BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25006_g2_i3 len=3317 path=[6108:0-24 15570:25-993 16539:994-1851
23852:1852-1855 17398:1856-3316]

Length=3317
                                                                      Score     E

ref|XP_009779040.1|  PREDICTED: putative F-box protein At1g47790      93.2    1e-16   
ref|XP_009597735.1|  PREDICTED: putative F-box protein At1g32420      86.3    1e-14   
ref|XP_010314076.1|  PREDICTED: putative F-box protein At1g32420      84.3    7e-14   
ref|XP_009779041.1|  PREDICTED: putative F-box protein At1g32420      80.1    2e-12   
ref|XP_006350130.1|  PREDICTED: putative F-box protein At1g47790-...  77.8    1e-11   
ref|XP_009596418.1|  PREDICTED: putative F-box protein At1g32420      68.9    4e-09   
ref|XP_009762873.1|  PREDICTED: putative F-box protein At5g15660      66.2    6e-08   
ref|XP_006367351.1|  PREDICTED: F-box protein At2g40925-like          62.0    1e-06   
gb|ABK28187.1|  unknown                                               62.0    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179218.1|  putative F-box protein                              62.0    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108845.1|  PREDICTED: putative F-box protein At1g30925      54.7    3e-04   
ref|XP_009609120.1|  PREDICTED: putative F-box protein At1g32420      52.8    4e-04   
ref|XP_009619255.1|  PREDICTED: putative F-box protein At1g47730      53.9    4e-04   
ref|XP_006391498.1|  hypothetical protein EUTSA_v10019545mg           53.9    6e-04   
ref|XP_006366472.1|  PREDICTED: putative F-box protein At3g10240-...  53.1    0.001   



>ref|XP_009779040.1| PREDICTED: putative F-box protein At1g47790 [Nicotiana sylvestris]
Length=381

 Score = 93.2 bits (230),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 107/387 (28%), Positives = 167/387 (43%), Gaps = 42/387 (11%)
 Frame = +1

Query  1897  ITRLPREILVKILTGLPAKSAVRFRCSCKFFYSYIPKPRF---GFRIvvvlpssvrsvls  2067
             +  +P E++V+IL  + AKS +RFRC  K F S I  P F     +  V          +
Sbjct  4     VACIPHELIVEILKKVRAKSLLRFRCVSKSFCSRISDPLFIEAHQKSCVAQFLVGCLAWT  63

Query  2068  lnslsYN---EESHGRLQADSAQVLDLRGLRWADSTSSADGKMVLLNNKLWGDQALFDIS  2238
                + YN    E H  L A   Q LD    R  +   S  G + L NN   G+ A+ +  
Sbjct  64    PKDVIYNLGQREEHQDL-AYPIQYLDQPCFREFNYMQSIGGLVCLWNNV--GEVAICNPF  120

Query  2239  TGRRIsvpsdsslsyvssvftvDVVAFDSVSERYKVFRSSPLYENYRWVLNRYWVLTVDV  2418
               + + +P       +  + T   +  D  ++++KVF++  L  N R    RYWV T+ V
Sbjct  121   IKQHVFLPYQQPTGELYGIMTCCSLCVDPTTKKHKVFKAH-LRNNER----RYWVFTIGV  175

Query  2419  DESWREIEFTTGHL--YVAMVHINGIIYFIPDMSEWSPDDINELSSSPKIAAMDVATESF  2592
             D+ WREI   +  L      V+I+G+IY++          IN  +    IAA  V  E F
Sbjct  176   DKLWREISGCSNFLPSNGNCVYIDGVIYWV---------HINRCN----IAAFSVGDEKF  222

Query  2593  ITFVPFPSG--YHPYPHGYVLWWVPWIMKLNGRMSFINFIIPDAREDERKIEIWTWERSM  2766
             I  + FP       +  G      P I ++ G+++ +  +    ++    + +       
Sbjct  223   IRMISFPDREWTLRFSEG-----TPRIAEIKGQVALLGPVY--FKKSTIALYVLNGSGET  275

Query  2767  EEWEKQTILLPLEESKVISQASSMGFATNSMGEIVFLLQSNTMSPLILVYSFGR-DVWKR  2943
             +EW K  I LPLE  K         F  N  GEI+ L   N+ S  + +Y  GR D WK 
Sbjct  276   DEWVKHIIELPLELPKTCGGCLCSLFTINPKGEILSLPDKNSSS--LFLYDAGRKDQWKL  333

Query  2944  FEISGVSNYKLHLS-SMKSLVHVEDEI  3021
              EI G+   K  +   +  L+++ D I
Sbjct  334   VEIHGIYERKFLVEIQITVLLNIVDSI  360



>ref|XP_009597735.1| PREDICTED: putative F-box protein At1g32420 [Nicotiana tomentosiformis]
Length=346

 Score = 86.3 bits (212),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 96/357 (27%), Positives = 151/357 (42%), Gaps = 59/357 (17%)
 Frame = +1

Query  1906  LPREILVKILTGLPAKSAVRFRCSCKFFYSYIPKPRFGFRIvvvlpssvrsvlslnslsY  2085
             +P E++ +IL  +PAKS +RFRC  K F S I +P F                   +  +
Sbjct  14    IPHEMIFEILKQVPAKSLMRFRCVSKSFCSLISEPLF----------IEAHQKLSTAQFH  63

Query  2086  NEESHGRLQADSAQVLDLRGLRWADSTSSADGKMVLLNNKLWGDQALFDISTGRRIsvps  2265
                S      D  Q L+        S +S +G + L N    GD A+ +  T   I +P 
Sbjct  64    VSCSSLTTSKDVIQYLNQSRFSKLHSLASTNGVVCLWN--FDGDVAVSNPFTQEHIFLPY  121

Query  2266  dsslsyvssvftvDVVAFDSVSERYKVFRSSPLYENYRWVLNRYWVLTVDVDESWREIEF  2445
               S     S      + FDS +++YKV ++  L ++      RYW+ T+ VD+ WREI  
Sbjct  122   QQSSITCCS------LGFDSTTKKYKVIKAQYLLDDRDSGKVRYWIYTIGVDKLWREIP-  174

Query  2446  TTGHLYVA--MVHINGIIYFIPDMSEWSPDDINELSSSPKIAAMDVATESFITFVPFPSG  2619
                +++ A   V+I+G+ Y            +N LS S  IAA  V  E  I  +  P G
Sbjct  175   DCANIFPAYSFVYIDGVTYC-----------VNRLSESYNIAAFSVKNEKLIRMILSPDG  223

Query  2620  YHPYPHGYVLWWV----PWIMKLNGRMSFINFIIPDAREDERKIEIWTWERS--MEEWEK  2781
                        W     P I+++NG+++ +     D      K+ ++    +   E W K
Sbjct  224   V----------WASKSPPNIVEINGQVALV-----DQSNSGGKVSLYVLNGTGETETWVK  268

Query  2782  QTILLPLEESKVISQASSMGFATNSMGEIVFLLQSNTMSPLILVYSFGRDVWKRFEI  2952
               I LP   S++I+      F TN  GEI   L   T+  + L Y   +  W++ +I
Sbjct  269   HIIALP---SELINTKYLPLFKTNPKGEIALPL--CTVLDMFL-YDIAKKDWRKVDI  319



>ref|XP_010314076.1| PREDICTED: putative F-box protein At1g32420 [Solanum lycopersicum]
Length=356

 Score = 84.3 bits (207),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 93/365 (25%), Positives = 161/365 (44%), Gaps = 43/365 (12%)
 Frame = +1

Query  1906  LPREILVKILTGLPAKSAVRFRCSCKFFYSYIPKPRF-GFRIvvvlpssvrsvlslnsls  2082
             +P E++V+IL  LPAKS ++F+C  K F S +  P F        +     + L +    
Sbjct  11    IPDELIVEILRKLPAKSLMKFKCVSKSFNSLMSDPSFIESHQKSYMTEFFINRLRMEYYR  70

Query  2083  YNEESHGRLQADSAQVLDLRGLRWADSTSSADGKMVLLNNKLWGDQALFDISTGRRIsvp  2262
              ++     L     + LD    R      S +G + L NN   GD A+ +    + I +P
Sbjct  71    LSKTDEDLLSTCPLEYLDQSCFRNLKCMQSTNGLVCLWNNH--GDIAICNPFIKQHIFLP  128

Query  2263  sdsslsyvssvftvDVVAFDSVSERYKVFRSSPLYENYRWVLNRYWVLTVDVDESWREIE  2442
                  S          + FD  ++ +KVF+   ++E+ + +   Y + T+ +D+SWREI 
Sbjct  129   RQQHYSRTIYAG----IGFDPTTKTHKVFKEEIIFESGKVM---YSIFTIGIDKSWREIN  181

Query  2443  --FTTGHLYVAMVHINGIIYFIPDMSEWSPDDINELSSSPKIAAMDVATESFITFVPFPS  2616
                    ++   V I+G+IYFI +                 + A  V  E FI  +PFP+
Sbjct  182   GWINFRPMFYNSVCIDGVIYFINNCVR-------------DVIAFSVRHEKFIRRIPFPT  228

Query  2617  GYHPYPHGYVLWWV---PWIMKLNGRMSFINFIIPDAREDERKIEIWTWERSMEEWEKQT  2787
                P      L W    P +++  G+++ +  +  D      KI ++T E  +E W K  
Sbjct  229   KEWP------LRWCDFTPILVETKGQVAILGHVYFDF----GKIALYTSE--IEPWVKHI  276

Query  2788  ILLPLEESKVISQASSMGFATNSMGEIVFLLQSNTMSPLILVYSFGRDVWKRFEISGVSN  2967
             I LPL E K I+++ S    TN  G+I+ + +  T +P + +Y   +  W+    + +  
Sbjct  277   IELPL-EYKNITRSLSFLSTTNPKGDILSIPE--TKNPPLFLYDDEKKEWRIVAKNRIYA  333

Query  2968  YKLHL  2982
               LH+
Sbjct  334   QSLHI  338



>ref|XP_009779041.1| PREDICTED: putative F-box protein At1g32420 [Nicotiana sylvestris]
Length=352

 Score = 80.1 bits (196),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 90/360 (25%), Positives = 145/360 (40%), Gaps = 51/360 (14%)
 Frame = +1

Query  1906  LPREILVKILTGLPAKSAVRFRCSCKFFYSYIPKPRFGFRIvvvlpssvrsvlslnslsY  2085
             +P EI+ +IL  +P KS +RFRC  K F S I +P F                   +  +
Sbjct  14    IPHEIIFEILKKIPVKSLMRFRCVSKSFCSLISEPLF----------IEAHQKLSTAQFH  63

Query  2086  NEESHGRLQADSAQVLDLRGLRWADSTSSADGKMVLLNNKLWGDQALFDISTGRRIsvps  2265
                S    + +  Q  +        S +S +G + L N   +G+ A+ +  T   I +P+
Sbjct  64    VSCSSLATRENVIQYFNQSRFSKLHSLASTNGLVCLWN--FYGEVAVCNPFTQEHIFLPN  121

Query  2266  dsslsyvssvftvDVVAFDSVSERYKVFRSSPLYENYR--WVLNRYWVLTVDVDESWREI  2439
                     S      + FD  +++YKV ++     + R      RYW+ T+ VD  WREI
Sbjct  122   QRPSITCCS------LGFDPTTKKYKVIKAQYYILDDRDYSCKVRYWIYTIGVDNLWREI  175

Query  2440  EFTTGHLYV-AMVHINGIIYFIPDMSEWSPDDINELSSSPKIAAMDVATESFITFVPFPS  2616
                     +   V+I G+IY            +N LS    IAA  V  E  I  +  P 
Sbjct  176   PDCANIFPIYNFVYIGGVIYC-----------VNRLSKPYNIAAFSVENEKLIRMILSPD  224

Query  2617  GYHPYPHGYVLWWVPWIMKLNGRMSFINFIIPDAR----EDERKIEIWTWERSMEEWEKQ  2784
                           P I+++ G+++ +     D R    +D+  + +       E W K 
Sbjct  225   EVSTSKSP------PKIVEIKGQVALV-----DQRKFGGDDKVSLYVLNGTGETETWVKH  273

Query  2785  TILLPLEESKVISQASSMGFATNSMGEIVFLLQSNTMSPLILVYSFGRDVWKRFEISGVS  2964
              I LPLE   +I+      F TN  GEI     S+T+  + L Y   +  W++ +I G+ 
Sbjct  274   IIALPLE---LINTKYLPLFNTNPKGEITLNTNSSTIWQMFL-YDIAKKDWRKVDIHGIC  329



>ref|XP_006350130.1| PREDICTED: putative F-box protein At1g47790-like [Solanum tuberosum]
Length=360

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 89/371 (24%), Positives = 154/371 (42%), Gaps = 43/371 (12%)
 Frame = +1

Query  1897  ITRLPREILVKILTGLPAKSAVRFRCSCKFFYSYIPKPRF---GFRIvvvlpssvrsvls  2067
             +  +P E++++IL  LP KS ++F+C  K FYS I  P F     +  +      R  ++
Sbjct  8     VACIPGELVIEILKKLPVKSLMKFKCVSKSFYSLISDPFFIESHQKSYMTQFFVNRPRMT  67

Query  2068  lnslsYNEESHGRLQADSAQVLD---LRGLRWADSTSSADGKMVLLNNKLWGDQALFDIS  2238
                LS NEE    L     + LD    + LR+  ST+            LW D  L DI+
Sbjct  68    YYRLSKNEERDEDLATCPLEYLDQSCFQNLRYMQSTNGLVC--------LWND--LGDIA  117

Query  2239  TGRRIsvpsdsslsyvssvftvDVVAFDSVSERYKVFRSSPLYENYRWVLNRYWVLTVDV  2418
                                 T   + FD+ ++R+KVF +  ++   + + +   + T+ +
Sbjct  118   ICNPFIKQHVFLPCQQHKGSTFYAIGFDTTTKRHKVFNAE-IFRGGKLICS---IFTIGI  173

Query  2419  DESWREIEFTTGHLYV--AMVHINGIIYFIPDMSEWSPDDINELSSSPKIAAMDVATESF  2592
             D+SWREI             V I+G+IYF+ +                 I A  V  E F
Sbjct  174   DKSWREICSCINFRPTDDNCVCIDGVIYFVNNYIR-------------DIVAFSVVDEKF  220

Query  2593  ITFVPFPSGYHPYPHGYVLWWVPWIMKLNGRMSFINFIIPDAREDERKIEIWTWERSMEE  2772
             I  +PFP    P     +  + P +++  G+++ +  +  +    +  + I      +E 
Sbjct  221   IRRIPFPINEWPL---RLFNFTPILVETKGQVAILGHVYFNF--GKIALYILNGTSEIEP  275

Query  2773  WEKQTILLPLEESKVISQASSMGFATNSMGEIVFLLQSNTMSPLILVYSFGRDVWKRFEI  2952
             W K TI LPLE  K I+Q+      TN  G I+ + +    +P + +Y   +  W+    
Sbjct  276   WVKHTIELPLEFKK-ITQSFCFLLTTNPKGNILSIPE--IKNPPLFLYDNEKKEWRIVAR  332

Query  2953  SGVSNYKLHLS  2985
             + +     H+ 
Sbjct  333   NKIYGQNFHIQ  343



>ref|XP_009596418.1| PREDICTED: putative F-box protein At1g32420, partial [Nicotiana 
tomentosiformis]
Length=274

 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 70/267 (26%), Positives = 112/267 (42%), Gaps = 37/267 (14%)
 Frame = +1

Query  1906  LPREILVKILTGLPAKSAVRFRCSCKFFYSYIPKPRFGFRIvvvlpssvrsvlslnslsY  2085
             +P EI+ +IL  +PAKS +RFRC  K F S I +P F   I      S        +   
Sbjct  14    IPYEIIFEILKEVPAKSLMRFRCVSKSFCSLISEPLF---IEAHQKFSTAQFHVSCTSLT  70

Query  2086  NEESHGRLQADSAQVLDLRGLRWADSTSSADGKMVLLNNKLWGDQALFDISTGRRIsvps  2265
               E       +  Q  +        S +S +G + L N   +GD A+ +  T   I +P+
Sbjct  71    TRE-------NVIQYFNQSRFSKLHSLASTNGLVCLWN--FYGDVAVCNPFTQEHIFLPN  121

Query  2266  dsslsyvssvftvDVVAFDSVSERYKVFRSSPLYENYRWVLN-RYWVLTVDVDESWREIE  2442
                     S      + FD  +++YKV ++  + E+  +    RYW+ T+ VD+ WREI 
Sbjct  122   QQPSITCCS------LGFDPTTKKYKVIKAQYMLEDRDYSCKVRYWIYTIGVDKLWREIP  175

Query  2443  FTTGHLYV-AMVHINGIIYFIPDMSEWSPDDINELSSSPKIAAMDVATESFITFVPFPSG  2619
                    +   V+I G+IY            +N LS    IAA  V  E  I  +  P G
Sbjct  176   DCANIFPIYNFVYIGGVIYC-----------VNRLSKPYNIAAFSVEDEKLIRMILLPDG  224

Query  2620  YHPYPHGYVLWWVPWIMKLNGRMSFIN  2700
                          P I+++ G+++ ++
Sbjct  225   VS------TSKCPPKIVEIKGQVALVD  245



>ref|XP_009762873.1| PREDICTED: putative F-box protein At5g15660 [Nicotiana sylvestris]
Length=346

 Score = 66.2 bits (160),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 102/226 (45%), Gaps = 39/226 (17%)
 Frame = +1

Query  2311  VAFDSVSERYKVFRSSPLYENYRWVLNRYWVLTVDVDESWREIEFTTGH--LYVAMVHIN  2484
             + FD +++++KVF++     +        W+ T+ VD+SWREI   T    L    V+I 
Sbjct  137   LCFDPITKKHKVFKTLGDQNSCEVAC---WIFTIGVDKSWREIADCTNFFPLRYNCVYIG  193

Query  2485  GIIYFIPDMSEWSPDDINELSSSPKIAAMDVATESFITFV--PFPSGYHPYPHGYVLWWV  2658
             G+IY            +N L+++  I A  V  E  I  +  PF      +P        
Sbjct  194   GVIYC-----------VNRLATAYNIVAFSVGDEKLIRMILTPFEVLTSEFP--------  234

Query  2659  PWIMKLNGRMSFI---NFIIPDAREDERKIEIWTWERSMEEWEKQTILLPLEESKVISQA  2829
             P I ++ G+++ +   NF++    + +  + I+      EEW K  I L L ES  I + 
Sbjct  235   PKIFEIKGQVALLDGRNFLV----DGKFHLYIFNGTGENEEWVKHIIEL-LSES--IPKR  287

Query  2830  SSMGFATNSMGEIVFLLQSNT--MSPLILVYSFGRDVWKRFEISGV  2961
                 F TN  GEIV  +  NT  + P+ L     +  W +FE+ G+
Sbjct  288   FCPSFNTNPKGEIVLFIPVNTDRIFPVFL-RDIAKKEWTKFEMHGI  332



>ref|XP_006367351.1| PREDICTED: F-box protein At2g40925-like [Solanum tuberosum]
Length=353

 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 89/376 (24%), Positives = 158/376 (42%), Gaps = 75/376 (20%)
 Frame = +1

Query  1906  LPREILVKILTGLPAKSAVRFRCSCKFFYSYIPKPRF------------GFRIvvvlpss  2049
             +P EI+ +I + LP KS +RF+C+ KF  S I +  F            G    ++    
Sbjct  9     IPEEIMFEIFSWLPVKSLLRFKCNTKFCTSLILESDFVNIHTCRSMSRSGRTKFILREKW  68

Query  2050  vrsvlslnslsYNEESHGRLQADSAQVLDLRGLRWADSTSSADGKMVLLNNKLWGDQALF  2229
                  +       ++S   LQ      L L GL +    +  +G   + ++      A+F
Sbjct  69    ESIFFTAEQREDEKDSTPFLQIPRYNYLYLHGLAYYSRLNCVNGLCCMWDSLSTRHAAIF  128

Query  2230  DISTGRRIsvpsdsslsyvssvftvDVVAFDSVSERYKVFRSSPLYENYRWVLNRYWVLT  2409
             + ST R +    +         ++   + F+   +++KVF        Y+    R+WV T
Sbjct  129   NPST-REVRFLPNIDGELSPCNYS---LGFEPEEKKFKVF------SRYK---ERHWVFT  175

Query  2410  VDVDESWRE---IEFTTGHLYVAMVHINGIIYFIPDMSEWSPDDINELSSSPKIAAMDVA  2580
             + +D+SWRE   I F   + +   V I+G+IY + + +               IAA+D+ 
Sbjct  176   LGIDKSWRENKNISFAIPY-FKPSVCISGVIYQLINGA---------------IAAIDIK  219

Query  2581  TESFITFVPFPSGYHPYPHGYVLWWVPWIMKLNGRMSFINFIIPDAREDERK-----IEI  2745
             +E   T   + S  H  P+ Y L      +++ G++  I         D RK     +++
Sbjct  220   SEKCETIALWNSS-HELPNYYEL------IEVKGKLEVI---------DYRKWVGGYLDL  263

Query  2746  WTWERS-MEEWEKQTILLPLEESKVISQASSMGFATNSM---GEIVFLLQSNTMSPLILV  2913
             W ++++   +WE+  I LP      I  A   GF ++ M   GEIVF++   +     L 
Sbjct  264   WIFDQTPQRKWERHIIRLP-----SIWNAMKPGFVSSVMSHDGEIVFVVIFKSGGAC-LC  317

Query  2914  YSFGRDVWKRFEISGV  2961
             Y   R  W+  +I G+
Sbjct  318   YDVTRKSWRELKIMGL  333



>gb|ABK28187.1| unknown [Arabidopsis thaliana]
Length=408

 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 96/408 (24%), Positives = 169/408 (41%), Gaps = 66/408 (16%)
 Frame = +1

Query  1906  LPREILVKILTGLPAKSAVRFRCSCK--------------FFYSYIPKPRFGFRIvvvlp  2043
             L  ++++++L+ LP KS  RF C  K              F      KPR  F IV    
Sbjct  6     LTNDLILEVLSRLPLKSVARFHCVSKRWASMFGSPYFKELFLTRSSAKPRLLFAIVQNGV  65

Query  2044  ----ssvrsvlslnslsYNEESHGRLQADSAQVLDLRGLRWADSTSSADGKMVLLNNKLW  2211
                 SS R   S ++L    E H +L  ++ ++      R+  S   A G + L  ++  
Sbjct  66    WRFFSSPRLEKSSSTLVATAEFHMKLSPNNLRIYHDNTPRYF-SIGYASGLIYLYGDRYE  124

Query  2212  GDQALFDISTGRRIsvpsdsslsyvssvftvDVVAFDSVSERYK----VFRSSPLYENYR  2379
                 + + +TGR             +         FD + ++YK    ++ S P +    
Sbjct  125   ATPLICNPNTGR-----YTILPKCYTYRKAFSFFGFDPIDKQYKALSMIYPSGPGHSK--  177

Query  2380  WVLNRYWVLTV-DVDESWREIEFTTGH-LYVAMVHINGIIYFIPDMSEWSPDDINELSSS  2553
                    +LT  D D +W++I++   H +Y   + ING++Y++ D S+W  D+ ++++S 
Sbjct  178   -------ILTFGDGDMNWKKIKYRVLHDIYSQGICINGVLYYLGDTSDW--DNDHDVTSG  228

Query  2554  PKIAAMDVATESFITFVPFPSGYHPYPHGYVLWWVPWIMKLNGRMSFINFIIPDAREDER  2733
               +   D+ +ESF TF+    G               ++   G+++ I +   D  + + 
Sbjct  229   NVLVCFDLRSESF-TFIGLECG--------------QLINYKGKLAVIFWDDVDDDDVKD  273

Query  2734  ----KIEIWTWER-SMEEWEKQTILLPLEESKVISQASSMGFATNSMGEIVFLLQSNTMS  2898
                 ++ +W  E    +EW K       E+    SQ S +G   +  GEIVF ++  T  
Sbjct  274   DAIDEMHVWVLEDVEKKEWSKYAYTW-TEDKLYRSQVSVVGMTAS--GEIVFSMRKYTSE  330

Query  2899  PLILVYSFG--RDVWKRFEISGVSNYKLHLSSMKSLVHVEDEIAYFLE  3036
                 VY F   R+  +R EI G   +    +    + HVED   Y L+
Sbjct  331   QPFYVYYFNPERNNLRRVEIQGFEAFTKFGTVYTFVDHVEDLNVYNLK  378



>ref|NP_179218.1| putative F-box protein [Arabidopsis thaliana]
 sp|Q8S8C7.1|FB105_ARATH RecName: Full=Putative F-box protein At2g16220 [Arabidopsis thaliana]
 gb|AAM15403.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABE65447.1| F-box family protein [Arabidopsis thaliana]
 gb|AEC06475.1| putative F-box protein [Arabidopsis thaliana]
Length=407

 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 96/408 (24%), Positives = 169/408 (41%), Gaps = 66/408 (16%)
 Frame = +1

Query  1906  LPREILVKILTGLPAKSAVRFRCSCK--------------FFYSYIPKPRFGFRIvvvlp  2043
             L  ++++++L+ LP KS  RF C  K              F      KPR  F IV    
Sbjct  6     LTNDLILEVLSRLPLKSVARFHCVSKRWASMFGSPYFKELFLTRSSAKPRLLFAIVQNGV  65

Query  2044  ----ssvrsvlslnslsYNEESHGRLQADSAQVLDLRGLRWADSTSSADGKMVLLNNKLW  2211
                 SS R   S ++L    E H +L  ++ ++      R+  S   A G + L  ++  
Sbjct  66    WRFFSSPRLEKSSSTLVATAEFHMKLSPNNLRIYHDNTPRYF-SIGYASGLIYLYGDRYE  124

Query  2212  GDQALFDISTGRRIsvpsdsslsyvssvftvDVVAFDSVSERYK----VFRSSPLYENYR  2379
                 + + +TGR             +         FD + ++YK    ++ S P +    
Sbjct  125   ATPLICNPNTGR-----YTILPKCYTYRKAFSFFGFDPIDKQYKALSMIYPSGPGHSK--  177

Query  2380  WVLNRYWVLTV-DVDESWREIEFTTGH-LYVAMVHINGIIYFIPDMSEWSPDDINELSSS  2553
                    +LT  D D +W++I++   H +Y   + ING++Y++ D S+W  D+ ++++S 
Sbjct  178   -------ILTFGDGDMNWKKIKYRVLHDIYSQGICINGVLYYLGDTSDW--DNDHDVTSG  228

Query  2554  PKIAAMDVATESFITFVPFPSGYHPYPHGYVLWWVPWIMKLNGRMSFINFIIPDAREDER  2733
               +   D+ +ESF TF+    G               ++   G+++ I +   D  + + 
Sbjct  229   NVLVCFDLRSESF-TFIGLECG--------------QLINYKGKLAVIFWDDVDDDDVKD  273

Query  2734  ----KIEIWTWER-SMEEWEKQTILLPLEESKVISQASSMGFATNSMGEIVFLLQSNTMS  2898
                 ++ +W  E    +EW K       E+    SQ S +G   +  GEIVF ++  T  
Sbjct  274   DAIDEMHVWVLEDVEKKEWSKYAYTW-TEDKLYRSQVSVVGMTAS--GEIVFSMRKYTSE  330

Query  2899  PLILVYSFG--RDVWKRFEISGVSNYKLHLSSMKSLVHVEDEIAYFLE  3036
                 VY F   R+  +R EI G   +    +    + HVED   Y L+
Sbjct  331   QPFYVYYFNPERNNLRRVEIQGFEAFTKFGTVYTFVDHVEDLNVYNLK  378



>ref|XP_009108845.1| PREDICTED: putative F-box protein At1g30925 [Brassica rapa]
Length=348

 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 84/365 (23%), Positives = 152/365 (42%), Gaps = 55/365 (15%)
 Frame = +1

Query  1906  LPREILVKILTGLPAKSAVRFRCSCKFFYSYIPKPRFGFRIvvvlpssvrsvlslnslsY  2085
             +P +++ +IL+ LP KS  RFRC  K + S + +PR  F +       +          Y
Sbjct  5     IPTDLIPEILSRLPGKSIARFRCVSKLWLSILTRPRLLFALERANEEMLFFSSPHPQNPY  64

Query  2086  NEESHGRLQADSAQVLDLRGLRWADSTSSADGKMVLLNNKLWGDQALFDISTGRRIsvps  2265
             ++ S     AD         LR   S     G + L  NK    + ++++STG  +    
Sbjct  65    DKSS----PADFLIKFVCPELRAFTS-----GLIYLCANK----RVIYNLSTGEYV----  107

Query  2266  dsslsyvssvftvDVVAFDSVSERYKVFRSSPLYENYRWVLNRYWVLTV--DVDESWREI  2439
              +         +   + +D +++++KV     LY  Y    + + +LT+    ++ WR+I
Sbjct  108   -NLPDLKRYRKSNSFLGYDPLNKQFKV-----LYMAYLSGPDDHRILTLGPSKEKKWRKI  161

Query  2440  EFTTGH------LYVAMVHINGIIYFIPDMSEWSPDDINELSSSPKIAAMDVATESFITF  2601
             +    H      + +  + I+G++Y+I     ++ ++ + +     I   DV +E F  F
Sbjct  162   KCRLTHQPLHDQVRINGICISGVLYYIGKAYGYTAEERHYM-----IICFDVRSEKF-KF  215

Query  2602  VPFPSGYHPYPHGYVLWWVPWIMKLNGRMSFINFIIPDAREDERKIEIWTWER-SMEEWE  2778
             V       P            ++   G++  I+    D+  D  ++ +W  E    +EW 
Sbjct  216   VEAECFGDP--------KATKLINYKGKLGGIDLTYNDS--DAIELCMWILEDVERKEWS  265

Query  2779  KQTILLPLEESKVISQASSMGFATNSMGEIVFLLQSNTMSPLILVY-SFGRDVWKRFEIS  2955
             K    LP+     I     +G  T   GEIV L +  T +P  + Y S  R+  +R EI 
Sbjct  266   KYVYTLPVNN---IRNVFVVGVITT--GEIV-LSEKFTSTPFCVFYFSPERNTLQRVEIR  319

Query  2956  GVSNY  2970
             GV  Y
Sbjct  320   GVGEY  324



>ref|XP_009609120.1| PREDICTED: putative F-box protein At1g32420 [Nicotiana tomentosiformis]
Length=212

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 71/166 (43%), Gaps = 23/166 (14%)
 Frame = +1

Query  2311  VAFDSVSERYKVFRSSPLYENYRWVLNRYWVLTVDVDESWREIEFTTGHLYV-AMVHING  2487
             + FD  +++YKV ++  +         RYW+ T+ VD+ WREI        +   V+I G
Sbjct  68    LGFDPTTKKYKVIKAHWILGGRNSCEVRYWIYTIGVDKIWREIPDCANIFPIYNFVYIGG  127

Query  2488  IIYFIPDMSEWSPDDINELSSSPKIAAMDVATESFITFVPFPSGYHPYPHGYVLWWVPWI  2667
             +IY            +N LS    IAA  V  E  I  +  P G        +L     I
Sbjct  128   VIYC-----------VNRLSKPYNIAAFSVEEEKLIRMILLPDG--------ILAKNSKI  168

Query  2668  MKLNGRMSFINFIIPDAREDER-KIEIWTWERSMEEWEKQTILLPL  2802
             +++ G+++ ++  + + R D    + +       + W K  I LPL
Sbjct  169   VEMKGQVALLD--LKNIRGDGYVSLHVLNGTGKTKTWVKHIIALPL  212



>ref|XP_009619255.1| PREDICTED: putative F-box protein At1g47730 [Nicotiana tomentosiformis]
Length=291

 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 77/321 (24%), Positives = 121/321 (38%), Gaps = 72/321 (22%)
 Frame = +1

Query  1906  LPREILVKILTGLPAKSAVRFRCSCKFFYSYIPKPRFGFRIvvvlpssvrsvlslnslsY  2085
             +P EI+  I + LP KS +RF+C  KF+ S +    F                 ++   Y
Sbjct  10    IPDEIIYDIFSWLPIKSLMRFKCVSKFYSSLVSDSCF-----------------VDIHQY  52

Query  2086  NEESH--------GRLQADSAQVLDLRGLRWADSTSSADGKMVLLNNKLWGDQALFDIST  2241
             N   H        G  +A   +V  LRGL              ++  K    + LF +  
Sbjct  53    NSIHHPDKHRRGGGTSKASVIRVGKLRGL--------------IIYPKFGYAKGLFGLWC  98

Query  2242  GRRIsvpsdsslsyvssvftvDVVAFDSVSERYKVFRSSPLYENYRWVLNR-------YW  2400
                   P   +           +  FD +++ Y      P    Y+ +L R       YW
Sbjct  99    STSRLPPVIYNPITRKVRPLPRLNFFDEITDCYYSLGFEPDKSKYKILLVRHSCLPLRYW  158

Query  2401  VLTVDVDESWREIEFTTGH--LYVAMVHINGIIYFIPDMSEWSPDDINELSSSPKIAAMD  2574
             V T+   +SWREI+ T     L    V ING IY           +    +    I   +
Sbjct  159   VYTLGTSKSWREIKSTVDFFPLLKGGVCINGAIY-----------NFGFYNKRFCIVEFN  207

Query  2575  VATESFITFVPFPSGYHPYPHGYVLWWVPWIMKLNGRMSFINFIIPDAREDERKIEIWTW  2754
             + TE F   VP+       P G    W  ++++L G+++ ++      R  + ++++W  
Sbjct  208   LRTEIF-RIVPWWKDLQYDPEG----WFYYLIELEGKLAVVD------RSTKGEMDLWIL  256

Query  2755  ERSM--EEWEKQTILLPLEES  2811
             ERS   EEW K  I  P E S
Sbjct  257   ERSKSSEEWVKHAIAFPSELS  277



>ref|XP_006391498.1| hypothetical protein EUTSA_v10019545mg [Eutrema salsugineum]
 gb|ESQ28784.1| hypothetical protein EUTSA_v10019545mg [Eutrema salsugineum]
Length=381

 Score = 53.9 bits (128),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 56/245 (23%), Positives = 102/245 (42%), Gaps = 29/245 (12%)
 Frame = +1

Query  2308  VVAFDSVSERYKVFRSSPLYENYRWVLNRYWVLTVDVDE-SWREIEFTTGHLYVAM---V  2475
             ++ FD + +++KV  ++ +         ++ VLTV     SWR IE +  H Y      +
Sbjct  153   LLGFDPIDKQFKVLSTTKVIYREDNSYLKHQVLTVGTGNLSWRMIECSISHHYYPSKDGI  212

Query  2476  HINGIIYFIPDMSEWSPDDINELSSSPKIAAM---DVATESFITFVPFPSGYHPYPHGYV  2646
               NG++Y++           ++L   PK+ A+   DV +E+F                 +
Sbjct  213   CTNGVLYYV-----------SQLGGPPKVCAIVCFDVRSENFSVI--------NRAEDMI  253

Query  2647  LWWVPWIMKLNGRMSFI-NFIIPDAREDERKIEIWTW-ERSMEEWEKQTILLPLEESKVI  2820
             L  V  ++   G++  + N        + R +E W   +    EW K   +LP     V+
Sbjct  254   LRMVSTLVNYMGKLGVLSNGGFEGLTRESRSLEFWVLVDAEKHEWSKHKYVLPSSWKNVV  313

Query  2821  SQASSMGFATNSMGEIVFLLQSNTMSPLILVYSFGRDVWKRFEISGVSNYKLHLSSMKSL  3000
             ++A        S  EIV   +  +    +  Y+  R+  +R EI G+  +K +     SL
Sbjct  314   AEAKIFIVGVTSANEIVLSPRYLSNPFYVFYYNNERNTIRRVEIHGMDAFK-NCGVHISL  372

Query  3001  VHVED  3015
              HVE+
Sbjct  373   DHVEE  377



>ref|XP_006366472.1| PREDICTED: putative F-box protein At3g10240-like [Solanum tuberosum]
Length=356

 Score = 53.1 bits (126),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 58/225 (26%), Positives = 95/225 (42%), Gaps = 37/225 (16%)
 Frame = +1

Query  2311  VAFDSVSERYKVFRSSPLYENYRWVLNRYWVLTVDVDESWRE-IEFTTGHLYV----AMV  2475
             + F+    +YKV  +    +     L+R WVLT+ +D+SWRE I++     Y+    + +
Sbjct  130   IGFEPEENKYKVILTIDTNDG----LSRAWVLTLGIDKSWREMIQYAEHDYYITPYRSGI  185

Query  2476  HINGIIYFIPDMSEWSPDDINELSSSPKIAAMDVATESFITFVP----FPSGYHPYPHGY  2643
              I+GIIY     SE+             I A DV +E F         F +  H     Y
Sbjct  186   CISGIIYRFCYSSEYC------------IVAFDVKSEIFTRITTLIELFGNNIHESEFDY  233

Query  2644  VLWWVPWIMKLNGRMSFINFIIPDAREDERKIEIWTWERSMEEWEKQTILLPLEESKVIS  2823
             +L      +++NG++  +NF      E+   I +  +E    +WE Q    PL       
Sbjct  234   ML------IEVNGKLGILNFSKFWCTEN---IHLLIFEGG--KWEHQIFQFPLGWKPNNI  282

Query  2824  QASSMGFATNSMGEIVFLLQSNTMSPLI-LVYSFGRDVWKRFEIS  2955
               S+         EIVF ++  +   L+  VY    + W+RFE+ 
Sbjct  283   YLSTYKICKYGGEEIVFAIKLTSSDVLLCFVYDVKNNSWRRFEVQ  327



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 10852228312380