAQEVE-YGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            L+ RL  D   + L+ NP  +EV+ YGR    Q      FF  LECEP LQIGYQ     
Sbjct  171  LRLRL-ADGYQMPLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQGQQD-  228

Query  176  TVAAAGPSVNNFMPEWYP  123
                AGPSVNN+M  W P
Sbjct  229  -GMGAGPSVNNYMLGWLP  245



>ref|XP_010530562.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X2 
[Tarenaya hassleriana]
Length=248

 Score =   231 bits (589),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 153/200 (77%), Gaps = 10/200 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKC+YGAPEPN+ +REAL+E+SSQQEYLKLK R++ALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCSYGAPEPNVPSREALEELSSQQEYLKLKQRFDALQRT  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLN+KELE+LERQLD SLKQIR+ RTQ MLDQ  +LQRKE  L E NK+L
Sbjct  111  QRNLLGEDLGPLNTKELEALERQLDSSLKQIRALRTQYMLDQRNELQRKEQMLTETNKAL  170

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT-  174
            + RL E    + L+ NP  +E+ YGRQ  H +     FFH L+ EP LQIGYQ    +  
Sbjct  171  RIRLSE-GYQMPLQLNPHPEEIGYGRQPQHDA-----FFHPLDSEPILQIGYQQQQDVMN  224

Query  173  ---VAAAGPSVNNFMPEWYP  123
                A AGPSVNN+M  W P
Sbjct  225  AAAAAGAGPSVNNYMLGWLP  244



>gb|ABD62860.1| SEP3.2 [Persea borbonia]
Length=225

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 146/189 (77%), Gaps = 8/189 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE  +STRE     SS QEYLKLKAR EALQRS
Sbjct  43   RGKLYEFCSSSSMLKTLERYQKCNYGAPETTVSTRETQ---SSHQEYLKLKARVEALQRS  99

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL SKEL++LE+QLD SLKQIRSTRTQ MLDQL DLQR+E  L+EANK+L
Sbjct  100  QRNLLGEDLGPLTSKELDTLEKQLDASLKQIRSTRTQYMLDQLADLQRREQMLSEANKNL  159

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGR-QAIHQSDGDHGFFHHLE-CEPTLQIGYQTDHHI  177
            K+RL E        W+P    V YGR QA  QSD   GFFH L+ CEPTL IGYQ    I
Sbjct  160  KRRLEEGMQANPQVWDPNGHPVTYGRQQAPPQSD---GFFHPLDTCEPTLHIGYQPADQI  216

Query  176  TVAAAGPSV  150
            T+AA GPSV
Sbjct  217  TIAAPGPSV  225



>ref|XP_010025292.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Eucalyptus grandis]
 gb|KCW61919.1| hypothetical protein EUGRSUZ_H04617 [Eucalyptus grandis]
Length=253

 Score =   230 bits (587),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 151/204 (74%), Gaps = 9/204 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGA EPN+S RE+L E+S QQEYL+LKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGALEPNVSARESL-ELSCQQEYLRLKARYEALQRT  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGE+LG L+SKELESLERQLD SLKQIRS RTQ MLDQL DLQ +E  L+EAN++L
Sbjct  110  QRNLLGEELGQLSSKELESLERQLDGSLKQIRSRRTQYMLDQLTDLQHREQLLHEANRTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEV-EYGRQAIHQSDG-------DHGFFHHLECEPTLQIGY  195
             QRLME      L+ N  A+EV  YG                   FFH LECEPTLQ+GY
Sbjct  170  NQRLMEGYQVNALQLNQHAEEVGGYGHPPPPPLPPQPLAQPHSEAFFHPLECEPTLQMGY  229

Query  194  QTDHHITVAAAGPSVNNFMPEWYP  123
            Q D   +V   GPS+NNFMP W P
Sbjct  230  QPDPVSSVITGGPSINNFMPGWLP  253



>gb|KFK44483.1| developmental protein sepallata 3 [Arabis alpina]
Length=249

 Score =   229 bits (585),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 150/197 (76%), Gaps = 5/197 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL++KELESLERQLD SLKQIR  RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSTKELESLERQLDSSLKQIRGLRTQFMLDQLNDLQSKERMLTETNKT  170

Query  353  LKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            L+ RL  D   + L+ NP  +++++   A HQ      FF  LECEP LQIGYQT     
Sbjct  171  LRLRL-ADGYQMPLQLNPNQEDIDH--YARHQHQHSQAFFQPLECEPILQIGYQTQQQDG  227

Query  173  VAAAGPSVNNFMPEWYP  123
            +  AGPSVNN+M  W P
Sbjct  228  M-GAGPSVNNYMLGWLP  243



>gb|AAX15918.1| AGL9 [Eschscholzia californica]
Length=241

 Score =   229 bits (584),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 155/194 (80%), Gaps = 9/194 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM KTLERYQK NYGAPE N+S RE+ QE SS QEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMFKTLERYQKSNYGAPETNVSVRES-QEHSSHQEYLKLKARVEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KELESLERQLDMSLKQIRSTRTQ MLDQL DLQR+E  L++ANK+L
Sbjct  110  QRNLLGEDLGPLSGKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRREQMLSDANKTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            ++RL E+      +W    Q ++YG+Q  H + G+ GFFH +ECEPTLQ+GYQ D     
Sbjct  170  RRRL-EEGTVTCHQWE---QNMQYGQQQAH-AQGE-GFFHPIECEPTLQMGYQQDQITVA  223

Query  170  AAAGPS--VNNFMP  135
            AAAGPS  +N++MP
Sbjct  224  AAAGPSMTMNSYMP  237



>gb|ABQ85953.1| MADS-box transcription factor SEP-like 4 [Trochodendron aralioides]
Length=229

 Score =   228 bits (582),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 150/194 (77%), Gaps = 4/194 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM KTLERYQKCNY APE N+STRE L++ SS QEYLKLKAR++ LQR+
Sbjct  38   RGKLYEFCSSSSMFKTLERYQKCNYAAPETNVSTRETLEQ-SSYQEYLKLKARHDDLQRT  96

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
             RN +GEDLGPL+ KELESLERQL++SLKQIRS RTQ MLDQL DLQR+E  L+E+NK+L
Sbjct  97   HRNFMGEDLGPLSGKELESLERQLNVSLKQIRSIRTQYMLDQLTDLQRREQMLSESNKTL  156

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
             +RL E      L+W+P AQ + Y RQ  H   GD GFFH LECEPTLQIGYQ D    +
Sbjct  157  ARRLEEGNQANALQWDPNAQGMGYDRQPAH-PQGD-GFFHPLECEPTLQIGYQHDQTAGM  214

Query  170  AAAGPSVNNFMPEW  129
             A GPS NN+M  W
Sbjct  215  -APGPSGNNYMAGW  227



>gb|ABI60898.1| MADS-box transcription factor [Arachis hypogaea]
Length=243

 Score =   229 bits (584),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 153/197 (78%), Gaps = 5/197 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLER QKCNYGAPE N+STREAL E+SSQQEYLK KARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERCQKCNYGAPETNVSTREAL-ELSSQQEYLKPKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SKELESLERQLD SLK IRSTRTQ MLDQL +LQRKEH L+EAN++L
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKLIRSTRTQFMLDQLSELQRKEHLLSEANRAL  169

Query  350  KQRLMEDANHLTLEWNPTA-QEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            +QR +E      ++ NP    ++ Y R    Q   D   F  L+CEPTLQIGYQ D  ++
Sbjct  170  RQRQLEGYQINPMQLNPGGVDDMGYARHP-PQPQPDP-LFQQLDCEPTLQIGYQPD-PVS  226

Query  173  VAAAGPSVNNFMPEWYP  123
            V  AGPS+ N+M  W P
Sbjct  227  VVTAGPSMGNYMGGWLP  243



>gb|ABF67487.1| MADS-domain transcription factor [Impatiens hawkeri]
Length=244

 Score =   229 bits (583),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 151/199 (76%), Gaps = 12/199 (6%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSS SMLKTLERYQKCNYGAPE NIS+R AL E+S QQEYLKLK RYE LQR+
Sbjct  51   RGKLYEFCSSPSMLKTLERYQKCNYGAPEANISSRGAL-ELSGQQEYLKLKQRYETLQRT  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KEL+++ERQLD SLK IRSTRTQ M+DQL DLQRKE  LNEAN++L
Sbjct  110  QRNLLGEDLGPLDGKELDTIERQLDTSLKHIRSTRTQHMVDQLEDLQRKEQILNEANRAL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQ--IGYQTDHHI  177
            KQRL+E     +  W    Q V+Y   A+ Q + D   FH LECEPTLQ  +GYQT H  
Sbjct  170  KQRLLES----SFNWMQNGQHVDYSGPAV-QPNXDE-LFHPLECEPTLQMAMGYQTHHDP  223

Query  176  T---VAAAGPSVNNFMPEW  129
            T    A AGPS+NN+ P W
Sbjct  224  TSVEAAGAGPSMNNYFPGW  242



>ref|XP_009415892.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   229 bits (583),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 150/197 (76%), Gaps = 9/197 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     +SQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIISREIQ---TSQQEYLKLKARVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KELE LERQLD SL+QIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLSIKELEQLERQLDASLRQIRSTRTQCMLDQLADLQRREQMLCEANKAL  167

Query  350  KQRLME--DANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH-  180
            K R+ E   AN   L W+P AQ V Y R    Q  GD GFF  +ECEPTLQIGY  D   
Sbjct  168  KIRMDEGNQANQQQL-WDPNAQAVAYCRHQ-PQPQGD-GFFQPIECEPTLQIGYHPDQMA  224

Query  179  ITVAAAGPSVNNFMPEW  129
            I  AA GPSV++++P W
Sbjct  225  IAAAAPGPSVSSYVPGW  241



>gb|AFX72879.1| MADS-box protein SEP3 [Aquilegia coerulea]
Length=244

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 152/195 (78%), Gaps = 4/195 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKC+YG PEPN+S REA QE SS QEYL+LK + E+LQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCSYGGPEPNVSAREA-QEHSSHQEYLRLKGKVESLQRT  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KELE+LERQLD SL+QIRSTRTQ MLDQL DLQR+E  L+EANK+L
Sbjct  110  QRNLLGEDLGPLSGKELETLERQLDSSLRQIRSTRTQYMLDQLTDLQRREQMLSEANKNL  169

Query  350  KQRLMEDANHLTLEWNPTAQE-VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            ++RL E        W+P     V + RQ   Q+ G+ GFFH LECEPTLQIG   +  I+
Sbjct  170  RRRLEEGTQPNHHHWDPNMHNGVTFARQQA-QAQGE-GFFHPLECEPTLQIGSYQNEQIS  227

Query  173  VAAAGPSVNNFMPEW  129
            VA AGPS+NN+M  W
Sbjct  228  VATAGPSMNNYMQGW  242



>ref|XP_010531079.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X2 
[Tarenaya hassleriana]
Length=249

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 147/197 (75%), Gaps = 3/197 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSML+TLERYQKC+YGAPEPN+ +REAL+E+SSQQEYLKLK R++AL RS
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCSYGAPEPNVPSREALEELSSQQEYLKLKQRHDALLRS  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDL PLN+KELE+LERQLD SLKQIR+ RTQ MLDQL DL  KE  L E NK+L
Sbjct  111  QRNLLGEDLAPLNTKELEALERQLDSSLKQIRALRTQYMLDQLNDLHHKEQMLTETNKTL  170

Query  350  KQRLMEDANHL-TLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            + RL E  + +  L+ NP  +E+ YGRQ   Q      FFH L  EP LQIGYQ      
Sbjct  171  RIRLSEGYDQMPPLQLNPHPEELGYGRQPQQQLAQADAFFHPLASEPILQIGYQQQQE--  228

Query  173  VAAAGPSVNNFMPEWYP  123
              A GPSVNN+M  W P
Sbjct  229  AMAGGPSVNNYMLGWLP  245



>ref|XP_003630490.1| MADS-box transcription factor [Medicago truncatula]
Length=330

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 143/230 (62%), Positives = 159/230 (69%), Gaps = 39/230 (17%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNVSAREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTR-------------------------  426
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRSTR                         
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRGLKHGYLPVQFLFLLVVAGLDGSMN  169

Query  425  ---------TqlmldqlmdlQRKEHELNEANKSLKQRLMEDANHLTLEWNPTAQEVEYGR  273
                     TQ MLDQL DLQRKEH L+EAN+SL+QRL E      L+ N   +E+ YGR
Sbjct  170  QTISLLTRETQFMLDQLSDLQRKEHMLSEANRSLRQRL-EGYQLNQLQMNACVEEMGYGR  228

Query  272  QAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITVAAAGPSVNNFMPEWYP  123
                Q+ GD G +  LECEPTLQIGYQ D   +V  AGPS++N+M  W P
Sbjct  229  HP-SQTQGD-GLYQQLECEPTLQIGYQPDPG-SVCTAGPSMSNYMGGWLP  275



>gb|AIU94433.1| MADS-box transcription factor 2 isoform 1, partial [Musa balbisiana]
Length=243

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 149/197 (76%), Gaps = 9/197 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     +SQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIISREIQ---TSQQEYLKLKARVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KELE LERQLD SL+QIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLSIKELEQLERQLDASLRQIRSTRTQCMLDQLADLQRREQMLCEANKAL  167

Query  350  KQRLME--DANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH-  180
            K RL E   AN   L W+P A  V Y R    Q  GD GFF  +ECEPTLQIGY  D   
Sbjct  168  KIRLDEGNQANQQQL-WDPNAHAVAYCRHQ-PQPQGD-GFFQPIECEPTLQIGYHPDQMA  224

Query  179  ITVAAAGPSVNNFMPEW  129
            I  AA GPSV++++P W
Sbjct  225  IAAAAPGPSVSSYVPGW  241



>gb|ACJ64678.1| MADS-box protein MADS2 [Musa acuminata AAA Group]
 gb|AIU94429.1| MADS-box transcription factor 2 isoform 1 [Musa acuminata]
Length=243

 Score =   226 bits (577),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 149/197 (76%), Gaps = 9/197 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     +SQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIISREIQ---TSQQEYLKLKARVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KELE LERQLD SL+QIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLSIKELEQLERQLDASLRQIRSTRTQCMLDQLADLQRREQMLCEANKAL  167

Query  350  KQRLME--DANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH-  180
            K R+ E   AN   L W+P A  V Y R    Q  GD GFF  +ECEPTLQIGY  D   
Sbjct  168  KIRMDEGNQANQQQL-WDPNAHAVAYCRHQ-PQPQGD-GFFQPIECEPTLQIGYHPDQMA  224

Query  179  ITVAAAGPSVNNFMPEW  129
            I  AA GPSV++++P W
Sbjct  225  IAAAAPGPSVSSYVPGW  241



>ref|XP_010530561.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X1 
[Tarenaya hassleriana]
Length=249

 Score =   226 bits (577),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 153/201 (76%), Gaps = 11/201 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSMLKTLERYQKC+YGAPEPN+ +REAL+ E+SSQQEYLKLK R++ALQR
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCSYGAPEPNVPSREALEVELSSQQEYLKLKQRFDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPLN+KELE+LERQLD SLKQIR+ RTQ MLDQ  +LQRKE  L E NK+
Sbjct  111  TQRNLLGEDLGPLNTKELEALERQLDSSLKQIRALRTQYMLDQRNELQRKEQMLTETNKA  170

Query  353  LKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            L+ RL E    + L+ NP  +E+ YGRQ  H +     FFH L+ EP LQIGYQ    + 
Sbjct  171  LRIRLSE-GYQMPLQLNPHPEEIGYGRQPQHDA-----FFHPLDSEPILQIGYQQQQDVM  224

Query  173  ----VAAAGPSVNNFMPEWYP  123
                 A AGPSVNN+M  W P
Sbjct  225  NAAAAAGAGPSVNNYMLGWLP  245



>ref|XP_002890717.1| hypothetical protein ARALYDRAFT_472923 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66976.1| hypothetical protein ARALYDRAFT_472923 [Arabidopsis lyrata subsp. 
lyrata]
Length=247

 Score =   226 bits (576),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 149/198 (75%), Gaps = 9/198 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKDRYDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL++KELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKT  170

Query  353  LKQRLMEDANHLTLEWNPTAQEVE-YGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            L+ RL  D   + L+ NP  +EV+ YGR   H       FF  LECEP LQIGYQ     
Sbjct  171  LRLRL-ADGYQMPLQLNPNQEEVDHYGRHHQH----SQAFFQPLECEPILQIGYQGQQD-  224

Query  176  TVAAAGPSVNNFMPEWYP  123
                AGPS+NN+M  W P
Sbjct  225  -GMGAGPSLNNYMLGWLP  241



>ref|XP_010499199.1| PREDICTED: developmental protein SEPALLATA 3 isoform X4 [Camelina 
sativa]
Length=250

 Score =   226 bits (576),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 147/198 (74%), Gaps = 6/198 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR+
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQRT  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+L
Sbjct  111  QRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTL  170

Query  350  KQRLMEDANHLTLEWNPTAQE--VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            + RL  D   + L+ NP  ++    YGR    Q      FF  LECEP LQIGYQ     
Sbjct  171  RLRL-ADGYQMPLQLNPNPEDHLDPYGRHHHQQQH-SQAFFQPLECEPILQIGYQGQQD-  227

Query  176  TVAAAGPSVNNFMPEWYP  123
                AGPSVNN+M  W P
Sbjct  228  -GMGAGPSVNNYMLGWLP  244



>ref|XP_010682730.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=226

 Score =   225 bits (573),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 147/196 (75%), Gaps = 20/196 (10%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKL+EFCSS SMLKTLERYQK NYGAP+  +STREAL+E+SSQQEYLKLKAR+EALQR+
Sbjct  51   RGKLFEFCSSPSMLKTLERYQKSNYGAPDNTVSTREALKELSSQQEYLKLKARHEALQRT  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
             RNL+GEDLGPL+SKELESLERQLDMSLKQIRSTRTQ M+DQL DLQRK  E N+A+   
Sbjct  111  HRNLMGEDLGPLSSKELESLERQLDMSLKQIRSTRTQYMVDQLTDLQRKLIEANQAS---  167

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
                       +L+WN    ++ Y RQ       D  FFH L+CEPTLQ+GYQ D     
Sbjct  168  -----------SLQWN--VHDIGYDRQPAQPH--DDSFFHPLDCEPTLQMGYQND--AVN  210

Query  170  AAAGPSVNNFMPEWYP  123
            AAAG SVNNFMP W P
Sbjct  211  AAAGGSVNNFMPNWLP  226



>ref|XP_010460483.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X4 
[Camelina sativa]
Length=254

 Score =   226 bits (575),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 150/201 (75%), Gaps = 8/201 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR+
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQRT  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+L
Sbjct  111  QRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTL  170

Query  350  KQRLMEDANHLTLEWNPTAQE-VE-YGR---QAIHQSDGDHGFFHHLECEPTLQIGYQTD  186
            + RL  D   + L+ NP  ++ V+ YGR   Q   Q      FF  LECEP LQIGYQ  
Sbjct  171  RLRL-ADGYQMPLQLNPNPEDHVDLYGRHHQQQQQQQQHSQAFFQPLECEPILQIGYQAQ  229

Query  185  HHITVAAAGPSVNNFMPEWYP  123
                   AGPSVNN+M  W P
Sbjct  230  QD--GMGAGPSVNNYMLGWLP  248



>gb|AJC01941.1| MADS-box protein, partial [Ficus carica]
Length=199

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 144/170 (85%), Gaps = 3/170 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQK NYGAPEPN+S REAL E+SSQQEYLKLKARYE+L R+
Sbjct  33   RGKLYEFCSSSSMLKTLERYQKSNYGAPEPNVSAREAL-ELSSQQEYLKLKARYESLLRN  91

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
             RNL+GE+LG L+SKELESLERQLDMSLKQIRSTRTQ MLDQL DL+RKEH LNE N++L
Sbjct  92   HRNLMGEELGALSSKELESLERQLDMSLKQIRSTRTQTMLDQLTDLRRKEHLLNETNRTL  151

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQI  201
            KQRL+E     +L+ NP A +V YGRQ   Q+ GD  FFH +ECEPTLQ+
Sbjct  152  KQRLVEGYQLSSLQLNPGADDVGYGRQP-AQAQGDI-FFHPIECEPTLQL  199



>ref|XP_010917559.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Elaeis 
guineensis]
 gb|AAQ03225.1|AF411844_1 MADS box transcription factor [Elaeis guineensis]
 gb|AAY96424.1| putative MADS box protein [Elaeis guineensis]
Length=242

 Score =   225 bits (573),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 150/197 (76%), Gaps = 10/197 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM+KTLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMMKTLERYQKCNYGAPETNIISRETQ---SSQQEYLKLKARVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANKSL
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSL  167

Query  350  KQRLMEDANHLTLE--WNPTAQEVEYGRQAIH-QSDGDHGFFHHLECEPTLQIGYQTDHH  180
            ++RL E++N    +  W+PTA  V YGRQ    QSD   GF+  ++ EPTLQI Y  +  
Sbjct  168  RRRL-EESNQAGQQQVWDPTAHAVGYGRQPPQPQSD---GFYQQIDGEPTLQIRYPPEQI  223

Query  179  ITVAAAGPSVNNFMPEW  129
               AA G SV+ +MP W
Sbjct  224  TIAAAPGSSVSTYMPGW  240



>gb|AAP83398.1| SEPALLATA3-like MADS-box [Papaver nudicaule]
Length=215

 Score =   223 bits (568),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 150/198 (76%), Gaps = 8/198 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSS+SM KT ERYQKCNYG PEPN+S RE+L E +S QEYLKLKAR EALQRS
Sbjct  20   RGKLYEFCSSNSMFKTXERYQKCNYGQPEPNVSARESL-EHASHQEYLKLKARVEALQRS  78

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KELE LE+QLD SLKQIRSTRTQ MLDQL DLQR+E  L++ANK+L
Sbjct  79   QRNLLGEDLGPLSGKELEFLEKQLDSSLKQIRSTRTQYMLDQLTDLQRREQMLSDANKTL  138

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGR--QAIHQSDGDH--GFFHHLECEPTLQIGYQTDH  183
            ++RL E A     +W+     V Y R  Q+ H    DH  GFFH LECEPTLQIGYQ D 
Sbjct  139  RRRLEEGAQASQQQWD-MQHGVGYSRQQQSXHHQAADHNQGFFHPLECEPTLQIGYQQD-  196

Query  182  HITVAAAGPSVNNFMPEW  129
             ITVA   P + ++MP W
Sbjct  197  QITVAQGAP-MGSYMPGW  213



>gb|AIU94764.1| class E MADS-domain transcription factor, partial [Hypoxis villosa]
Length=211

 Score =   223 bits (567),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 150/196 (77%), Gaps = 10/196 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSS SMLKTLERYQKCNYGAPE ++ TRE     SSQQEY+KLKAR EALQRS
Sbjct  22   RGKLYEFCSSPSMLKTLERYQKCNYGAPETSVVTRETQ---SSQQEYMKLKARVEALQRS  78

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL++KELE LERQLD SL+QIRSTRTQ MLDQL DLQRKE  L EANK+L
Sbjct  79   QRNLLGEDLGPLSTKELEHLERQLDASLRQIRSTRTQYMLDQLQDLQRKEQMLCEANKAL  138

Query  350  KQRLMEDANHLTLE--WNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            ++RL E++NH   +  W+  A  + YGRQ   Q D   GFFH LE EPTLQIGYQ D   
Sbjct  139  RRRL-EESNHANQQHVWDHNAPGMGYGRQPQPQGD---GFFHPLE-EPTLQIGYQPDQIT  193

Query  176  TVAAAGPSVNNFMPEW  129
              AA   +VNNF+P W
Sbjct  194  IAAAPVQNVNNFLPGW  209



>dbj|BAM34478.1| MADS-box transcription factor [Alstroemeria ligtu subsp. ligtu]
Length=244

 Score =   224 bits (570),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 150/197 (76%), Gaps = 9/197 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM+KTLERYQKCNYGAPE N+ +RE     SSQQEYLKLKAR EALQR 
Sbjct  51   RGKLYEFCSSSSMMKTLERYQKCNYGAPETNVISRETQ---SSQQEYLKLKARVEALQRY  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQRKE  L EANKSL
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDASLKQIRSTRTQFMLDQLADLQRKEQMLCEANKSL  167

Query  350  KQRLMEDANHLTLE--WNPTAQEVE-YGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            ++RL E+++H   +  W+  A     Y R+   Q  GD GFFH LECEPTLQIGY  D  
Sbjct  168  RRRL-EESSHPNQQQVWDHNAHSAAGYAREQA-QPQGD-GFFHPLECEPTLQIGYHPDQI  224

Query  179  ITVAAAGPSVNNFMPEW  129
               +A GPS +++MP W
Sbjct  225  TIASAPGPSASSYMPGW  241



>gb|AIU94762.1| class E MADS-domain transcription factor, partial [Gongora galeata]
Length=225

 Score =   223 bits (568),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 154/198 (78%), Gaps = 12/198 (6%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS++SMLKTLERYQKCNYGAPE N+ +RE     SSQQEYLKLK R EALQRS
Sbjct  29   RGKLYEFCSTNSMLKTLERYQKCNYGAPETNVISRETQ---SSQQEYLKLKGRVEALQRS  85

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  86   QRNLLGEDLGPLSSKELEQLERQLDNSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTL  145

Query  350  KQRL---MEDANHLTLE--WNP-TAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQT  189
            K+RL   +E++N    +  W+P TA  + Y RQ   Q  GD  F+H LECEPTLQIGYQ+
Sbjct  146  KRRLIRILEESNQANPQQMWDPSTAHAMGYDRQPA-QPHGD-AFYHPLECEPTLQIGYQS  203

Query  188  DHHITVAAAGPSVNNFMP  135
            D  I   AA P+VNN+MP
Sbjct  204  DLTIAPMAA-PNVNNYMP  220



>ref|XP_010025293.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Eucalyptus grandis]
 gb|KCW61920.1| hypothetical protein EUGRSUZ_H04617 [Eucalyptus grandis]
Length=251

 Score =   224 bits (570),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 150/204 (74%), Gaps = 11/204 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGA EPN+S RE+L E+S QQEYL+LKARYEALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGALEPNVSARESL-ELSCQQEYLRLKARYEALQRT  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGE+LG L+SKELESLERQLD SLKQIRS RTQ MLDQL DLQ +   L+EAN++L
Sbjct  110  QRNLLGEELGQLSSKELESLERQLDGSLKQIRSRRTQYMLDQLTDLQHR--LLHEANRTL  167

Query  350  KQRLMEDANHLTLEWNPTAQEV-EYGRQAIHQSDG-------DHGFFHHLECEPTLQIGY  195
             QRLME      L+ N  A+EV  YG                   FFH LECEPTLQ+GY
Sbjct  168  NQRLMEGYQVNALQLNQHAEEVGGYGHPPPPPLPPQPLAQPHSEAFFHPLECEPTLQMGY  227

Query  194  QTDHHITVAAAGPSVNNFMPEWYP  123
            Q D   +V   GPS+NNFMP W P
Sbjct  228  QPDPVSSVITGGPSINNFMPGWLP  251



>gb|AGT20513.1| SEP3 [Brassica oleracea var. viridis]
Length=250

 Score =   223 bits (569),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 149/198 (75%), Gaps = 6/198 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGK YEFCSSSSML+TL+RYQKCNYGAPEPN+ +REAL E++SQQEYLKLK RY+ALQR+
Sbjct  51   RGKQYEFCSSSSMLRTLDRYQKCNYGAPEPNVPSREALAELNSQQEYLKLKERYDALQRT  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL++KELESLERQLD SLK IR+ RTQ MLDQL DLQ KE  L E NK+L
Sbjct  111  QRNLLGEDLGPLSTKELESLERQLDSSLKHIRALRTQFMLDQLNDLQSKERMLAETNKTL  170

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQT--DHHI  177
            + RL  D   + L+ NP  ++ +YGR   H+      FF  LECEP LQ+G Q   DH +
Sbjct  171  RLRL-ADGYQMPLQLNPNPEDHDYGRHQQHEHSHHQAFFQPLECEPILQMGCQGQQDHGM  229

Query  176  TVAAAGPSVNNFMPEWYP  123
                AGPSVNN+M  W P
Sbjct  230  ---GAGPSVNNYMLGWLP  244



>ref|XP_010531071.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X1 
[Tarenaya hassleriana]
Length=250

 Score =   223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 147/198 (74%), Gaps = 4/198 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSML+TLERYQKC+YGAPEPN+ +REAL+ E+SSQQEYLKLK R++AL R
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCSYGAPEPNVPSREALEVELSSQQEYLKLKQRHDALLR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            SQRNLLGEDL PLN+KELE+LERQLD SLKQIR+ RTQ MLDQL DL  KE  L E NK+
Sbjct  111  SQRNLLGEDLAPLNTKELEALERQLDSSLKQIRALRTQYMLDQLNDLHHKEQMLTETNKT  170

Query  353  LKQRLMEDANHL-TLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            L+ RL E  + +  L+ NP  +E+ YGRQ   Q      FFH L  EP LQIGYQ     
Sbjct  171  LRIRLSEGYDQMPPLQLNPHPEELGYGRQPQQQLAQADAFFHPLASEPILQIGYQQQQE-  229

Query  176  TVAAAGPSVNNFMPEWYP  123
               A GPSVNN+M  W P
Sbjct  230  -AMAGGPSVNNYMLGWLP  246



>ref|XP_009102995.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Brassica rapa]
Length=252

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 150/199 (75%), Gaps = 6/199 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSM++TLERYQKCNYG PEPN+ +REAL  E+SSQQEYLKLK RYEALQR
Sbjct  51   RGKLYEFCSSSSMIRTLERYQKCNYGPPEPNVPSREALAVELSSQQEYLKLKERYEALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL++KELE LERQLD SLKQIR+ RTQ MLDQL DLQ KE  LNE NK+
Sbjct  111  TQRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLNETNKT  170

Query  353  LKQRLMEDANHLTLEWNPTAQE--VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            L+ RL  D   + L+ NP+ ++  V+YGR    Q    H FF  LECEP LQ+GYQ  H 
Sbjct  171  LRLRL-ADGYQMPLQLNPSQEDHHVDYGRHD-QQQHSHHAFFQPLECEPILQMGYQ-GHQ  227

Query  179  ITVAAAGPSVNNFMPEWYP  123
                 AGPS +N+M  W P
Sbjct  228  NHGMEAGPSASNYMLGWLP  246



>ref|XP_009113783.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Brassica rapa]
Length=252

 Score =   222 bits (566),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 151/201 (75%), Gaps = 10/201 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGK YEFCSSSSML+TL+RYQKCNYGAPEPN+ +REAL E++SQQEYLKLK RY+ALQR+
Sbjct  51   RGKQYEFCSSSSMLRTLDRYQKCNYGAPEPNVPSREALAELNSQQEYLKLKERYDALQRT  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL++KELE LERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+L
Sbjct  111  QRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLAETNKTL  170

Query  350  KQRLMEDANHLTLEWNPTAQE---VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQT--D  186
            + RL  D   + L+ NP  ++   V+YGR   H+      FF  LECEP LQ+GYQ   D
Sbjct  171  RLRL-ADGYQMPLQLNPNPEDHHHVDYGRHQQHEH-SHQAFFQPLECEPILQMGYQGQQD  228

Query  185  HHITVAAAGPSVNNFMPEWYP  123
            H +    AGPSVNN+M  W P
Sbjct  229  HGM---GAGPSVNNYMLGWLP  246



>gb|ABS17562.1| SEPALLATA 3-like protein [Platanus x acerifolia]
Length=239

 Score =   221 bits (564),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 148/194 (76%), Gaps = 7/194 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGK  EFCS+SSM KTLERYQKC+YGAPE N STRE  QE +S QEYL+LKAR+EALQRS
Sbjct  51   RGKQSEFCSNSSMYKTLERYQKCSYGAPEKNASTRET-QEHNSYQEYLRLKARFEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KEL+SLERQL MSLK IRSTRTQ MLDQL DLQ++E  L EAN +L
Sbjct  110  QRNLLGEDLGPLSGKELDSLERQLGMSLKHIRSTRTQYMLDQLTDLQKREQTLTEANMTL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            K+RL E++      WNP+A  V  G+Q        +GFFH L+CEPTLQIGYQ +  I V
Sbjct  170  KRRLEEESQA---TWNPSAHGVGCGQQP--SQPHSNGFFHPLQCEPTLQIGYQPN-QIAV  223

Query  170  AAAGPSVNNFMPEW  129
             A GP VNN+MP W
Sbjct  224  TAPGPCVNNYMPVW  237



>ref|XP_008801850.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Phoenix dactylifera]
Length=271

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 152/225 (68%), Gaps = 37/225 (16%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIVSRETQ---SSQQEYLKLKARVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRK-----------  384
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+           
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRRVWLMQSNSFKK  167

Query  383  ------------------EHELNEANKSLKQRLMEDANHLTLE--WNPTAQEVEYGRQAI  264
                              E  L EANKSLK+RL E++N  T +  W+P A  V YGRQ  
Sbjct  168  HLFFIPPFPSYYHCSFLQEQMLCEANKSLKRRL-EESNQATQQQVWDPNAHAVGYGRQP-  225

Query  263  HQSDGDHGFFHHLECEPTLQIGYQTDHHITVAAAGPSVNNFMPEW  129
             Q  GD GF+  +ECEPTL IGY  +     A  GPSV+N+MP W
Sbjct  226  PQPQGD-GFYQPIECEPTLHIGYHPEQITIAAGPGPSVSNYMPGW  269



>sp|O04067.1|AGL9_SINAL RecName: Full=Agamous-like MADS-box protein AGL9 homolog; AltName: 
Full=MADS D [Sinapis alba]
 emb|CAA69916.1| MADS D [Sinapis alba]
Length=254

 Score =   222 bits (565),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 152/202 (75%), Gaps = 10/202 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSM++TLERYQKCNYG PEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSMIRTLERYQKCNYGPPEPNVPSREALAVELSSQQEYLKLKERYDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL++KELE LERQLD SLKQIR+ RTQ MLDQL DLQ KE  LNE NK+
Sbjct  111  TQRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLNETNKT  170

Query  353  LKQRLMEDANHLTLEWNPTAQE--VEYGR-QAIHQSDGDHGFFHHLECEPTLQIGY--QT  189
            L+ RL  D   + L+ NP  ++  V+YGR     Q +  H FF  LECEP LQ+GY  Q 
Sbjct  171  LRLRLA-DGYQMPLQLNPNQEDHHVDYGRHDQQQQQNSHHAFFQPLECEPILQMGYQGQQ  229

Query  188  DHHITVAAAGPSVNNFMPEWYP  123
            DH +    AGPS NN+M  W P
Sbjct  230  DHGM---EAGPSENNYMLGWLP  248



>ref|XP_010499198.1| PREDICTED: developmental protein SEPALLATA 3 isoform X3 [Camelina 
sativa]
Length=251

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 147/199 (74%), Gaps = 7/199 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKT  170

Query  353  LKQRLMEDANHLTLEWNPTAQE--VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            L+ RL  D   + L+ NP  ++    YGR    Q      FF  LECEP LQIGYQ    
Sbjct  171  LRLRL-ADGYQMPLQLNPNPEDHLDPYGRHHHQQQH-SQAFFQPLECEPILQIGYQGQQD  228

Query  179  ITVAAAGPSVNNFMPEWYP  123
                 AGPSVNN+M  W P
Sbjct  229  --GMGAGPSVNNYMLGWLP  245



>ref|XP_010478051.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X4 
[Camelina sativa]
Length=253

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 147/200 (74%), Gaps = 7/200 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR+
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQRT  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+L
Sbjct  111  QRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTL  170

Query  350  KQRLMEDANHLTLEWNPTAQE--VEYGR-QAIHQSDGDHGFFHHLECEPTLQIG-YQTDH  183
            + RL  D   + L+ NP  ++    YGR     Q      FF  LECEP LQIG YQ   
Sbjct  171  RLRL-ADGYQMPLQLNPNPEDHIDPYGRHHHQQQQQHSQAFFQPLECEPILQIGSYQAQQ  229

Query  182  HITVAAAGPSVNNFMPEWYP  123
                  AGPSVNN+M  W P
Sbjct  230  D--GMGAGPSVNNYMLGWLP  247



>ref|XP_010499197.1| PREDICTED: developmental protein SEPALLATA 3 isoform X2 [Camelina 
sativa]
Length=251

 Score =   221 bits (564),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 147/199 (74%), Gaps = 7/199 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSS ML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSSMLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKT  170

Query  353  LKQRLMEDANHLTLEWNPTAQE--VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            L+ RL  D   + L+ NP  ++    YGR    Q      FF  LECEP LQIGYQ    
Sbjct  171  LRLRL-ADGYQMPLQLNPNPEDHLDPYGRHHHQQQH-SQAFFQPLECEPILQIGYQGQQD  228

Query  179  ITVAAAGPSVNNFMPEWYP  123
                 AGPSVNN+M  W P
Sbjct  229  --GMGAGPSVNNYMLGWLP  245



>dbj|BAG50409.1| MADS-box transcription factor [Cardamine sp. SIM-2007]
Length=219

 Score =   220 bits (561),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 151/198 (76%), Gaps = 8/198 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  22   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQR  81

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL++KELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L+E NK+
Sbjct  82   AQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLSETNKT  141

Query  353  LKQRLMEDANHLTLEWNPTAQEVE-YGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            L+ RL  D   + L+ NP  +EV+ Y R   HQ      FF  LECEP LQIGYQT    
Sbjct  142  LRLRL-ADGYLMPLQLNPNPEEVDHYAR---HQQQQQQAFFQPLECEPILQIGYQTQQD-  196

Query  176  TVAAAGPSVNNFMPEWYP  123
                AGPSVNN+M  W P
Sbjct  197  -GMGAGPSVNNYMLGWLP  213



>ref|XP_010913018.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Elaeis guineensis]
Length=234

 Score =   221 bits (562),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 149/197 (76%), Gaps = 18/197 (9%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     +SQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIVSRETQ---TSQQEYLKLKARVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLG+DLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANKSL
Sbjct  108  QRNLLGDDLGPLSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSL  167

Query  350  KQRLMEDANHLTLE--WNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            KQRL E++N  T +  W+P A  V YGRQ   Q  GD GF+  +E  P           I
Sbjct  168  KQRL-EESNQATQQQVWDPNAPAVGYGRQP-PQPQGD-GFYQQIEYPP---------EQI  215

Query  176  TVAAA-GPSVNNFMPEW  129
            T+AAA GPSV+N+MP W
Sbjct  216  TIAAAPGPSVSNYMPGW  232



>ref|XP_010460481.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X2 
[Camelina sativa]
Length=255

 Score =   221 bits (563),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 150/202 (74%), Gaps = 9/202 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSS ML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSSMLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKT  170

Query  353  LKQRLMEDANHLTLEWNPTAQE-VE-YGR---QAIHQSDGDHGFFHHLECEPTLQIGYQT  189
            L+ RL  D   + L+ NP  ++ V+ YGR   Q   Q      FF  LECEP LQIGYQ 
Sbjct  171  LRLRL-ADGYQMPLQLNPNPEDHVDLYGRHHQQQQQQQQHSQAFFQPLECEPILQIGYQA  229

Query  188  DHHITVAAAGPSVNNFMPEWYP  123
                    AGPSVNN+M  W P
Sbjct  230  QQD--GMGAGPSVNNYMLGWLP  249



>ref|XP_010460482.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X3 
[Camelina sativa]
Length=255

 Score =   221 bits (563),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 150/202 (74%), Gaps = 9/202 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKT  170

Query  353  LKQRLMEDANHLTLEWNPTAQE-VE-YGR---QAIHQSDGDHGFFHHLECEPTLQIGYQT  189
            L+ RL  D   + L+ NP  ++ V+ YGR   Q   Q      FF  LECEP LQIGYQ 
Sbjct  171  LRLRL-ADGYQMPLQLNPNPEDHVDLYGRHHQQQQQQQQHSQAFFQPLECEPILQIGYQA  229

Query  188  DHHITVAAAGPSVNNFMPEWYP  123
                    AGPSVNN+M  W P
Sbjct  230  QQD--GMGAGPSVNNYMLGWLP  249



>gb|AAX53102.1| AGL9-like protein [Eupomatia bennettii]
Length=222

 Score =   220 bits (560),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 148/202 (73%), Gaps = 16/202 (8%)
 Frame = -3

Query  710  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSS M KTLERYQKCNYGAPE  ++TRE     SS QEYLKLKAR EALQR
Sbjct  27   RGKLYEFCSSSSSMFKTLERYQKCNYGAPETVVTTREIQ---SSHQEYLKLKARVEALQR  83

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            SQRNLLGEDLGPL+ KEL++LERQLDMSLKQIRSTRTQ MLDQL DLQR+E  L+EANK+
Sbjct  84   SQRNLLGEDLGPLSGKELDTLERQLDMSLKQIRSTRTQYMLDQLTDLQRREQMLSEANKT  143

Query  353  LKQRLME----DANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIG---Y  195
            LK+RL E    + NH    W+     + + RQ       D GFFH L+CEPTLQIG   Y
Sbjct  144  LKRRLEEGMEANPNH---AWDHNPHAMGFVRQ--QGPPQDDGFFHPLDCEPTLQIGLCRY  198

Query  194  QTDHHITVAAAGPSVNNFMPEW  129
            QTD      A GPS NN+MP W
Sbjct  199  QTDQMQMTTAPGPSANNYMPGW  220



>emb|CDY03905.1| BnaC07g11300D [Brassica napus]
Length=270

 Score =   221 bits (564),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 149/199 (75%), Gaps = 6/199 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSM++TLERYQKCNYG PEPN+ +REAL  E+SSQQEYLKLK RYEALQR
Sbjct  69   RGKLYEFCSSSSMIRTLERYQKCNYGPPEPNVPSREALAVELSSQQEYLKLKERYEALQR  128

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL++KELE LERQLD SLKQIR+ RTQ MLDQL DLQ KE  LNE NK+
Sbjct  129  TQRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLNETNKT  188

Query  353  LKQRLMEDANHLTLEWNPTAQE--VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            L+ RL  D   + L+ NP+ ++  V+YGR    Q    H FF  LECEP LQ+GYQ  H 
Sbjct  189  LRLRL-ADGYQMPLQLNPSQEDRHVDYGRHD-QQQHSHHAFFQPLECEPILQMGYQ-GHQ  245

Query  179  ITVAAAGPSVNNFMPEWYP  123
                 AGPS  N+M  W P
Sbjct  246  NHGMEAGPSAINYMLGWLP  264



>ref|XP_009102994.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Brassica rapa]
Length=253

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 148/199 (74%), Gaps = 5/199 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSM++TLERYQKCNYG PEPN+ +REAL  E+SSQQEYLKLK RYEALQR
Sbjct  51   RGKLYEFCSSSSMIRTLERYQKCNYGPPEPNVPSREALAVELSSQQEYLKLKERYEALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL++KELE LERQLD SLKQIR+ RTQ MLDQL DLQ KE  LNE NK+
Sbjct  111  TQRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLNETNKT  170

Query  353  LKQRLMEDANHLTLEWNPTAQE--VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            L+ RL  D   + L+ NP+ ++  V+YGR    Q    H FF  LECEP LQ+G    H 
Sbjct  171  LRLRL-ADGYQMPLQLNPSQEDHHVDYGRHD-QQQHSHHAFFQPLECEPILQMGRYQGHQ  228

Query  179  ITVAAAGPSVNNFMPEWYP  123
                 AGPS +N+M  W P
Sbjct  229  NHGMEAGPSASNYMLGWLP  247



>gb|AIU94434.1| MADS-box transcription factor 2 isoform 2, partial [Musa balbisiana]
Length=247

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 150/201 (75%), Gaps = 13/201 (6%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     +SQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIISREIQ---TSQQEYLKLKARVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KELE LERQLD SL+QIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLSIKELEQLERQLDASLRQIRSTRTQCMLDQLADLQRREQMLCEANKAL  167

Query  350  KQRLME--DANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDH--  183
            K R+ E   AN   L W+P AQ V Y R    Q  GD GFF  ++CEPTLQIGY  D   
Sbjct  168  KIRMDEGNQANQQQL-WDPNAQAVAYCRHQ-PQPQGD-GFFQPIDCEPTLQIGYHPDQMA  224

Query  182  ---HITVAAAGPSVNNFMPEW  129
                   AAAGPSV+N++P W
Sbjct  225  IAAAAAAAAAGPSVSNYVPGW  245



>emb|CDY27603.1| BnaA09g28040D [Brassica napus]
Length=253

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 152/202 (75%), Gaps = 11/202 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGK YEFCSSSSML+TL+RYQKCNYGAPEPN+ +REAL  E++SQQEYLKLK RY+ALQR
Sbjct  51   RGKQYEFCSSSSMLRTLDRYQKCNYGAPEPNVPSREALAVELNSQQEYLKLKERYDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL++KELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLAETNKT  170

Query  353  LKQRLMEDANHLTLEWNPTAQE---VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQT--  189
            L+ RL  D   + L+ NP  ++   V+YGR   H+      FF  LECEP LQ+GYQ   
Sbjct  171  LRLRL-ADGYQMPLQLNPNPEDHHHVDYGRHQQHEH-SHQAFFQPLECEPILQMGYQGQQ  228

Query  188  DHHITVAAAGPSVNNFMPEWYP  123
            DH +    AGPSVNN+M  W P
Sbjct  229  DHGM---GAGPSVNNYMLGWLP  247



>gb|ADJ67238.1| MADS box transcription factor 6 [Oncidium hybrid cultivar]
Length=243

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 154/196 (79%), Gaps = 12/196 (6%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS++SMLKTLERYQKCNYGAPE N+ +RE     SSQQEYLKLK R E LQRS
Sbjct  51   RGKLYEFCSTNSMLKTLERYQKCNYGAPETNVISRETQ---SSQQEYLKLKGRVETLQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLNSKELEQLERQLDNSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTL  167

Query  350  KQRLMEDANHLTLE--WNP-TAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            K+RL E++N    +  W+P TA  + Y RQ   Q  GD  F+H LECEPTLQIGYQ+D  
Sbjct  168  KRRL-EESNQANPQQMWDPSTAHAMGYDRQPA-QPHGD-AFYHPLECEPTLQIGYQSD--  222

Query  179  ITVAA-AGPSVNNFMP  135
            +T+A  A P+V+N+MP
Sbjct  223  LTMAPMAAPNVHNYMP  238



>gb|AHM92084.1| MADS-box protein 8 [Erycina pusilla]
Length=243

 Score =   219 bits (558),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 152/198 (77%), Gaps = 10/198 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS++SMLKTLERYQKCNYGAPE N+ +RE     SSQQEYLKLK R E LQRS
Sbjct  51   RGKLYEFCSTNSMLKTLERYQKCNYGAPETNVISRETQ---SSQQEYLKLKGRVENLQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLNSKELEQLERQLDNSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTL  167

Query  350  KQRLMED--ANHLTLEWNP-TAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            K+RL E   AN   + W+P TA  + Y RQ   Q  GD  F+H LECEPTLQIGYQ+D  
Sbjct  168  KRRLEESNQANPPQM-WDPSTAHAMGYDRQP-PQPHGD-AFYHPLECEPTLQIGYQSDLT  224

Query  179  ITVAAAGPSVNNFMPEWY  126
            I   AA P+V+N+MP  +
Sbjct  225  IAPMAA-PNVHNYMPPGW  241



>emb|CDY15724.1| BnaA07g08950D [Brassica napus]
Length=252

 Score =   219 bits (559),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 149/199 (75%), Gaps = 6/199 (3%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSM++TLERYQKCNYG PEPN+ +REAL  E SSQQEYLKLK RYEALQR
Sbjct  51   RGKLYEFCSSSSMIRTLERYQKCNYGPPEPNVPSREALAVEFSSQQEYLKLKERYEALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL++KELE LERQLD SLKQIR+ RTQ MLDQL DLQ KE  LNE NK+
Sbjct  111  TQRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLNETNKT  170

Query  353  LKQRLMEDANHLTLEWNPTAQE--VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            L+ RL  D   + L+ NP+ ++  V+YGR    Q    H FF  LECEP LQ+GYQ  H 
Sbjct  171  LRLRL-ADGYQMPLQLNPSQEDYHVDYGRHD-QQQHSHHPFFQPLECEPILQMGYQ-GHQ  227

Query  179  ITVAAAGPSVNNFMPEWYP  123
                 +GPS +N+M  W P
Sbjct  228  NHGMESGPSASNYMLGWLP  246



>gb|AIU94432.1| MADS-box transcription factor 2 isoform 3, partial [Musa acuminata]
Length=243

 Score =   219 bits (557),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 150/201 (75%), Gaps = 17/201 (8%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKL+EFCSSSSMLKTLERYQKCNYGAPE N+ +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLFEFCSSSSMLKTLERYQKCNYGAPETNVISRETQ---SSQQEYLKLKARVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLN KELE LERQLD SL+QIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLNIKELEQLERQLDASLRQIRSTRTQYMLDQLTDLQRREQMLCEANKAL  167

Query  350  KQRLMED--ANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDH--  183
            K+RL E   AN   L W+P      YGRQ   Q  GD GFF  ++CEPTLQIGY  D   
Sbjct  168  KRRLEESNQANQQQL-WDPNT----YGRQQ-PQPQGD-GFFQPIDCEPTLQIGYHPDQMA  220

Query  182  ---HITVAAAGPSVNNFMPEW  129
                   AAAGPSV+N++P W
Sbjct  221  IAAAAAAAAAGPSVSNYVPGW  241



>gb|ADD25199.1| SEP3 [Nuphar advena]
Length=215

 Score =   218 bits (554),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 146/198 (74%), Gaps = 8/198 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS+S+M K LERYQKCNYG  E  ++T+E     SS QEYLKLKAR E LQRS
Sbjct  20   RGKLYEFCSTSNMYKALERYQKCNYGTLETTVTTKETQ---SSHQEYLKLKARLENLQRS  76

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDL PL+ KEL+ LERQLD SL+QIRSTRTQ MLDQL DLQRKE  L EANKSL
Sbjct  77   QRNLLGEDLXPLSGKELDQLERQLDASLRQIRSTRTQYMLDQLGDLQRKEQMLIEANKSL  136

Query  350  KQRLMED--ANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTD--H  183
            ++RL E+  AN     W+P A  V Y RQ      G+ GFFH L+CE TLQIGYQ+    
Sbjct  137  RRRLEEENVANAHQAVWDPNAHNVGYARQPAQAPQGE-GFFHPLDCELTLQIGYQSGCPD  195

Query  182  HITVAAAGPSVNNFMPEW  129
             IT++AAGPSV N+MP W
Sbjct  196  QITISAAGPSVTNYMPGW  213



>gb|ACA24481.1| agamous-like 9 protein 1 [Glycine max]
Length=223

 Score =   218 bits (555),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 143/175 (82%), Gaps = 4/175 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGK YEFCS SSMLKTLERYQKCNYGAPE N++T+EAL E+SSQQEYL+LKARYEALQRS
Sbjct  51   RGKQYEFCSGSSMLKTLERYQKCNYGAPEDNVATKEAL-ELSSQQEYLRLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRS RTQ MLDQL DLQRKEH L E+N+ L
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSIRTQFMLDQLSDLQRKEHFLGESNRDL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTD  186
            +QRL E+     L+ NP+A+++ YGR    Q  G H  F  LECEPTLQIGY  D
Sbjct  170  RQRL-EEFQINPLQLNPSAEDMGYGRHP-GQPQG-HALFQPLECEPTLQIGYHPD  221



>gb|ABD62861.1| SEP3.1 [Persea borbonia]
Length=220

 Score =   218 bits (554),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 151/192 (79%), Gaps = 19/192 (10%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS++SMLKTLERYQKCNYGAPE  +S+RE LQ  SS QEY+KLKAR EALQRS
Sbjct  43   RGKLYEFCSTASMLKTLERYQKCNYGAPETTVSSRE-LQ--SSHQEYMKLKARVEALQRS  99

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL  KEL++LE+QLD+SLK IRSTRTQ MLDQL DLQR+EH L+EANKSL
Sbjct  100  QRNLLGEDLGPLTGKELDTLEKQLDVSLKHIRSTRTQYMLDQLGDLQRREHMLSEANKSL  159

Query  350  KQRL----MEDANHLTLEWNPTAQEVEYGR-QAIHQSDGDHGFFHHLECEPTLQIGYQTD  186
            ++RL     E+ NH    W+P      Y R QA  QSD   GFFH +ECEPTLQIGYQ+ 
Sbjct  160  RRRLEEGMQENPNH---AWDPNG----YVRQQAPPQSD---GFFHPIECEPTLQIGYQSS  209

Query  185  HHITVAAAGPSV  150
              IT+AA GP+V
Sbjct  210  -QITIAAPGPNV  220



>emb|CDX84935.1| BnaC05g21200D [Brassica napus]
Length=251

 Score =   219 bits (557),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 148/199 (74%), Gaps = 7/199 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGK YEFCSSSSML+TL+RYQKCNYGAPEPN+ +REAL  E+ SQQEYLKLK RY+ALQR
Sbjct  51   RGKQYEFCSSSSMLRTLDRYQKCNYGAPEPNVPSREALAVELDSQQEYLKLKERYDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL++KELESLERQLD SLK IR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSTKELESLERQLDSSLKHIRALRTQFMLDQLNDLQSKERMLAETNKT  170

Query  353  LKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQT--DHH  180
            L+ RL  D   + L+ NP  ++ +YGR   H+      FF  LECEP LQ+G Q   DH 
Sbjct  171  LRLRL-ADGYQMPLQLNPNPEDHDYGRHQQHEHSHHQAFFQPLECEPILQMGCQGQQDHG  229

Query  179  ITVAAAGPSVNNFMPEWYP  123
            +    AGPSVNN+M  W P
Sbjct  230  M---GAGPSVNNYMLGWLP  245



>gb|AAP20094.1| MADS4 [Vitis vinifera]
Length=153

 Score =   215 bits (548),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 135/157 (86%), Gaps = 4/157 (3%)
 Frame = -3

Query  614  STREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIR  435
            STREAL E+SSQQEYLKLKARYEALQRSQRNLLGEDLGPL++KELESLERQLD+SLKQIR
Sbjct  1    STREAL-ELSSQQEYLKLKARYEALQRSQRNLLGEDLGPLSTKELESLERQLDVSLKQIR  59

Query  434  STRTqlmldqlmdlQRKEHELNEANKSLKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQS  255
            STRTQ MLDQL DLQRKEH LNEANK+LKQRL+E      L+WNP AQ+V YGRQ   Q 
Sbjct  60   STRTQYMLDQLTDLQRKEHMLNEANKTLKQRLLEGTQVNQLQWNPNAQDVGYGRQQA-QP  118

Query  254  DGDHGFFHHLECEPTLQIGYQTDHHITVAAAGPSVNN  144
             GD GFFH LECEPTLQIGYQ D  ITVAAAGPSVNN
Sbjct  119  QGD-GFFHPLECEPTLQIGYQPD-PITVAAAGPSVNN  153



>gb|AAZ95252.1| MADS box protein SEP1 [Dendrobium crumenatum]
Length=243

 Score =   218 bits (555),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 151/196 (77%), Gaps = 12/196 (6%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNY  PE NI +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYEGPETNIISRETQ---SSQQEYLKLKARVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLSSKELEHLERQLDASLKQIRSTRTQFMLDQLADLQRREQMLCEANKAL  167

Query  350  KQRLMEDANHLTLE--WNP-TAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            K+R  E++N    +  W+P T   V YGRQ   Q  GD  F+H LECEPTLQIGY +D  
Sbjct  168  KRRF-EESNQTAHQQVWDPSTTHAVGYGRQPA-QHHGD-AFYHPLECEPTLQIGYHSD--  222

Query  179  ITVA-AAGPSVNNFMP  135
            IT+A    P+V+N+MP
Sbjct  223  ITMAPTTAPNVSNYMP  238



>ref|XP_008801853.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X4 [Phoenix dactylifera]
Length=234

 Score =   218 bits (554),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 148/197 (75%), Gaps = 18/197 (9%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIVSRETQ---SSQQEYLKLKARVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANKSL
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSL  167

Query  350  KQRLMEDANHLTLE--WNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            K+RL E++N  T +  W+P A  V YGRQ   Q  GD GF+  +E  P           I
Sbjct  168  KRRL-EESNQATQQQVWDPNAHAVGYGRQP-PQPQGD-GFYQPIEYHP---------EQI  215

Query  176  TVAAA-GPSVNNFMPEW  129
            T+AA  GPSV+N+MP W
Sbjct  216  TIAAGPGPSVSNYMPGW  232



>gb|AAX15916.1| AGL9, partial [Amborella trichopoda]
Length=194

 Score =   216 bits (551),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 148/196 (76%), Gaps = 13/196 (7%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGK YEFCSSSSMLKTLERYQKCNYG  E  +ST+E     SSQQEYL+LKA +EALQRS
Sbjct  4    RGKQYEFCSSSSMLKTLERYQKCNYGTQETTVSTKETQ---SSQQEYLRLKAHFEALQRS  60

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KELE LE+QLDMSLKQIRS +TQ M+DQL DLQRKE  L+E+N +L
Sbjct  61   QRNLLGEDLGPLSGKELEQLEQQLDMSLKQIRSIKTQYMIDQLADLQRKEQALSESNNAL  120

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDH--HI  177
            K++L          W+ T  ++EY RQ   Q+  D+ FFH LEC+PTLQIGY + +   I
Sbjct  121  KRKLEAAGG-----WDSTGHQMEYNRQPA-QAQADN-FFHPLECDPTLQIGYPSGYPNPI  173

Query  176  TVAAAGPSVNNFMPEW  129
            TVAA GPSV NFMP W
Sbjct  174  TVAAPGPSVTNFMP-W  188



>ref|XP_009113782.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Brassica rapa]
Length=253

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 151/202 (75%), Gaps = 11/202 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGK YEFCSSSSML+TL+RYQKCNYGAPEPN+ +REAL  E++SQQEYLKLK RY+ALQR
Sbjct  51   RGKQYEFCSSSSMLRTLDRYQKCNYGAPEPNVPSREALAVELNSQQEYLKLKERYDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL++KELE LERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLAETNKT  170

Query  353  LKQRLMEDANHLTLEWNPTAQE---VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQT--  189
            L+ RL  D   + L+ NP  ++   V+YGR   H+      FF  LECEP LQ+GYQ   
Sbjct  171  LRLRL-ADGYQMPLQLNPNPEDHHHVDYGRHQQHEH-SHQAFFQPLECEPILQMGYQGQQ  228

Query  188  DHHITVAAAGPSVNNFMPEWYP  123
            DH +    AGPSVNN+M  W P
Sbjct  229  DHGM---GAGPSVNNYMLGWLP  247



>gb|AAX53104.1| AGL9-like protein [Magnolia grandiflora]
Length=206

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 146/185 (79%), Gaps = 10/185 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS SSMLKTLERYQKCNYGAPE  +STRE     S  QEYLKLKAR EALQRS
Sbjct  29   RGKLYEFCSGSSMLKTLERYQKCNYGAPELPVSTRETQ---SYHQEYLKLKARVEALQRS  85

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KELE+LERQLD+SL+QIRSTRTQ MLDQL DLQR+EH L+EANK+L
Sbjct  86   QRNLLGEDLGPLSGKELETLERQLDISLRQIRSTRTQCMLDQLGDLQRREHMLSEANKTL  145

Query  350  KQRLMED--ANHLTLEWNPTAQEVE-YGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            ++RL E   ANH  + W P A  V+ Y RQ   Q  GD GFFH LECEPTL IGYQ D  
Sbjct  146  RRRLEEGAQANHNQV-WEPNAHAVDSYNRQQPQQQ-GD-GFFHPLECEPTLHIGYQPD-Q  201

Query  179  ITVAA  165
            IT+AA
Sbjct  202  ITIAA  206



>ref|XP_010478049.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X2 
[Camelina sativa]
Length=254

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 147/201 (73%), Gaps = 8/201 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKT  170

Query  353  LKQRLMEDANHLTLEWNPTAQE--VEYGR-QAIHQSDGDHGFFHHLECEPTLQIG-YQTD  186
            L+ RL  D   + L+ NP  ++    YGR     Q      FF  LECEP LQIG YQ  
Sbjct  171  LRLRL-ADGYQMPLQLNPNPEDHIDPYGRHHHQQQQQHSQAFFQPLECEPILQIGSYQAQ  229

Query  185  HHITVAAAGPSVNNFMPEWYP  123
                   AGPSVNN+M  W P
Sbjct  230  QD--GMGAGPSVNNYMLGWLP  248



>gb|AIU94430.1| MADS-box transcription factor 2 isoform 2 [Musa acuminata]
 gb|AIU94431.1| MADS-box transcription factor 2 isoform 2 [Musa acuminata]
Length=244

 Score =   217 bits (552),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 150/202 (74%), Gaps = 18/202 (9%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKL+EFCSSSSMLKTLERYQKCNYGAPE N+ +RE     +SQQEYLKLKAR EALQRS
Sbjct  51   RGKLFEFCSSSSMLKTLERYQKCNYGAPETNVMSRETQ---NSQQEYLKLKARVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLN KELE LERQLD SL+QIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLNIKELEQLERQLDASLRQIRSTRTQYMLDQLTDLQRREQMLCEANKAL  167

Query  350  KQRLMED--ANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDH--  183
            K+RL E   AN   L W+P      YGRQ   Q  GD GFF  ++CEPTLQIGY  D   
Sbjct  168  KRRLEESNQANQQQL-WDPNT----YGRQQ-PQPQGD-GFFQPIDCEPTLQIGYHPDKMA  220

Query  182  ----HITVAAAGPSVNNFMPEW  129
                    AAAGPSV+N++P W
Sbjct  221  IAAAAAAAAAAGPSVSNYVPGW  242



>ref|XP_010478050.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X3 
[Camelina sativa]
Length=254

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 147/201 (73%), Gaps = 8/201 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSS ML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSSMLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+
Sbjct  111  TQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKT  170

Query  353  LKQRLMEDANHLTLEWNPTAQE--VEYGR-QAIHQSDGDHGFFHHLECEPTLQIG-YQTD  186
            L+ RL  D   + L+ NP  ++    YGR     Q      FF  LECEP LQIG YQ  
Sbjct  171  LRLRL-ADGYQMPLQLNPNPEDHIDPYGRHHHQQQQQHSQAFFQPLECEPILQIGSYQAQ  229

Query  185  HHITVAAAGPSVNNFMPEWYP  123
                   AGPSVNN+M  W P
Sbjct  230  QD--GMGAGPSVNNYMLGWLP  248



>gb|ACB69509.1| SEPALLATA3-like MADS-box protein [Crocus sativus]
Length=238

 Score =   217 bits (552),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 142/194 (73%), Gaps = 8/194 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSS++KTLERYQKC+YGAP+  +  RE     SS QEYLKLKA  EALQRS
Sbjct  51   RGKLYEFCSSSSIMKTLERYQKCSYGAPDNIVQIRETQLLQSSHQEYLKLKAHVEALQRS  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQRKEH L EAN+SL
Sbjct  111  QRNLLGEDLGPLSSKELEQLERQLDSSLKQIRSTRTQCMLDQLGDLQRKEHMLCEANRSL  170

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            ++RL E +      W   A  + Y RQA  Q   +  F+  L+C+PTLQIG+Q D     
Sbjct  171  RKRLEESSQAHQQVWESNANAIAYARQANQQ---EEEFYQPLDCQPTLQIGFQADQ----  223

Query  170  AAAGPSVNNFMPEW  129
              AGPSV N+MP W
Sbjct  224  -MAGPSVTNYMPGW  236



>ref|XP_010499195.1| PREDICTED: developmental protein SEPALLATA 3 isoform X1 [Camelina 
sativa]
Length=252

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 147/200 (74%), Gaps = 8/200 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQ  537
            RGKLYEFCSSSS ML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQ
Sbjct  51   RGKLYEFCSSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQ  110

Query  536  RSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANK  357
            R+QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK
Sbjct  111  RTQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNK  170

Query  356  SLKQRLMEDANHLTLEWNPTAQE--VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDH  183
            +L+ RL  D   + L+ NP  ++    YGR    Q      FF  LECEP LQIGYQ   
Sbjct  171  TLRLRL-ADGYQMPLQLNPNPEDHLDPYGRHHHQQQH-SQAFFQPLECEPILQIGYQGQQ  228

Query  182  HITVAAAGPSVNNFMPEWYP  123
                  AGPSVNN+M  W P
Sbjct  229  D--GMGAGPSVNNYMLGWLP  246



>ref|XP_006848294.1| hypothetical protein AMTR_s00013p00103080 [Amborella trichopoda]
 gb|ERN09875.1| hypothetical protein AMTR_s00013p00103080 [Amborella trichopoda]
 gb|AIE44770.1| putative MADS-domain transcription factor AGL9 [Amborella trichopoda]
Length=241

 Score =   216 bits (551),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 148/196 (76%), Gaps = 13/196 (7%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGK YEFCSSSSMLKTLERYQKCNYG  E  +ST+E     SSQQEYL+LKA +EALQRS
Sbjct  51   RGKQYEFCSSSSMLKTLERYQKCNYGTQETTVSTKETQ---SSQQEYLRLKAHFEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+ KELE LE+QLDMSLKQIRS +TQ M+DQL DLQRKE  L+E+N +L
Sbjct  108  QRNLLGEDLGPLSGKELEQLEQQLDMSLKQIRSIKTQYMIDQLADLQRKEQALSESNNAL  167

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDH--HI  177
            K++L          W+ T  ++EY RQ   Q+  D+ FFH LEC+PTLQIGY + +   I
Sbjct  168  KRKLEAAGG-----WDSTGHQMEYNRQPA-QAQADN-FFHPLECDPTLQIGYPSGYPNPI  220

Query  176  TVAAAGPSVNNFMPEW  129
            TVAA GPSV NFMP W
Sbjct  221  TVAAPGPSVTNFMP-W  235



>ref|XP_006415782.1| hypothetical protein EUTSA_v10008591mg [Eutrema salsugineum]
 gb|ESQ34135.1| hypothetical protein EUTSA_v10008591mg [Eutrema salsugineum]
Length=185

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 141/186 (76%), Gaps = 9/186 (5%)
 Frame = -3

Query  674  MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGPL  495
            ML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR+QRNLLGEDLGPL
Sbjct  1    MLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQRTQRNLLGEDLGPL  60

Query  494  NSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSLKQRLMEDANHLT  315
            ++KELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK+L+ RL  D   + 
Sbjct  61   STKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRLA-DGYQMP  119

Query  314  LEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGY--QTDHHITVAAAGPSVNNF  141
            L+ NP  ++V+YGR   HQ      FF  LECEP LQIGY  Q DH +    AGPSVNN+
Sbjct  120  LQLNPNQEDVDYGR---HQQQHSQAFFQPLECEPILQIGYQGQQDHGM---GAGPSVNNY  173

Query  140  MPEWYP  123
            M  W P
Sbjct  174  MLGWLP  179



>gb|AHW52536.1| SEPALLATA-like MADS-box protein 1 [Phalaenopsis equestris]
Length=244

 Score =   216 bits (551),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 151/195 (77%), Gaps = 9/195 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQK NYGAPE NI +RE     SSQQEYLKLK+R EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKNNYGAPETNIISRETQ---SSQQEYLKLKSRVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLNSKELEQLERQLDNSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTL  167

Query  350  KQRLMEDANHLTLE--WNP-TAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            K+RL E++N    +  W+P TA  + Y ++   Q  G+  F+H LECEPTL IGY +D  
Sbjct  168  KRRL-EESNQANPQQIWDPSTAHAMGYDQRQPVQPHGE-AFYHPLECEPTLHIGYHSDLS  225

Query  179  ITVAAAGPSVNNFMP  135
            I   AA P+VNN+MP
Sbjct  226  IAPMAA-PNVNNYMP  239



>gb|AIU94765.1| class E MADS-domain transcription factor, partial [Hypoxis villosa]
Length=218

 Score =   215 bits (548),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 146/196 (74%), Gaps = 10/196 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSS+SMLKTLERYQKC+YGAP+ ++  RE     SS QEYLKLKAR E LQRS
Sbjct  29   RGKLYEFCSSNSMLKTLERYQKCSYGAPDTSVQLRETQMLQSSHQEYLKLKARVETLQRS  88

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE+LERQLD SL+QIRSTRTQ MLDQL DLQRKE  L EAN++L
Sbjct  89   QRNLLGEDLGPLSSKELENLERQLDSSLRQIRSTRTQYMLDQLTDLQRKEQMLCEANRNL  148

Query  350  KQRLMEDAN--HLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            ++RL ED+N  H    W   A  + YGRQ   Q   +  FFH LEC+PTLQIG+  D   
Sbjct  149  RKRL-EDSNQAHHQQVWESNANALGYGRQPTQQQGEE--FFHPLECQPTLQIGFTPDQ--  203

Query  176  TVAAAGPSVNNFMPEW  129
                AGPSV+ +MP W
Sbjct  204  ---MAGPSVSTYMPGW  216



>ref|XP_010460480.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X1 
[Camelina sativa]
Length=256

 Score =   216 bits (551),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 150/203 (74%), Gaps = 10/203 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQ  537
            RGKLYEFCSSSS ML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQ
Sbjct  51   RGKLYEFCSSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQ  110

Query  536  RSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANK  357
            R+QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK
Sbjct  111  RTQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNK  170

Query  356  SLKQRLMEDANHLTLEWNPTAQE-VE-YGR---QAIHQSDGDHGFFHHLECEPTLQIGYQ  192
            +L+ RL  D   + L+ NP  ++ V+ YGR   Q   Q      FF  LECEP LQIGYQ
Sbjct  171  TLRLRL-ADGYQMPLQLNPNPEDHVDLYGRHHQQQQQQQQHSQAFFQPLECEPILQIGYQ  229

Query  191  TDHHITVAAAGPSVNNFMPEWYP  123
                     AGPSVNN+M  W P
Sbjct  230  AQQD--GMGAGPSVNNYMLGWLP  250



>gb|ABC70706.1| MADS-box transcription factor [Asparagus virgatus]
Length=239

 Score =   216 bits (550),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 146/194 (75%), Gaps = 7/194 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKC+YGAP+ ++  RE+    SS QEYL+LKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCSYGAPDTSVQIRESQMLQSSHQEYLRLKARVEALQRS  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EAN+SL
Sbjct  111  QRNLLGEDLGPLSSKELEQLERQLDSSLKQIRSTRTQYMLDQLADLQRREQMLCEANRSL  170

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            ++RL E +     +    A  + Y RQ  +Q  GD  FFH LEC+PTLQIG+Q D     
Sbjct  171  RKRLEESSQANQQQVWEDANAMGYNRQP-NQPQGDQ-FFHPLECQPTLQIGFQPDQ----  224

Query  170  AAAGPSVNNFMPEW  129
               GPSV+N+MP W
Sbjct  225  -MPGPSVSNYMPGW  237



>ref|XP_009419371.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Musa acuminata 
subsp. malaccensis]
Length=245

 Score =   215 bits (548),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 149/200 (75%), Gaps = 18/200 (9%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKL+EFCSSSSMLKTLERYQKCNYGAPE N+ +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLFEFCSSSSMLKTLERYQKCNYGAPETNVISRETQ---SSQQEYLKLKARVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLN KELE LERQLD SL+QIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLNIKELEQLERQLDASLRQIRSTRTQYMLDQLTDLQRREQMLCEANKAL  167

Query  350  KQRLMED--ANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDH--  183
            K+RL E   AN   L W+P      YGRQ   Q  GD GFF  ++CEPTLQIGY  D   
Sbjct  168  KRRLEESNQANQQQL-WDPNT----YGRQQ-PQPQGD-GFFQPIDCEPTLQIGYHPDQMA  220

Query  182  ----HITVAAAGPSVNNFMP  135
                    AAAGPSV+N++P
Sbjct  221  IAAAAAAAAAAGPSVSNYVP  240



>gb|AAQ83834.1| MADS box protein [Asparagus officinalis]
 gb|ABC70709.1| MADS-box transcription factor [Asparagus officinalis]
Length=239

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 146/194 (75%), Gaps = 7/194 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKC+YGAP+ ++  RE+    SS QEYL+LKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCSYGAPDTSVQIRESQMLQSSHQEYLRLKARVEALQRS  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EAN+SL
Sbjct  111  QRNLLGEDLGPLSSKELEQLERQLDSSLKQIRSTRTQYMLDQLADLQRREQMLCEANRSL  170

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            ++RL E +     +    A  + Y RQ  +Q  GD  FFH LEC+PTLQIG+Q D     
Sbjct  171  RKRLEESSQANQQQVWEDANAMGYNRQP-NQPHGDQ-FFHPLECQPTLQIGFQPDQ----  224

Query  170  AAAGPSVNNFMPEW  129
               GPSV+N+MP W
Sbjct  225  -MPGPSVSNYMPGW  237



>gb|ACB69510.1| SEPALLATA3-like MADS-box protein [Crocus sativus]
Length=239

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 144/196 (73%), Gaps = 11/196 (6%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSS+LKTLERYQKC+YGAP+ N+  RE     SS QEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSILKTLERYQKCSYGAPDNNVQIRETQLLQSSHQEYLKLKARVEALQRS  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQRKEH L EAN+SL
Sbjct  111  QRNLLGEDLGPLSSKELEQLERQLDSSLKQIRSTRTQCMLDQLGDLQRKEHMLCEANRSL  170

Query  350  KQRLMED--ANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            ++ L E   ANH  + W   A  + Y RQA  Q +    F+  L+C+PTL IG+Q D   
Sbjct  171  RKTLEESNQANHQQV-WESNANAIAYDRQANQQRE---EFYQPLDCQPTLHIGFQGDQ--  224

Query  176  TVAAAGPSVNNFMPEW  129
                AGPSV  +MP W
Sbjct  225  ---MAGPSVTTYMPGW  237



>ref|NP_001185081.1| MADs box transcription factor SEPALLATA3 [Arabidopsis thaliana]
 gb|AEE30504.1| MADs box transcription factor SEPALLATA3 [Arabidopsis thaliana]
Length=237

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 137/198 (69%), Gaps = 19/198 (10%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL++KELESLERQLD SLKQIR+ RTQ ML           +LN+    
Sbjct  111  TQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFML----------DQLNDLQSK  160

Query  353  LKQRLMEDANHLTLEWNPTAQEVE-YGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            L      D   + L+ NP  +EV+ YGR    Q      FF  LECEP LQIGYQ     
Sbjct  161  LA-----DGYQMPLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQGQQD-  214

Query  176  TVAAAGPSVNNFMPEWYP  123
                AGPSVNN+M  W P
Sbjct  215  -GMGAGPSVNNYMLGWLP  231



>gb|AHJ80843.1| SEPALLATA3 [Cymbidium goeringii]
Length=243

 Score =   214 bits (545),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 152/195 (78%), Gaps = 10/195 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS++SM+KT+E+YQK NYGAPE N+ +RE     SSQQEYLKLK+R EALQRS
Sbjct  51   RGKLYEFCSNNSMMKTIEKYQKSNYGAPETNVISRETQ---SSQQEYLKLKSRVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDSSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTL  167

Query  350  KQRLMEDANHLTLE--WNP-TAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            K+RL E++N    +  W+P TA  + Y RQ   Q  GD  F+H LECEPTLQIGYQ+D  
Sbjct  168  KRRL-EESNQANPQQIWDPSTAHAMGYDRQPA-QPHGD-AFYHPLECEPTLQIGYQSDLT  224

Query  179  ITVAAAGPSVNNFMP  135
            I   AA  +VNN+MP
Sbjct  225  IAPMAAA-NVNNYMP  238



>gb|AIU94763.1| class E MADS-domain transcription factor, partial [Vanilla planifolia]
Length=220

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 155/200 (78%), Gaps = 14/200 (7%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE ++ +RE     SSQQEYLKLKAR EALQRS
Sbjct  28   RGKLYEFCSSSSMLKTLERYQKCNYGAPETSMISRETQ---SSQQEYLKLKARVEALQRS  84

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  85   QRNLLGEDLGPLSSKELEQLERQLDASLKQIRSTRTQFMLDQLADLQRREQMLCEANKAL  144

Query  350  KQRLMEDANHLTLE--WNP-TAQEVEYGRQ-AIHQSDGDHGFFHHLECEPTLQIGYQTDH  183
            K+RL E+++ +  +  W+P +A  V Y RQ A+  SD     +H LECEPTLQ+GY  D 
Sbjct  145  KRRL-EESSQVNPQQVWDPSSAHAVGYSRQPALPHSDAX---YHPLECEPTLQVGYHPD-  199

Query  182  HITVA-AAGPSVNNFMPEWY  126
             IT+A  A P+ +N++P  +
Sbjct  200  -ITMAPVAAPNASNYLPSGW  218



>gb|AFH66785.1| SEP-like MADS-box protein [Cymbidium ensifolium]
Length=243

 Score =   214 bits (545),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 152/195 (78%), Gaps = 10/195 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS++SM+KT+E+YQK NYGAPE N+ +RE     SSQQEYLKLK+R EALQRS
Sbjct  51   RGKLYEFCSNNSMMKTIEKYQKSNYGAPETNVISRETQ---SSQQEYLKLKSRVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDSSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTL  167

Query  350  KQRLMEDANHLTLE--WNP-TAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            K+RL E++N    +  W+P TA  + Y RQ   Q  GD  F+H LECEPTL IGYQ+D  
Sbjct  168  KRRL-EESNQANPQQMWDPSTAHAMGYDRQPA-QPHGD-AFYHPLECEPTLLIGYQSDLT  224

Query  179  ITVAAAGPSVNNFMP  135
            I   AA P+VNN+MP
Sbjct  225  IAPMAA-PNVNNYMP  238



>gb|AEX92976.1| MADS box protein 1 [Agave tequilana]
Length=243

 Score =   213 bits (543),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 147/199 (74%), Gaps = 13/199 (7%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSM+KTLERYQKC+YGAP+ ++  RE     SS QEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMMKTLERYQKCSYGAPDNSVQIRENQMLQSSHQEYLKLKARVEALQRS  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EAN+SL
Sbjct  111  QRNLLGEDLGPLSSKELEQLERQLDSSLKQIRSTRTQYMLDQLADLQRREQMLCEANRSL  170

Query  350  KQRLME-----DANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTD  186
            ++R ++      AN    E NP A  V Y RQ  +Q  GD  FFH LEC+PTLQ+G Q D
Sbjct  171  RKRCVQLEETSQANQQVWEANPNAM-VGYSRQP-NQPQGDE-FFHPLECQPTLQMGVQPD  227

Query  185  HHITVAAAGPSVNNFMPEW  129
             +     AGPSV+ FM  W
Sbjct  228  QN-----AGPSVSAFMLGW  241



>gb|ACA24482.1| agamous-like 9 protein 2 [Glycine max]
Length=242

 Score =   213 bits (543),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 144/181 (80%), Gaps = 4/181 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGK YEFCS SSMLKTLERYQKCNYGAPE N++T+EAL+ E+SSQQEYL+LKARYEALQR
Sbjct  51   RGKQYEFCSGSSMLKTLERYQKCNYGAPEDNVATKEALELELSSQQEYLRLKARYEALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            SQRNL+GEDLGPL+SKELESLERQLD SLKQIRS RTQ MLDQL DLQRKEH L E+N+ 
Sbjct  111  SQRNLMGEDLGPLSSKELESLERQLDSSLKQIRSIRTQFMLDQLSDLQRKEHFLGESNRD  170

Query  353  LKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHIT  174
            L+QRL E+     L+ NP+A+++ YGR    Q  G H  F  LECEPTLQI Y    H  
Sbjct  171  LRQRL-EEFQINPLQLNPSAEDMGYGRHP-GQPQG-HALFQPLECEPTLQIEYYFPLHSN  227

Query  173  V  171
            +
Sbjct  228  I  228



>gb|ACJ64681.1| MADS-box protein MADS4 [Musa acuminata AAA Group]
Length=243

 Score =   213 bits (543),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 146/200 (73%), Gaps = 15/200 (8%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSML+TLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR + LQRS
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPETNIISRETQ---SSQQEYLKLKARVDGLQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLN KELE LERQLD SL+QIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLNIKELEQLERQLDASLRQIRSTRTQYMLDQLGDLQRREQMLCEANKAL  167

Query  350  KQRLME--DANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDH--  183
            K RL E  +A+   L W+P    V YGRQ   Q  GD GFF  ++CEPTLQIGY  D   
Sbjct  168  KIRLEESSEADQQQL-WDPNTHAVAYGRQQ-PQPQGD-GFFQSIDCEPTLQIGYHPDQMA  224

Query  182  --HITVAAAGPSVNNFMPEW  129
                  AA GPS   +MP W
Sbjct  225  IAAAAAAAPGPS---YMPGW  241



>ref|XP_008801855.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X6 [Phoenix dactylifera]
Length=192

 Score =   212 bits (539),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 140/185 (76%), Gaps = 8/185 (4%)
 Frame = -3

Query  677  SMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGP  498
             MLKTLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR EALQRSQRNLLGEDLGP
Sbjct  12   GMLKTLERYQKCNYGAPETNIVSRETQ---SSQQEYLKLKARVEALQRSQRNLLGEDLGP  68

Query  497  LNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSLKQRLMEDANHL  318
            L+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANKSLK+RL E++N  
Sbjct  69   LSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSLKRRL-EESNQA  127

Query  317  TLE--WNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITVAAAGPSVNN  144
            T +  W+P A  V YGRQ   Q  GD GF+  +ECEPTL IGY  +     A  GPSV+N
Sbjct  128  TQQQVWDPNAHAVGYGRQP-PQPQGD-GFYQPIECEPTLHIGYHPEQITIAAGPGPSVSN  185

Query  143  FMPEW  129
            +MP W
Sbjct  186  YMPGW  190



>sp|Q42464.1|AGL9_SOLLC RecName: Full=Agamous-like MADS-box protein AGL9 homolog; AltName: 
Full=TM5 [Solanum lycopersicum]
 emb|CAA43010.1| TDR5 [Solanum lycopersicum]
 emb|CAA43170.1| TDR5 [Solanum lycopersicum]
Length=224

 Score =   213 bits (541),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 122/128 (95%), Gaps = 1/128 (1%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL EISSQQEYLKLK RYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREAL-EISSQQEYLKLKGRYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQL D QRKEH LNEAN++L
Sbjct  110  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDYQRKEHALNEANRTL  169

Query  350  KQRLMEDA  327
            KQRLME +
Sbjct  170  KQRLMEGS  177



>ref|XP_010478048.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X1 
[Camelina sativa]
Length=255

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 147/202 (73%), Gaps = 9/202 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQ  537
            RGKLYEFCSSSS ML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQ
Sbjct  51   RGKLYEFCSSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQ  110

Query  536  RSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANK  357
            R+QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ MLDQL DLQ KE  L E NK
Sbjct  111  RTQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNK  170

Query  356  SLKQRLMEDANHLTLEWNPTAQE--VEYGR-QAIHQSDGDHGFFHHLECEPTLQIG-YQT  189
            +L+ RL  D   + L+ NP  ++    YGR     Q      FF  LECEP LQIG YQ 
Sbjct  171  TLRLRL-ADGYQMPLQLNPNPEDHIDPYGRHHHQQQQQHSQAFFQPLECEPILQIGSYQA  229

Query  188  DHHITVAAAGPSVNNFMPEWYP  123
                    AGPSVNN+M  W P
Sbjct  230  QQD--GMGAGPSVNNYMLGWLP  249



>dbj|BAC80253.1| MADS-box transcription factor [Houttuynia cordata]
Length=243

 Score =   211 bits (537),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 147/200 (74%), Gaps = 11/200 (6%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSS M+KT+ERYQKCNYGAPE  +ST+E     SS QEY+KLKAR E+LQRS
Sbjct  51   RGKLYEFCSSSGMMKTIERYQKCNYGAPEATVSTKEIQ---SSYQEYMKLKARVESLQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL  KELE LERQLDMSLKQIRSTRTQ MLDQL DLQR+E  L+EANK+L
Sbjct  108  QRNLLGEDLGPLTGKELEQLERQLDMSLKQIRSTRTQCMLDQLSDLQRREQMLSEANKAL  167

Query  350  KQRL--MEDANHLTL--EWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDH  183
            ++RL  ++D +       W+P A  V Y R    Q  G+   F  L+CEPTL IGYQ D 
Sbjct  168  RRRLLQLDDGSQTNPHHSWDPNAHGVGYSRHP-GQPQGEV-IFDPLDCEPTLHIGYQPD-  224

Query  182  HITVAAAGPSVNNFMPEWYP  123
             IT+AA GP+  N+M  W P
Sbjct  225  QITIAAPGPN-GNYMQGWLP  243



>sp|Q38694.1|AGL9_ARADE RecName: Full=Agamous-like MADS-box protein AGL9 homolog; AltName: 
Full=OM1 [x Aranda deborah]
 emb|CAA48859.1| MADS-box protein [x Aranda deborah]
Length=250

 Score =   211 bits (536),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 149/197 (76%), Gaps = 14/197 (7%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSS+SMLKTLE+YQKCN+G+PE  I +RE     SSQQEYLKLK R EALQRS
Sbjct  51   RGKLYEFCSSTSMLKTLEKYQKCNFGSPESTIISRETQ---SSQQEYLKLKNRVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL SKELE LERQLD SL+QIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  108  QRNLLGEDLGPLGSKELEQLERQLDSSLRQIRSTRTQFMLDQLADLQRREQMLCEANKTL  167

Query  350  KQRLMED--ANHLTLEWNPT-AQEVEYGRQ-AIHQSDGDHGFFHHLECEPTLQIGYQTDH  183
            K+R  E   AN   + W+P+    V YGRQ A H  +    F+H LECEPTLQIGY +D 
Sbjct  168  KRRFEESSQANQQQV-WDPSNTHAVGYGRQPAQHHGE---AFYHPLECEPTLQIGYHSD-  222

Query  182  HITVAAAGPS-VNNFMP  135
             IT+A A  S VNN+MP
Sbjct  223  -ITMATATASTVNNYMP  238



>ref|NP_001242742.1| uncharacterized protein LOC100805078 [Glycine max]
 gb|ACU17977.1| unknown [Glycine max]
Length=226

 Score =   208 bits (529),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 138/171 (81%), Gaps = 3/171 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE N+STREAL E+SSQQEYLKLKARYEALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPEANVSTREAL-ELSSQQEYLKLKARYEALQRS  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNL+GEDLGPL+SKELESLERQLD SLKQIRSTRTQ MLDQL DLQRKEH L+EAN+SL
Sbjct  110  QRNLMGEDLGPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIG  198
            +QR +E      L+ NP  +E+ YGR    Q+ G+   FH        ++G
Sbjct  170  RQRQLEGYQINPLQLNPGVEEMGYGRHPA-QTHGE-ALFHKWSVSQRYKLG  218



>dbj|BAM34479.1| MADS-box transcription factor [Alstroemeria ligtu subsp. ligtu]
Length=242

 Score =   208 bits (529),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 141/198 (71%), Gaps = 8/198 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS +SM KTLE+YQ  NY APE N  +RE L   SSQQEYLKLK+R EALQRS
Sbjct  51   RGKLYEFCSPASMTKTLEKYQNSNYSAPETNTISRETL---SSQQEYLKLKSRVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SK+L+ LERQLD+SLKQIRSTRTQ MLDQL DLQRKE  L EANKS+
Sbjct  108  QRNLLGEDLGPLSSKDLDQLERQLDVSLKQIRSTRTQCMLDQLSDLQRKEQMLCEANKSM  167

Query  350  KQRLMED--ANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            ++RL E   AN   + W    Q   Y RQ + Q  GD GFFH L+CEPTLQIGY  +H  
Sbjct  168  RRRLEESSIANQQQM-WEHNVQAARYARQQV-QPLGD-GFFHPLDCEPTLQIGYHQEHIT  224

Query  176  TVAAAGPSVNNFMPEWYP  123
                 G S   +M  W P
Sbjct  225  VAEVPGTSDRTYMEGWLP  242



>ref|XP_009109826.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Brassica rapa]
Length=244

 Score =   208 bits (529),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 146/202 (72%), Gaps = 14/202 (7%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKL+EFCS+SSMLKTLERYQKCNYG PEPN+ +REAL E+SSQQEYLKLK RY+ALQR+
Sbjct  51   RGKLFEFCSNSSMLKTLERYQKCNYGPPEPNVPSREALAELSSQQEYLKLKQRYDALQRT  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL++KELESLERQLD SLKQIR  RTQ MLDQL DLQ KE  L++ NK+L
Sbjct  111  QRNLLGEDLGPLSTKELESLERQLDSSLKQIRGLRTQFMLDQLNDLQSKERMLSDTNKTL  170

Query  350  KQRLMEDANHLTLEWNPTAQE--VEYGRQAIHQSDGDHGFFHHLECEPTLQIGY----QT  189
            + RL  D   +  + NP  +E  V+YG    H       FF  LE EP  Q+GY    Q 
Sbjct  171  RLRL-ADGYQMPFQLNPNQEEVHVDYG----HHQPQQQAFFQPLEYEPIFQMGYHQGQQQ  225

Query  188  DHHITVAAAGPSVNNFMPEWYP  123
            DH +    AGPS NN+M  W P
Sbjct  226  DHGM---GAGPSANNYMLGWLP  244



>dbj|BAL05005.1| putative MADS box protein [Zostera japonica]
 dbj|BAL05006.1| putative MADS box protein [Zostera japonica]
Length=246

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 145/199 (73%), Gaps = 10/199 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSS SMLKTLERYQKCNY APE N+ TRE     SSQQEYLKLKAR E+LQR+
Sbjct  51   RGKLYEFCSSPSMLKTLERYQKCNYVAPETNVQTREIQ---SSQQEYLKLKARVESLQRN  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLG L+S++LE+LERQLD SL+QIRS RTQ MLDQL DLQ++E  L EANK+L
Sbjct  108  QRNLLGEDLGSLSSRDLENLERQLDASLRQIRSIRTQYMLDQLSDLQKQEQALCEANKAL  167

Query  350  KQRLMEDANHLTLE--WNPTAQEVEYGR---QAIHQSDGDHGFFHHLECEPTLQIGYQTD  186
            ++RL E+  H + +  W   A  + Y R              FFH L+CEPTLQIGY  +
Sbjct  168  RRRL-EETTHPSQQQVWESEAHAMAYSRQQQSQQQHHHQSDAFFHPLDCEPTLQIGYHPE  226

Query  185  HHITVAAAGPSVNNFMPEW  129
              ITVAA+GPSV  ++P W
Sbjct  227  -QITVAASGPSVGGYVPTW  244



>gb|ABC70710.1| MADS-box transcription factor [Asparagus officinalis]
Length=243

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 143/199 (72%), Gaps = 13/199 (7%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSS SMLKTL+RYQKC+YGAP+ ++  RE     SS QEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSPSMLKTLDRYQKCSYGAPDTSVQIRENQMLQSSHQEYLKLKARVEALQRS  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LE+QLD SLKQIRSTRTQ MLDQL DLQRKE  L EAN+SL
Sbjct  111  QRNLLGEDLGPLSSKELEQLEKQLDSSLKQIRSTRTQYMLDQLGDLQRKEQMLCEANRSL  170

Query  350  KQRLME-----DANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTD  186
            ++R  +      AN   + W   A  + Y RQ   Q  G+  FFH LEC+PTLQIG+Q D
Sbjct  171  RKRYAQLEETSQANQQQV-WEANANAMGYSRQP-SQPQGEE-FFHPLECQPTLQIGFQPD  227

Query  185  HHITVAAAGPSVNNFMPEW  129
                    GPS ++FMP W
Sbjct  228  Q-----MPGPSASSFMPGW  241



>gb|AIU94761.1| class E MADS-domain transcription factor, partial [Gongora galeata]
Length=228

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 151/199 (76%), Gaps = 12/199 (6%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSS+SMLKTLE+YQK N+GAPE    +RE     +SQQEYLKLK+R E+LQRS
Sbjct  29   RGKLYEFCSSTSMLKTLEKYQKSNFGAPEQPTISRETQ---TSQQEYLKLKSRVESLQRS  85

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+E  L EANK+L
Sbjct  86   QRNLLGEDLGPLNSKELEQLERQLDASLKQIRSTRTQFMLDQLADLQRREQMLCEANKAL  145

Query  350  KQRLMEDA-NHLTLEWNPT-AQEVEYGRQ-AIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            K+R  E +  +  L W+ +    V YGRQ A H  D    F+H L+CEPTLQIG+ +D  
Sbjct  146  KRRFEESSQTNPHLVWDTSNTNGVGYGRQPAQHHED---AFYHPLDCEPTLQIGFHSD--  200

Query  179  ITVA-AAGPSVNNFMPEWY  126
            IT+A AA P+V+N+MP  +
Sbjct  201  ITMAPAAAPNVSNYMPSGW  219



>gb|AHY82573.1| MADS-box protein 6 [Lilium formosanum]
Length=242

 Score =   206 bits (523),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 142/194 (73%), Gaps = 4/194 (2%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEF S+SSM++TLERYQKCNYGAPE NI +RE     +SQQEYLKLKA+ EALQRS
Sbjct  51   RGKLYEFSSTSSMMRTLERYQKCNYGAPETNIVSRETQ---NSQQEYLKLKAKVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLN+KELE LERQLD SLK IRSTRTQ MLDQL DLQR+E  L EANKSL
Sbjct  108  QRNLLGEDLGPLNTKELEQLERQLDTSLKLIRSTRTQFMLDQLSDLQRREQMLCEANKSL  167

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            ++RL E+ +H   +    A     G  A       +GFFH LECEPTLQIGY  D     
Sbjct  168  RRRL-EETSHANQQQVWEANVHAAGYAAQQAQPQGNGFFHPLECEPTLQIGYPPDQITIA  226

Query  170  AAAGPSVNNFMPEW  129
            +  GPS ++++P W
Sbjct  227  SGPGPSGSSYLPGW  240



>ref|XP_010499201.1| PREDICTED: developmental protein SEPALLATA 3 isoform X6 [Camelina 
sativa]
Length=237

 Score =   205 bits (521),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 135/199 (68%), Gaps = 21/199 (11%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSSML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ ML           +LN+    
Sbjct  111  TQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFML----------DQLNDLQSK  160

Query  353  LKQRLMEDANHLTLEWNPTAQE--VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            L      D   + L+ NP  ++    YGR    Q      FF  LECEP LQIGYQ    
Sbjct  161  LA-----DGYQMPLQLNPNPEDHLDPYGRHHHQQQH-SQAFFQPLECEPILQIGYQGQQD  214

Query  179  ITVAAAGPSVNNFMPEWYP  123
                 AGPSVNN+M  W P
Sbjct  215  --GMGAGPSVNNYMLGWLP  231



>ref|XP_010499200.1| PREDICTED: developmental protein SEPALLATA 3 isoform X5 [Camelina 
sativa]
Length=237

 Score =   205 bits (521),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 135/199 (68%), Gaps = 21/199 (11%)
 Frame = -3

Query  710  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQR  534
            RGKLYEFCSSSS ML+TLERYQKCNYGAPEPN+ +REAL E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLYEFCSSSSSMLRTLERYQKCNYGAPEPNVPSREALAELSSQQEYLKLKERYDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RTQ ML           +LN+    
Sbjct  111  TQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFML----------DQLNDLQSK  160

Query  353  LKQRLMEDANHLTLEWNPTAQE--VEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            L      D   + L+ NP  ++    YGR    Q      FF  LECEP LQIGYQ    
Sbjct  161  LA-----DGYQMPLQLNPNPEDHLDPYGRHHHQQQH-SQAFFQPLECEPILQIGYQGQQD  214

Query  179  ITVAAAGPSVNNFMPEWYP  123
                 AGPSVNN+M  W P
Sbjct  215  --GMGAGPSVNNYMLGWLP  231



>emb|CDY11824.1| BnaC03g57540D [Brassica napus]
Length=245

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 146/203 (72%), Gaps = 15/203 (7%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKL+EFCS+SSMLKTLERYQKCNYG PEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLFEFCSNSSMLKTLERYQKCNYGPPEPNVPSREALAVELSSQQEYLKLKQRYDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL++KELESLERQLD SLKQIR  RTQ MLDQL DLQ KE  L++ NK+
Sbjct  111  TQRNLLGEDLGPLSTKELESLERQLDSSLKQIRGLRTQFMLDQLNDLQSKERMLSDTNKT  170

Query  353  LKQRLMEDANHLTLEWNPTAQE--VEYGRQAIHQSDGDHGFFHHLECEPTLQIGY----Q  192
            L+ RL  D   +  + NP  +E  V+YG    H       FF  LE EP  QIGY    Q
Sbjct  171  LRLRL-ADGYQMPFQLNPNQEEVHVDYG----HHQPQQQAFFQPLEYEPIFQIGYHQGQQ  225

Query  191  TDHHITVAAAGPSVNNFMPEWYP  123
             DH +    AGPS NN+M  W P
Sbjct  226  QDHGM---GAGPSANNYMLGWLP  245



>ref|XP_009109825.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Brassica rapa]
 emb|CDY66153.1| BnaAnng21750D [Brassica napus]
Length=245

 Score =   203 bits (517),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 146/203 (72%), Gaps = 15/203 (7%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQR  534
            RGKL+EFCS+SSMLKTLERYQKCNYG PEPN+ +REAL  E+SSQQEYLKLK RY+ALQR
Sbjct  51   RGKLFEFCSNSSMLKTLERYQKCNYGPPEPNVPSREALAVELSSQQEYLKLKQRYDALQR  110

Query  533  SQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKS  354
            +QRNLLGEDLGPL++KELESLERQLD SLKQIR  RTQ MLDQL DLQ KE  L++ NK+
Sbjct  111  TQRNLLGEDLGPLSTKELESLERQLDSSLKQIRGLRTQFMLDQLNDLQSKERMLSDTNKT  170

Query  353  LKQRLMEDANHLTLEWNPTAQE--VEYGRQAIHQSDGDHGFFHHLECEPTLQIGY----Q  192
            L+ RL  D   +  + NP  +E  V+YG    H       FF  LE EP  Q+GY    Q
Sbjct  171  LRLRL-ADGYQMPFQLNPNQEEVHVDYG----HHQPQQQAFFQPLEYEPIFQMGYHQGQQ  225

Query  191  TDHHITVAAAGPSVNNFMPEWYP  123
             DH +    AGPS NN+M  W P
Sbjct  226  QDHGM---GAGPSANNYMLGWLP  245



>gb|AHM92085.1| MADS-box protein 9 [Erycina pusilla]
Length=250

 Score =   203 bits (516),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 150/199 (75%), Gaps = 12/199 (6%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSS+SMLKTL++YQK N+GAPEP   +RE     +SQQEYLKLK+R E+LQR 
Sbjct  51   RGKLYEFCSSTSMLKTLDKYQKSNFGAPEPTTISRETQ---TSQQEYLKLKSRVESLQRE  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL SKELE LERQLD SL+QIRSTRTQ MLDQL DLQR+E  L EANKSL
Sbjct  108  QRNLLGEDLGPLTSKELEHLERQLDASLRQIRSTRTQFMLDQLADLQRREQMLCEANKSL  167

Query  350  KQRLMEDA-NHLTLEWNPT-AQEVEYGRQ-AIHQSDGDHGFFHHLECEPTLQIGYQTDHH  180
            K++  E +  +  L W+P+    V YGRQ A H  D    F+H L+C+PTLQIGY +D  
Sbjct  168  KRKFEESSQTNPQLVWDPSNPNGVGYGRQPAQHHED---AFYHPLDCQPTLQIGYHSD--  222

Query  179  ITVAAAG-PSVNNFMPEWY  126
            +T+A A  P+V+N+MP  +
Sbjct  223  MTMAPANTPNVSNYMPSGW  241



>gb|AGV31155.1| E-class MADS-box protein [Allium cepa]
Length=240

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 144/196 (73%), Gaps = 10/196 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEF S++S++KTLERYQK ++GAP+ ++  RE+    SS QEYLKLKAR EALQRS
Sbjct  51   RGKLYEFASNNSIMKTLERYQKSSFGAPDNSVQIRESQMLQSSHQEYLKLKARVEALQRS  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQRKE  L EAN+SL
Sbjct  111  QRNLLGEDLGPLSSKELEQLERQLDSSLKQIRSTRTQYMLDQLTDLQRKEQMLCEANRSL  170

Query  350  KQRLMEDANHLTLE--WNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            ++RL ED N    +  W   A  + Y RQ  +Q  G+  FFH LEC+PTLQ+G+Q D   
Sbjct  171  RKRL-EDTNQANQQQVWEANANAMGYARQQ-NQPQGED-FFHPLECQPTLQMGFQQDQ--  225

Query  176  TVAAAGPSVNNFMPEW  129
                AGPS + FM  W
Sbjct  226  ---MAGPSASTFMTGW  238



>gb|ACB69511.1| SEPALLATA3-like MADS-box protein [Crocus sativus]
Length=234

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 145/196 (74%), Gaps = 12/196 (6%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQK +YGAP+  +  R+  Q + S QEYLKLKAR E+LQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKSSYGAPDHGVQIRDT-QLLQSHQEYLKLKARVESLQRT  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLG L++KELE LERQLD SL+QIRSTRTQ MLDQL DLQR+EH L E+NKSL
Sbjct  110  QRNLLGEDLGQLSTKELEQLERQLDSSLRQIRSTRTQYMLDQLSDLQRQEHMLCESNKSL  169

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHITV  171
            +++L E++N     W   A  + YGRQ      G+  FFH L C+PTLQ+G+QT+     
Sbjct  170  RKKL-EESNQ---AWESNANPLGYGRQQTQPQVGE--FFHPLACQPTLQMGFQTEQ----  219

Query  170  AAAGPSVNNFMPEWYP  123
              +GPS + + P W+P
Sbjct  220  -LSGPSASTYTPGWFP  234



>gb|AAX15922.1| AGL2 [Acorus americanus]
Length=237

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 142/196 (72%), Gaps = 13/196 (7%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RG+L+EFCSSSSMLKTL+RYQKC++ A E +  +RE LQ  SS QEYLKLKA+ EALQRS
Sbjct  51   RGRLFEFCSSSSMLKTLDRYQKCSFHAAESSAPSRE-LQ--SSYQEYLKLKAKVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELE LE QL+MSLKQ+RST+TQ MLDQL DL+RKE  L EANKSL
Sbjct  108  QRNLLGEDLGPLNSKELEQLESQLEMSLKQVRSTKTQYMLDQLCDLKRKEQMLQEANKSL  167

Query  350  KQRLME--DANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHHI  177
            K++L E    N L L W+     V YGRQ  H  D    FF  L  +P+L IGYQ    +
Sbjct  168  KRKLDEYNSENPLQLSWDNGGSNVPYGRQPTHSED----FFQPLSVDPSLHIGYQ----V  219

Query  176  TVAAAGPSVNNFMPEW  129
              AA G +VN F+P W
Sbjct  220  NAAATGQNVNGFIPGW  235



>gb|ABC70707.1| MADS-box transcription factor [Asparagus virgatus]
Length=243

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 142/199 (71%), Gaps = 13/199 (7%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSS SMLKTL+RYQKC+YGAP+ ++  RE     SS QEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSPSMLKTLDRYQKCSYGAPDTSVQIRENQMLQSSHQEYLKLKARVEALQRS  110

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL+SKELE LE+QLD SL+QIRSTRTQ MLDQL DLQR+E  L EAN+SL
Sbjct  111  QRNLLGEDLGPLSSKELEQLEKQLDSSLRQIRSTRTQYMLDQLGDLQREEQMLCEANRSL  170

Query  350  KQRLME-----DANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTD  186
            ++R ++       N   + W   A  + Y RQ   Q  G+  FFH LEC+PTLQIG+Q D
Sbjct  171  RKRYVQLEETSQTNQRQV-WEANANAMGYNRQP-SQPQGEE-FFHPLECQPTLQIGFQPD  227

Query  185  HHITVAAAGPSVNNFMPEW  129
                    GPS + +MP W
Sbjct  228  Q-----MPGPSASTYMPGW  241



>ref|XP_010260833.1| PREDICTED: MADS-box protein CMB1 [Nelumbo nucifera]
Length=243

 Score =   201 bits (511),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 140/198 (71%), Gaps = 11/198 (6%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTL+RYQKC+YGA E   +++ A +  SS QEYLKLKAR E LQRS
Sbjct  51   RGKLYEFCSSSSMLKTLDRYQKCSYGALE---TSQPAKETQSSYQEYLKLKARVEVLQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL +KELE LE QL+MSLKQIRST+TQLMLDQL DLQRKE  L EAN++L
Sbjct  108  QRNLLGEDLGPLTTKELEQLEHQLEMSLKQIRSTKTQLMLDQLSDLQRKEQMLQEANRTL  167

Query  350  KQRLMEDA--NHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQT--DH  183
            K++L E +  N L L W    Q + Y RQA        GFF  LEC  TLQIGY      
Sbjct  168  KRKLEESSCENPLRLTWEAGGQNISYSRQAAQ----SEGFFQPLECNSTLQIGYNPVGPD  223

Query  182  HITVAAAGPSVNNFMPEW  129
             ITV     +VN F+P W
Sbjct  224  QITVTTPTQNVNGFIPGW  241



>ref|XP_008801851.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Phoenix dactylifera]
Length=263

 Score =   201 bits (512),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 148/226 (65%), Gaps = 47/226 (21%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR EALQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCNYGAPETNIVSRETQ---SSQQEYLKLKARVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRK-----------  384
            QRNLLGEDLGPL+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+           
Sbjct  108  QRNLLGEDLGPLSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRRVWLMQSNSFKK  167

Query  383  ------------------EHELNEANKSLKQRLMEDANHLTLE--WNPTAQEVEYGRQAI  264
                              E  L EANKSLK+RL E++N  T +  W+P A  V YGRQ  
Sbjct  168  HLFFIPPFPSYYHCSFLQEQMLCEANKSLKRRL-EESNQATQQQVWDPNAHAVGYGRQP-  225

Query  263  HQSDGDHGFFHHLECEPTLQIGYQTDHHITVAAA-GPSVNNFMPEW  129
             Q  GD GF+  +E  P           IT+AA  GPSV+N+MP W
Sbjct  226  PQPQGD-GFYQPIEYHP---------EQITIAAGPGPSVSNYMPGW  261



>ref|XP_002299317.2| hypothetical protein POPTR_0001s13650g [Populus trichocarpa]
 gb|EEE84122.2| hypothetical protein POPTR_0001s13650g [Populus trichocarpa]
Length=169

 Score =   197 bits (500),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 131/164 (80%), Gaps = 3/164 (2%)
 Frame = -3

Query  620  NISTREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQ  441
            +I  R    E+SSQQEYLKLKARYEALQR+QRNLLGE+LGPL+SKELESLERQLDMSLKQ
Sbjct  7    SILKRHITVELSSQQEYLKLKARYEALQRTQRNLLGEELGPLSSKELESLERQLDMSLKQ  66

Query  440  IRSTRTqlmldqlmdlQRKEHELNEANKSLKQRLMEDANHLTLEWNPTAQEVEYGRQAIH  261
            IRSTRTQ MLDQL DLQ KEH L  ANKSLK+RLME     +L+ NP+A++VEY RQ   
Sbjct  67   IRSTRTQYMLDQLNDLQHKEHMLTAANKSLKERLMEGYQLNSLQLNPSAEDVEYARQQA-  125

Query  260  QSDGDHGFFHHLECEPTLQIGYQTDHHITVAAAGPSVNNFMPEW  129
            Q  GD GFFH LECEPTLQIGYQ + +IT+  AGPS+  +MP W
Sbjct  126  QPQGD-GFFHALECEPTLQIGYQPE-NITMVTAGPSMTTYMPGW  167



>gb|ADD25197.1| SEP2 [Nuphar advena]
Length=223

 Score =   199 bits (505),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 143/199 (72%), Gaps = 11/199 (6%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RG+LYEFCS+SSMLKTLERYQKCNYG+ E ++ +RE     +S QEYLKLK++ EALQ S
Sbjct  29   RGRLYEFCSTSSMLKTLERYQKCNYGSIEASVPSRETQ---NSYQEYLKLKSKVEALQHS  85

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELE LE+QL++SLK +RST+TQ MLDQL DL+ KE  L +AN +L
Sbjct  86   QRNLLGEDLGPLNSKELEHLEQQLEVSLKHVRSTKTQFMLDQLSDLKGKEQILQDANMAL  145

Query  350  KQRL---MEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQ--TD  186
             ++L      ANH  L W    Q ++YGR +  Q D   GF+H LEC+ TLQIGY     
Sbjct  146  VRKLEGAAGSANHQQLSWENGGQHLQYGRHSGPQKD---GFYHPLECDSTLQIGYNPTAQ  202

Query  185  HHITVAAAGPSVNNFMPEW  129
              ITVAA   +VN F+P W
Sbjct  203  EQITVAAPAHNVNGFIPSW  221



>ref|XP_006305560.1| hypothetical protein CARUB_v100101340mg, partial [Capsella rubella]
 gb|EOA38458.1| hypothetical protein CARUB_v100101340mg, partial [Capsella rubella]
Length=232

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 136/203 (67%), Gaps = 25/203 (12%)
 Frame = -3

Query  710  RGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNISTREALQ-EISSQQEYLKLKARYEALQ  537
            RGKLYEFCSSSS ML+TLERYQKCNYGAPEPN+ +REAL  E+SSQQEYLKLK RY+ALQ
Sbjct  42   RGKLYEFCSSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQ  101

Query  536  RSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANK  357
            R+QRNLLGEDLGPL+SKELESLERQLD SLKQIR+ RT             +  L++ N 
Sbjct  102  RTQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRT-------------QFMLDQLND  148

Query  356  SLKQRLMEDANHLTLEWNPTAQE--VEYGR-QAIHQSDGDHGFFHHLECEPTLQIGYQT-  189
               Q  + D   + L+ NP  ++    Y R     Q      FF  LECEP LQIGYQ  
Sbjct  149  --LQSKLADGYQMPLQLNPNPEDHVDHYARHHHQQQHQHSQAFFQPLECEPILQIGYQGQ  206

Query  188  -DHHITVAAAGPSVNNFMPEWYP  123
             DH +    AGPSVNN+M  W P
Sbjct  207  QDHGM---GAGPSVNNYMLGWLP  226



>ref|NP_001268109.1| MADS-box protein 2 [Vitis vinifera]
 gb|AAM21342.1|AF373601_1 MADS-box protein 2 [Vitis vinifera]
Length=244

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 142/198 (72%), Gaps = 10/198 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKC+YGA E +  ++E   E SS +EYLKLK+++EALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCSYGAVEVSRPSKEL--EQSSYREYLKLKSKFEALQRT  108

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLN+KELE LERQL+ SLKQ+RST+TQ MLDQL DLQ KE  L E+NK+L
Sbjct  109  QRNLLGEDLGPLNTKELEQLERQLETSLKQVRSTKTQFMLDQLSDLQNKEQVLVESNKAL  168

Query  350  KQRLMEDA--NHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQ--TDH  183
             ++L E +  NHL L W    Q + YG    HQ     GFF  LEC PTLQIGY      
Sbjct  169  TRKLDEISVKNHLQLSWESGEQSMPYG----HQQAQSQGFFQPLECNPTLQIGYNPAGSS  224

Query  182  HITVAAAGPSVNNFMPEW  129
             ++  +   +VN F+P W
Sbjct  225  QLSAPSNAQNVNGFIPGW  242



>ref|XP_010257958.1| PREDICTED: developmental protein SEPALLATA 1 [Nelumbo nucifera]
Length=243

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 143/198 (72%), Gaps = 11/198 (6%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKC+YGA E +   +E     SS QEYLKLKAR E LQRS
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCSYGALEASQPAKETQ---SSYQEYLKLKARVEVLQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPL++KELE LE QL+MSLKQIRST+TQLMLDQL DLQRKE  L EAN++L
Sbjct  108  QRNLLGEDLGPLSTKELEQLEHQLEMSLKQIRSTKTQLMLDQLSDLQRKEQMLQEANRAL  167

Query  350  KQRLMEDA--NHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQ--TDH  183
            K++L E +  N L L W    Q + Y RQ   QS+   GFF  LE   TLQIGY      
Sbjct  168  KRKLDESSSENPLRLTWEAGGQNISYSRQP-SQSE---GFFQPLEGNSTLQIGYNPVGPD  223

Query  182  HITVAAAGPSVNNFMPEW  129
             ITVAA+  +VN ++P W
Sbjct  224  QITVAASAQNVNGYIPGW  241



>gb|AIE44769.1| putative MADS-domain transcription factor AGL2 [Nuphar advena]
Length=245

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 143/199 (72%), Gaps = 11/199 (6%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RG+LYEFCS+SSMLKTLERYQKCNYG+ E ++ +RE     +S QEYLKLK++ EALQ S
Sbjct  51   RGRLYEFCSTSSMLKTLERYQKCNYGSIEASVPSRETQ---NSYQEYLKLKSKVEALQHS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLNSKELE LE+QL++SLK +RST+TQ MLDQL DL+ KE  L +AN +L
Sbjct  108  QRNLLGEDLGPLNSKELEHLEQQLEVSLKHVRSTKTQFMLDQLSDLKGKEQILQDANMAL  167

Query  350  KQRL---MEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQ--TD  186
             ++L      ANH  L W    Q ++YGR +  Q D   GF+H LEC+ TLQIGY     
Sbjct  168  VRKLEGAAGSANHQQLSWENGGQHLQYGRHSGPQKD---GFYHPLECDSTLQIGYNPTAQ  224

Query  185  HHITVAAAGPSVNNFMPEW  129
              ITVAA   +VN F+P W
Sbjct  225  EQITVAAPAHNVNGFIPSW  243



>gb|ACB69512.1| SEPALLATA3-like MADS-box protein [Crocus sativus]
Length=239

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 145/200 (73%), Gaps = 15/200 (8%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQK +YGAP+  +  R+  Q + S QEYLKLKAR E+LQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKSSYGAPDHGVQIRDT-QLLQSHQEYLKLKARVESLQRT  109

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLG L++KELE LERQLD SL+QIRSTRTQ MLDQL DLQR+EH L E+NKSL
Sbjct  110  QRNLLGEDLGQLSTKELEQLERQLDSSLRQIRSTRTQYMLDQLSDLQRQEHMLCESNKSL  169

Query  350  KQRL----MEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDH  183
            +++     +E++N     W   A  + YGRQ      G+  FFH L C+PTLQ+G+QT+ 
Sbjct  170  RKKSPFMQLEESNQ---AWESNANPLGYGRQQTQPQVGE--FFHPLACQPTLQMGFQTEQ  224

Query  182  HITVAAAGPSVNNFMPEWYP  123
                  +GPS + + P W+P
Sbjct  225  -----LSGPSASTYTPGWFP  239



>ref|XP_006385890.1| hypothetical protein POPTR_0003s16810g [Populus trichocarpa]
 gb|ERP63687.1| hypothetical protein POPTR_0003s16810g [Populus trichocarpa]
Length=203

 Score =   197 bits (501),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 128/159 (81%), Gaps = 2/159 (1%)
 Frame = -3

Query  599  LQEISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTq  420
            LQE+SSQQEYLKLKARYEALQR+QRNLLGEDLGPL+SKELESLERQLDMSLKQIRSTRTQ
Sbjct  47   LQELSSQQEYLKLKARYEALQRTQRNLLGEDLGPLSSKELESLERQLDMSLKQIRSTRTQ  106

Query  419  lmldqlmdlQRKEHELNEANKSLKQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHG  240
             MLDQL DLQ KEH L  ANKSL++RLME     +L+ N +A++V + RQ   Q  G +G
Sbjct  107  YMLDQLNDLQHKEHMLTAANKSLRERLMEGYEVNSLQLNLSAEDVGFSRQQ-AQPQG-YG  164

Query  239  FFHHLECEPTLQIGYQTDHHITVAAAGPSVNNFMPEWYP  123
            FFH LECEPTLQIGYQ D  ITV  +GPS+  +MP W P
Sbjct  165  FFHPLECEPTLQIGYQPDSAITVVTSGPSMTAYMPGWLP  203



>ref|XP_008801854.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X5 [Phoenix dactylifera]
Length=221

 Score =   196 bits (498),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 140/214 (65%), Gaps = 37/214 (17%)
 Frame = -3

Query  677  SMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRSQRNLLGEDLGP  498
             MLKTLERYQKCNYGAPE NI +RE     SSQQEYLKLKAR EALQRSQRNLLGEDLGP
Sbjct  12   GMLKTLERYQKCNYGAPETNIVSRETQ---SSQQEYLKLKARVEALQRSQRNLLGEDLGP  68

Query  497  LNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRK----------------------  384
            L+SKELE LERQLD SLKQIRSTRTQ MLDQL DLQR+                      
Sbjct  69   LSSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRRVWLMQSNSFKKHLFFIPPFPSY  128

Query  383  -------EHELNEANKSLKQRLMEDANHLTLE--WNPTAQEVEYGRQAIHQSDGDHGFFH  231
                   E  L EANKSLK+RL E++N  T +  W+P A  V YGRQ   Q  GD GF+ 
Sbjct  129  YHCSFLQEQMLCEANKSLKRRL-EESNQATQQQVWDPNAHAVGYGRQP-PQPQGD-GFYQ  185

Query  230  HLECEPTLQIGYQTDHHITVAAAGPSVNNFMPEW  129
             +ECEPTL IGY  +     A  GPSV+N+MP W
Sbjct  186  PIECEPTLHIGYHPEQITIAAGPGPSVSNYMPGW  219



>gb|EPS62764.1| hypothetical protein M569_12026, partial [Genlisea aurea]
Length=141

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 121/144 (84%), Gaps = 4/144 (3%)
 Frame = -3

Query  593  EISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlm  414
            E+SSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQ M
Sbjct  1    ELSSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAM  60

Query  413  ldqlmdlQRKEHELNEANKSLKQRLMEDANHLTLEWNPTAQEV-EYGRQAIHQSDGDHGF  237
            LD L DLQRKE+ LNEANK+LKQRLME  + ++L+WNP AQE   YGRQA HQ   D GF
Sbjct  61   LDTLTDLQRKEYALNEANKTLKQRLME-GSQISLQWNPNAQECGGYGRQA-HQGHPD-GF  117

Query  236  FHHLECEPTLQIGYQTDHHITVAA  165
            FH L+CEPTL IGYQ DH    AA
Sbjct  118  FHPLDCEPTLHIGYQPDHFAVAAA  141



>gb|ADD25177.1| SEP1-1 [Cabomba caroliniana]
Length=226

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 143/196 (73%), Gaps = 8/196 (4%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSS MLKTLERYQKC+YG  E  + +RE  +   S QEYLKLK++ EALQR+
Sbjct  35   RGKLYEFCSSSGMLKTLERYQKCSYGTVEATVPSRETQR---SYQEYLKLKSKVEALQRT  91

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLG+DLGPLNSKELE LE+QL+ SLK +RST+TQ MLDQL +L++KE  L E N++L
Sbjct  92   QRNLLGDDLGPLNSKELEHLEQQLEGSLKHVRSTKTQYMLDQLGELKQKEQNLQEVNRAL  151

Query  350  KQRLMEDANHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQTDHH--I  177
             ++L    +H  + W  + Q ++Y RQ+  QS+   GF+  L+C+PTLQIGY       I
Sbjct  152  IRKLEGGVSHHQIPWESSGQHIQYVRQSDPQSN---GFYQRLDCDPTLQIGYNPSGQETI  208

Query  176  TVAAAGPSVNNFMPEW  129
            T++A+  +VN ++P W
Sbjct  209  TISASAQNVNGYLPTW  224



>gb|AHW52538.1| SEPALLATA-like MADS-box protein 3 [Phalaenopsis equestris]
Length=250

 Score =   196 bits (498),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 146/201 (73%), Gaps = 17/201 (8%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCS++SMLKTLE+YQKCN+G PE  I +RE     +SQQEYLKLK+R EALQRS
Sbjct  51   RGKLYEFCSNTSMLKTLEKYQKCNFGGPETTIISRETQ---NSQQEYLKLKSRVEALQRS  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDL PL+ KELE LERQ+D SLKQIRSTRTQ MLDQL DLQR+E  L EAN++L
Sbjct  108  QRNLLGEDLAPLSGKELEQLERQVDSSLKQIRSTRTQFMLDQLADLQRREQMLCEANRAL  167

Query  350  KQRLMED--ANHLTLEWNPT-AQEVEYGRQAIHQSDGDHG--FFHHLECEPTLQIGYQTD  186
            K R  E   AN   + W+P+    V YGRQ        HG  F+H L+ EPTLQIGY +D
Sbjct  168  KIRFEEGSQANQPQV-WDPSNTHAVGYGRQPAQH----HGEAFYHPLDSEPTLQIGYHSD  222

Query  185  HHITVAAAGPS-VNNFM-PEW  129
              IT+A A  S VNN+M P W
Sbjct  223  --ITMATATTSTVNNYMLPGW  241



>ref|XP_010660492.1| PREDICTED: MADS-box protein 2 isoform X1 [Vitis vinifera]
 emb|CBI16936.3| unnamed protein product [Vitis vinifera]
Length=243

 Score =   196 bits (497),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 141/198 (71%), Gaps = 11/198 (6%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTLERYQKC+YGA E +  ++E     SS +EYLKLK+++E+LQR+
Sbjct  51   RGKLYEFCSSSSMLKTLERYQKCSYGAVEVSRPSKEL---ESSYREYLKLKSKFESLQRT  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLN+KELE LERQL+ SLKQ+RST+TQ MLDQL DLQ KE  L E+NK+L
Sbjct  108  QRNLLGEDLGPLNTKELEQLERQLETSLKQVRSTKTQFMLDQLSDLQNKEQVLVESNKAL  167

Query  350  KQRLMEDA--NHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQ--TDH  183
             ++L E +  NHL L W    Q + YG    HQ     GFF  LEC PTLQIGY      
Sbjct  168  TRKLDEISVKNHLQLSWESGEQSMPYG----HQQAQSQGFFQPLECNPTLQIGYNPAGSS  223

Query  182  HITVAAAGPSVNNFMPEW  129
             ++  +   +VN F+P W
Sbjct  224  QLSAPSNAQNVNGFIPGW  241



>gb|AFO68778.1| agamous-like protein 2, partial [Gunnera manicata]
Length=227

 Score =   195 bits (495),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 137/198 (69%), Gaps = 10/198 (5%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSS SML+TLERYQKC+YG  E +   +E   E SS +EYLKLKAR+EALQRS
Sbjct  35   RGKLYEFCSSPSMLRTLERYQKCSYGTTEVSRPAKE--NEQSSYREYLKLKARFEALQRS  92

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRN LGEDLGPLNSKELE LERQL+ +LKQIRST+TQ +LDQL DLQ KEH L EANK+L
Sbjct  93   QRNFLGEDLGPLNSKELEQLERQLETTLKQIRSTKTQFVLDQLSDLQSKEHMLIEANKAL  152

Query  350  KQRLMEDA--NHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQ--TDH  183
            + +L E    NH    W    Q + YG    HQ    HGF+  +EC PTLQIGY      
Sbjct  153  RTKLDEFGTENHFRPTWEGGEQSIPYG----HQHVQSHGFYQPIECNPTLQIGYNHVGSD  208

Query  182  HITVAAAGPSVNNFMPEW  129
             I  +    +VN+F+P W
Sbjct  209  EINASTHTQNVNSFIPGW  226



>gb|ACD39982.1| MADS1 [Carica papaya]
Length=245

 Score =   195 bits (496),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 139/200 (70%), Gaps = 13/200 (7%)
 Frame = -3

Query  710  RGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALQEISSQQEYLKLKARYEALQRS  531
            RGKLYEFCSSSSMLKTL+RYQKC+YGA E +   +E     SS +EYLKLK R+EALQR+
Sbjct  51   RGKLYEFCSSSSMLKTLDRYQKCSYGAVEVSKPAKEL---ESSYREYLKLKTRFEALQRT  107

Query  530  QRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTqlmldqlmdlQRKEHELNEANKSL  351
            QRNLLGEDLGPLN+KELE LERQL+ SLK +RST+TQ MLDQL DLQ KEH L EAN++L
Sbjct  108  QRNLLGEDLGPLNTKELEQLERQLESSLKHVRSTKTQYMLDQLTDLQNKEHMLLEANRAL  167

Query  350  KQRLMEDA--NHLTLEWNPTAQEVEYGRQAIHQSDGDHGFFHHLECEPTLQIGYQ--TDH  183
              +L E +  NHL + W  + Q V YG    HQ     G F  LEC PTLQIGY      
Sbjct  168  TIKLDEISARNHLRVAWEGSEQNVSYG----HQHAQSQGLFQPLECNPTLQIGYNPVGSD  223

Query  182  HITVAAA--GPSVNNFMPEW  129
             +T AA   G  VN F+P W
Sbjct  224  QMTAAATSQGQQVNGFIPGW  243



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1181407783314