BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25011_g3_i1 len=187 path=[5044:0-186]

Length=187
                                                                      Score     E

gb|ADU56819.1|  MADS-box protein AGL2 subfamily                       97.8    2e-24   
ref|XP_007153483.1|  hypothetical protein PHAVU_003G039400g           97.1    3e-24   
gb|AHC54186.1|  sepallata-like MADS box transcription factor 3        98.6    3e-24   
ref|XP_004170688.1|  PREDICTED: agamous-like MADS-box protein AGL...  96.3    3e-24   
gb|AHC54151.1|  sepallata-like MADS box transcription factor 3        99.0    3e-24   
ref|XP_009622386.1|  PREDICTED: MADS-box protein CMB1-like            97.8    3e-24   
gb|EYU33467.1|  hypothetical protein MIMGU_mgv1a0126181mg             97.1    4e-24   
gb|EPS57613.1|  hypothetical protein M569_17204                       96.3    4e-24   
gb|EYU33468.1|  hypothetical protein MIMGU_mgv1a0126181mg             96.7    4e-24   
gb|KDO65669.1|  hypothetical protein CISIN_1g0246401mg                95.9    4e-24   
ref|XP_006385889.1|  hypothetical protein POPTR_0003s16800g           96.7    4e-24   
ref|XP_007158666.1|  hypothetical protein PHAVU_002G1723001g          98.2    4e-24   
ref|XP_007158665.1|  hypothetical protein PHAVU_002G1723001g          98.2    5e-24   
gb|EMT30881.1|  MADS-box transcription factor 7                       97.1    5e-24   
gb|AHC54157.1|  sepallata-like MADS box transcription factor 3        98.6    5e-24   
gb|AAQ72506.1|  MADS-box protein 12                                   95.5    7e-24   Petunia x hybrida [garden petunia]
gb|AHC54178.1|  sepallata-like MADS box transcription factor 3        98.6    7e-24   
gb|AHC54171.1|  sepallata-like MADS box transcription factor 3        98.2    7e-24   
gb|AHC54190.1|  sepallata-like MADS box transcription factor 3        98.2    8e-24   
gb|AHH28273.1|  MADS-box transcription factor                         97.8    8e-24   
gb|AHC54144.1|  sepallata-like MADS box transcription factor 3        98.2    8e-24   
gb|ADU56818.1|  MADS-box protein AGL2 subfamily                       98.2    9e-24   
gb|AHC54191.1|  sepallata-like MADS box transcription factor 3        98.2    9e-24   
emb|CAE46179.1|  AGL2-like MADS box transcription factor              99.0    1e-23   Elaeis guineensis
gb|EMS66516.1|  MADS-box transcription factor 8                       96.3    1e-23   
gb|AGT80607.1|  AGL6-like MADS-box protein                            98.2    1e-23   
gb|KDO70302.1|  hypothetical protein CISIN_1g0260431mg                94.7    1e-23   
gb|AHC54188.1|  sepallata-like MADS box transcription factor 3        97.4    1e-23   
ref|XP_010532442.1|  PREDICTED: developmental protein SEPALLATA 3...  97.8    1e-23   
ref|XP_010532441.1|  PREDICTED: developmental protein SEPALLATA 3...  97.8    1e-23   
gb|KDP31378.1|  hypothetical protein JCGZ_11754                       98.2    1e-23   
ref|XP_010257958.1|  PREDICTED: developmental protein SEPALLATA 1     99.0    1e-23   
gb|AHC54147.1|  sepallata-like MADS box transcription factor 3        97.4    1e-23   
ref|XP_007155209.1|  hypothetical protein PHAVU_003G182800g           99.0    2e-23   
ref|XP_009773225.1|  PREDICTED: MADS-box protein CMB1-like isofor...  97.4    2e-23   
gb|KDP24297.1|  hypothetical protein JCGZ_25593                       99.0    2e-23   
gb|KCW86946.1|  hypothetical protein EUGRSUZ_B03516                   95.5    2e-23   
ref|NP_001242742.1|  uncharacterized protein LOC100805078             98.6    2e-23   
gb|KHG17252.1|  Developmental SEPALLATA 2 -like protein               99.0    2e-23   
ref|XP_010681125.1|  PREDICTED: MADS-box protein CMB1-like            99.0    2e-23   
ref|XP_004154725.1|  PREDICTED: developmental protein SEPALLATA 2...  99.0    2e-23   
gb|AEJ76841.1|  MADS17                                                99.0    2e-23   
ref|NP_001267667.1|  developmental protein SEPALLATA 2-like           99.0    2e-23   
gb|AAB50187.1|  MADS box transcription factor SbMADS1                 98.6    2e-23   Sorghum bicolor [broomcorn]
ref|XP_011086825.1|  PREDICTED: agamous-like MADS-box protein AGL...  98.6    2e-23   
ref|XP_002263410.2|  PREDICTED: MADS-box protein CMB1                 98.6    2e-23   Vitis vinifera
tpg|DAA40488.2|  TPA: LOW QUALITY PROTEIN: zea mays MADS7             98.6    2e-23   
gb|AAN15182.1|  MADS box protein GHMADS-1                             98.6    2e-23   Gossypium hirsutum [American cotton]
ref|XP_007032865.1|  K-box region and MADS-box transcription fact...  98.6    2e-23   
ref|XP_003518786.1|  PREDICTED: developmental protein SEPALLATA 1...  98.6    2e-23   
ref|XP_007043949.1|  K-box region and MADS-box transcription fact...  98.6    3e-23   
gb|KDP41334.1|  hypothetical protein JCGZ_15741                       98.2    3e-23   
ref|XP_007043947.1|  K-box region and MADS-box transcription fact...  98.6    3e-23   
gb|AGW23364.1|  MADS box protein MADS62                               98.6    3e-23   
dbj|BAO74164.1|  MADS-box transcription factor SEP3.2                 98.6    3e-23   
dbj|BAG55316.1|  transcription factor                                 98.2    3e-23   Petunia integrifolia subsp. inflata
gb|AAL08423.2|AF185574_1  transcription factor MAGL4                  98.6    3e-23   Populus tremuloides
gb|AEL33631.1|  SEPALLATA1                                            98.6    3e-23   
gb|EPS70807.1|  hypothetical protein M569_03954                       98.6    3e-23   
gb|ADF49576.1|  transcription factor MADS-box 2                       98.2    3e-23   
gb|KCW48935.1|  hypothetical protein EUGRSUZ_K02546                   98.2    3e-23   
dbj|BAJ11578.1|  transcription factor                                 98.2    3e-23   
ref|NP_001280756.1|  agamous-like MADS-box protein AGL9 homolog       98.2    3e-23   
ref|NP_001289232.1|  agamous-like MADS-box protein AGL9 homolog       98.2    3e-23   
ref|XP_010558530.1|  PREDICTED: developmental protein SEPALLATA 1     98.2    3e-23   
ref|XP_010460480.1|  PREDICTED: developmental protein SEPALLATA 3...  98.2    3e-23   
emb|CAN77787.1|  hypothetical protein VITISV_023233                   95.1    4e-23   Vitis vinifera
dbj|BAO74162.1|  MADS-box transcription factor SEP1.2                 98.2    4e-23   
ref|XP_009372256.1|  PREDICTED: agamous-like MADS-box protein AGL...  98.2    4e-23   
ref|XP_010653929.1|  PREDICTED: MADS-box protein 4 isoform X1         98.2    4e-23   
ref|XP_010460482.1|  PREDICTED: developmental protein SEPALLATA 3...  98.2    4e-23   
gb|AAQ72498.1|  MADS-box protein 12                                   98.2    4e-23   Petunia x hybrida [garden petunia]
gb|AGC10825.1|  MADS-box transcription factor                         93.6    4e-23   
ref|XP_007043948.1|  K-box region and MADS-box transcription fact...  98.2    4e-23   
ref|XP_010460483.1|  PREDICTED: developmental protein SEPALLATA 3...  98.2    4e-23   
gb|ABD65406.1|  MADS-box protein                                      98.2    4e-23   Diospyros kaki [Japanese persimmon]
ref|NP_973411.1|  protein SEPALLATA 4                                 97.1    4e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AFX72878.1|  MADS-box protein SEP2B                                94.4    4e-23   
gb|ACH61565.1|  truncated MADS-box transcription factor               93.6    4e-23   Pseudotsuga menziesii
ref|XP_008230289.1|  PREDICTED: developmental protein SEPALLATA 1...  97.8    4e-23   
ref|XP_008230291.1|  PREDICTED: developmental protein SEPALLATA 1...  97.8    4e-23   
gb|AEW50208.1|  SEP1                                                  97.8    4e-23   
ref|XP_006440805.1|  hypothetical protein CICLE_v10021357mg           98.2    4e-23   
ref|XP_007215877.1|  hypothetical protein PRUPE_ppa010548mg           97.8    4e-23   
gb|AAY30858.1|  MADS-box transcription factor                         97.8    4e-23   Prunus dulcis [sweet almond]
gb|AAC78282.1|  MADS box protein                                      96.7    5e-23   Eucalyptus grandis [rose gum]
ref|XP_008230292.1|  PREDICTED: developmental protein SEPALLATA 1...  97.8    5e-23   
ref|XP_008230290.1|  PREDICTED: developmental protein SEPALLATA 1...  97.8    5e-23   
gb|AFM30904.1|  transcription factor MADS4                            97.8    5e-23   
ref|XP_006477712.1|  PREDICTED: developmental protein SEPALLATA 1...  98.2    5e-23   
ref|XP_007215876.1|  hypothetical protein PRUPE_ppa010548mg           97.8    5e-23   
ref|XP_006477711.1|  PREDICTED: developmental protein SEPALLATA 1...  98.2    5e-23   
ref|NP_568322.1|  MADS box transcription factor SEPALLATA 1           97.8    5e-23   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA40489.1|  TPA: zea mays MADS7                                  98.6    5e-23   
gb|AHC54175.1|  sepallata-like MADS box transcription factor 3        96.3    5e-23   
gb|ACU18427.1|  unknown                                               95.1    6e-23   Glycine max [soybeans]
ref|XP_004174115.1|  PREDICTED: MADS-box transcription factor 6-like  93.6    6e-23   
gb|ACU18363.1|  unknown                                               95.9    6e-23   Histoplasma capsulatum
gb|AHC54174.1|  sepallata-like MADS box transcription factor 3        95.9    7e-23   
gb|AAP83411.1|  SEPALLATA1-like MADS-box                              96.7    7e-23   Syringa vulgaris
emb|CAE53896.1|  putative MADS-box transcription factor               95.1    7e-23   Triticum aestivum [Canadian hard winter wheat]
gb|KFK37664.1|  hypothetical protein AALP_AA3G012500                  95.1    7e-23   
ref|NP_001119230.1|  MADS box transcription factor SEPALLATA 1        97.4    7e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAX15924.1|  AGL9.2                                                97.1    7e-23   Persea americana
gb|AAF77579.1|AF072534_1  pepper MADS-box protein                     95.9    8e-23   Capsicum annuum
ref|XP_008801850.1|  PREDICTED: agamous-like MADS-box protein AGL...  97.4    8e-23   
ref|XP_003614241.1|  MADS box transcription factor                    93.2    8e-23   
ref|XP_007037631.1|  K-box region and MADS-box transcription fact...  98.6    9e-23   
gb|ABI60898.1|  MADS-box transcription factor                         97.1    9e-23   Arachis hypogaea [goober]
ref|XP_010523499.1|  PREDICTED: agamous-like MADS-box protein AGL3    96.7    1e-22   
gb|AES97199.2|  MADS-box transcription factor family protein          94.0    1e-22   
ref|XP_007151388.1|  hypothetical protein PHAVU_004G042300g           96.3    1e-22   
gb|AAZ77748.1|  AGL2-like MADS box 3                                  96.7    1e-22   Castanea mollissima
emb|CAN59955.1|  hypothetical protein VITISV_006723                   96.7    1e-22   Vitis vinifera
gb|AAY21913.2|  putative MADS box protein                             96.7    1e-22   Musa acuminata [banana]
gb|AAX15920.1|  AGL9                                                  96.7    1e-22   Liriodendron tulipifera
emb|CAL36576.1|  deficiens H49 homologue                              96.7    1e-22   Misopates orontium
emb|CAA64741.1|  DEFH49                                               96.7    1e-22   Antirrhinum majus [garden snapdragon]
gb|AHC54189.1|  sepallata-like MADS box transcription factor 3        95.1    1e-22   
gb|AHM92085.1|  MADS-box protein 9                                    96.7    1e-22   
ref|XP_004137606.1|  PREDICTED: MADS-box transcription factor 8-like  95.5    1e-22   
gb|ABF67487.1|  MADS-domain transcription factor                      96.7    1e-22   Impatiens hawkeri
gb|ACU13166.1|  unknown                                               96.3    1e-22   Glycine max [soybeans]
ref|XP_006477714.1|  PREDICTED: developmental protein SEPALLATA 1...  96.7    1e-22   
ref|XP_006477713.1|  PREDICTED: developmental protein SEPALLATA 1...  96.7    1e-22   
ref|XP_003621519.1|  MADS-box protein                                 96.7    1e-22   
gb|AES77737.2|  MADS-box transcription factor                         96.7    1e-22   
gb|ADC79703.1|  SEPALLATA3-like protein                               96.7    1e-22   Pachysandra terminalis
gb|ACJ83943.1|  unknown                                               95.5    1e-22   Medicago truncatula
emb|CAH04878.1|  MADS domain protein                                  96.7    1e-22   Gerbera hybrid cultivar
gb|AFU81295.1|  SEPALLATA1                                            96.7    1e-22   
ref|XP_003544012.1|  PREDICTED: developmental protein SEPALLATA 1...  96.7    1e-22   
gb|AAO22982.1|  MADS-box transcription factor CDM44                   96.7    1e-22   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AFX72877.1|  MADS-box protein SEP2A                                96.3    1e-22   
gb|AHC54137.1|  sepallata-like MADS box transcription factor 3        94.7    1e-22   
gb|AHC54115.1|  sepallata-like MADS box transcription factor 3        95.1    2e-22   
gb|ABD17386.1|  MADS-box protein SEP3-1                               97.4    2e-22   Taihangia rupestris
ref|XP_008801851.1|  PREDICTED: agamous-like MADS-box protein AGL...  96.7    2e-22   
gb|AFS60087.1|  MADS box transcription factor SEP2                    95.9    2e-22   
ref|XP_007045799.1|  MADS-box transcription factor                    96.3    2e-22   
gb|AHC54135.1|  sepallata-like MADS box transcription factor 3        94.7    2e-22   
gb|AFK42306.1|  unknown                                               96.3    2e-22   
gb|AEJ76844.1|  MADS20                                                96.3    2e-22   
gb|KHF99411.1|  Agamous-like MADS-box protein AGL6                    96.3    2e-22   
ref|XP_010319477.1|  PREDICTED: MADS-box protein CMB1 isoform X2      95.9    2e-22   
sp|Q42464.1|AGL9_SOLLC  RecName: Full=Agamous-like MADS-box prote...  95.9    2e-22   Solanum lycopersicum
gb|KHG10874.1|  Agamous-like MADS-box protein AGL6                    95.1    2e-22   
gb|AHC54130.1|  sepallata-like MADS box transcription factor 3        94.7    2e-22   
gb|AEJ76842.1|  MADS18                                                96.3    2e-22   
gb|AIC33052.1|  flower development transporter SEP3                   96.3    2e-22   
gb|AIE44768.1|  putative MADS-domain transcription factor AGL6.2      95.9    2e-22   
ref|NP_001289804.1|  MADS-box transcription factor 8                  96.3    2e-22   
ref|XP_010091612.1|  MADS-box protein                                 96.3    2e-22   
emb|CDY15724.1|  BnaA07g08950D                                        96.3    2e-22   
gb|EMS63701.1|  MADS-box transcription factor 6                       95.1    2e-22   
gb|AHC54154.1|  sepallata-like MADS box transcription factor 3        94.4    2e-22   
gb|EPS71714.1|  hypothetical protein M569_03044                       94.4    2e-22   
emb|CAX65571.1|  GRCD5 protein                                        95.9    2e-22   Gerbera hybrid cultivar
ref|XP_008459849.1|  PREDICTED: agamous-like MADS-box protein AGL...  95.5    2e-22   
gb|ABC73603.1|  AGL6-like MADS-box transcription factor               94.4    2e-22   Elaeis guineensis
ref|XP_010250667.1|  PREDICTED: agamous-like MADS-box protein AGL...  95.9    2e-22   
ref|XP_010499201.1|  PREDICTED: developmental protein SEPALLATA 3...  95.9    3e-22   
ref|XP_010499200.1|  PREDICTED: developmental protein SEPALLATA 3...  95.9    3e-22   
ref|XP_004153375.1|  PREDICTED: MADS-box transcription factor 6-like  94.4    3e-22   
dbj|BAD38890.1|  MADS box transcription factor                        95.9    3e-22   Gentiana triflora
gb|ABK23248.1|  unknown                                               93.6    3e-22   Picea sitchensis
ref|XP_003630490.1|  MADS-box transcription factor                    96.7    3e-22   
gb|AGH61294.1|  sepallata 3                                           95.9    3e-22   
gb|AAZ20812.1|  MADS1                                                 95.1    3e-22   Castanea mollissima
gb|AAF13260.1|AF198174_1  MADS box protein DOMADS1                    94.4    3e-22   Dendrobium grex Madame Thong-In
ref|XP_008677797.1|  PREDICTED: MADS box protein isoform X1           96.3    3e-22   
ref|XP_008801852.1|  PREDICTED: agamous-like MADS-box protein AGL...  95.9    3e-22   
gb|AEE60891.1|  MADS-box protein 5                                    95.9    3e-22   
gb|ACA24482.1|  agamous-like 9 protein 2                              95.5    3e-22   
gb|AAT37486.1|  MADS7 protein                                         95.9    3e-22   Dendrocalamus latiflorus [sweet bamboo]
gb|AHC54165.1|  sepallata-like MADS box transcription factor 3        94.4    3e-22   
emb|CAA64743.1|  DEFH200                                              95.5    3e-22   Antirrhinum majus [garden snapdragon]
ref|XP_011099041.1|  PREDICTED: developmental protein SEPALLATA 1...  95.9    3e-22   
ref|XP_011099040.1|  PREDICTED: developmental protein SEPALLATA 1...  95.9    3e-22   
gb|AEL33632.1|  SEPALLATA2                                            95.5    3e-22   
ref|XP_008783531.1|  PREDICTED: MADS-box transcription factor 6-like  95.5    3e-22   
gb|AAX15918.1|  AGL9                                                  95.5    3e-22   Eschscholzia californica
ref|XP_010913017.1|  PREDICTED: agamous-like MADS-box protein AGL...  95.5    3e-22   
gb|AET98846.1|  SEPALLATA1                                            95.5    3e-22   
gb|AAZ95252.1|  MADS box protein SEP1                                 95.5    3e-22   Dendrobium crumenatum
ref|XP_009102995.1|  PREDICTED: agamous-like MADS-box protein AGL...  95.9    3e-22   
ref|XP_010919412.1|  PREDICTED: MADS-box transcription factor 6-like  92.0    3e-22   
gb|AEJ76840.1|  MADS16                                                95.5    3e-22   
ref|XP_003552609.1|  PREDICTED: developmental protein SEPALLATA 1...  95.9    3e-22   
ref|XP_006602962.1|  PREDICTED: developmental protein SEPALLATA 1...  95.9    3e-22   
ref|XP_010694134.1|  PREDICTED: developmental protein SEPALLATA 1...  95.5    3e-22   
ref|XP_010694125.1|  PREDICTED: developmental protein SEPALLATA 1...  95.5    3e-22   
gb|AAT37484.1|  MADS5 protein                                         95.5    3e-22   Dendrocalamus latiflorus [sweet bamboo]
gb|AAT37485.1|  MADS6 protein                                         95.5    3e-22   Dendrocalamus latiflorus [sweet bamboo]
ref|XP_010694117.1|  PREDICTED: developmental protein SEPALLATA 1...  95.5    3e-22   
gb|AEF59025.1|  MADS-1                                                95.5    3e-22   
ref|XP_010917558.1|  PREDICTED: agamous-like MADS-box protein AGL...  95.5    3e-22   
gb|ABD62860.1|  SEP3.2                                                95.1    3e-22   Persea borbonia [red bay]
gb|AEL33633.1|  SEPALLATA3                                            95.5    3e-22   
ref|XP_004304204.1|  PREDICTED: developmental protein SEPALLATA 2...  95.5    4e-22   
ref|XP_009608617.1|  PREDICTED: developmental protein SEPALLATA 1...  95.5    4e-22   
gb|AAP83382.1|  AGL6-like MADS-box                                    94.7    4e-22   Magnolia figo
ref|XP_011034912.1|  PREDICTED: MADS-box transcription factor 6 i...  95.5    4e-22   
ref|XP_009608616.1|  PREDICTED: developmental protein SEPALLATA 1...  95.5    4e-22   
gb|AAQ11687.1|  MADS box protein                                      95.5    4e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004145053.1|  PREDICTED: MADS-box transcription factor 6-like  94.4    4e-22   
ref|XP_009608615.1|  PREDICTED: developmental protein SEPALLATA 1...  95.5    4e-22   
gb|AHC54138.1|  sepallata-like MADS box transcription factor 3        94.0    4e-22   
dbj|BAD10945.1|  SEPALLATA3 homologous protein                        95.5    4e-22   Silene latifolia
gb|ABK41485.1|  putative MADS box protein                             95.1    4e-22   Elaeis guineensis
ref|XP_008240082.1|  PREDICTED: MADS-box protein CMB1-like            95.5    4e-22   
ref|XP_009102994.1|  PREDICTED: agamous-like MADS-box protein AGL...  95.5    4e-22   
gb|AAL14197.1|  SEPELLATA3-like MADS-box protein                      93.6    4e-22   Cleisostoma racemiferum
gb|AAV84087.1|  MADS box transcription factor                         94.4    4e-22   Pharus virescens
ref|XP_004166872.1|  PREDICTED: MADS-box protein CMB1-like            91.7    4e-22   
ref|XP_010549963.1|  PREDICTED: developmental protein SEPALLATA 1     95.5    4e-22   
gb|AAT37482.1|  MADS3 protein                                         95.1    4e-22   Dendrocalamus latiflorus [sweet bamboo]
gb|AHM92068.1|  MADS-box protein 8                                    95.5    4e-22   
gb|AHC54140.1|  sepallata-like MADS box transcription factor 3        94.0    4e-22   
gb|AAK21247.1|AF335234_1  MADS-box transcription factor FBP4          95.1    4e-22   Petunia x hybrida [garden petunia]
gb|EMS49687.1|  MADS-box transcription factor 7                       95.5    4e-22   
ref|XP_009372255.1|  PREDICTED: agamous-like MADS-box protein AGL...  95.5    4e-22   
gb|ADC79704.1|  SEPALLATA3-like protein                               95.1    4e-22   Pachysandra terminalis
gb|AHC54133.1|  sepallata-like MADS box transcription factor 3        94.0    4e-22   
dbj|BAN89460.1|  sepallata 3                                          95.1    4e-22   
ref|XP_006585806.1|  PREDICTED: developmental protein SEPALLATA 1...  95.1    4e-22   
ref|XP_003531877.1|  PREDICTED: developmental protein SEPALLATA 1...  95.1    4e-22   
ref|XP_006490968.1|  PREDICTED: agamous-like MADS-box protein AGL...  95.1    4e-22   
gb|ABF57918.1|  MADS-box transcription factor TaAGL16                 95.1    4e-22   Triticum aestivum [Canadian hard winter wheat]
gb|AFX72879.1|  MADS-box protein SEP3                                 95.1    5e-22   
gb|ABS82744.1|  MADS-box protein                                      95.1    5e-22   Narcissus tazetta var. chinensis
ref|NP_001105692.1|  MADS box protein                                 95.1    5e-22   Zea mays [maize]
dbj|BAF75018.1|  MADS-box protein                                     95.1    5e-22   Triticum aestivum [Canadian hard winter wheat]
gb|AIU94287.1|  SEPALLATA1-like protein                               95.1    5e-22   
gb|ABF57932.1|  MADS-box transcription factor TaAGL30                 95.1    5e-22   Triticum aestivum [Canadian hard winter wheat]
gb|AAK21248.1|AF335235_1  MADS-box transcription factor FBP5          95.1    5e-22   Petunia x hybrida [garden petunia]
ref|XP_006445200.1|  hypothetical protein CICLE_v10021911mg           95.1    5e-22   
gb|AHC54092.1|  sepallata-like MADS box transcription factor LOFSEP   92.8    5e-22   
ref|NP_001268114.1|  MADS-box protein 4                               95.1    5e-22   
gb|KHG12954.1|  MADS-box CMB1                                         95.1    5e-22   
dbj|BAJ53135.1|  JHL05D22.6                                           95.1    5e-22   
gb|ACB45304.1|  MIKC-type MADS-box transcription factor WM10A         95.1    5e-22   Hordeum vulgare [barley]
emb|CAM59053.1|  MIKC-type MADS-box transcription factor WM10A        95.1    5e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009615091.1|  PREDICTED: MADS-box protein CMB1-like isofor...  94.4    5e-22   
ref|NP_001289642.1|  developmental protein SEPALLATA 1-like           95.1    5e-22   
ref|XP_010318407.1|  PREDICTED: MADS-box protein 1 isoform X1         94.7    5e-22   
gb|ACR38104.1|  unknown                                               95.1    5e-22   Zea mays [maize]
ref|XP_007220139.1|  hypothetical protein PRUPE_ppa019932mg           94.0    5e-22   
ref|XP_007209505.1|  hypothetical protein PRUPE_ppa010391mg           95.1    5e-22   
gb|KHG04329.1|  MADS-box CMB1                                         95.1    5e-22   
gb|ACB69512.1|  SEPALLATA3-like MADS-box protein                      95.1    5e-22   Crocus sativus [saffron crocus]
dbj|BAC80255.1|  MADS-box transcription factor                        95.1    5e-22   Houttuynia cordata [chameleon-plant]
ref|XP_010531079.1|  PREDICTED: developmental protein SEPALLATA 3...  95.1    5e-22   
gb|KCW72885.1|  hypothetical protein EUGRSUZ_E013301                  91.3    5e-22   
ref|XP_010531071.1|  PREDICTED: developmental protein SEPALLATA 3...  95.1    5e-22   
gb|AAD47632.1|AF159710_1  MADS-box transcription factor               90.5    5e-22   Secale cereale
gb|EEE69055.1|  hypothetical protein OsJ_28057                        95.9    5e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ64678.1|  MADS-box protein MADS2                                94.7    5e-22   Musa acuminata AAA Group [Cavendish banana]
gb|ABF50242.1|  putative transcription factor SEPALATTA               92.0    5e-22   Nicotiana langsdorffii x Nicotiana sanderae
gb|AHC54113.1|  sepallata-like MADS box transcription factor 3        93.6    5e-22   
sp|O04067.1|AGL9_SINAL  RecName: Full=Agamous-like MADS-box prote...  95.1    5e-22   Sinapis alba [bai jie]
dbj|BAF75017.1|  MADS-box protein                                     94.7    6e-22   Triticum aestivum [Canadian hard winter wheat]
dbj|BAF75016.1|  MADS-box protein                                     94.7    6e-22   Triticum aestivum [Canadian hard winter wheat]
gb|AFH66785.1|  SEP-like MADS-box protein                             94.7    6e-22   
ref|NP_001185081.1|  MADs box transcription factor SEPALLATA3         94.7    6e-22   
ref|XP_006652688.1|  PREDICTED: MADS-box transcription factor 17-...  95.1    6e-22   
gb|ADU15478.1|  SEP1                                                  94.7    6e-22   
gb|AIE44767.1|  putative MADS-domain transcription factor AGL6.1      94.7    6e-22   
gb|ADD25198.1|  AGL6                                                  94.7    6e-22   Nuphar advena
ref|XP_008243816.1|  PREDICTED: MADS-box protein CMB1-like isofor...  94.4    6e-22   
ref|XP_011018962.1|  PREDICTED: MADS-box protein CMB1-like            94.7    6e-22   
ref|XP_010917559.1|  PREDICTED: agamous-like MADS-box protein AGL...  94.7    6e-22   
gb|AAT46095.1|  SEPALLATA-like protein                                94.7    6e-22   Akebia trifoliata
gb|AHC54091.1|  sepallata-like MADS box transcription factor LOFSEP   92.4    6e-22   
dbj|BAK09619.1|  MADS-box transcription factor                        94.7    6e-22   
ref|XP_004140534.1|  PREDICTED: agamous-like MADS-box protein AGL...  94.7    6e-22   
emb|CBI27678.3|  unnamed protein product                              94.7    6e-22   
ref|NP_001105332.1|  bearded-ear1                                     95.1    6e-22   Zea mays [maize]
ref|XP_006484143.1|  PREDICTED: agamous-like MADS-box protein AGL...  95.1    6e-22   
ref|XP_011020782.1|  PREDICTED: agamous-like MADS-box protein AGL...  94.7    6e-22   
ref|XP_006856372.1|  hypothetical protein AMTR_s00047p00190220        94.7    6e-22   
ref|XP_006437996.1|  hypothetical protein CICLE_v10032507mg           95.1    6e-22   
emb|CDY57524.1|  BnaA05g33600D                                        94.7    6e-22   
ref|XP_002311352.1|  MADS-box protein 4                               94.7    6e-22   
ref|XP_006437997.1|  hypothetical protein CICLE_v10032507mg           95.1    6e-22   
ref|XP_008365428.1|  PREDICTED: developmental protein SEPALLATA 1...  94.7    6e-22   
gb|ADL36751.1|  MADS domain class transcription factor                94.7    6e-22   
gb|AHW58036.1|  SEP1/2                                                94.7    6e-22   
gb|AIU94433.1|  MADS-box transcription factor 2 isoform 1             94.7    6e-22   
ref|XP_011071269.1|  PREDICTED: floral homeotic protein APETALA 1     97.1    6e-22   
ref|XP_009378252.1|  PREDICTED: developmental protein SEPALLATA 1...  94.7    6e-22   
gb|AGT42203.1|  sepallata-like MADS box transcription factor LOFSEP   92.4    7e-22   
gb|AEJ76843.1|  MADS19                                                94.7    7e-22   
ref|XP_008801853.1|  PREDICTED: agamous-like MADS-box protein AGL...  94.7    7e-22   
ref|XP_006660815.1|  PREDICTED: MADS-box transcription factor 8-like  94.7    7e-22   
gb|AHC54080.1|  sepallata-like MADS box transcription factor LOFSEP   92.0    7e-22   
ref|XP_006352168.1|  PREDICTED: agamous-like MADS-box protein AGL...  94.7    7e-22   
ref|NP_001234384.1|  agamous-like MADS-box protein AGL9 homolog       94.7    7e-22   
ref|XP_008340234.1|  PREDICTED: agamous-like MADS-box protein AGL...  95.1    7e-22   
dbj|BAA85630.1|  GpMADS3                                              94.7    7e-22   
emb|CAA04920.1|  MdMADS9                                              94.7    7e-22   
ref|XP_009121545.1|  PREDICTED: developmental protein SEPALLATA 1     94.7    7e-22   
gb|KHN15201.1|  MADS-box protein CMB1                                 94.7    7e-22   
ref|XP_009415892.1|  PREDICTED: agamous-like MADS-box protein AGL...  94.7    7e-22   
ref|NP_001242365.1|  uncharacterized protein LOC100797819             94.7    7e-22   
ref|XP_003601749.1|  MADS-box transcription factor                    94.7    7e-22   
dbj|BAM34482.1|  MADS-box transcription factor                        94.7    7e-22   
ref|XP_002445814.1|  hypothetical protein SORBIDRAFT_07g026200        94.7    7e-22   
gb|AAT37481.1|  MADS18 protein                                        94.7    7e-22   
ref|NP_001284431.1|  agamous-like MADS-box protein AGL9 homolog       94.7    7e-22   
gb|KHN22837.1|  Developmental protein SEPALLATA 2                     90.5    7e-22   
gb|KDP26829.1|  hypothetical protein JCGZ_17987                       94.7    7e-22   
ref|XP_004953459.1|  PREDICTED: MADS-box transcription factor 6-like  94.7    7e-22   
gb|AGT80616.1|  AGL6-like MADS-box protein                            92.4    8e-22   
ref|XP_010682730.1|  PREDICTED: agamous-like MADS-box protein AGL...  94.4    8e-22   
gb|AHC54110.1|  sepallata-like MADS box transcription factor 3        93.2    8e-22   
gb|AAC49816.2|  MADS box protein                                      94.7    8e-22   
emb|CDP02339.1|  unnamed protein product                              94.7    8e-22   
ref|XP_010913018.1|  PREDICTED: agamous-like MADS-box protein AGL...  94.4    8e-22   
emb|CAB97355.1|  MADS-box protein 9                                   94.7    8e-22   
ref|XP_002454472.1|  hypothetical protein SORBIDRAFT_04g031750        94.7    8e-22   
gb|KHG25284.1|  Agamous-like MADS-box protein AGL9                    94.7    8e-22   
ref|NP_001063613.1|  Os09g0507200                                     94.7    8e-22   
ref|XP_006294857.1|  hypothetical protein CARUB_v10023910mg           94.7    8e-22   
ref|XP_010099309.1|  Developmental protein SEPALLATA 2                94.7    8e-22   
ref|XP_006848294.1|  hypothetical protein AMTR_s00013p00103080        94.4    8e-22   
ref|NP_182089.1|  agamous-like MADS-box protein AGL6                  94.7    8e-22   
gb|AGW23594.1|  MADS1                                                 94.7    8e-22   
gb|AAQ83834.1|  MADS box protein                                      94.4    8e-22   
emb|CDY03905.1|  BnaC07g11300D                                        94.7    8e-22   
ref|XP_006829120.1|  hypothetical protein AMTR_s00001p00267050        94.4    8e-22   
gb|ABK28537.1|  unknown                                               94.7    8e-22   
gb|AHJ80843.1|  SEPALLATA3                                            94.4    8e-22   
ref|XP_002460491.1|  hypothetical protein SORBIDRAFT_02g029310        94.4    8e-22   
gb|EEC84853.1|  hypothetical protein OsI_31966                        94.4    8e-22   
gb|EMT12289.1|  MADS-box transcription factor 8                       94.7    8e-22   
gb|ACF78403.1|  unknown                                               94.4    9e-22   
ref|XP_002884314.1|  SEPALLATA2                                       94.4    9e-22   
gb|ADU15479.1|  SEP4                                                  94.4    9e-22   
gb|AFP23737.1|  AGAMOUS-like protein 6                                94.4    9e-22   
gb|AHC54126.1|  sepallata-like MADS box transcription factor 3        92.8    9e-22   
gb|ACB69511.1|  SEPALLATA3-like MADS-box protein                      94.4    9e-22   
gb|AFP23750.1|  AGAMOUS-like protein 6                                94.4    9e-22   
ref|XP_009147359.1|  PREDICTED: developmental protein SEPALLATA 2...  94.4    9e-22   
ref|XP_006437994.1|  hypothetical protein CICLE_v10032507mg           94.4    9e-22   
ref|XP_010029406.1|  PREDICTED: developmental protein SEPALLATA 1     94.4    9e-22   
emb|CDX70651.1|  BnaC03g07350D                                        94.7    9e-22   
gb|AHC54129.1|  sepallata-like MADS box transcription factor 3        92.8    9e-22   
gb|AGW23347.1|  MADS box protein MADS45                               94.4    9e-22   
ref|XP_004507288.1|  PREDICTED: developmental protein SEPALLATA 1...  94.4    9e-22   
ref|XP_002890717.1|  hypothetical protein ARALYDRAFT_472923           94.4    9e-22   
ref|XP_009129078.1|  PREDICTED: agamous-like MADS-box protein AGL3    94.7    9e-22   
ref|XP_004507287.1|  PREDICTED: developmental protein SEPALLATA 1...  94.4    9e-22   
ref|XP_002880190.1|  hypothetical protein ARALYDRAFT_483701           94.4    9e-22   
ref|XP_006437995.1|  hypothetical protein CICLE_v10032507mg           94.4    9e-22   
ref|XP_004974003.1|  PREDICTED: MADS-box transcription factor 7-like  94.4    9e-22   
dbj|BAF34912.1|  MADS-box protein                                     94.4    9e-22   
ref|XP_010463632.1|  PREDICTED: developmental protein SEPALLATA 2...  94.4    9e-22   
gb|ADU56817.1|  MADS-box protein AGL2 subfamily                       94.4    9e-22   
ref|XP_010499197.1|  PREDICTED: developmental protein SEPALLATA 3...  94.4    9e-22   
ref|XP_006579435.1|  PREDICTED: uncharacterized protein LOC100805...  94.4    9e-22   
ref|XP_004507289.1|  PREDICTED: developmental protein SEPALLATA 1...  94.4    9e-22   
ref|XP_006579433.1|  PREDICTED: uncharacterized protein LOC100805...  94.4    1e-21   
ref|XP_010499195.1|  PREDICTED: developmental protein SEPALLATA 3...  94.4    1e-21   
gb|EMS57198.1|  MADS-box transcription factor 1                       90.1    1e-21   
ref|XP_006579434.1|  PREDICTED: uncharacterized protein LOC100805...  94.4    1e-21   
emb|CAA64742.1|  DEFH72                                               94.4    1e-21   
gb|ABQ85951.1|  MADS-box transcription factor SEP-like 2              94.4    1e-21   
gb|ADR83588.1|  Sepallata 1-like protein                              94.4    1e-21   
gb|AHW58034.1|  SEP3                                                  94.4    1e-21   
gb|ABC70706.1|  MADS-box transcription factor                         94.4    1e-21   
ref|XP_010499199.1|  PREDICTED: developmental protein SEPALLATA 3...  94.4    1e-21   
ref|XP_010499198.1|  PREDICTED: developmental protein SEPALLATA 3...  94.4    1e-21   
emb|CAC81072.1|  MADS box transcription factor                        94.4    1e-21   
gb|AAA32732.1|  transcription factor                                  94.4    1e-21   
ref|NP_001171777.1|  MADS-domain transcription factor 4               94.4    1e-21   
gb|ACF83306.1|  unknown                                               94.4    1e-21   
ref|XP_006484242.1|  PREDICTED: developmental protein SEPALLATA 1...  94.4    1e-21   
ref|XP_006579436.1|  PREDICTED: uncharacterized protein LOC100805...  94.4    1e-21   
ref|XP_006415783.1|  hypothetical protein EUTSA_v10008591mg           94.4    1e-21   
gb|KFK44483.1|  developmental protein sepallata 3                     94.4    1e-21   
gb|AHC54093.1|  sepallata-like MADS box transcription factor LOFSEP   91.7    1e-21   
gb|AHW52538.1|  SEPALLATA-like MADS-box protein 3                     94.4    1e-21   
ref|XP_010478050.1|  PREDICTED: developmental protein SEPALLATA 3...  94.4    1e-21   
ref|XP_009152152.1|  PREDICTED: agamous-like MADS-box protein AGL3    94.4    1e-21   
gb|ACG32919.1|  MADS-box transcription factor 8                       94.4    1e-21   
ref|XP_010478048.1|  PREDICTED: developmental protein SEPALLATA 3...  94.4    1e-21   
ref|XP_010478051.1|  PREDICTED: developmental protein SEPALLATA 3...  94.4    1e-21   
ref|XP_009615088.1|  PREDICTED: MADS-box protein CMB1-like isofor...  94.0    1e-21   
emb|CDX69499.1|  BnaA10g18480D                                        94.4    1e-21   
gb|ADU15477.1|  SEP3                                                  94.4    1e-21   
gb|AAO18233.1|  MADS-box transcriptional factor HAM137                94.4    1e-21   
ref|XP_010478049.1|  PREDICTED: developmental protein SEPALLATA 3...  94.4    1e-21   
emb|CDX78653.1|  BnaA03g05650D                                        94.4    1e-21   
dbj|BAD10944.1|  SEPALLATA1 homologous protein                        94.4    1e-21   
ref|XP_006659622.1|  PREDICTED: MADS-box transcription factor 7-like  94.4    1e-21   
gb|AAX13298.1|  MADS box protein SEP3                                 94.0    1e-21   
ref|XP_008464576.1|  PREDICTED: developmental protein SEPALLATA 1...  94.0    1e-21   
gb|AIU94434.1|  MADS-box transcription factor 2 isoform 2             94.0    1e-21   
sp|O65874.1|MTF1_PEA  RecName: Full=MADS-box transcription factor 1   94.0    1e-21   
gb|ADE77848.1|  unknown                                               92.4    1e-21   
gb|AAT37483.1|  MADS4 protein                                         94.0    1e-21   
gb|AHM92084.1|  MADS-box protein 8                                    94.0    1e-21   
ref|XP_006437878.1|  hypothetical protein CICLE_v10032572mg           94.0    1e-21   
ref|XP_010233642.1|  PREDICTED: MADS-box transcription factor 7-l...  94.0    1e-21   
gb|ADP09004.1|  SEP3-like protein                                     94.0    1e-21   
ref|XP_004504400.1|  PREDICTED: agamous-like MADS-box protein AGL...  93.6    1e-21   
ref|XP_004504399.1|  PREDICTED: agamous-like MADS-box protein AGL...  94.0    1e-21   
ref|NP_001105525.1|  MADS27                                           94.0    1e-21   
ref|XP_009131500.1|  PREDICTED: developmental protein SEPALLATA 1...  94.0    1e-21   
emb|CAN84110.1|  hypothetical protein VITISV_036170                   94.0    1e-21   
gb|AAF22138.1|AF129875_1  MADS box transcription factor MADS1         94.0    1e-21   
gb|AGS42241.1|  MADS-box protein                                      94.0    1e-21   
gb|EMT32696.1|  MADS-box transcription factor 5                       90.1    1e-21   
gb|AGW23350.1|  MADS box protein MADS48                               94.0    1e-21   
gb|AET04966.2|  MADS-box transcription factor                         94.0    1e-21   
ref|NP_001288311.1|  MADS-box transcription factor 7-like             94.0    1e-21   
ref|XP_011036099.1|  PREDICTED: agamous-like MADS-box protein AGL...  94.0    1e-21   
emb|CDY34718.1|  BnaA01g33070D                                        94.0    1e-21   
ref|XP_010485469.1|  PREDICTED: developmental protein SEPALLATA 2     94.0    1e-21   
dbj|BAK09620.1|  MADS-box transcription factor                        94.0    1e-21   
ref|XP_006400104.1|  hypothetical protein EUTSA_v10014493mg           94.0    1e-21   
ref|XP_006585129.1|  PREDICTED: MADS-box transcription factor 1-l...  94.0    1e-21   
ref|XP_006585130.1|  PREDICTED: MADS-box transcription factor 1-l...  94.0    1e-21   
ref|XP_003549578.1|  PREDICTED: MADS-box protein CMB1-like            94.0    1e-21   
gb|AAO42085.1|  putative floral homeotic protein AGL4                 94.0    1e-21   
ref|NP_186880.1|  developmental protein SEPALLATA 2                   94.0    1e-21   
ref|XP_009773224.1|  PREDICTED: MADS-box protein CMB1-like isofor...  94.0    1e-21   
gb|ADD10733.1|  MADS-domain transcription factor                      93.6    1e-21   
gb|AAX82498.1|  MADS box protein                                      89.7    1e-21   
gb|AJC01942.1|  MADS-box protein                                      93.6    1e-21   
dbj|BAM34478.1|  MADS-box transcription factor                        94.0    1e-21   
ref|XP_010025293.1|  PREDICTED: agamous-like MADS-box protein AGL...  94.0    1e-21   
ref|XP_006585132.1|  PREDICTED: MADS-box transcription factor 1-l...  93.6    1e-21   
gb|AHC54155.1|  sepallata-like MADS box transcription factor 3        92.4    1e-21   
ref|XP_006585131.1|  PREDICTED: MADS-box transcription factor 1-l...  93.6    1e-21   
ref|XP_007139420.1|  hypothetical protein PHAVU_008G027900g           94.0    1e-21   
ref|XP_009615089.1|  PREDICTED: MADS-box protein CMB1-like isofor...  93.6    1e-21   
ref|XP_010025292.1|  PREDICTED: agamous-like MADS-box protein AGL...  94.0    1e-21   
gb|AAU82031.1|  SEPALLATA2                                            94.0    1e-21   
gb|KHN18378.1|  MADS-box protein CMB1                                 93.6    1e-21   
ref|NP_001105153.1|  MADS6                                            93.6    1e-21   
ref|XP_009117898.1|  PREDICTED: developmental protein SEPALLATA 2     94.0    1e-21   
ref|XP_003538541.1|  PREDICTED: MADS-box transcription factor 1-l...  93.6    1e-21   
gb|KHN34832.1|  MADS-box transcription factor 1                       93.6    1e-21   
ref|XP_004504398.1|  PREDICTED: agamous-like MADS-box protein AGL...  93.6    1e-21   
gb|ADX97328.1|  SEPALLATA1-like protein                               93.6    1e-21   
gb|ACG32829.1|  SRF-type transcription factor family protein          93.6    1e-21   
ref|XP_010527982.1|  PREDICTED: agamous-like MADS-box protein AGL3    94.0    1e-21   
ref|XP_004504397.1|  PREDICTED: agamous-like MADS-box protein AGL...  93.6    2e-21   
ref|XP_010470619.1|  PREDICTED: developmental protein SEPALLATA 2...  94.0    2e-21   
ref|XP_009373783.1|  PREDICTED: developmental protein SEPALLATA 1...  93.6    2e-21   
emb|CAA75241.1|  M79 protein                                          94.0    2e-21   
gb|KHG01193.1|  Agamous-like MADS-box protein AGL6                    93.6    2e-21   
ref|XP_009373782.1|  PREDICTED: developmental protein SEPALLATA 1...  93.6    2e-21   
ref|XP_011021072.1|  PREDICTED: developmental protein SEPALLATA 2...  93.6    2e-21   
gb|ACS27539.1|  AGAMOUS-like protein 6                                93.6    2e-21   
sp|Q0J466.2|MADS7_ORYSJ  RecName: Full=MADS-box transcription fac...  94.0    2e-21   
ref|XP_006482430.1|  PREDICTED: developmental protein SEPALLATA 1...  93.6    2e-21   
gb|ACS27538.1|  AGAMOUS-like protein 6                                93.6    2e-21   
gb|ACS27540.1|  AGAMOUS-like protein 6                                93.6    2e-21   
gb|ABG78619.1|  MADS4                                                 93.6    2e-21   
gb|AHY82573.1|  MADS-box protein 6                                    93.6    2e-21   
emb|CAA04323.1|  MADS-box protein                                     93.6    2e-21   
gb|ABJ98752.1|  MADS-box transcription factor MADS-RIN                93.6    2e-21   
emb|CAB44455.1|  putative MADS domain transcription factor GGM9       94.0    2e-21   
gb|AAO45877.1|  MADS5                                                 93.6    2e-21   
gb|AAC25922.1|  MADS-box protein 1                                    93.6    2e-21   
ref|XP_006591442.1|  PREDICTED: MADS-box transcription factor 1-l...  93.6    2e-21   
ref|XP_006298399.1|  hypothetical protein CARUB_v10014470mg           93.6    2e-21   
dbj|BAM36705.1|  MADS transcriptional factor SEP3 homolog             93.6    2e-21   
emb|CDY26462.1|  BnaC09g42060D                                        94.0    2e-21   
emb|CAX65570.1|  GRCD4 protein                                        93.6    2e-21   
gb|ABD19719.1|  SEP3-like MADS-box protein                            93.6    2e-21   
ref|XP_010460481.1|  PREDICTED: developmental protein SEPALLATA 3...  93.6    2e-21   
ref|XP_010101660.1|  MADS-box protein                                 93.2    2e-21   
ref|XP_006430949.1|  hypothetical protein CICLE_v10012593mg           93.6    2e-21   
ref|XP_006484241.1|  PREDICTED: developmental protein SEPALLATA 1...  93.6    2e-21   
gb|ACS27537.1|  AGAMOUS-like protein 6                                93.6    2e-21   
ref|XP_002873742.1|  hypothetical protein ARALYDRAFT_909555           93.6    2e-21   
gb|AAU82009.1|  SEPALLATA2                                            93.6    2e-21   
ref|XP_010682729.1|  PREDICTED: agamous-like MADS-box protein AGL...  93.6    2e-21   
ref|XP_006484240.1|  PREDICTED: developmental protein SEPALLATA 1...  93.6    2e-21   
ref|NP_001280893.1|  developmental protein SEPALLATA 1                93.6    2e-21   
ref|XP_009788128.1|  PREDICTED: MADS-box protein CMB1-like            93.6    2e-21   
gb|AHH28272.1|  MADS-box transcription factor                         93.6    2e-21   
gb|ADL36747.1|  MADS domain class transcription factor                93.2    2e-21   
ref|XP_004502275.1|  PREDICTED: MADS-box transcription factor 1-l...  93.6    2e-21   
ref|NP_001289810.1|  MADS-box transcription factor 6                  94.0    2e-21   
gb|AHH28266.1|  MADS-box transcription factor                         93.6    2e-21   
emb|CAD48302.1|  MADS-box protein AGL3-a                              93.6    2e-21   
gb|ABF57929.1|  MADS-box transcription factor TaAGL28                 93.6    2e-21   
gb|ABD60322.1|  SEP2                                                  93.6    2e-21   
ref|XP_002306051.2|  hypothetical protein POPTR_0004s11440g           93.6    2e-21   
gb|AFW15784.1|  Agl6                                                  93.6    2e-21   
gb|AAB58907.1|  MADS-box protein                                      93.6    2e-21   
emb|CDY04164.1|  BnaA09g19420D                                        93.6    2e-21   
gb|KEH25149.1|  MADS-box transcription factor                         93.6    2e-21   
ref|NP_850953.1|  MADs box transcription factor SEPALLATA3            93.6    2e-21   
ref|XP_004490239.1|  PREDICTED: MADS-box protein CMB1-like isofor...  93.2    2e-21   



>gb|ADU56819.1| MADS-box protein AGL2 subfamily [Coffea arabica]
Length=108

 Score = 97.8 bits (242),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_007153483.1| hypothetical protein PHAVU_003G039400g [Phaseolus vulgaris]
 gb|ESW25477.1| hypothetical protein PHAVU_003G039400g [Phaseolus vulgaris]
Length=86

 Score = 97.1 bits (240),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AHC54186.1| sepallata-like MADS box transcription factor 3, partial [Indianthus 
virgatus]
Length=139

 Score = 98.6 bits (244),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  3    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  50



>ref|XP_004170688.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog, partial 
[Cucumis sativus]
 gb|KDO72290.1| hypothetical protein CISIN_1g0261432mg, partial [Citrus sinensis]
Length=61

 Score = 96.3 bits (238),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AHC54151.1| sepallata-like MADS box transcription factor 3, partial [Donax 
grandis]
Length=151

 Score = 99.0 bits (245),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  4    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  51



>ref|XP_009622386.1| PREDICTED: MADS-box protein CMB1-like [Nicotiana tomentosiformis]
Length=109

 Score = 97.8 bits (242),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|EYU33467.1| hypothetical protein MIMGU_mgv1a0126181mg, partial [Erythranthe 
guttata]
 gb|EYU33469.1| hypothetical protein MIMGU_mgv1a0126181mg, partial [Erythranthe 
guttata]
 gb|EYU33470.1| hypothetical protein MIMGU_mgv1a0126181mg, partial [Erythranthe 
guttata]
Length=89

 Score = 97.1 bits (240),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|EPS57613.1| hypothetical protein M569_17204 [Genlisea aurea]
Length=67

 Score = 96.3 bits (238),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|EYU33468.1| hypothetical protein MIMGU_mgv1a0126181mg, partial [Erythranthe 
guttata]
Length=88

 Score = 96.7 bits (239),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|KDO65669.1| hypothetical protein CISIN_1g0246401mg, partial [Citrus sinensis]
Length=61

 Score = 95.9 bits (237),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_006385889.1| hypothetical protein POPTR_0003s16800g [Populus trichocarpa]
 gb|ERP63686.1| hypothetical protein POPTR_0003s16800g [Populus trichocarpa]
Length=89

 Score = 96.7 bits (239),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAE+ALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEIALIIFSNRGKLY  55



>ref|XP_007158666.1| hypothetical protein PHAVU_002G1723001g, partial [Phaseolus vulgaris]
 gb|ESW30660.1| hypothetical protein PHAVU_002G1723001g, partial [Phaseolus vulgaris]
Length=146

 Score = 98.2 bits (243),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_007158665.1| hypothetical protein PHAVU_002G1723001g, partial [Phaseolus vulgaris]
 gb|ESW30659.1| hypothetical protein PHAVU_002G1723001g, partial [Phaseolus vulgaris]
Length=144

 Score = 98.2 bits (243),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|EMT30881.1| MADS-box transcription factor 7 [Aegilops tauschii]
Length=101

 Score = 97.1 bits (240),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLY  55



>gb|AHC54157.1| sepallata-like MADS box transcription factor 3, partial [Globba 
laeta]
Length=168

 Score = 98.6 bits (244),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  1    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  48



>gb|AAQ72506.1| MADS-box protein 12 [Petunia x hybrida]
Length=62

 Score = 95.5 bits (236),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENK+NRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKVNRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AHC54178.1| sepallata-like MADS box transcription factor 3, partial [Orchidantha 
siamensis]
Length=168

 Score = 98.6 bits (244),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  1    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  48



>gb|AHC54171.1| sepallata-like MADS box transcription factor 3, partial [Musa 
acuminata]
Length=168

 Score = 98.2 bits (243),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  1    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  48



>gb|AHC54190.1| sepallata-like MADS box transcription factor 3, partial [Zingiber 
officinale]
Length=168

 Score = 98.2 bits (243),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLY
Sbjct  1    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLY  48



>gb|AHH28273.1| MADS-box transcription factor, partial [Rafflesia cantleyi]
Length=155

 Score = 97.8 bits (242),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  7    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  54



>gb|AHC54144.1| sepallata-like MADS box transcription factor 3, partial [Costus 
spicatus]
Length=175

 Score = 98.2 bits (243),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|ADU56818.1| MADS-box protein AGL2 subfamily [Coffea arabica]
Length=170

 Score = 98.2 bits (243),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AHC54191.1| sepallata-like MADS box transcription factor 3, partial [Zingiber 
officinale]
Length=168

 Score = 98.2 bits (243),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLY
Sbjct  1    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLY  48



>emb|CAE46179.1| AGL2-like MADS box transcription factor [Elaeis guineensis]
Length=207

 Score = 99.0 bits (245),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|EMS66516.1| MADS-box transcription factor 8 [Triticum urartu]
Length=112

 Score = 96.3 bits (238),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AGT80607.1| AGL6-like MADS-box protein, partial [Zamia fischeri]
Length=185

 Score = 98.2 bits (243),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALI+FSNRGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLY  55



>gb|KDO70302.1| hypothetical protein CISIN_1g0260431mg, partial [Citrus sinensis]
Length=61

 Score = 94.7 bits (234),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  55



>gb|AHC54188.1| sepallata-like MADS box transcription factor 3, partial [Strelitzia 
sp. RY-2013]
Length=167

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/47 (100%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +2

Query  47   KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  1    KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  47



>ref|XP_010532442.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X2 
[Tarenaya hassleriana]
Length=178

 Score = 97.8 bits (242),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010532441.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X1 
[Tarenaya hassleriana]
Length=179

 Score = 97.8 bits (242),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|KDP31378.1| hypothetical protein JCGZ_11754 [Jatropha curcas]
Length=191

 Score = 98.2 bits (243),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010257958.1| PREDICTED: developmental protein SEPALLATA 1 [Nelumbo nucifera]
Length=243

 Score = 99.0 bits (245),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AHC54147.1| sepallata-like MADS box transcription factor 3, partial [Costus 
spicatus]
 gb|AHC54187.1| sepallata-like MADS box transcription factor 3, partial [Strelitzia 
sp. RY-2013]
Length=167

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/47 (100%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +2

Query  47   KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  1    KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  47



>ref|XP_007155209.1| hypothetical protein PHAVU_003G182800g [Phaseolus vulgaris]
 gb|ESW27203.1| hypothetical protein PHAVU_003G182800g [Phaseolus vulgaris]
Length=243

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_009773225.1| PREDICTED: MADS-box protein CMB1-like isoform X3 [Nicotiana sylvestris]
Length=173

 Score = 97.4 bits (241),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLY  55



>gb|KDP24297.1| hypothetical protein JCGZ_25593 [Jatropha curcas]
Length=243

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|KCW86946.1| hypothetical protein EUGRSUZ_B03516 [Eucalyptus grandis]
Length=95

 Score = 95.5 bits (236),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSHRGKLY  55



>ref|NP_001242742.1| uncharacterized protein LOC100805078 [Glycine max]
 gb|ACU17977.1| unknown [Glycine max]
Length=226

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|KHG17252.1| Developmental SEPALLATA 2 -like protein [Gossypium arboreum]
Length=244

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010681125.1| PREDICTED: MADS-box protein CMB1-like [Beta vulgaris subsp. vulgaris]
Length=243

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_004154725.1| PREDICTED: developmental protein SEPALLATA 2-like [Cucumis sativus]
Length=246

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AEJ76841.1| MADS17 [Gossypium hirsutum]
Length=244

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|NP_001267667.1| developmental protein SEPALLATA 2-like [Cucumis sativus]
 gb|AAF23363.1|AF135962_1 CAGL2 [Cucumis sativus]
Length=246

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AAB50187.1| MADS box transcription factor SbMADS1 [Sorghum bicolor]
Length=231

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_011086825.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Sesamum 
indicum]
Length=242

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_002263410.2| PREDICTED: MADS-box protein CMB1 [Vitis vinifera]
 emb|CBI27319.3| unnamed protein product [Vitis vinifera]
Length=243

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>tpg|DAA40488.2| TPA: LOW QUALITY PROTEIN: zea mays MADS7, partial [Zea mays]
Length=233

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  97   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  144



>gb|AAN15182.1| MADS box protein GHMADS-1 [Gossypium hirsutum]
Length=236

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_007032865.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
 gb|EOY03791.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
Length=243

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_003518786.1| PREDICTED: developmental protein SEPALLATA 1-like [Glycine max]
 gb|KHN29958.1| MADS-box protein CMB1 [Glycine soja]
Length=244

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_007043949.1| K-box region and MADS-box transcription factor family protein 
isoform 3 [Theobroma cacao]
 gb|EOX99780.1| K-box region and MADS-box transcription factor family protein 
isoform 3 [Theobroma cacao]
Length=247

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|KDP41334.1| hypothetical protein JCGZ_15741 [Jatropha curcas]
Length=227

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_007043947.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
 gb|EOX99778.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
Length=242

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AGW23364.1| MADS box protein MADS62 [Gossypium hirsutum]
Length=244

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>dbj|BAO74164.1| MADS-box transcription factor SEP3.2 [Torenia fournieri]
Length=253

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>dbj|BAG55316.1| transcription factor [Petunia integrifolia subsp. inflata]
 dbj|BAG55317.1| transcription factor [Petunia integrifolia subsp. inflata]
Length=240

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AAL08423.2|AF185574_1 transcription factor MAGL4 [Populus tremuloides]
Length=245

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AEL33631.1| SEPALLATA1 [Gossypium hirsutum]
Length=245

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|EPS70807.1| hypothetical protein M569_03954 [Genlisea aurea]
Length=256

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|ADF49576.1| transcription factor MADS-box 2 [Fragaria chiloensis]
Length=242

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|KCW48935.1| hypothetical protein EUGRSUZ_K02546 [Eucalyptus grandis]
Length=245

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>dbj|BAJ11578.1| transcription factor [Pyrus pyrifolia var. culta]
Length=235

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  5    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  52



>ref|NP_001280756.1| agamous-like MADS-box protein AGL9 homolog [Malus domestica]
 ref|XP_008389896.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Malus 
domestica]
 ref|XP_008350960.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Malus 
domestica]
 gb|ADL36740.1| MADS domain class transcription factor [Malus domestica]
Length=239

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|NP_001289232.1| agamous-like MADS-box protein AGL9 homolog [Pyrus x bretschneideri]
 ref|XP_009343139.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Pyrus 
x bretschneideri]
 ref|XP_009343141.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Pyrus 
x bretschneideri]
 dbj|BAF44101.1| transcription factor MADS [Pyrus x bretschneideri]
 dbj|BAM71398.1| transcription factor [Pyrus pyrifolia]
Length=239

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010558530.1| PREDICTED: developmental protein SEPALLATA 1 [Tarenaya hassleriana]
 gb|ABD96896.1| hypothetical protein [Cleome spinosa]
Length=248

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010460480.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X1 
[Camelina sativa]
Length=256

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>emb|CAN77787.1| hypothetical protein VITISV_023233 [Vitis vinifera]
Length=116

 Score = 95.1 bits (235),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS+RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSSRGKLY  55



>dbj|BAO74162.1| MADS-box transcription factor SEP1.2 [Torenia fournieri]
Length=252

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_009372256.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Pyrus x bretschneideri]
Length=250

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010653929.1| PREDICTED: MADS-box protein 4 isoform X1 [Vitis vinifera]
Length=258

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010460482.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X3 
[Camelina sativa]
Length=255

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AAQ72498.1| MADS-box protein 12 [Petunia x hybrida]
Length=246

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AGC10825.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10826.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10827.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10828.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10829.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10830.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10831.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10832.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10833.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10834.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10835.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10836.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10837.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10838.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10839.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10840.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10841.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10842.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10843.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10844.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10845.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10846.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10847.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10848.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10849.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10850.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10851.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10852.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10853.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10854.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10855.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10856.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10857.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10858.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10859.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10860.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10861.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10862.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10863.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10864.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10865.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10866.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10867.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10868.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10869.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10870.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10871.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10872.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10873.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10874.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10875.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10876.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10877.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10878.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10879.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10880.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10881.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10882.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10883.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10884.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10885.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10886.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10887.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10888.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10889.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10890.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10891.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10892.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10893.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10894.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10895.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10896.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10897.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10898.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10899.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10900.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10901.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10902.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10903.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10904.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10905.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10906.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10907.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10908.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10909.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10910.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10911.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10912.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10913.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10914.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10915.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10916.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10917.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10918.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10919.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10920.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10921.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10922.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10923.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10924.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10925.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10926.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10927.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10928.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10929.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10930.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10931.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10932.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10933.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10934.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10935.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10936.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10937.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10938.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10939.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10940.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10941.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10942.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10943.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10944.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10945.1| MADS-box transcription factor [Larix sibirica]
 gb|AGC10946.1| MADS-box transcription factor [Larix occidentalis]
 gb|AGC10947.1| MADS-box transcription factor [Larix occidentalis]
 gb|AGC10948.1| MADS-box transcription factor [Larix occidentalis]
 gb|AGC10949.1| MADS-box transcription factor [Larix occidentalis]
 gb|AGC10950.1| MADS-box transcription factor [Larix occidentalis]
 gb|AGC10951.1| MADS-box transcription factor [Larix occidentalis]
 gb|AGC10952.1| MADS-box transcription factor [Larix occidentalis]
 gb|AGC10953.1| MADS-box transcription factor [Larix occidentalis]
 gb|AGC10954.1| MADS-box transcription factor [Larix occidentalis]
 gb|AGC10955.1| MADS-box transcription factor [Larix occidentalis]
 gb|AGC10956.1| MADS-box transcription factor [Larix occidentalis]
 gb|AGC10957.1| MADS-box transcription factor [Larix occidentalis]
 gb|AGC10958.1| MADS-box transcription factor [Larix occidentalis]
 gb|AGC10959.1| MADS-box transcription factor [Larix occidentalis]
 gb|AGC10960.1| MADS-box transcription factor [Larix occidentalis]
 gb|AGC10961.1| MADS-box transcription factor [Larix occidentalis]
Length=64

 Score = 93.6 bits (231),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  55



>ref|XP_007043948.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 gb|EOX99779.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
Length=258

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010460483.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X4 
[Camelina sativa]
Length=254

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|ABD65406.1| MADS-box protein [Diospyros kaki]
Length=249

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|NP_973411.1| protein SEPALLATA 4 [Arabidopsis thaliana]
 gb|AAN52793.1| MADS-box protein AGL3-II [Arabidopsis thaliana]
 gb|AEC05740.1| agamous-like MADS-box protein AGL3 [Arabidopsis thaliana]
Length=187

 Score = 97.1 bits (240),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAE+AL+IFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEIALLIFSNRGKLY  55



>gb|AFX72878.1| MADS-box protein SEP2B [Aquilegia coerulea]
Length=85

 Score = 94.4 bits (233),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLY  55



>gb|ACH61565.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61566.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61567.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61568.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61569.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61570.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61571.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61572.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61573.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61574.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61575.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61576.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61577.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61578.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61579.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61580.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61581.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61582.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61583.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61584.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61585.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61586.1| truncated MADS-box transcription factor [Pseudotsuga menziesii]
 gb|ACH61587.1| truncated MADS-box transcription factor [Pseudotsuga macrocarpa]
Length=68

 Score = 93.6 bits (231),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  12   LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  59



>ref|XP_008230289.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Prunus mume]
Length=246

 Score = 97.8 bits (242),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLY  55



>ref|XP_008230291.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X3 
[Prunus mume]
Length=245

 Score = 97.8 bits (242),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLY  55



>gb|AEW50208.1| SEP1 [Acca sellowiana]
Length=245

 Score = 97.8 bits (242),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLY  55



>ref|XP_006440805.1| hypothetical protein CICLE_v10021357mg [Citrus clementina]
 gb|ESR54045.1| hypothetical protein CICLE_v10021357mg [Citrus clementina]
Length=253

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  59   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  106



>ref|XP_007215877.1| hypothetical protein PRUPE_ppa010548mg [Prunus persica]
 gb|ABO27622.1| transcription factor MADS7 [Prunus persica]
 gb|EMJ17076.1| hypothetical protein PRUPE_ppa010548mg [Prunus persica]
Length=245

 Score = 97.8 bits (242),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLY  55



>gb|AAY30858.1| MADS-box transcription factor [Prunus dulcis]
Length=246

 Score = 97.8 bits (242),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLY  55



>gb|AAC78282.1| MADS box protein [Eucalyptus grandis]
Length=183

 Score = 96.7 bits (239),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV LIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVGLIIFSNRGKLY  55



>ref|XP_008230292.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X4 
[Prunus mume]
Length=244

 Score = 97.8 bits (242),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLY  55



>ref|XP_008230290.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Prunus mume]
Length=245

 Score = 97.8 bits (242),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLY  55



>gb|AFM30904.1| transcription factor MADS4 [Prunus avium]
Length=244

 Score = 97.8 bits (242),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLY  55



>ref|XP_006477712.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Citrus sinensis]
Length=265

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_007215876.1| hypothetical protein PRUPE_ppa010548mg [Prunus persica]
 gb|EMJ17075.1| hypothetical protein PRUPE_ppa010548mg [Prunus persica]
Length=244

 Score = 97.8 bits (242),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLY  55



>ref|XP_006477711.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Citrus sinensis]
Length=266

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|NP_568322.1| MADS box transcription factor SEPALLATA 1 [Arabidopsis thaliana]
 sp|P29382.2|SEP1_ARATH RecName: Full=Developmental protein SEPALLATA 1; AltName: Full=Agamous-like 
MADS-box protein AGL2 [Arabidopsis thaliana]
 dbj|BAC43207.1| putative transcription factor AGL2 [Arabidopsis thaliana]
 gb|AAP12873.1| At5g15800 [Arabidopsis thaliana]
 gb|AAU81986.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81988.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82003.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AED92207.1| MADS box transcription factor SEPALLATA 1 [Arabidopsis thaliana]
Length=251

 Score = 97.8 bits (242),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>tpg|DAA40489.1| TPA: zea mays MADS7 [Zea mays]
 gb|AIB05828.1| MADS transcription factor, partial [Zea mays]
Length=332

 Score = 98.6 bits (244),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  97   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  144



>gb|AHC54175.1| sepallata-like MADS box transcription factor 3, partial [Orchidantha 
siamensis]
Length=168

 Score = 96.3 bits (238),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIEN INRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLY
Sbjct  1    LKRIENXINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLY  48



>gb|ACU18427.1| unknown [Glycine max]
Length=141

 Score = 95.1 bits (235),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  55



>ref|XP_004174115.1| PREDICTED: MADS-box transcription factor 6-like, partial [Cucumis 
sativus]
Length=86

 Score = 93.6 bits (231),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLY  55



>gb|ACU18363.1| unknown [Glycine max]
Length=162

 Score = 95.9 bits (237),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  55



>gb|AHC54174.1| sepallata-like MADS box transcription factor 3, partial [Orchidantha 
siamensis]
Length=168

 Score = 95.9 bits (237),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKR ENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLY
Sbjct  1    LKRXENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLY  48



>gb|AAP83411.1| SEPALLATA1-like MADS-box [Syringa vulgaris]
Length=207

 Score = 96.7 bits (239),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            L+R+ENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  5    LRRMENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  52



>emb|CAE53896.1| putative MADS-box transcription factor [Triticum aestivum]
Length=141

 Score = 95.1 bits (235),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  55



>gb|KFK37664.1| hypothetical protein AALP_AA3G012500 [Arabis alpina]
Length=146

 Score = 95.1 bits (235),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LI+FSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLY  55



>ref|NP_001119230.1| MADS box transcription factor SEPALLATA 1 [Arabidopsis thaliana]
 emb|CAC01779.1| MADS box protein AGL2 [Arabidopsis thaliana]
 gb|AED92208.1| MADS box transcription factor SEPALLATA 1 [Arabidopsis thaliana]
Length=262

 Score = 97.4 bits (241),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AAX15924.1| AGL9.2 [Persea americana]
Length=242

 Score = 97.1 bits (240),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AAF77579.1|AF072534_1 pepper MADS-box protein [Capsicum annuum]
Length=175

 Score = 95.9 bits (237),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRI+NKINRQVTFAKRRNGLLKKAYELSVLCDAE+ALIIFS+RGKLY
Sbjct  8    LKRIDNKINRQVTFAKRRNGLLKKAYELSVLCDAEIALIIFSSRGKLY  55



>ref|XP_008801850.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Phoenix dactylifera]
Length=271

 Score = 97.4 bits (241),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_003614241.1| MADS box transcription factor [Medicago truncatula]
Length=76

 Score = 93.2 bits (230),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNG+LKKAYELS+LCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGMLKKAYELSLLCDAEVALIIFSSRGKLY  55



>ref|XP_007037631.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
 gb|EOY22132.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
Length=407

 Score = 98.6 bits (244),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLY  55



>gb|ABI60898.1| MADS-box transcription factor [Arachis hypogaea]
Length=243

 Score = 97.1 bits (240),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010523499.1| PREDICTED: agamous-like MADS-box protein AGL3 [Tarenaya hassleriana]
Length=222

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKA+ELSVLCDAE+ALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAFELSVLCDAEIALIIFSNRGKLY  55



>gb|AES97199.2| MADS-box transcription factor family protein [Medicago truncatula]
Length=114

 Score = 94.0 bits (232),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNG+LKKAYELS+LCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGMLKKAYELSLLCDAEVALIIFSSRGKLY  55



>ref|XP_007151388.1| hypothetical protein PHAVU_004G042300g [Phaseolus vulgaris]
 gb|ESW23382.1| hypothetical protein PHAVU_004G042300g [Phaseolus vulgaris]
Length=217

 Score = 96.3 bits (238),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLY  55



>gb|AAZ77748.1| AGL2-like MADS box 3 [Castanea mollissima]
Length=243

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            +KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    VKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>emb|CAN59955.1| hypothetical protein VITISV_006723 [Vitis vinifera]
Length=244

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLY  55



>gb|AAY21913.2| putative MADS box protein [Musa acuminata]
Length=244

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLY  55



>gb|AAX15920.1| AGL9 [Liriodendron tulipifera]
Length=242

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>emb|CAL36576.1| deficiens H49 homologue [Misopates orontium]
Length=247

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>emb|CAA64741.1| DEFH49 [Antirrhinum majus]
Length=247

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AHC54189.1| sepallata-like MADS box transcription factor 3, partial [Tapeinochilos 
solomonensis]
Length=167

 Score = 95.1 bits (235),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  47   KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            KRIENKINRQV FAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  1    KRIENKINRQVXFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  47



>gb|AHM92085.1| MADS-box protein 9 [Erycina pusilla]
Length=250

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLY  55



>ref|XP_004137606.1| PREDICTED: MADS-box transcription factor 8-like, partial [Cucumis 
sativus]
Length=189

 Score = 95.5 bits (236),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAE+ALIIFSNRGKL+
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAELALIIFSNRGKLF  55



>gb|ABF67487.1| MADS-domain transcription factor [Impatiens hawkeri]
Length=244

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|ACU13166.1| unknown [Glycine max]
Length=220

 Score = 96.3 bits (238),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLY  55



>ref|XP_006477714.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X4 
[Citrus sinensis]
Length=249

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_006477713.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X3 
[Citrus sinensis]
Length=250

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_003621519.1| MADS-box protein [Medicago truncatula]
Length=245

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLY  55



>gb|AES77737.2| MADS-box transcription factor [Medicago truncatula]
Length=249

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLY  55



>gb|ADC79703.1| SEPALLATA3-like protein [Pachysandra terminalis]
Length=243

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|ACJ83943.1| unknown [Medicago truncatula]
Length=196

 Score = 95.5 bits (236),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>emb|CAH04878.1| MADS domain protein [Gerbera hybrid cultivar]
Length=247

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKL+
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLF  55



>gb|AFU81295.1| SEPALLATA1 [Medicago polyceratia]
Length=249

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLY  55



>ref|XP_003544012.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Glycine max]
Length=248

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLY  55



>gb|AAO22982.1| MADS-box transcription factor CDM44 [Chrysanthemum x morifolium]
Length=249

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AFX72877.1| MADS-box protein SEP2A [Aquilegia coerulea]
Length=243

 Score = 96.3 bits (238),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLY  55



>gb|AHC54137.1| sepallata-like MADS box transcription factor 3, partial [Orchidantha 
siamensis]
Length=166

 Score = 94.7 bits (234),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVA+IIFS+RGKLY
Sbjct  1    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVAVIIFSSRGKLY  48



>gb|AHC54115.1| sepallata-like MADS box transcription factor 3, partial [Costus 
spicatus]
Length=171

 Score = 95.1 bits (235),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVA+I+FS+RGKLY
Sbjct  1    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVAVIVFSSRGKLY  48



>gb|ABD17386.1| MADS-box protein SEP3-1 [Taihangia rupestris]
Length=325

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_008801851.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Phoenix dactylifera]
Length=263

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AFS60087.1| MADS box transcription factor SEP2 [Paphiopedilum concolor]
Length=208

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRG+L+
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLF  55



>ref|XP_007045799.1| MADS-box transcription factor [Theobroma cacao]
 gb|EOY01631.1| MADS-box transcription factor [Theobroma cacao]
Length=240

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLY  55



>gb|AHC54135.1| sepallata-like MADS box transcription factor 3, partial [Musa 
velutina]
Length=169

 Score = 94.7 bits (234),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVA+I+FS+RGKLY
Sbjct  1    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVAVIVFSSRGKLY  48



>gb|AFK42306.1| unknown [Medicago truncatula]
Length=250

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINR+VTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRRVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AEJ76844.1| MADS20 [Gossypium hirsutum]
Length=244

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLY  55



>gb|KHF99411.1| Agamous-like MADS-box protein AGL6 [Gossypium arboreum]
Length=247

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010319477.1| PREDICTED: MADS-box protein CMB1 isoform X2 [Solanum lycopersicum]
Length=218

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LC+AEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCEAEVALIIFSNRGKLY  55



>sp|Q42464.1|AGL9_SOLLC RecName: Full=Agamous-like MADS-box protein AGL9 homolog; AltName: 
Full=TM5 [Solanum lycopersicum]
 emb|CAA43010.1| TDR5 [Solanum lycopersicum]
 emb|CAA43170.1| TDR5 [Solanum lycopersicum]
Length=224

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIE KINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIEGKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|KHG10874.1| Agamous-like MADS-box protein AGL6 [Gossypium arboreum]
Length=189

 Score = 95.1 bits (235),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  55



>gb|AHC54130.1| sepallata-like MADS box transcription factor 3, partial [Marantochloa 
leucantha]
Length=171

 Score = 94.7 bits (234),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVA+I+FS+RGKLY
Sbjct  1    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVAVIVFSSRGKLY  48



>gb|AEJ76842.1| MADS18 [Gossypium hirsutum]
Length=249

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLY  55



>gb|AIC33052.1| flower development transporter SEP3 [Chrysanthemum lavandulifolium]
Length=250

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLY  55



>gb|AIE44768.1| putative MADS-domain transcription factor AGL6.2, partial [Nuphar 
advena]
Length=227

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  1    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  48



>ref|NP_001289804.1| MADS-box transcription factor 8 [Brachypodium distachyon]
 gb|ADQ92358.1| MADS-box [Brachypodium distachyon]
Length=247

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010091612.1| MADS-box protein [Morus notabilis]
 gb|EXB44878.1| MADS-box protein [Morus notabilis]
Length=268

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV LIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVGLIIFSNRGKLY  55



>emb|CDY15724.1| BnaA07g08950D [Brassica napus]
Length=252

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|EMS63701.1| MADS-box transcription factor 6 [Triticum urartu]
Length=199

 Score = 95.1 bits (235),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  55



>gb|AHC54154.1| sepallata-like MADS box transcription factor 3, partial [Elettariopsis 
smithiae]
Length=167

 Score = 94.4 bits (233),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  47   KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALII SNRGKLY
Sbjct  1    KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIXSNRGKLY  47



>gb|EPS71714.1| hypothetical protein M569_03044, partial [Genlisea aurea]
Length=172

 Score = 94.4 bits (233),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LK+IENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  8    LKKIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  55



>emb|CAX65571.1| GRCD5 protein [Gerbera hybrid cultivar]
Length=252

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_008459849.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Cucumis melo]
Length=228

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|ABC73603.1| AGL6-like MADS-box transcription factor [Elaeis guineensis]
Length=163

 Score = 94.4 bits (233),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELS+LCDAEVALIIFS RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSILCDAEVALIIFSGRGKLY  55



>ref|XP_010250667.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Nelumbo 
nucifera]
Length=239

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010499201.1| PREDICTED: developmental protein SEPALLATA 3 isoform X6 [Camelina 
sativa]
Length=237

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010499200.1| PREDICTED: developmental protein SEPALLATA 3 isoform X5 [Camelina 
sativa]
Length=237

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_004153375.1| PREDICTED: MADS-box transcription factor 6-like [Cucumis sativus]
Length=172

 Score = 94.4 bits (233),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLY  55



>dbj|BAD38890.1| MADS box transcription factor [Gentiana triflora]
Length=244

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|ABK23248.1| unknown [Picea sitchensis]
Length=136

 Score = 93.6 bits (231),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  55



>ref|XP_003630490.1| MADS-box transcription factor [Medicago truncatula]
Length=330

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AGH61294.1| sepallata 3 [Paeonia lactiflora]
Length=243

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AAZ20812.1| MADS1 [Castanea mollissima]
Length=211

 Score = 95.1 bits (235),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            +KRIENKINRQVTFAKRRNG LKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    VKRIENKINRQVTFAKRRNGFLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AAF13260.1|AF198174_1 MADS box protein DOMADS1 [Dendrobium grex Madame Thong-In]
 gb|AAD20816.1| MADS-box transcription factor [Dendrobium grex Madame Thong-In]
Length=174

 Score = 94.4 bits (233),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            +KRIENKINRQVTFAKRR GLLKKAYELSVLCD EVALIIFSNRGKLY
Sbjct  8    MKRIENKINRQVTFAKRRTGLLKKAYELSVLCDVEVALIIFSNRGKLY  55



>ref|XP_008677797.1| PREDICTED: MADS box protein isoform X1 [Zea mays]
Length=274

 Score = 96.3 bits (238),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/48 (96%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSGRGKLY  55



>ref|XP_008801852.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X3 [Phoenix dactylifera]
Length=242

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AEE60891.1| MADS-box protein 5 [Paeonia suffruticosa]
Length=243

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|ACA24482.1| agamous-like 9 protein 2 [Glycine max]
Length=242

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGK Y
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKQY  55



>gb|AAT37486.1| MADS7 protein [Dendrocalamus latiflorus]
Length=246

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AHC54165.1| sepallata-like MADS box transcription factor 3, partial [Heliconia 
wagneriana]
Length=168

 Score = 94.4 bits (233),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKR ENKINRQVTF KRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  1    LKRXENKINRQVTFXKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  48



>emb|CAA64743.1| DEFH200 [Antirrhinum majus]
Length=242

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_011099041.1| PREDICTED: developmental protein SEPALLATA 1 isoform X2 [Sesamum 
indicum]
Length=246

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_011099040.1| PREDICTED: developmental protein SEPALLATA 1 isoform X1 [Sesamum 
indicum]
Length=247

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AEL33632.1| SEPALLATA2 [Gossypium hirsutum]
Length=244

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLY  55



>ref|XP_008783531.1| PREDICTED: MADS-box transcription factor 6-like [Phoenix dactylifera]
Length=242

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  55



>gb|AAX15918.1| AGL9 [Eschscholzia californica]
Length=241

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010913017.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Elaeis guineensis]
 gb|AAQ03226.1|AF411845_1 MADS box transcription factor [Elaeis guineensis]
Length=242

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLY  55



>gb|AET98846.1| SEPALLATA1 [Passiflora edulis]
Length=242

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTRGKLY  55



>gb|AAZ95252.1| MADS box protein SEP1 [Dendrobium crumenatum]
Length=243

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLY  55



>ref|XP_009102995.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Brassica rapa]
Length=252

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010919412.1| PREDICTED: MADS-box transcription factor 6-like [Elaeis guineensis]
Length=93

 Score = 92.0 bits (227),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRR+GLLKKAYELSVLCDAE+ALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRSGLLKKAYELSVLCDAEIALIIFSSRGKLY  55



>gb|AEJ76840.1| MADS16 [Gossypium hirsutum]
 gb|KHG22181.1| Agamous-like MADS-box protein AGL9 [Gossypium arboreum]
Length=243

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_003552609.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Glycine max]
Length=254

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_006602962.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Glycine max]
 gb|KHN37943.1| Developmental protein SEPALLATA 2 [Glycine soja]
Length=255

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010694134.1| PREDICTED: developmental protein SEPALLATA 1 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=250

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010694125.1| PREDICTED: developmental protein SEPALLATA 1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=251

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AAT37484.1| MADS5 protein [Dendrocalamus latiflorus]
Length=246

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AAT37485.1| MADS6 protein [Dendrocalamus latiflorus]
Length=246

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010694117.1| PREDICTED: developmental protein SEPALLATA 1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=252

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AEF59025.1| MADS-1 [Fragaria x ananassa]
Length=249

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLY  55



>ref|XP_010917558.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Elaeis 
guineensis]
 gb|AAQ03224.1|AF411843_1 MADS box transcription factor [Elaeis guineensis]
Length=242

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|ABD62860.1| SEP3.2 [Persea borbonia]
Length=225

 Score = 95.1 bits (235),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/47 (100%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +2

Query  47   KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  1    KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  47



>gb|AEL33633.1| SEPALLATA3 [Gossypium hirsutum]
Length=243

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_004304204.1| PREDICTED: developmental protein SEPALLATA 2-like [Fragaria vesca 
subsp. vesca]
 gb|AAO49380.1| MADS-RIN-like protein [Fragaria x ananassa]
Length=249

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLY  55



>ref|XP_009608617.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X3 
[Nicotiana tomentosiformis]
Length=241

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALI+FSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIVFSNRGKLY  55



>gb|AAP83382.1| AGL6-like MADS-box [Magnolia figo]
Length=206

 Score = 94.7 bits (234),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKR+ENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  3    LKRMENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  50



>ref|XP_011034912.1| PREDICTED: MADS-box transcription factor 6 isoform X2 [Populus 
euphratica]
Length=244

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  55



>ref|XP_009608616.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Nicotiana tomentosiformis]
Length=245

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALI+FSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIVFSNRGKLY  55



>gb|AAQ11687.1| MADS box protein [Triticum aestivum]
Length=252

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_004145053.1| PREDICTED: MADS-box transcription factor 6-like [Cucumis sativus]
Length=187

 Score = 94.4 bits (233),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLY  55



>ref|XP_009608615.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Nicotiana tomentosiformis]
Length=246

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALI+FSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIVFSNRGKLY  55



>gb|AHC54138.1| sepallata-like MADS box transcription factor 3, partial [Orchidantha 
siamensis]
Length=171

 Score = 94.0 bits (232),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCD+EVA+I+FS+RGKLY
Sbjct  1    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDSEVAVIVFSSRGKLY  48



>dbj|BAD10945.1| SEPALLATA3 homologous protein [Silene latifolia]
Length=244

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|ABK41485.1| putative MADS box protein [Elaeis guineensis]
Length=242

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_008240082.1| PREDICTED: MADS-box protein CMB1-like [Prunus mume]
Length=251

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  55



>ref|XP_009102994.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Brassica rapa]
Length=253

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AAL14197.1| SEPELLATA3-like MADS-box protein [Cleisostoma racemiferum]
Length=164

 Score = 93.6 bits (231),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/45 (100%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +2

Query  53   IENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            IENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  1    IENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  45



>gb|AAV84087.1| MADS box transcription factor, partial [Pharus virescens]
Length=185

 Score = 94.4 bits (233),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            ++RIENKINRQVTFA RRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  2    MRRIENKINRQVTFAMRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  49



>ref|XP_004166872.1| PREDICTED: MADS-box protein CMB1-like, partial [Cucumis sativus]
Length=88

 Score = 91.7 bits (226),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LK+IENKINRQVTF KRRNGLLKKAYELS+LCDAEVALIIFS RGKLY
Sbjct  8    LKKIENKINRQVTFTKRRNGLLKKAYELSILCDAEVALIIFSARGKLY  55



>ref|XP_010549963.1| PREDICTED: developmental protein SEPALLATA 1 [Tarenaya hassleriana]
 gb|ABD96852.1| hypothetical protein [Cleome spinosa]
Length=248

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AAT37482.1| MADS3 protein [Dendrocalamus latiflorus]
Length=246

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|AHM92068.1| MADS-box protein 8 [Phyllostachys edulis]
Length=247

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLY  55



>gb|AHC54140.1| sepallata-like MADS box transcription factor 3, partial [Strelitzia 
sp. RY-2013]
Length=171

 Score = 94.0 bits (232),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCD+EVA+I+FS+RGKLY
Sbjct  1    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDSEVAVIVFSSRGKLY  48



>gb|AAK21247.1|AF335234_1 MADS-box transcription factor FBP4 [Petunia x hybrida]
Length=240

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|EMS49687.1| MADS-box transcription factor 7 [Triticum urartu]
Length=248

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLY  55



>ref|XP_009372255.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Pyrus x bretschneideri]
Length=264

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|ADC79704.1| SEPALLATA3-like protein [Pachysandra terminalis]
Length=244

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLY  55



>gb|AHC54133.1| sepallata-like MADS box transcription factor 3, partial [Musa 
acuminata]
Length=171

 Score = 94.0 bits (232),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCD+EVA+I+FS+RGKLY
Sbjct  1    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDSEVAVIVFSSRGKLY  48



>dbj|BAN89460.1| sepallata 3 [Shorea beccariana]
Length=242

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_006585806.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Glycine max]
Length=250

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_003531877.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Glycine max]
 gb|KHN30313.1| Developmental protein SEPALLATA 2 [Glycine soja]
Length=251

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_006490968.1| PREDICTED: agamous-like MADS-box protein AGL6-like isoform X2 
[Citrus sinensis]
Length=240

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  55



>gb|ABF57918.1| MADS-box transcription factor TaAGL16 [Triticum aestivum]
Length=246

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLY  55



>gb|AFX72879.1| MADS-box protein SEP3 [Aquilegia coerulea]
Length=244

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|ABS82744.1| MADS-box protein [Narcissus tazetta var. chinensis]
Length=241

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALI+FS+RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIVFSSRGKLY  55



>ref|NP_001105692.1| MADS box protein [Zea mays]
 gb|AAB00079.1| MADS box protein [Zea mays]
Length=255

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 46/48 (96%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSGRGKLY  55



>dbj|BAF75018.1| MADS-box protein [Triticum aestivum]
Length=246

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLY  55



>gb|AIU94287.1| SEPALLATA1-like protein [Prunus pseudocerasus]
Length=251

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  55



>gb|ABF57932.1| MADS-box transcription factor TaAGL30 [Triticum aestivum]
Length=246

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLY  55



>gb|AAK21248.1|AF335235_1 MADS-box transcription factor FBP5 [Petunia x hybrida]
Length=246

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LK+IENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALIIFSNRGKLY
Sbjct  8    LKKIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLY  55



>ref|XP_006445200.1| hypothetical protein CICLE_v10021911mg [Citrus clementina]
 ref|XP_006490967.1| PREDICTED: agamous-like MADS-box protein AGL6-like isoform X1 
[Citrus sinensis]
 gb|ESR58440.1| hypothetical protein CICLE_v10021911mg [Citrus clementina]
 gb|KDO85927.1| hypothetical protein CISIN_1g037149mg [Citrus sinensis]
Length=244

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  55



>gb|AHC54092.1| sepallata-like MADS box transcription factor LOFSEP, partial 
[Heliconia metallica]
Length=130

 Score = 92.8 bits (229),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVA+IIFS+RG+L+
Sbjct  3    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVAVIIFSSRGRLF  50



>ref|NP_001268114.1| MADS-box protein 4 [Vitis vinifera]
 gb|AAM21344.1|AF373603_1 MADS-box protein 4 [Vitis vinifera]
Length=242

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|KHG12954.1| MADS-box CMB1 [Gossypium arboreum]
Length=247

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLY  55



>dbj|BAJ53135.1| JHL05D22.6 [Jatropha curcas]
 gb|KDP28713.1| hypothetical protein JCGZ_14484 [Jatropha curcas]
Length=244

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  55



>gb|ACB45304.1| MIKC-type MADS-box transcription factor WM10A [Hordeum vulgare]
 dbj|BAK05620.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>emb|CAM59053.1| MIKC-type MADS-box transcription factor WM10A [Triticum aestivum]
Length=252

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_009615091.1| PREDICTED: MADS-box protein CMB1-like isoform X4 [Nicotiana tomentosiformis]
Length=207

 Score = 94.4 bits (233),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 46/48 (96%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSN GKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNTGKLY  55



>ref|NP_001289642.1| developmental protein SEPALLATA 1-like [Eucalyptus grandis]
 gb|AAC78284.1| MADS box protein [Eucalyptus grandis]
Length=245

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>ref|XP_010318407.1| PREDICTED: MADS-box protein 1 isoform X1 [Solanum lycopersicum]
Length=232

 Score = 94.7 bits (234),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  55



>gb|ACR38104.1| unknown [Zea mays]
 gb|AFW63384.1| zea agamous5 [Zea mays]
 gb|AIB04420.1| MADS transcription factor, partial [Zea mays]
Length=255

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 46/48 (96%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS RGKLY
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSGRGKLY  55



>ref|XP_007220139.1| hypothetical protein PRUPE_ppa019932mg [Prunus persica]
 gb|EMJ21338.1| hypothetical protein PRUPE_ppa019932mg [Prunus persica]
Length=191

 Score = 94.0 bits (232),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKL+
Sbjct  8    LKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLH  55



>ref|XP_007209505.1| hypothetical protein PRUPE_ppa010391mg [Prunus persica]
 gb|AAZ16241.1| MADS box protein [Prunus persica]
 gb|EMJ10704.1| hypothetical protein PRUPE_ppa010391mg [Prunus persica]
Length=251

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS+RGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLY  55



>gb|KHG04329.1| MADS-box CMB1 [Gossypium arboreum]
Length=244

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  44   LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLY  187
            LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLY
Sbjct  8    LKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLY  55



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 538862455824