BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25000_g1_i6 len=2494 path=[5999:0-179 353:180-241 10855:242-254
5780:255-287 12266:288-322 496:323-332 506:333-344 12325:345-347
12328:348-387 12362:388-396 570:397-426 600:427-463 637:464-467
641:468-493 8856:494-533 8896:534-1034 1208:1035-1069 8413:1070-1306
8650:1307-1489 1663:1490-1515 10242:1516-1750 10476:1751-1751
1925:1752-1759 12539:1760-1778 12558:1779-1783 6643:1784-1811
6671:1812-1821 6681:1822-1845 6705:1846-1848 2013:1849-1903
10706:1904-1921 2086:1922-2493]

Length=2494
                                                                      Score     E

ref|XP_011096562.1|  PREDICTED: dammarenediol II synthase-like         1274   0.0     
emb|CDP12624.1|  unnamed protein product                               1269   0.0     
gb|AEX99665.1|  amyrin synthase                                        1259   0.0     
gb|AFJ19235.1|  mixed amyrin synthase                                  1258   0.0     
gb|EYU33367.1|  hypothetical protein MIMGU_mgv1a001775mg               1254   0.0     
emb|CDP10664.1|  unnamed protein product                               1246   0.0     
dbj|BAF63702.1|  mixed amyrin synthase                                 1245   0.0     Olea europaea
gb|AIS39793.1|  mixed amyrin synthase 1                                1233   0.0     
gb|AHF22084.1|  OSC2                                                   1198   0.0     
gb|EYU34015.1|  hypothetical protein MIMGU_mgv1a021513mg               1187   0.0     
gb|AAS01523.1|  putative beta-amyrin synthase                          1175   0.0     Centella asiatica [Asiatic pennywort]
gb|ADM86392.1|  putative beta-amyrin synthase                          1175   0.0     
gb|AGI15962.1|  dammarenediol synthase                                 1160   0.0     
dbj|BAD15332.1|  beta-amyrin synthase                                  1159   0.0     Panax ginseng [Chinese ginseng]
gb|ACZ71036.1|  dammarenediol synthase protein                         1157   0.0     Panax ginseng [Chinese ginseng]
gb|AGK62449.1|  dammarenediol-II synthase                              1157   0.0     
gb|AED99864.1|  DS synthase                                            1157   0.0     
gb|AIK21788.1|  dammarenediol-II synthase                              1156   0.0     
gb|AGS79229.1|  dammarenediol-II synthase                              1156   0.0     
gb|AEO27862.1|  dammarenediol synthase                                 1154   0.0     
gb|AED99865.1|  DS synthase                                            1154   0.0     
gb|AGI19258.1|  dammarenediol synthase                                 1152   0.0     
gb|AGS16975.1|  dammarenediol synthase II                              1152   0.0     
sp|Q08IT1.1|DADIS_PANGI  RecName: Full=Dammarenediol II synthase       1152   0.0     Panax ginseng [Chinese ginseng]
ref|XP_010245756.1|  PREDICTED: beta-amyrin synthase-like              1008   0.0     
gb|ADX01169.1|  putative beta-amyrin synthase                          1003   0.0     
ref|XP_002270051.2|  PREDICTED: beta-amyrin synthase                    984   0.0     Vitis vinifera
gb|AHF49822.1|  bAS                                                     984   0.0     
emb|CDP08999.1|  unnamed protein product                                981   0.0     
ref|XP_002269395.2|  PREDICTED: beta-amyrin synthase isoform X1         979   0.0     Vitis vinifera
ref|XP_010655672.1|  PREDICTED: beta-amyrin synthase isoform X2         977   0.0     
ref|XP_010063692.1|  PREDICTED: beta-amyrin synthase                    976   0.0     
ref|XP_010245746.1|  PREDICTED: beta-amyrin synthase-like isoform X1    973   0.0     
ref|XP_010245749.1|  PREDICTED: beta-amyrin synthase-like isoform X1    972   0.0     
gb|ABY90140.2|  beta-amyrin synthase                                    972   0.0     Bupleurum chinense
ref|XP_009779988.1|  PREDICTED: beta-amyrin synthase                    968   0.0     
emb|CBI18407.3|  unnamed protein product                                966   0.0     
ref|XP_011093795.1|  PREDICTED: beta-amyrin synthase                    965   0.0     
ref|XP_009612988.1|  PREDICTED: beta-amyrin synthase                    964   0.0     
ref|NP_001234604.1|  beta-amyrin synthase                               964   0.0     
sp|E2IUA6.1|TARS_KALDA  RecName: Full=Taraxerol synthase; Short=K...    964   0.0     
ref|XP_002270934.1|  PREDICTED: beta-amyrin synthase                    964   0.0     Vitis vinifera
ref|XP_010313624.1|  PREDICTED: beta-amyrin synthase isoform X1         962   0.0     
gb|ADK12003.1|  beta-amyrin synthase                                    962   0.0     
sp|Q8W3Z1.1|BAMS_BETPL  RecName: Full=Beta-amyrin synthase              962   0.0     Betula platyphylla [Asian white birch]
gb|AHX97777.1|  beta-amyrin synthase                                    961   0.0     
sp|E2IUA9.1|LUPS_KALDA  RecName: Full=Lupeol synthase; Short=KdLUS      959   0.0     
sp|O82140.1|BAMS1_PANGI  RecName: Full=Beta-Amyrin Synthase 1           958   0.0     Panax ginseng [Chinese ginseng]
gb|EYU38890.1|  hypothetical protein MIMGU_mgv1a001796mg                958   0.0     
ref|XP_011009932.1|  PREDICTED: beta-amyrin synthase-like isoform X1    957   0.0     
ref|XP_006364890.1|  PREDICTED: beta-amyrin synthase-like               957   0.0     
sp|Q9MB42.1|BAMS_GLYGL  RecName: Full=Beta-amyrin synthase              957   0.0     Glycyrrhiza glabra
gb|AIK19223.1|  triterpene synthase                                     956   0.0     
sp|O82146.1|BAMS2_PANGI  RecName: Full=Beta-Amyrin Synthase 2           956   0.0     Panax ginseng [Chinese ginseng]
dbj|BAE53429.1|  beta-amyrin synthase                                   955   0.0     Lotus japonicus
ref|XP_007023608.1|  Beta-Amyrin Synthase                               955   0.0     
gb|AGG09939.1|  beta-amyrin synthase                                    955   0.0     
ref|XP_004488915.1|  PREDICTED: beta-amyrin synthase-like               954   0.0     
dbj|BAE43642.1|  beta-amyrin synthase                                   954   0.0     Euphorbia tirucalli
gb|AAO33580.1|AF478455_1  multifunctional beta-amyrin synthase          954   0.0     Lotus japonicus
ref|XP_010245752.1|  PREDICTED: taraxerol synthase-like                 953   0.0     
ref|XP_006582958.1|  PREDICTED: beta-amyrin synthase isoform X1         953   0.0     
ref|XP_009344015.1|  PREDICTED: beta-amyrin synthase                    953   0.0     
gb|ADE88148.1|  beta-amyrin synthase                                    953   0.0     
ref|XP_010027664.1|  PREDICTED: beta-amyrin synthase-like isoform X1    952   0.0     
ref|XP_004305792.1|  PREDICTED: beta-amyrin synthase-like               951   0.0     
ref|XP_010063691.1|  PREDICTED: beta-amyrin synthase-like               950   0.0     
ref|XP_010531942.1|  PREDICTED: beta-amyrin synthase-like               950   0.0     
gb|KHN39383.1|  Beta-amyrin synthase                                    949   0.0     
gb|ACV21067.1|  beta-amyrin synthase                                    949   0.0     
ref|XP_007214978.1|  hypothetical protein PRUPE_ppa001812mg             949   0.0     
ref|XP_003531781.1|  PREDICTED: beta-amyrin synthase-like isoform 1     949   0.0     
sp|A8CDT2.1|BAS_BRUGY  RecName: Full=Beta-amyrin synthase; Short=...    949   0.0     Bruguiera gymnorhiza [Burma mangrove]
ref|XP_011085901.1|  PREDICTED: beta-amyrin synthase-like               948   0.0     
gb|AIS39794.1|  mixed amyrin synthase 2                                 948   0.0     
gb|AIE17466.1|  oxidosqualene cyclase                                   947   0.0     
ref|XP_010027785.1|  PREDICTED: beta-amyrin synthase-like               947   0.0     
gb|AHI17180.1|  beta-amyrin synthase                                    947   0.0     
gb|ACH88048.1|  beta-amyrin synthase                                    946   0.0     Nigella sativa [black-caraway]
sp|A8C980.1|GERS_RHISY  RecName: Full=Germanicol synthase; Short=...    945   0.0     Rhizophora stylosa
ref|XP_009369010.1|  PREDICTED: beta-amyrin synthase-like               945   0.0     
ref|XP_007214977.1|  hypothetical protein PRUPE_ppa001810mg             945   0.0     
ref|XP_010531951.1|  PREDICTED: camelliol C synthase-like isoform X1    944   0.0     
gb|KHN38108.1|  Beta-amyrin synthase                                    944   0.0     
emb|CDP15852.1|  unnamed protein product                                944   0.0     
ref|XP_007135871.1|  hypothetical protein PHAVU_010G165100g             944   0.0     
ref|XP_010065062.1|  PREDICTED: beta-amyrin synthase-like               943   0.0     
ref|XP_004305793.1|  PREDICTED: beta-amyrin synthase-like               943   0.0     
ref|XP_003604121.1|  Beta-amyrin synthase                               943   0.0     
sp|E2IUA7.1|GLUTS_KALDA  RecName: Full=Glutinol synthase; Short=K...    943   0.0     
gb|AAO33579.1|AF478454_1  putative beta-amyrin synthase                 943   0.0     Lotus japonicus
ref|XP_008380418.1|  PREDICTED: beta-amyrin synthase                    942   0.0     
ref|XP_008228023.1|  PREDICTED: beta-amyrin synthase                    942   0.0     
gb|AFM82492.1|  lupeol synthase                                         942   0.0     
ref|XP_007214979.1|  hypothetical protein PRUPE_ppa001817mg             941   0.0     
gb|AAO33578.1|AF478453_1  beta-amyrin synthase                          941   0.0     Medicago truncatula
gb|AIE17465.1|  oxidosqualene cyclase                                   940   0.0     
ref|XP_006364889.1|  PREDICTED: delta-amyrin synthase-like              939   0.0     
ref|XP_010027674.1|  PREDICTED: beta-amyrin synthase-like isoform X2    937   0.0     
ref|XP_009591746.1|  PREDICTED: beta-amyrin synthase-like               937   0.0     
gb|KEH17471.1|  beta-amyrin synthase                                    937   0.0     
ref|XP_006374734.1|  hypothetical protein POPTR_0014s00350g             937   0.0     
gb|ABL07607.1|  beta-amyrin synthase                                    937   0.0     Polygala tenuifolia [Chinese senega-root]
ref|XP_010537755.1|  PREDICTED: camelliol C synthase-like isoform X1    936   0.0     
gb|ACM89978.1|  putative beta amyrin synthase                           936   0.0     Malus domestica [apple tree]
ref|XP_010696136.1|  PREDICTED: beta-amyrin synthase-like               936   0.0     
ref|XP_010472733.1|  PREDICTED: amyrin synthase LUP2 isoform X1         936   0.0     
ref|XP_010655243.1|  PREDICTED: beta-Amyrin Synthase 1                  936   0.0     
ref|XP_006425178.1|  hypothetical protein CICLE_v10027855mg             935   0.0     
gb|AGA17940.1|  beta-amyrin synthase                                    935   0.0     
ref|XP_010052732.1|  PREDICTED: beta-amyrin synthase-like isoform X1    934   0.0     
ref|NP_001234597.1|  delta-amyrin synthase                              934   0.0     
ref|XP_011031247.1|  PREDICTED: beta-amyrin synthase                    934   0.0     
gb|ACB87531.1|  beta-amyrin synthase                                    934   0.0     Artemisia annua [sweet Annie]
emb|CBI18393.3|  unnamed protein product                                933   0.0     
ref|XP_010063690.1|  PREDICTED: beta-amyrin synthase-like               933   0.0     
ref|XP_002265019.2|  PREDICTED: beta-amyrin synthase-like               932   0.0     Vitis vinifera
gb|ACA13386.1|  beta-amyrin synthase                                    932   0.0     Artemisia annua [sweet Annie]
gb|KEH28511.1|  beta-amyrin synthase                                    932   0.0     
ref|XP_002513298.1|  Cycloartenol synthase, putative                    932   0.0     Ricinus communis
ref|XP_010063688.1|  PREDICTED: beta-amyrin synthase-like               932   0.0     
ref|XP_009344148.1|  PREDICTED: beta-amyrin synthase-like               931   0.0     
gb|ADM89633.1|  beta-amyrin synthase                                    930   0.0     
emb|CBI30890.3|  unnamed protein product                                929   0.0     
ref|XP_006488698.1|  PREDICTED: beta-amyrin synthase-like               929   0.0     
ref|XP_003521102.1|  PREDICTED: beta-amyrin synthase-like isoform X1    929   0.0     
emb|CBI18382.3|  unnamed protein product                                928   0.0     
ref|XP_002269328.2|  PREDICTED: beta-Amyrin Synthase 1-like             928   0.0     Vitis vinifera
ref|XP_006351975.1|  PREDICTED: beta-amyrin synthase-like               927   0.0     
sp|E2IUA8.1|FRIES_KALDA  RecName: Full=Friedelin synthase; Short=...    927   0.0     
gb|EPS65499.1|  beta-amyrin synthase                                    927   0.0     
ref|XP_003521100.1|  PREDICTED: beta-amyrin synthase-like isoformX1     927   0.0     
ref|XP_010417511.1|  PREDICTED: amyrin synthase LUP2-like isoform X2    927   0.0     
ref|XP_010531947.1|  PREDICTED: camelliol C synthase-like isoform X1    926   0.0     
ref|XP_009344016.1|  PREDICTED: beta-amyrin synthase-like               926   0.0     
sp|Q9LRH8.1|BAMS_PEA  RecName: Full=Beta-amyrin synthase                926   0.0     Pisum sativum [garden pea]
gb|AIU41743.1|  beta-amyrin synthase                                    926   0.0     
ref|XP_010429762.1|  PREDICTED: amyrin synthase LUP2-like               926   0.0     
ref|XP_008362478.1|  PREDICTED: beta-amyrin synthase                    926   0.0     
ref|XP_002310349.1|  beta-Amyrin synthase family protein                926   0.0     Populus trichocarpa [western balsam poplar]
gb|ABK76265.1|  beta-amyrin synthase                                    926   0.0     Vaccaria hispanica [bladder-soapwort]
ref|XP_010417510.1|  PREDICTED: amyrin synthase LUP2-like isoform X1    925   0.0     
gb|AFF27505.1|  beta-amyrin synthase                                    925   0.0     
ref|NP_178017.2|  lupeol synthase 2                                     925   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429766.1|  PREDICTED: amyrin synthase LUP2-like isoform X2    924   0.0     
ref|XP_010429765.1|  PREDICTED: amyrin synthase LUP2-like isoform X1    924   0.0     
ref|XP_009779991.1|  PREDICTED: beta-amyrin synthase-like               924   0.0     
ref|XP_009379200.1|  PREDICTED: beta-amyrin synthase-like               924   0.0     
gb|AAC17080.1|  Strong similarity to lupeol synthase gb|U49919 an...    924   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300770.1|  hypothetical protein CARUB_v10019849mg             924   0.0     
ref|NP_683508.1|  camelliol C synthase 1                                924   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417512.1|  PREDICTED: amyrin synthase LUP2-like isoform X3    923   0.0     
ref|XP_010048520.1|  PREDICTED: LOW QUALITY PROTEIN: lupeol synth...    923   0.0     
ref|XP_009104558.1|  PREDICTED: amyrin synthase LUP2-like               923   0.0     
ref|XP_008365649.1|  PREDICTED: beta-amyrin synthase                    923   0.0     
gb|AAG41762.1|AF099968_1  pentacyclic triterpene synthase               923   0.0     
ref|XP_009347735.1|  PREDICTED: beta-amyrin synthase-like               923   0.0     
emb|CDY57947.1|  BnaA07g38460D                                          923   0.0     
ref|XP_008365698.1|  PREDICTED: beta-amyrin synthase-like               923   0.0     
gb|KFK42270.1|  hypothetical protein AALP_AA2G234200                    922   0.0     
ref|XP_006488602.1|  PREDICTED: beta-amyrin synthase-like               922   0.0     
ref|XP_010245750.1|  PREDICTED: beta-amyrin synthase-like isoform X2    922   0.0     
gb|KFK42272.1|  hypothetical protein AALP_AA2G234400                    921   0.0     
ref|XP_006377610.1|  putative oxidosqualene cyclase family protein      921   0.0     
gb|AAS83468.1|  beta-armyrin synthase                                   921   0.0     Bupleurum kaoi
emb|CBI18406.3|  unnamed protein product                                921   0.0     
ref|XP_004507562.1|  PREDICTED: beta-amyrin synthase-like isoform X1    920   0.0     
ref|XP_002887124.1|  ATLUP2                                             920   0.0     
ref|XP_009379199.1|  PREDICTED: beta-amyrin synthase-like               919   0.0     
gb|ACO24697.1|  beta-amyrin synthase                                    919   0.0     Gentiana straminea
ref|XP_006409183.1|  hypothetical protein EUTSA_v10022563mg             918   0.0     
ref|XP_010472735.1|  PREDICTED: amyrin synthase LUP2 isoform X2         918   0.0     
ref|XP_002889222.1|  hypothetical protein ARALYDRAFT_316793             918   0.0     
ref|XP_002271333.1|  PREDICTED: beta-Amyrin Synthase 1 isoform X1       917   0.0     Vitis vinifera
ref|XP_011006636.1|  PREDICTED: beta-amyrin synthase-like               916   0.0     
ref|XP_006301366.1|  hypothetical protein CARUB_v10021777mg             916   0.0     
ref|XP_010669609.1|  PREDICTED: lupeol synthase-like                    915   0.0     
dbj|BAA86930.1|  lupeol synthase                                        915   0.0     Olea europaea
ref|XP_006389936.1|  hypothetical protein EUTSA_v10018166mg             915   0.0     
ref|XP_011009936.1|  PREDICTED: beta-amyrin synthase-like isoform X3    914   0.0     
ref|XP_004251564.1|  PREDICTED: beta-amyrin synthase-like isoform X1    914   0.0     
ref|XP_011009935.1|  PREDICTED: beta-amyrin synthase-like isoform X2    914   0.0     
ref|XP_004309763.1|  PREDICTED: beta-amyrin synthase-like               914   0.0     
ref|XP_007023364.1|  Beta-Amyrin Synthase                               913   0.0     
gb|AAX14716.1|  beta-amyrin synthase                                    913   0.0     Aster sedifolius
ref|XP_010252186.1|  PREDICTED: lupeol synthase-like                    911   0.0     
sp|Q2XPU7.1|LUPS_RICCO  RecName: Full=Lupeol synthase                   910   0.0     Ricinus communis
gb|AAC17070.1|  Strong similarity to lupeol synthase gb|U49919 fr...    910   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_007023363.1|  Terpenoid cyclases family protein                  908   0.0     
ref|XP_009106612.1|  PREDICTED: camelliol C synthase                    907   0.0     
emb|CDX88493.1|  BnaC06g39370D                                          907   0.0     
sp|B9X0J1.1|STBOS_STERE  RecName: Full=Baccharis oxide synthase; ...    907   0.0     Stevia rebaudiana
ref|XP_007014712.1|  Beta-Amyrin Synthase isoform 1                     906   0.0     
ref|XP_011031246.1|  PREDICTED: beta-amyrin synthase-like               906   0.0     
gb|KHG28038.1|  Beta-amyrin synthase                                    906   0.0     
ref|XP_006409184.1|  hypothetical protein EUTSA_v10022563mg             905   0.0     
gb|KFK42271.1|  hypothetical protein AALP_AA2G234300                    904   0.0     
gb|KFK40207.1|  hypothetical protein AALP_AA3G344300                    904   0.0     
gb|KEH18380.1|  beta-amyrin synthase                                    904   0.0     
dbj|BAE53430.1|  lupeol synthase                                        904   0.0     Lotus japonicus
sp|F8WQD0.1|SHS1_ASTTA  RecName: Full=Shionone synthase; Short=At...    902   0.0     
ref|XP_006300769.1|  hypothetical protein CARUB_v10019844mg             900   0.0     
emb|CAN77299.1|  hypothetical protein VITISV_033299                     900   0.0     Vitis vinifera
ref|XP_010539602.1|  PREDICTED: camelliol C synthase-like isoform X5    899   0.0     
ref|XP_002310351.1|  hypothetical protein POPTR_0007s15210g             899   0.0     Populus trichocarpa [western balsam poplar]
gb|KHN00954.1|  Lupeol synthase                                         899   0.0     
gb|KEH27290.1|  beta-amyrin synthase                                    899   0.0     
ref|XP_006606308.1|  PREDICTED: lupeol synthase-like isoform X1         899   0.0     
dbj|BAF35580.1|  multifunctional triterpene synthase                    898   0.0     Kandelia candel
dbj|BAE43643.1|  putative oxidosqulene cyclase                          897   0.0     Euphorbia tirucalli
ref|NP_178016.2|  beta-amyrin synthase                                  896   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006389937.1|  hypothetical protein EUTSA_v10018165mg             895   0.0     
emb|CDX87419.1|  BnaA07g34540D                                          895   0.0     
emb|CAN65909.1|  hypothetical protein VITISV_001242                     895   0.0     Vitis vinifera
ref|XP_010429761.1|  PREDICTED: beta-amyrin synthase                    894   0.0     
ref|XP_010313621.1|  PREDICTED: delta-amyrin synthase isoform X1        894   0.0     
emb|CDY35103.1|  BnaA06g11130D                                          894   0.0     
ref|XP_010472731.1|  PREDICTED: camelliol C synthase-like isoform X1    893   0.0     
ref|XP_009106614.1|  PREDICTED: amyrin synthase LUP2                    893   0.0     
ref|XP_003530475.1|  PREDICTED: lupeol synthase isoform 1               892   0.0     
ref|XP_009364429.1|  PREDICTED: beta-amyrin synthase-like               891   0.0     
sp|Q9LRH7.1|ABAMS_PEA  RecName: Full=Mixed-amyrin synthase              891   0.0     Pisum sativum [garden pea]
ref|XP_007153005.1|  hypothetical protein PHAVU_004G178500g             891   0.0     
ref|XP_002305339.1|  putative oxidosqualene cyclase family protein      890   0.0     Populus trichocarpa [western balsam poplar]
dbj|BAG82628.1|  beta-amyrin synthase                                   890   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009337925.1|  PREDICTED: beta-amyrin synthase-like               890   0.0     
emb|CDX88494.1|  BnaC06g39380D                                          889   0.0     
ref|XP_009786280.1|  PREDICTED: lupeol synthase                         889   0.0     
ref|XP_009149097.1|  PREDICTED: amyrin synthase LUP2-like               889   0.0     
ref|XP_002887763.1|  ATLUP2                                             889   0.0     
ref|XP_002264289.1|  PREDICTED: cycloartenol Synthase                   889   0.0     Vitis vinifera
sp|Q8W3Z2.1|LUPS_BETPL  RecName: Full=Lupeol synthase                   888   0.0     Betula platyphylla [Asian white birch]
ref|NP_001236591.1|  beta-amyrin synthase                               887   0.0     
ref|XP_008223938.1|  PREDICTED: cycloartenol synthase 2                 887   0.0     
emb|CBI18408.3|  unnamed protein product                                887   0.0     
ref|XP_006450022.1|  hypothetical protein CICLE_v10013952mg             887   0.0     
ref|XP_010532332.1|  PREDICTED: camelliol C synthase-like               887   0.0     
gb|AIK19225.1|  triterpene synthase                                     887   0.0     
ref|XP_010095206.1|  Lupeol synthase                                    886   0.0     
ref|XP_006468116.1|  PREDICTED: beta-amyrin synthase-like               886   0.0     
ref|XP_010655249.1|  PREDICTED: beta-amyrin synthase                    886   0.0     
ref|XP_004510379.1|  PREDICTED: mixed-amyrin synthase-like              885   0.0     
emb|CAN60556.1|  hypothetical protein VITISV_020304                     885   0.0     Vitis vinifera
gb|AIK21791.1|  beta-amyrin synthase                                    885   0.0     
ref|XP_002304910.2|  putative oxidosqualene cyclase family protein      885   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_007225240.1|  hypothetical protein PRUPE_ppa001844mg             884   0.0     
ref|XP_010054047.1|  PREDICTED: beta-amyrin synthase-like               884   0.0     
gb|KCW83375.1|  hypothetical protein EUGRSUZ_B00308                     884   0.0     
ref|XP_002530442.1|  Cycloartenol synthase, putative                    884   0.0     Ricinus communis
ref|XP_002269060.2|  PREDICTED: lupeol synthase isoform X1              884   0.0     Vitis vinifera
ref|XP_010656689.1|  PREDICTED: lupeol synthase isoform X2              884   0.0     
gb|KDP37006.1|  hypothetical protein JCGZ_06062                         883   0.0     
emb|CBI24038.3|  unnamed protein product                                883   0.0     
dbj|BAA86932.1|  lupeol synthase                                        882   0.0     Taraxacum officinale [dandelion]
gb|AIK19224.1|  triterpene synthase                                     882   0.0     
dbj|BAL41371.1|  lupeol synthase                                        882   0.0     
sp|A8CDT3.1|LUPS_BRUGY  RecName: Full=Lupeol synthase; Short=BgLUS      882   0.0     Bruguiera gymnorhiza [Burma mangrove]
ref|XP_011037652.1|  PREDICTED: beta-amyrin synthase-like               882   0.0     
ref|XP_010655247.1|  PREDICTED: beta-Amyrin Synthase 1 isoform X2       881   0.0     
ref|XP_006468107.1|  PREDICTED: beta-amyrin synthase-like               881   0.0     
ref|XP_009345284.1|  PREDICTED: cycloartenol synthase 2-like            880   0.0     
ref|XP_011034490.1|  PREDICTED: lupeol synthase-like isoform X1         880   0.0     
ref|XP_010417513.1|  PREDICTED: amyrin synthase LUP2-like isoform X4    880   0.0     
ref|XP_006436395.1|  hypothetical protein CICLE_v10030771mg             880   0.0     
ref|XP_009370034.1|  PREDICTED: cycloartenol synthase 2                 879   0.0     
gb|KCW70932.1|  hypothetical protein EUGRSUZ_F04049                     879   0.0     
ref|XP_006374737.1|  hypothetical protein POPTR_0014s00370g             879   0.0     
ref|XP_010531952.1|  PREDICTED: camelliol C synthase-like isoform X2    879   0.0     
sp|Q9SXV6.1|CAS1_GLYGL  RecName: Full=Cycloartenol synthase             878   0.0     Glycyrrhiza glabra
sp|Q764T8.1|LUPS_GLYGL  RecName: Full=Lupeol synthase; Short=GgLUS1     878   0.0     Glycyrrhiza glabra
ref|XP_010244585.1|  PREDICTED: cycloartenol synthase 2 isoform X1      877   0.0     
emb|CDP08328.1|  unnamed protein product                                877   0.0     
gb|KDP27754.1|  hypothetical protein JCGZ_19783                         877   0.0     
gb|KCW80789.1|  hypothetical protein EUGRSUZ_C02165                     877   0.0     
ref|XP_004299756.1|  PREDICTED: cycloartenol synthase-like              877   0.0     
sp|Q948R6.1|IMFS_LUFAE  RecName: Full=Isomultiflorenol synthase; ...    877   0.0     Luffa aegyptiaca [dishcloth gourd]
gb|KDP25033.1|  hypothetical protein JCGZ_22568                         876   0.0     
ref|XP_006353758.1|  PREDICTED: lupeol synthase-like                    876   0.0     
ref|XP_007019802.1|  Cycloartenol synthase 1 isoform 1                  876   0.0     
dbj|BAE53431.1|  cycloartenol synthase                                  876   0.0     
gb|AHY94897.1|  cycloartenol synthase                                   875   0.0     
gb|AGG09938.1|  beta-amyrin synthase                                    875   0.0     
ref|XP_006468103.1|  PREDICTED: beta-amyrin synthase-like               875   0.0     
ref|XP_010669612.1|  PREDICTED: lupeol synthase-like                    874   0.0     
ref|XP_010656690.1|  PREDICTED: lupeol synthase isoform X3              873   0.0     
ref|XP_010271332.1|  PREDICTED: cycloartenol Synthase isoform X2        873   0.0     
ref|XP_010413093.1|  PREDICTED: cycloartenol synthase                   873   0.0     
ref|XP_009136183.1|  PREDICTED: cycloartenol synthase                   873   0.0     
ref|XP_007147805.1|  hypothetical protein PHAVU_006G156500g             873   0.0     
sp|Q8W3Z3.1|CAS2_BETPL  RecName: Full=Cycloartenol synthase 2           873   0.0     
ref|XP_009102615.1|  PREDICTED: cycloartenol synthase-like              872   0.0     
ref|XP_006374736.1|  hypothetical protein POPTR_0014s00370g             872   0.0     
gb|KEH25838.1|  beta-amyrin synthase                                    871   0.0     
emb|CAM91422.1|  cycloartenol synthase                                  871   0.0     
ref|XP_010488811.1|  PREDICTED: cycloartenol synthase-like              870   0.0     
gb|AIU41742.1|  cycloartenol synthase                                   870   0.0     
ref|XP_009362029.1|  PREDICTED: cycloartenol synthase 2-like            870   0.0     
gb|AET01563.2|  beta-amyrin synthase                                    870   0.0     
ref|XP_004243674.1|  PREDICTED: lupeol synthase isoform X1              870   0.0     
gb|AGC82084.1|  beta amyrn synthase                                     870   0.0     
ref|XP_010271331.1|  PREDICTED: cycloartenol Synthase isoform X1        870   0.0     
emb|CBD47302.1|  cycloartenol synthase                                  870   0.0     
ref|XP_010467143.1|  PREDICTED: cycloartenol synthase-like              870   0.0     
ref|XP_007019803.1|  Cycloartenol synthase 1 isoform 2                  870   0.0     
ref|XP_010065064.1|  PREDICTED: beta-amyrin synthase-like               869   0.0     
ref|XP_010541955.1|  PREDICTED: cycloartenol synthase                   869   0.0     
ref|XP_010531948.1|  PREDICTED: camelliol C synthase-like isoform X2    869   0.0     
ref|XP_006296684.1|  hypothetical protein CARUB_v10013036mg             869   0.0     
ref|XP_011094034.1|  PREDICTED: cycloartenol Synthase                   868   0.0     
ref|XP_006362808.1|  PREDICTED: cycloartenol Synthase-like isofor...    868   0.0     
ref|XP_002883756.1|  cycloartenol synthase                              868   0.0     
gb|AIY33888.1|  cycloartenol synthase                                   867   0.0     
emb|CDX93093.1|  BnaA03g38150D                                          867   0.0     
gb|AAC04931.1|  cycloartenol synthase                                   867   0.0     
ref|NP_178722.1|  cycloartenol synthase                                 867   0.0     
ref|XP_009620777.1|  PREDICTED: cycloartenol Synthase-like isofor...    867   0.0     
ref|XP_002299271.2|  hypothetical protein POPTR_0001s14610g             867   0.0     
ref|XP_006371457.1|  hypothetical protein POPTR_0019s10800g             867   0.0     
ref|XP_004156484.1|  PREDICTED: LOW QUALITY PROTEIN: isomultiflor...    867   0.0     
ref|XP_010537757.1|  PREDICTED: camelliol C synthase-like isoform X3    866   0.0     
sp|Q2XPU6.1|CAS1_RICCO  RecName: Full=Cycloartenol synthase; Shor...    866   0.0     
dbj|BAB83253.1|  cycloartenol synthase                                  866   0.0     
ref|XP_006372242.1|  cycloartenol synthase family protein               866   0.0     
ref|XP_008391430.1|  PREDICTED: cycloartenol synthase 2 isoform X1      865   0.0     
ref|XP_010537756.1|  PREDICTED: camelliol C synthase-like isoform X2    865   0.0     
gb|KHG28306.1|  Beta-amyrin synthase                                    865   0.0     
emb|CDY50938.1|  BnaC03g74380D                                          865   0.0     
ref|XP_006396089.1|  hypothetical protein EUTSA_v10002412mg             865   0.0     
ref|XP_010677527.1|  PREDICTED: cycloartenol synthase 2                 865   0.0     
gb|KFK39919.1|  hypothetical protein AALP_AA3G306200                    864   0.0     
ref|XP_008228019.1|  PREDICTED: beta-amyrin synthase-like               864   0.0     
gb|ABY60426.1|  cycloartenol synthase                                   864   0.0     
ref|XP_006468104.1|  PREDICTED: beta-amyrin synthase-like isoform X1    864   0.0     
gb|AAS01524.1|  cycloartenol synthase                                   864   0.0     
gb|EYU25764.1|  hypothetical protein MIMGU_mgv1a024154mg                863   0.0     
gb|KHN32929.1|  Cycloartenol synthase                                   863   0.0     
ref|XP_002513299.1|  Cycloartenol synthase, putative                    863   0.0     
ref|NP_176868.1|  Terpenoid cyclases family protein                     863   0.0     
ref|XP_007153003.1|  hypothetical protein PHAVU_004G178300g             863   0.0     
ref|XP_002887764.1|  hypothetical protein ARALYDRAFT_477065             863   0.0     
ref|XP_010655670.1|  PREDICTED: beta-amyrin synthase                    862   0.0     
emb|CDP12480.1|  unnamed protein product                                862   0.0     
ref|XP_007147800.1|  hypothetical protein PHAVU_006G156000g             862   0.0     
ref|XP_003516849.1|  PREDICTED: cycloartenol synthase                   862   0.0     
emb|CDX77512.1|  BnaA07g06500D                                          862   0.0     
ref|XP_007160210.1|  hypothetical protein PHAVU_002G302200g             862   0.0     
sp|O82139.1|CAS1_PANGI  RecName: Full=Cycloartenol Synthase             861   0.0     
ref|XP_007147811.1|  hypothetical protein PHAVU_006G156900g             861   0.0     
ref|XP_004139371.1|  PREDICTED: isomultiflorenol synthase-like          860   0.0     
ref|NP_001233784.1|  cycloartenol synthase                              860   0.0     
ref|XP_004513124.1|  PREDICTED: cycloartenol synthase-like              860   0.0     
gb|AGK62447.1|  cycloartenol synthase                                   860   0.0     
gb|AAD05032.1|  lupeol synthase                                         859   0.0     
ref|XP_002308131.2|  cycloartenol synthase family protein               859   0.0     
ref|NP_178018.1|  lupeol synthase 1                                     859   0.0     
gb|ADG60271.1|  cycloartenol synthase                                   858   0.0     
gb|AIW81530.1|  cycloartenol synthase protein                           857   0.0     
dbj|BAA23533.1|  cycloartenol synthase                                  857   0.0     
ref|XP_006306840.1|  hypothetical protein CARUB_v10008384mg             857   0.0     
gb|AAB94341.1|  2,3-oxidosqualene-triterpenoid cyclase                  857   0.0     
ref|XP_008455462.1|  PREDICTED: LOW QUALITY PROTEIN: isomultiflor...    857   0.0     
ref|XP_006850984.1|  hypothetical protein AMTR_s00025p00210690          857   0.0     
gb|AFS49705.1|  cycloartenol synthase                                   856   0.0     
gb|AAG44096.1|AF216755_1  cycloartenol synthase                         856   0.0     
ref|XP_008462187.1|  PREDICTED: isomultiflorenol synthase               856   0.0     
gb|KEH22226.1|  beta-amyrin synthase                                    853   0.0     
ref|XP_009409584.1|  PREDICTED: cycloartenol synthase-like              855   0.0     
gb|AFC67276.1|  cycloartenol synthase                                   854   0.0     
gb|KHN16704.1|  Lupeol synthase                                         852   0.0     
ref|XP_006403308.1|  hypothetical protein EUTSA_v10003155mg             852   0.0     
ref|XP_008228021.1|  PREDICTED: cycloartenol synthase                   852   0.0     
gb|ADC84219.1|  putative 2,3 oxidosqualene cyclase                      851   0.0     
ref|XP_007214976.1|  hypothetical protein PRUPE_ppa001806mg             849   0.0     
ref|XP_007214975.1|  hypothetical protein PRUPE_ppa001797mg             849   0.0     
gb|KHG12373.1|  Cycloartenol synthase 2                                 848   0.0     
ref|XP_006646871.1|  PREDICTED: cycloartenol synthase-like              848   0.0     
dbj|BAF73929.1|  cycloartenol synthase                                  848   0.0     
ref|XP_004156436.1|  PREDICTED: isomultiflorenol synthase-like is...    848   0.0     
ref|XP_011017592.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    848   0.0     
ref|XP_002527337.1|  Cycloartenol synthase, putative                    847   0.0     
gb|AGC82085.1|  cycloartenol synthase protein                           847   0.0     
ref|XP_007147801.1|  hypothetical protein PHAVU_006G156100g             847   0.0     
ref|XP_008348400.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    847   0.0     
ref|XP_004513125.1|  PREDICTED: lupeol synthase-like                    846   0.0     
gb|AAS83469.1|  cycloartenol synthase                                   845   0.0     
ref|XP_004141834.1|  PREDICTED: isomultiflorenol synthase-like          846   0.0     
gb|EYU25760.1|  hypothetical protein MIMGU_mgv1a001797mg                845   0.0     
gb|AGF87141.1|  cycloartenol synthase                                   845   0.0     
ref|XP_008353809.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amyrin ...    843   0.0     
gb|KEH25840.1|  beta-amyrin synthase                                    845   0.0     
ref|XP_003610947.1|  Cycloartenol synthase                              845   0.0     
ref|XP_011019951.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    845   0.0     
ref|XP_010927167.1|  PREDICTED: cycloartenol synthase-like              843   0.0     
sp|E2IUB0.1|CASS_KALDA  RecName: Full=Cycloartenol synthase; Shor...    843   0.0     
ref|XP_006484812.1|  PREDICTED: cycloartenol synthase 2-like            843   0.0     
gb|AET01567.2|  beta-amyrin synthase                                    841   0.0     
gb|AAC98864.1|  pentacyclic triterpene synthase                         839   0.0     
ref|XP_004308480.1|  PREDICTED: lupeol synthase-like                    842   0.0     
ref|XP_003627091.1|  Beta-amyrin synthase                               840   0.0     
gb|AEM42981.1|  cycloartenol synthase                                   842   0.0     
ref|XP_006368912.1|  hypothetical protein POPTR_0001s14610g             841   0.0     
ref|XP_004303790.1|  PREDICTED: cycloartenol synthase-like              841   0.0     
emb|CAN65908.1|  hypothetical protein VITISV_001241                     841   0.0     
ref|NP_001045848.1|  Os02g0139700                                       841   0.0     
ref|XP_002888561.1|  hypothetical protein ARALYDRAFT_475791             839   0.0     
gb|KDP37007.1|  hypothetical protein JCGZ_06063                         837   0.0     
emb|CDP14235.1|  unnamed protein product                                835   0.0     
dbj|BAF73930.1|  cycloartenol synthase                                  837   0.0     
gb|AEO27878.1|  cycloartenol synthases                                  837   0.0     
gb|ABX75046.1|  cycloartenol synthase 1                                 837   0.0     
ref|XP_006340479.1|  PREDICTED: cycloartenol Synthase-like              837   0.0     
ref|XP_009764017.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    836   0.0     
ref|XP_006474339.1|  PREDICTED: cycloartenol synthase 2-like isof...    836   0.0     
ref|XP_006453168.1|  hypothetical protein CICLE_v10007532mg             836   0.0     
gb|KEH33351.1|  beta-amyrin synthase                                    833   0.0     
gb|AAF03375.1|AF169966_1  putative cycloartenol synthase                835   0.0     
ref|XP_002453283.1|  hypothetical protein SORBIDRAFT_04g003200          835   0.0     
ref|XP_007023625.1|  Cycloartenol synthase 1                            835   0.0     
gb|AAT38889.1|  cycloartenol synthase                                   834   0.0     
ref|XP_010927164.1|  PREDICTED: cycloartenol Synthase-like isofor...    836   0.0     
ref|XP_011034491.1|  PREDICTED: lupeol synthase-like isoform X2         832   0.0     
emb|CDX85104.1|  BnaC07g08020D                                          833   0.0     
emb|CAC84559.1|  cycloartenol synthase                                  833   0.0     
gb|AGA17939.1|  lupeol synthase                                         833   0.0     
gb|AAT38888.1|  cycloartenol synthase                                   832   0.0     
ref|XP_010539599.1|  PREDICTED: camelliol C synthase-like isoform X2    830   0.0     
ref|XP_010906067.1|  PREDICTED: cycloartenol synthase-like              831   0.0     
dbj|BAA84603.1|  oxidosqualene cyclase                                  831   0.0     
gb|AAT38891.1|  cycloartenol synthase                                   831   0.0     
gb|KHN33083.1|  Beta-amyrin synthase                                    830   0.0     
gb|AAT38890.1|  cycloartenol synthase                                   830   0.0     
ref|XP_004289557.1|  PREDICTED: beta-amyrin synthase-like               830   0.0     
ref|XP_004303791.1|  PREDICTED: beta-amyrin synthase-like               829   0.0     
ref|NP_001168640.1|  hypothetical protein                               829   0.0     
gb|KHG27893.1|  Cycloartenol synthase                                   828   0.0     
gb|AAT38892.1|  cycloartenol synthase                                   828   0.0     
sp|A8C981.1|TARS_RHISY  RecName: Full=Taraxerol synthase; Short=RsM2    828   0.0     
gb|AAT38887.1|  cycloartenol synthase                                   828   0.0     
ref|XP_010534788.1|  PREDICTED: seco-amyrin synthase-like               827   0.0     
ref|XP_008240807.1|  PREDICTED: lupeol synthase-like                    827   0.0     
ref|XP_009379198.1|  PREDICTED: cycloartenol synthase-like              827   0.0     
sp|Q8W3Z4.1|CAS1_BETPL  RecName: Full=Cycloartenol synthase             827   0.0     
ref|XP_002262960.1|  PREDICTED: cycloartenol Synthase-like              825   0.0     
dbj|BAB83254.1|  multifunctional triterpene synthase                    825   0.0     
ref|XP_008679954.1|  PREDICTED: cycloartenol synthase isoform X1        825   0.0     
ref|XP_010539597.1|  PREDICTED: camelliol C synthase-like isoform X1    822   0.0     
ref|XP_011009937.1|  PREDICTED: beta-amyrin synthase-like isoform X4    819   0.0     
ref|XP_008462186.1|  PREDICTED: cycloartenol synthase                   823   0.0     
ref|XP_004141754.1|  PREDICTED: cycloartenol synthase-like              823   0.0     
sp|Q9SLP9.1|CAS1_LUFAE  RecName: Full=Cycloartenol synthase; Shor...    823   0.0     
ref|XP_004159000.1|  PREDICTED: cycloartenol synthase-like              822   0.0     
ref|XP_008228020.1|  PREDICTED: beta-amyrin synthase-like               822   0.0     
ref|XP_007134028.1|  hypothetical protein PHAVU_010G013200g             821   0.0     
ref|XP_003574426.1|  PREDICTED: cycloartenol synthase                   821   0.0     
ref|XP_010098882.1|  hypothetical protein L484_012176                   821   0.0     
sp|Q6BE25.1|CAS1_CUCPE  RecName: Full=Cycloartenol synthase             820   0.0     
gb|AFW80117.1|  hypothetical protein ZEAMMB73_095189                    820   0.0     
ref|XP_007214981.1|  hypothetical protein PRUPE_ppa001830mg             819   0.0     
gb|KFK33872.1|  hypothetical protein AALP_AA5G071200                    817   0.0     
ref|XP_007224874.1|  hypothetical protein PRUPE_ppa022710mg             820   0.0     
ref|XP_008655662.1|  PREDICTED: cycloartenol synthase-like isofor...    819   0.0     
ref|XP_010068963.1|  PREDICTED: cycloartenol Synthase-like              818   0.0     
gb|AEM42982.1|  cucurbitadienol synthase                                818   0.0     
ref|XP_008655663.1|  PREDICTED: cycloartenol synthase-like isofor...    818   0.0     
ref|XP_010323971.1|  PREDICTED: lupeol synthase isoform X2              815   0.0     
ref|XP_010545605.1|  PREDICTED: seco-amyrin synthase-like               816   0.0     
ref|XP_007025071.1|  Beta-Amyrin Synthase, putative                     815   0.0     
ref|XP_010313692.1|  PREDICTED: delta-amyrin synthase-like isofor...    813   0.0     
ref|XP_002527812.1|  Cycloartenol synthase, putative                    813   0.0     
ref|XP_004951930.1|  PREDICTED: cycloartenol synthase-like              812   0.0     
ref|XP_007023369.1|  Beta-Amyrin Synthase                               810   0.0     
ref|XP_003604122.1|  Beta-amyrin synthase                               809   0.0     
ref|XP_004975971.1|  PREDICTED: cycloartenol synthase-like              812   0.0     
ref|XP_009117329.1|  PREDICTED: seco-amyrin synthase-like               812   0.0     
ref|XP_010927163.1|  PREDICTED: cycloartenol synthase-like isofor...    814   0.0     
ref|XP_010533174.1|  PREDICTED: seco-amyrin synthase-like               812   0.0     
ref|XP_002269849.1|  PREDICTED: cycloartenol synthase                   811   0.0     
ref|XP_006436398.1|  hypothetical protein CICLE_v10033377mg             808   0.0     
ref|XP_003632939.1|  PREDICTED: cycloartenol synthase-like              810   0.0     
ref|XP_008465722.1|  PREDICTED: beta-amyrin synthase-like isoform X1    810   0.0     
emb|CDX79277.1|  BnaC06g20260D                                          807   0.0     
ref|XP_010495860.1|  PREDICTED: tirucalladienol synthase-like           810   0.0     
dbj|BAF93208.1|  cycloartenol synthase                                  809   0.0     
ref|XP_011031251.1|  PREDICTED: cycloartenol synthase-like              808   0.0     
ref|XP_010048521.1|  PREDICTED: cycloartenol synthase-like              808   0.0     
ref|XP_004140567.1|  PREDICTED: cucurbitadienol synthase-like           807   0.0     
ref|XP_008459938.1|  PREDICTED: cucurbitadienol synthase                808   0.0     
ref|XP_004305790.1|  PREDICTED: beta-amyrin synthase-like               807   0.0     
emb|CBI30907.3|  unnamed protein product                                880   0.0     
emb|CAN82129.1|  hypothetical protein VITISV_040666                     804   0.0     
ref|NP_001280946.1|  beta-amyrin synthase                               806   0.0     
ref|XP_002310905.1|  hypothetical protein POPTR_0007s15200g             806   0.0     
ref|XP_004299757.1|  PREDICTED: cycloartenol synthase-like              806   0.0     
ref|XP_010655242.1|  PREDICTED: cycloartenol synthase-like              806   0.0     
ref|XP_010067808.1|  PREDICTED: cycloartenol synthase 2-like isof...    806   0.0     
ref|XP_009346737.1|  PREDICTED: cycloartenol synthase-like              806   0.0     
ref|XP_010502925.1|  PREDICTED: tirucalladienol synthase-like           806   0.0     
ref|XP_009379194.1|  PREDICTED: beta-amyrin synthase                    805   0.0     
ref|XP_009334975.1|  PREDICTED: beta-amyrin synthase-like               805   0.0     
ref|XP_010531955.1|  PREDICTED: camelliol C synthase-like isoform X5    801   0.0     



>ref|XP_011096562.1| PREDICTED: dammarenediol II synthase-like [Sesamum indicum]
 ref|XP_011096564.1| PREDICTED: dammarenediol II synthase-like [Sesamum indicum]
Length=761

 Score =  1274 bits (3297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/756 (77%), Positives = 667/756 (88%), Gaps = 0/756 (0%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI EG GPY+YSTNN+ GRQIWEYDPN GTPEE++AF+KAR+ F + R+KG H+C 
Sbjct  1     MWKLKIAEGHGPYLYSTNNFVGRQIWEYDPNGGTPEERQAFQKAREEFNENRKKGFHSCA  60

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DLFMRMQ+ +ES +D+LSIPPVR+ E+EEV YEA T AV+KA+RLN A+QA DGHWPAEN
Sbjct  61    DLFMRMQLKRESGIDLLSIPPVRVGEKEEVTYEAATIAVKKALRLNRAVQASDGHWPAEN  120

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GP+FFTPPL+IALYISG+I+ ILTSEHKKE+VRY+YNHQNEDGGWG YI+GHSTMIGSA
Sbjct  121   AGPMFFTPPLLIALYISGAINTILTSEHKKEMVRYIYNHQNEDGGWGFYIEGHSTMIGSA  180

Query  1883  LNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLSP  1704
             L+YVALR+LGEGPDDG+GA+AR RKWILDHGGAT IPSWGK YLSVLGVYEWDGCNPL P
Sbjct  181   LSYVALRILGEGPDDGNGAVARARKWILDHGGATGIPSWGKTYLSVLGVYEWDGCNPLPP  240

Query  1703  EFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQIDW  1524
             EFWLFPS  P+HPAKMWCYCRTTYMPMSYLY ++Y GPLTD+VL++R EIHVK Y+QIDW
Sbjct  241   EFWLFPSVLPYHPAKMWCYCRTTYMPMSYLYGRKYHGPLTDLVLSIRQEIHVKPYDQIDW  300

Query  1523  NQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEAE  1344
             N+AR  CCK+DLYYPH+FIQDLLW+ L YCTEPFMRRWP  KIR+ AM KAIKYMRY AE
Sbjct  301   NKARHDCCKDDLYYPHTFIQDLLWDTLNYCTEPFMRRWPLNKIRQKAMDKAIKYMRYGAE  360

Query  1343  ETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDAA  1164
             E+RYITIGC+EKSLQMMCWWA DPN DE K+HLARVPDYLWLAEDGM M  FGSQ WD+ 
Sbjct  361   ESRYITIGCVEKSLQMMCWWAHDPNCDEFKHHLARVPDYLWLAEDGMKMQSFGSQIWDST  420

Query  1163  FATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHGW  984
              ATQA+IASGMV+EYGDCL+K HFY+KESQ+KENPKGD  +MYRH TKG+WTFSDQD GW
Sbjct  421   LATQAVIASGMVDEYGDCLKKAHFYVKESQIKENPKGDHTAMYRHFTKGAWTFSDQDQGW  480

Query  983   AVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVPQ  804
              VSDCTAE LKCLLLL +MP +I GEK DV+RLYEAV+V LYLQSP SGGFA WEPP+PQ
Sbjct  481   VVSDCTAEALKCLLLLSQMPTEIAGEKADVERLYEAVNVLLYLQSPLSGGFAIWEPPIPQ  540

Query  803   PYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLEK  624
             PYLQVLNPSE+FADIVVE+EH+E T SI+ AL+AF+  +P +R KE+ IS+AKA+Q+LE+
Sbjct  541   PYLQVLNPSELFADIVVEQEHVECTASIVQALLAFKRLHPGHREKEIEISVAKALQFLEE  600

Query  623   QQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGEC  444
             +Q  DGSWYGYWG+CFLYGTFF L GL AAGK+YEN EAV    +FFLS QN+EGGWGE 
Sbjct  601   KQWPDGSWYGYWGICFLYGTFFVLGGLAAAGKTYENSEAVRKGVNFFLSTQNEEGGWGES  660

Query  443   LQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDFP  264
             L+SCPSM+Y PLEG  TNLVQTSWAMLGL+ +GQAERDPTPLHRAAKLLINAQM+DGDFP
Sbjct  661   LESCPSMKYTPLEGNRTNLVQTSWAMLGLLQSGQAERDPTPLHRAAKLLINAQMDDGDFP  720

Query  263   QQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             QQ+ITGVYMKNCMLHYA +R+ FPL AL EYRKRVW
Sbjct  721   QQEITGVYMKNCMLHYAQYRNIFPLWALGEYRKRVW  756



>emb|CDP12624.1| unnamed protein product [Coffea canephora]
Length=761

 Score =  1269 bits (3284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/756 (77%), Positives = 662/756 (88%), Gaps = 0/756 (0%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI EG GPY+YSTNN+AGRQIWEYD NAGTPEE+EAFEKAR+ FTK R+KG H CG
Sbjct  1     MWKLKIAEGHGPYLYSTNNFAGRQIWEYDSNAGTPEEREAFEKAREEFTKNRKKGVHPCG  60

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DLFMRMQ+IKES +D+LSIPP+RL E EE  YE  T AV+KA+RLN A+QA DGHWPAEN
Sbjct  61    DLFMRMQLIKESGIDLLSIPPIRLGENEEATYENTTIAVKKALRLNRAIQASDGHWPAEN  120

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GP+FFTPPL+IALYISG+I+ ILT EHKKE++RY+YNHQN+DGGWG YI+GHSTMIGSA
Sbjct  121   AGPMFFTPPLLIALYISGAINTILTKEHKKEMIRYIYNHQNDDGGWGFYIEGHSTMIGSA  180

Query  1883  LNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLSP  1704
             L+YVALR+LGEGPDDG+GA+AR RKWILDHGGAT IPSWGK YLSVLGVY+WDGCNP+ P
Sbjct  181   LSYVALRILGEGPDDGNGAVARARKWILDHGGATGIPSWGKTYLSVLGVYDWDGCNPVPP  240

Query  1703  EFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQIDW  1524
             EFWLFP  FP+HPAKMWCYCRTTYMPMSYLY K+Y GPLTD+V++LR EIHVK Y+QIDW
Sbjct  241   EFWLFPEFFPYHPAKMWCYCRTTYMPMSYLYGKKYHGPLTDLVMSLRQEIHVKPYDQIDW  300

Query  1523  NQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEAE  1344
             N+AR  CC EDLYYPHS IQDLLW+ L YCTEP MRRWP  KIRE AM KAIKYMRY AE
Sbjct  301   NKARHDCCTEDLYYPHSRIQDLLWDTLNYCTEPIMRRWPLNKIRERAMDKAIKYMRYGAE  360

Query  1343  ETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDAA  1164
             E+RYITIGC+EKSLQMMCWWA DPN DE KYHLARVPDYLWLAEDGM M  FGSQ WD A
Sbjct  361   ESRYITIGCVEKSLQMMCWWAHDPNCDEFKYHLARVPDYLWLAEDGMKMQSFGSQVWDCA  420

Query  1163  FATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHGW  984
              ATQA++A+GMV+EYGDCL+K HF+IKESQVKENPKGDFKSMYRH TKGSWTFSDQD GW
Sbjct  421   LATQAVMATGMVDEYGDCLKKAHFHIKESQVKENPKGDFKSMYRHFTKGSWTFSDQDQGW  480

Query  983   AVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVPQ  804
              VSDCTAE+LKCLL+L +MP +I G+K DV+RLY+AV+V LYLQSPESGGF+ WEPPVPQ
Sbjct  481   VVSDCTAESLKCLLMLSQMPTEISGKKADVERLYDAVNVLLYLQSPESGGFSIWEPPVPQ  540

Query  803   PYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLEK  624
             PYLQVLNPSE+FADIVVE+EH+E T SII AL+ F+  +P +R KE+ I++AKAV +LE 
Sbjct  541   PYLQVLNPSELFADIVVEQEHVENTASIIQALLLFKRLHPGHREKEIEIAVAKAVSFLEG  600

Query  623   QQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGEC  444
             +Q  DGSWYGYWG+CFLYGT F L GL  AGK+Y N EAV  A  F+LS QN+EGGWGE 
Sbjct  601   KQWPDGSWYGYWGICFLYGTMFVLAGLVVAGKTYSNSEAVRKAVQFYLSTQNEEGGWGES  660

Query  443   LQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDFP  264
             L+SCPSM+Y PLEG  TNLVQT+WAMLGLM+ GQAERDPTPLH+AAKLL+NAQM+DGDFP
Sbjct  661   LESCPSMKYTPLEGNRTNLVQTAWAMLGLMHGGQAERDPTPLHKAAKLLMNAQMDDGDFP  720

Query  263   QQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             QQ+ITGVYMKNCMLHYA +R+ FPL ALSEYRKRVW
Sbjct  721   QQEITGVYMKNCMLHYAQYRNIFPLWALSEYRKRVW  756



>gb|AEX99665.1| amyrin synthase [Catharanthus roseus]
Length=762

 Score =  1259 bits (3259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/757 (77%), Positives = 661/757 (87%), Gaps = 1/757 (0%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT-C  2247
             MWKLKI EG GPY+YSTNN+ GRQIWEYDPNAGTP+E+EAFEKAR+ F   R+KG H  C
Sbjct  1     MWKLKIAEGKGPYLYSTNNFVGRQIWEYDPNAGTPQEREAFEKAREQFRNNRKKGVHNPC  60

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DLFMRMQ+IKE+ +D++SIPPVR+ E+EE+ +E  T AV+KA+RLN A+QA DGHWPAE
Sbjct  61    ADLFMRMQLIKENGIDLMSIPPVRVEEKEELTFEKTTIAVKKALRLNRAIQATDGHWPAE  120

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GP+FFTPPL+IALYISG+I+ ILTSEHKKELVRY+YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGPMFFTPPLLIALYISGAINTILTSEHKKELVRYIYNHQNEDGGWGFYIEGHSTMIGS  180

Query  1886  ALNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             AL+YVALRLLGEGPDDGDGA+ RGR+WILDHGGAT IPSWGK YLSVLGVY+WDGCNPL 
Sbjct  181   ALSYVALRLLGEGPDDGDGAVGRGRQWILDHGGATGIPSWGKTYLSVLGVYDWDGCNPLP  240

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWLFPS FP+HPAKMWCYCRTTYMPMSYLY K+Y GPLT +V+ LR EIHVK Y+QID
Sbjct  241   PEFWLFPSFFPYHPAKMWCYCRTTYMPMSYLYGKKYHGPLTHLVMQLRQEIHVKPYDQID  300

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+AR  CCK+DLYYPHSFIQDLLW+ L Y +EP MRRWP  KIRE AMRK IKYMRY A
Sbjct  301   WNKARHDCCKDDLYYPHSFIQDLLWDTLNYFSEPVMRRWPCNKIREKAMRKCIKYMRYGA  360

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             EE+RYITIGC+EKSLQMMCW A DPN DE KYHLARVPDYLWLAEDGM M  FGSQ WD 
Sbjct  361   EESRYITIGCVEKSLQMMCWCAHDPNCDEFKYHLARVPDYLWLAEDGMKMQSFGSQLWDC  420

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
               ATQAIIA+GMVEEYGD ++K HFYIKESQVKENPK DFK+MYRH TKGSWTFSDQD G
Sbjct  421   TLATQAIIATGMVEEYGDTIKKAHFYIKESQVKENPKEDFKAMYRHFTKGSWTFSDQDQG  480

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE LKCLL+  +MP  + GEK DV+RLY+AV+V LYLQSPESGGFA WEPPVP
Sbjct  481   WVVSDCTAEALKCLLVCSQMPQDLAGEKADVERLYDAVNVLLYLQSPESGGFAIWEPPVP  540

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
             QPYLQVLNPSE+FADIVVE+EH+E T SI+ ALV F+  +P +R KE+ +S++KAV++LE
Sbjct  541   QPYLQVLNPSELFADIVVEQEHVENTASIVQALVLFKRLHPGHREKEIEVSVSKAVRFLE  600

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
              +Q  DGSWYGYWG+CFLYGT F L GLTAAGK+Y+N EA+  A  F+LS QN+EGGWGE
Sbjct  601   GRQWPDGSWYGYWGICFLYGTMFVLGGLTAAGKTYKNSEAIRKAVKFYLSTQNEEGGWGE  660

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
             CL+SCPSM+YIPLEG  TNLVQTSWAMLGLMY GQAERDPTPLH+AAKLLINAQM+DGDF
Sbjct  661   CLESCPSMKYIPLEGNRTNLVQTSWAMLGLMYGGQAERDPTPLHKAAKLLINAQMDDGDF  720

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             PQQ+ITGVYMKNCMLHYA +R+ FPL AL+EYRKRVW
Sbjct  721   PQQEITGVYMKNCMLHYAEYRNIFPLWALAEYRKRVW  757



>gb|AFJ19235.1| mixed amyrin synthase [Catharanthus roseus]
Length=762

 Score =  1258 bits (3254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/757 (77%), Positives = 661/757 (87%), Gaps = 1/757 (0%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT-C  2247
             MWKLKI +G GPY+YSTNN+ GRQIWEYDPNAGTP+E+EAFEKAR+ F   R+KG H  C
Sbjct  1     MWKLKIAKGKGPYLYSTNNFVGRQIWEYDPNAGTPQEREAFEKAREQFRNNRKKGVHNPC  60

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DLFMRMQ+IKE+ +D++SIPPVR+ E+EE+ +E  T AV+KA+RLN A+QA DGHWPAE
Sbjct  61    ADLFMRMQLIKENGIDLMSIPPVRVEEKEELTFEKTTIAVKKALRLNRAIQATDGHWPAE  120

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GP+FFTPPL+IALYISG+I+ ILTSEHKKELVRY+YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGPMFFTPPLLIALYISGAINTILTSEHKKELVRYIYNHQNEDGGWGFYIEGHSTMIGS  180

Query  1886  ALNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             AL+YVALRLLGEGPDDGDGA+ RGR+WILDHGGAT IPSWGK YLSVLGVY+WDGCNPL 
Sbjct  181   ALSYVALRLLGEGPDDGDGAVGRGRQWILDHGGATGIPSWGKTYLSVLGVYDWDGCNPLP  240

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWLFPS FP+HPAKMWCYCRTTYMPMSYLY K+Y GPLT +V+ LR EIHVK Y+QID
Sbjct  241   PEFWLFPSFFPYHPAKMWCYCRTTYMPMSYLYGKKYHGPLTHLVMQLRQEIHVKPYDQID  300

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+AR  CCK+DLYYPHSFIQDLLW+ L Y +EP MRRWP  KIRE AMRK IKYMRY A
Sbjct  301   WNKARHDCCKDDLYYPHSFIQDLLWDTLNYFSEPVMRRWPCNKIREKAMRKCIKYMRYGA  360

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             EE+RYITIGC+EKSLQMMCW A DPN DE KYHLARVPDYLWLAEDGM M  FGSQ WD 
Sbjct  361   EESRYITIGCVEKSLQMMCWCAHDPNCDEFKYHLARVPDYLWLAEDGMKMQSFGSQLWDC  420

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
               ATQAIIA+GMVEEYGD ++K HFYIKESQVKENPK DFK+MYRH TKGSWTFSDQD G
Sbjct  421   TLATQAIIATGMVEEYGDTIKKAHFYIKESQVKENPKEDFKAMYRHFTKGSWTFSDQDQG  480

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE LKCLL+  +MP  + GEK DV+RLY+AV+V LYLQSPESGGFA WEPPVP
Sbjct  481   WVVSDCTAEALKCLLVCSQMPQDLAGEKADVERLYDAVNVLLYLQSPESGGFAIWEPPVP  540

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
             QPYLQVLNPSE+FADIVVE+EH+E T SI+ ALV F+  +P +R KE+ +S++KAV++LE
Sbjct  541   QPYLQVLNPSELFADIVVEQEHVENTASIVQALVLFKRLHPGHREKEIEVSVSKAVRFLE  600

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
              +Q  DGSWYGYWG+CFLYGT F L GLTAAGK+Y+N EA+  A  F+LS QN+EGGWGE
Sbjct  601   GRQWPDGSWYGYWGICFLYGTMFVLGGLTAAGKTYKNSEAIRKAVKFYLSTQNEEGGWGE  660

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
             CL+SCPSM+YIPLEG  TNLVQTSWAMLGLMY GQAERDPTPLH+AAKLLINAQM+DGDF
Sbjct  661   CLESCPSMKYIPLEGNRTNLVQTSWAMLGLMYGGQAERDPTPLHKAAKLLINAQMDDGDF  720

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             PQQ+ITGVYMKNCMLHYA +R+ FPL AL+EYRKRVW
Sbjct  721   PQQEITGVYMKNCMLHYAEYRNIFPLWALAEYRKRVW  757



>gb|EYU33367.1| hypothetical protein MIMGU_mgv1a001775mg [Erythranthe guttata]
Length=761

 Score =  1254 bits (3246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/756 (76%), Positives = 658/756 (87%), Gaps = 0/756 (0%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI EG GPY+YSTNN+ GRQ WEYDPNAGTPE++E+F+KAR  F + R+KG H+CG
Sbjct  1     MWKLKIAEGNGPYLYSTNNFVGRQTWEYDPNAGTPEDRESFQKARDIFDQNRKKGFHSCG  60

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DLFMRMQ+ KES +D+ SIPPVRL E+EE+ YE  T AV+KA+RLN A+QA DGHWPAEN
Sbjct  61    DLFMRMQLKKESGIDLESIPPVRLEEKEEITYETATIAVKKALRLNRAVQASDGHWPAEN  120

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GP+FFTPPL+IALYISG+I+  LTSEHKKE++RY+YNHQNEDGGWG YI+GHSTMIGSA
Sbjct  121   AGPMFFTPPLLIALYISGAINTTLTSEHKKEMIRYIYNHQNEDGGWGFYIEGHSTMIGSA  180

Query  1883  LNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLSP  1704
             L+YVALR+LGEG DDG+GAIAR RKWILDHGGAT IPSWGK YLSVLGVYEW+GCNPL P
Sbjct  181   LSYVALRILGEGADDGNGAIARARKWILDHGGATGIPSWGKTYLSVLGVYEWEGCNPLPP  240

Query  1703  EFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQIDW  1524
             EFWLFPS  P+HPAKMWCYCRTTYMPMSYLY ++Y GP+TD+VL+LRNEIHVKSY+QIDW
Sbjct  241   EFWLFPSILPYHPAKMWCYCRTTYMPMSYLYGRKYHGPITDLVLSLRNEIHVKSYDQIDW  300

Query  1523  NQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEAE  1344
             N+AR  CCKED+YYPH+F+QDLLW+ L YCTEP M+RWP  KIR+ A+ K IKYMRY AE
Sbjct  301   NKARHHCCKEDVYYPHTFVQDLLWDTLNYCTEPVMKRWPLNKIRQRALDKTIKYMRYGAE  360

Query  1343  ETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDAA  1164
             E+RYITIGC+EKSLQMMCWWA D N DE KYHLARVPDYLWLAEDGM M  FGSQ WD+ 
Sbjct  361   ESRYITIGCVEKSLQMMCWWAHDQNCDEFKYHLARVPDYLWLAEDGMKMQSFGSQIWDST  420

Query  1163  FATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHGW  984
              ATQA+I++GMVEEYGDCL+K HFYIKESQ+KENPKGDF+ MYRH TKG+WTFSDQD GW
Sbjct  421   LATQAVISTGMVEEYGDCLQKAHFYIKESQIKENPKGDFRGMYRHFTKGAWTFSDQDQGW  480

Query  983   AVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVPQ  804
              VSDCTAE LKCLLLL +MP +I GEKP V+RLY+AV+V LYLQSP SGGFA WEP +PQ
Sbjct  481   VVSDCTAEALKCLLLLSQMPAEISGEKPPVERLYDAVNVLLYLQSPLSGGFAIWEPAIPQ  540

Query  803   PYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLEK  624
             PYLQVLNPSE+FADIVVE+EH+E T SI+ AL++F+  +P +R KE+  S+A+ V +LE+
Sbjct  541   PYLQVLNPSELFADIVVEQEHVECTASIVQALISFKRMHPGHREKEIENSVARGVSFLEE  600

Query  623   QQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGEC  444
             +Q  DGSWYGYWG+CFLYGTFF L GL AAGK+YENCEAV  A +FFLS QN+EGGWGE 
Sbjct  601   KQWPDGSWYGYWGICFLYGTFFTLGGLAAAGKTYENCEAVRKAVNFFLSSQNEEGGWGES  660

Query  443   LQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDFP  264
             L+SCPSM+Y PLEG  TNLVQTSWAMLGLMY GQAERDP PLH+AAKLLIN QM DGDFP
Sbjct  661   LESCPSMKYTPLEGNRTNLVQTSWAMLGLMYGGQAERDPMPLHKAAKLLINEQMIDGDFP  720

Query  263   QQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             QQ+ITGVYMKNCMLHYA +R+ FPL AL EYRKRVW
Sbjct  721   QQEITGVYMKNCMLHYAQYRNIFPLWALGEYRKRVW  756



>emb|CDP10664.1| unnamed protein product [Coffea canephora]
Length=761

 Score =  1246 bits (3223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 575/756 (76%), Positives = 656/756 (87%), Gaps = 0/756 (0%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MW+LKI EG GPY+YSTNN+ GRQIWE+DPN GTPEE+EAFEKAR+ F   R+KG H C 
Sbjct  1     MWRLKIAEGNGPYLYSTNNFVGRQIWEWDPNDGTPEEREAFEKAREDFRNNRKKGVHPCA  60

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DLFMRMQ+ KE+    L IPPVRL E EEV YE  TTAVRKAVRLN A+QAKDGHWPAEN
Sbjct  61    DLFMRMQLKKENSHIDLGIPPVRLGENEEVTYETATTAVRKAVRLNRAIQAKDGHWPAEN  120

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GP+FFTPPL+IALYISG+I+  LTSEHKKELVRY+YNHQNEDGGWG YI+GHSTM+GSA
Sbjct  121   AGPMFFTPPLLIALYISGAINTHLTSEHKKELVRYIYNHQNEDGGWGFYIEGHSTMMGSA  180

Query  1883  LNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLSP  1704
             L+YVALR+LGEGPDDGDGA+AR RKWILD+GGAT IPSWGK YLSVLGVY+WDGCNPL P
Sbjct  181   LSYVALRILGEGPDDGDGAVARARKWILDNGGATGIPSWGKTYLSVLGVYDWDGCNPLPP  240

Query  1703  EFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQIDW  1524
             EFWLFP  FP+HPAKMWCYCRTTYMPMSYLY ++Y GPLTD+VL+LR EIHVK Y+QI+W
Sbjct  241   EFWLFPEFFPYHPAKMWCYCRTTYMPMSYLYGRQYHGPLTDLVLSLRREIHVKPYDQINW  300

Query  1523  NQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEAE  1344
             N+AR  CCKEDLYYPHSFIQDLLW+ L YCTEPFMRRWP  KIR+ AM K+I+YMRY AE
Sbjct  301   NKARHDCCKEDLYYPHSFIQDLLWDTLNYCTEPFMRRWPCNKIRQRAMAKSIEYMRYGAE  360

Query  1343  ETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDAA  1164
              +RYITIGC+EKSLQMMC+WA DPNGD+ KYHLARVPDYLWLAEDGM M  FGSQ WD A
Sbjct  361   VSRYITIGCVEKSLQMMCFWAHDPNGDDFKYHLARVPDYLWLAEDGMKMQSFGSQIWDCA  420

Query  1163  FATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHGW  984
              A QAI+ASGMV+EYGD L+K HF++KE+Q K NPKGDFK MYRH TKGSWTFSDQD GW
Sbjct  421   LACQAILASGMVDEYGDSLKKAHFHLKEAQCKTNPKGDFKKMYRHFTKGSWTFSDQDQGW  480

Query  983   AVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVPQ  804
              VSDCTAE LKCLLL  +MP +I GEK DV+RLY+AV+VCLYLQSPE+GGF+ WEPPVPQ
Sbjct  481   VVSDCTAEALKCLLLFSQMPQEIAGEKADVERLYDAVNVCLYLQSPETGGFSIWEPPVPQ  540

Query  803   PYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLEK  624
             PYLQ LNPSE+FADIVVE+EH+E + SII AL+ F+  +P +R KE+ I+++KAV +LE 
Sbjct  541   PYLQQLNPSEMFADIVVEQEHVENSVSIIQALLLFKRLHPGHREKEIEIAVSKAVHFLEG  600

Query  623   QQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGEC  444
             +Q  DGSWYGYWG+CFLYGT F L G TAAGK+YEN E+V  A +F+LS QN+EGGWGEC
Sbjct  601   KQWPDGSWYGYWGICFLYGTMFVLAGFTAAGKTYENSESVRKAVNFYLSTQNEEGGWGEC  660

Query  443   LQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDFP  264
             L+SCPSM+YIPLEG  TNLVQTSWAMLGLM+ GQAERDPTPLH+ AKLLINAQM+DGDFP
Sbjct  661   LESCPSMKYIPLEGNRTNLVQTSWAMLGLMFGGQAERDPTPLHKGAKLLINAQMDDGDFP  720

Query  263   QQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             QQ+ITGVYMKNCMLHYA +R+ FPL AL+EYRKRVW
Sbjct  721   QQEITGVYMKNCMLHYAEYRNIFPLWALAEYRKRVW  756



>dbj|BAF63702.1| mixed amyrin synthase [Olea europaea]
Length=762

 Score =  1245 bits (3222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/758 (77%), Positives = 663/758 (87%), Gaps = 1/758 (0%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2247
             MWKLKI EG GPY+YSTNN+AGRQIWEYDPN GTPEE+EA++KAR+ F + R+ KG H C
Sbjct  1     MWKLKIAEGHGPYLYSTNNFAGRQIWEYDPNGGTPEEREAYDKAREEFQRNRKLKGVHPC  60

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDLFMR+Q+IKES +D++SIPPVRL E+EEV YE  TTAV+KA+ LN A+QA DGHWPAE
Sbjct  61    GDLFMRIQLIKESGIDLMSIPPVRLGEKEEVTYETATTAVKKALLLNRAVQASDGHWPAE  120

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GP+FFTPPL+I LYISG+I+ ILTSEH+KE+VRY+YNHQN+DGGWG YI+GHSTMIGS
Sbjct  121   NAGPMFFTPPLIIVLYISGAINTILTSEHRKEMVRYIYNHQNDDGGWGFYIEGHSTMIGS  180

Query  1886  ALNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             AL+Y+ALRLLGEGPDDG+G+IAR RKWILDHGGAT IPSWGK YLSVLGVY+WDGCNPL 
Sbjct  181   ALSYIALRLLGEGPDDGNGSIARARKWILDHGGATGIPSWGKTYLSVLGVYDWDGCNPLP  240

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWLFPS  P+HPAKMWCYCRTTYMPMSYLY ++Y GPLTD+VL+LRNEIH+K Y +ID
Sbjct  241   PEFWLFPSFLPYHPAKMWCYCRTTYMPMSYLYGRKYHGPLTDLVLSLRNEIHIKPYNEID  300

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+AR  CCKEDLYYPHS IQDLLW+ L YC EP MRRWP  KIR+ A+ K IKYMRY A
Sbjct  301   WNKARHDCCKEDLYYPHSSIQDLLWDTLNYCAEPVMRRWPLNKIRQRALNKTIKYMRYGA  360

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             EE+RYITIGC+EKSLQMMCWWA DPNGDE K+HLARVPDYLWLAEDGM M  FGSQ WD+
Sbjct  361   EESRYITIGCVEKSLQMMCWWAHDPNGDEFKHHLARVPDYLWLAEDGMKMQSFGSQIWDS  420

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
               ATQA+IA+GMVEEYGDCL+K HFY+KESQ+KENP GDFKSMYRH TKG+WTFSDQD G
Sbjct  421   TLATQAVIATGMVEEYGDCLKKAHFYVKESQIKENPAGDFKSMYRHFTKGAWTFSDQDQG  480

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE LKCLLLL ++P +  GEK DV+RLYEAV+V LYLQSPESGGFA WEPPVP
Sbjct  481   WVVSDCTAEALKCLLLLSQLPTETAGEKADVERLYEAVNVLLYLQSPESGGFAIWEPPVP  540

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
             QPYLQ+LNPSEIFADIVVE EH+E + SII AL+AF+  YP +R KE+ IS+AKA+ +LE
Sbjct  541   QPYLQMLNPSEIFADIVVETEHVECSASIIQALLAFKRLYPGHREKEIEISVAKAISFLE  600

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
              +Q  DGSWYGYWG+CFLYGTFF L GL+AAGK+YEN EAV    +F LS QN+EGGWGE
Sbjct  601   GRQWPDGSWYGYWGICFLYGTFFVLGGLSAAGKTYENSEAVRKGVNFLLSTQNEEGGWGE  660

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
             CL+SCPSM+Y PLEG  TNLVQTSWAMLGLMY GQAERDPT LH+AAKLLI+AQM+DGDF
Sbjct  661   CLESCPSMKYTPLEGNRTNLVQTSWAMLGLMYGGQAERDPTSLHKAAKLLIDAQMDDGDF  720

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVWT  153
             PQQ+ITGVYMKNCMLHYA +R+ FPL AL EYRKRVW+
Sbjct  721   PQQEITGVYMKNCMLHYAQYRNIFPLWALGEYRKRVWS  758



>gb|AIS39793.1| mixed amyrin synthase 1 [Ilex asprella var. asprella]
Length=762

 Score =  1233 bits (3191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/757 (75%), Positives = 652/757 (86%), Gaps = 0/757 (0%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI EG GPY+YSTNN+ GRQIWEY+P AGTPEE+E  EKAR+ F K R++G H CG
Sbjct  1     MWKLKIAEGKGPYLYSTNNFVGRQIWEYEPEAGTPEEREEVEKARETFRKNRKQGIHPCG  60

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DL MRMQM KES +DVLSIPPVRL E+EEV YEA+TT+VRKAVRL  ALQAKDGHWPAEN
Sbjct  61    DLLMRMQMKKESGIDVLSIPPVRLGEKEEVTYEAVTTSVRKAVRLLRALQAKDGHWPAEN  120

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +G  FF+PPLMI+LYISG+I+ +LT  HKKEL+R+LYNHQN+DGGWG YI+GHSTMIGSA
Sbjct  121   AGVNFFSPPLMISLYISGAINTVLTPHHKKELIRWLYNHQNDDGGWGFYIEGHSTMIGSA  180

Query  1883  LNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLSP  1704
             L+YV LR+LGEGPDDGDGAIARGRKWILDHGGAT IPSWGK YL+VLGVYEWDGCNPL+P
Sbjct  181   LSYVMLRILGEGPDDGDGAIARGRKWILDHGGATGIPSWGKTYLAVLGVYEWDGCNPLTP  240

Query  1703  EFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQIDW  1524
             EFWLFPS  P+HPAKMWCYCRTTYMPMSYLY ++Y GPLTDVVL LR EIH + Y +I+W
Sbjct  241   EFWLFPSILPYHPAKMWCYCRTTYMPMSYLYGRKYHGPLTDVVLQLRQEIHPQPYHEINW  300

Query  1523  NQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEAE  1344
             N+AR  CCKEDLYY H+FIQDLLW+ L Y TEP M+ WPF+K+RE A+RKAIKYMRY + 
Sbjct  301   NKARHDCCKEDLYYHHTFIQDLLWDTLNYVTEPLMKFWPFRKLRERALRKAIKYMRYGST  360

Query  1343  ETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDAA  1164
             E+RYITIGC+EKSLQMMCWWAEDPN +E KYHLARVPDYLWLAEDGM+M  FGSQ WDA 
Sbjct  361   ESRYITIGCVEKSLQMMCWWAEDPNCEEFKYHLARVPDYLWLAEDGMTMQSFGSQLWDAT  420

Query  1163  FATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHGW  984
              ATQAI+AS M EEYGD L+K HFYIKESQ KE+P GD  +MYRH TKGSWTFSDQD GW
Sbjct  421   LATQAILASNMEEEYGDSLKKAHFYIKESQCKESPAGDHMAMYRHFTKGSWTFSDQDQGW  480

Query  983   AVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVPQ  804
              VSDCTAE LKCLL+L +MP ++ GEK DVQRLY+AV+V LYLQSPESGGFA WEPP+P 
Sbjct  481   VVSDCTAEALKCLLVLSQMPQEMAGEKADVQRLYDAVNVLLYLQSPESGGFAIWEPPIPL  540

Query  803   PYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLEK  624
             P LQVLNPSE+FADIVVE+EH+E T  II AL+AF+  +P +R KE+ IS+AKA Q+LE 
Sbjct  541   PALQVLNPSEVFADIVVEKEHLENTACIIQALLAFKRLHPGHREKEIEISVAKAAQFLED  600

Query  623   QQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGEC  444
             +Q  DGSWYGYWG+CFLYGT F L GL A GK+Y+NC AV  A HF+LS QN+EGGWGE 
Sbjct  601   KQYPDGSWYGYWGICFLYGTCFVLGGLLAVGKTYDNCPAVRKAVHFYLSTQNEEGGWGES  660

Query  443   LQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDFP  264
             L++CPSM+YIPLEG  TN+VQT+WAM+GLMY GQAERDPTPLHRAAKLLINAQM+DGDFP
Sbjct  661   LEACPSMKYIPLEGNRTNIVQTAWAMMGLMYAGQAERDPTPLHRAAKLLINAQMDDGDFP  720

Query  263   QQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVWT  153
             QQ+I GVYMKNCMLHYA +RSYFPL AL EYR+R+W+
Sbjct  721   QQEILGVYMKNCMLHYAEYRSYFPLWALGEYRRRLWS  757



>gb|AHF22084.1| OSC2 [Artemisia annua]
Length=760

 Score =  1198 bits (3100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/757 (72%), Positives = 643/757 (85%), Gaps = 0/757 (0%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLK+ EG  PY++STNN+ GRQIWE+DP+AG+P E++  E AR+ F   R++G H CG
Sbjct  1     MWKLKVAEGNDPYLFSTNNFVGRQIWEFDPSAGSPVERQEVEDARQQFKNNRREGVHPCG  60

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DL MR+Q+IKE+ +DV+SIPPVRL E E+VNY+A+TT V+KA+RLN A+QAKDGHWPAEN
Sbjct  61    DLLMRIQLIKENGIDVMSIPPVRLGENEDVNYDAVTTTVKKALRLNRAIQAKDGHWPAEN  120

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GP+FFTPPL+IA+YISG+I+  LT EH+ E++RY+YNHQNEDGGWG YI+GHSTMIGSA
Sbjct  121   AGPMFFTPPLLIAMYISGTINTHLTKEHRTEMIRYIYNHQNEDGGWGFYIEGHSTMIGSA  180

Query  1883  LNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLSP  1704
             L+YVALRLLGEGPDDG+GA+ R RKWILDHGGA  IPSWGK YLSVLGVYEW+GCNPL P
Sbjct  181   LSYVALRLLGEGPDDGNGAVDRARKWILDHGGAASIPSWGKTYLSVLGVYEWEGCNPLPP  240

Query  1703  EFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQIDW  1524
             EFWLFP   PFHPAKMWCYCRTTYMPMSYLY ++Y GP+TD+VL LR EIH   Y +I+W
Sbjct  241   EFWLFPEALPFHPAKMWCYCRTTYMPMSYLYGRKYHGPITDLVLQLRQEIHPIPYHKINW  300

Query  1523  NQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEAE  1344
             N+ R  CCKEDLYYPHS +QDLLW+ L Y +EP ++ WPF K+RE  +++A++ MRY AE
Sbjct  301   NKQRHNCCKEDLYYPHSTVQDLLWDGLHYLSEPILKYWPFTKLRERGLKRAVELMRYGAE  360

Query  1343  ETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDAA  1164
             E+RY+TIGC+EKSLQMMCWWAE+PNGDE K+HLARVPDYLWLAEDGM+MH FGSQ WD  
Sbjct  361   ESRYMTIGCVEKSLQMMCWWAENPNGDEFKHHLARVPDYLWLAEDGMTMHSFGSQLWDCV  420

Query  1163  FATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHGW  984
              ATQAIIAS MVEE+GD L+K HFYIKESQ+K+NP GDF  M R  TKG+WTFSDQD GW
Sbjct  421   LATQAIIASDMVEEFGDSLKKAHFYIKESQIKQNPSGDFSKMCRQFTKGAWTFSDQDQGW  480

Query  983   AVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVPQ  804
              VSDCTAE LKCLLLL +MP +I G+K D +RLYEAV+V LYLQSP SGGFA WEPPVPQ
Sbjct  481   VVSDCTAEALKCLLLLSQMPEEISGKKADNERLYEAVNVLLYLQSPISGGFAIWEPPVPQ  540

Query  803   PYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLEK  624
             PYLQ+LNPSEIFADIVVE+EH+E T SII AL+AF+  +P +R KE+ IS+AKAV +LE 
Sbjct  541   PYLQMLNPSEIFADIVVEKEHVECTSSIIKALLAFKDLHPGHREKEIEISVAKAVCFLEG  600

Query  623   QQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGEC  444
             +Q  DGSWYGYWG+CFLYGTFF L GL +AGK+Y+N EAV  A +FFLS QN+EGGWGE 
Sbjct  601   KQCHDGSWYGYWGICFLYGTFFTLAGLVSAGKTYDNSEAVRKAVNFFLSTQNEEGGWGES  660

Query  443   LQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDFP  264
             ++SCPS  Y PL+G  TNLVQTSWAMLGLM+ GQAERDPTPLH+AAK+LINAQM+DGDFP
Sbjct  661   IKSCPSEVYTPLDGNRTNLVQTSWAMLGLMFGGQAERDPTPLHKAAKILINAQMDDGDFP  720

Query  263   QQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVWT  153
             QQ+ITGVYMKNCMLHYA +R+ FPL AL EYRKRVW 
Sbjct  721   QQEITGVYMKNCMLHYAEYRNIFPLWALGEYRKRVWV  757



>gb|EYU34015.1| hypothetical protein MIMGU_mgv1a021513mg [Erythranthe guttata]
Length=727

 Score =  1187 bits (3072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/722 (75%), Positives = 624/722 (86%), Gaps = 0/722 (0%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI EG GPY+YSTNN+ GRQ WEYDPNAGTPE++E+F+KAR  F + R KG H+CG
Sbjct  1     MWKLKIAEGNGPYLYSTNNFVGRQTWEYDPNAGTPEDRESFQKARDQFDQNRIKGFHSCG  60

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DLFMRMQ+ KES +D+ SIP VRL E+EE+ YE  T AV+KA+RLN A+QA DGHWPAEN
Sbjct  61    DLFMRMQLKKESGIDLESIPAVRLEEKEEITYETATIAVKKALRLNRAVQASDGHWPAEN  120

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GP+ FTPPL+IALYISG+I+  LTSEHKKE++RY+YNHQNEDGGWGLYI+GHSTMIGSA
Sbjct  121   AGPMLFTPPLLIALYISGAINTTLTSEHKKEMIRYMYNHQNEDGGWGLYIEGHSTMIGSA  180

Query  1883  LNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLSP  1704
             L+YVALR+LGEG DDG+GAIAR RKWILDHGGAT IPSWGK YLSVLGVYEW+GCNPL P
Sbjct  181   LSYVALRILGEGADDGNGAIARARKWILDHGGATGIPSWGKAYLSVLGVYEWEGCNPLPP  240

Query  1703  EFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQIDW  1524
             EFWLFPS  P+HPAKMWCYCRTTYMPMSYLY ++Y GP+TD+VL+LRNEIHVKSY+QIDW
Sbjct  241   EFWLFPSILPYHPAKMWCYCRTTYMPMSYLYGRKYHGPITDLVLSLRNEIHVKSYDQIDW  300

Query  1523  NQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEAE  1344
             N+AR  CCKED+YYPH+F+QDLLW+ L YCTEP M+RWP  KIR+ A+ K IKYMRY AE
Sbjct  301   NKARHHCCKEDVYYPHTFVQDLLWDTLNYCTEPVMKRWPLNKIRQRALDKTIKYMRYGAE  360

Query  1343  ETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDAA  1164
             E+RYITIGC+EKSLQMMCWWA D   DE KYHLARVPDYLWLAEDGM+M  FGSQ WD+ 
Sbjct  361   ESRYITIGCVEKSLQMMCWWAHDQKCDEFKYHLARVPDYLWLAEDGMTMQSFGSQIWDST  420

Query  1163  FATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHGW  984
              ATQA+I++GMVEEYGDCL K HFYIKESQ+KENPKGDF+ MYRH TKG+WTFSDQD GW
Sbjct  421   LATQAVISTGMVEEYGDCLEKAHFYIKESQIKENPKGDFRGMYRHFTKGAWTFSDQDQGW  480

Query  983   AVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVPQ  804
              VSDCTAE LKCLLLL +MP +I GEKP V+R Y+AV+V LYLQS  SGGFA WEP +PQ
Sbjct  481   VVSDCTAEALKCLLLLSQMPTEISGEKPPVERSYDAVNVLLYLQSSLSGGFAIWEPAIPQ  540

Query  803   PYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLEK  624
             PYLQVLNPSE+FADIVVE+EH+E T SI+ AL++F+  +P +R KE+  S+A+ V +LE+
Sbjct  541   PYLQVLNPSELFADIVVEQEHVECTASIVQALISFKRMHPGHREKEIENSVARGVSFLEE  600

Query  623   QQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGEC  444
             +Q  DGSWYGYWG+CFLYGTFF L GL AAGK+YENCEAV  A +FFLS QN+EGGWGE 
Sbjct  601   RQWHDGSWYGYWGICFLYGTFFTLGGLAAAGKTYENCEAVRKAVNFFLSWQNEEGGWGES  660

Query  443   LQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDFP  264
             L+SCPSM+Y PLEG  TNLVQTSWAMLGLMY GQAERDPTPLH+AAKLLIN QM DGDFP
Sbjct  661   LESCPSMKYTPLEGNRTNLVQTSWAMLGLMYGGQAERDPTPLHKAAKLLINEQMSDGDFP  720

Query  263   QQ  258
             QQ
Sbjct  721   QQ  722



>gb|AAS01523.1| putative beta-amyrin synthase [Centella asiatica]
Length=760

 Score =  1175 bits (3040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/757 (71%), Positives = 634/757 (84%), Gaps = 1/757 (0%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHTC  2247
             MWKLKI EG G Y+YSTNN+ GRQIWEYDP+AGTPEE+   EK R+ +       G H C
Sbjct  1     MWKLKIAEGNGAYLYSTNNFVGRQIWEYDPDAGTPEERLEVEKLRETYKYNLINNGIHPC  60

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GD+ MR+Q+IKES +D+LSIPPVRL E+EEVNY+ +TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    GDMLMRLQLIKESGLDLLSIPPVRLGEQEEVNYQVVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GP+FFTPPL+IALYISG+ID  LT +HKKE++R++Y HQN+DGGWG YI+GHSTMIGS
Sbjct  121   NAGPMFFTPPLIIALYISGAIDTHLTIQHKKEMIRFIYLHQNKDGGWGFYIEGHSTMIGS  180

Query  1886  ALNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             AL+YVALRLLGEGPDDGDGA+ R RKWILDHGGA  IPSWGK YL+VLGVYEW+GCNPL 
Sbjct  181   ALSYVALRLLGEGPDDGDGAVERARKWILDHGGAASIPSWGKTYLAVLGVYEWEGCNPLP  240

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWLFP   P+HPAKMWCYCRTTYMPMSYLY K+Y GP+TD+V++LR EIH   YE+I+
Sbjct  241   PEFWLFPEALPYHPAKMWCYCRTTYMPMSYLYGKKYHGPITDLVISLRKEIHPIPYEKIN  300

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+ R  C KEDLYYPHSFIQDLLW+ L Y TEP ++ WPF K+R+  M++AI+ MRY  
Sbjct  301   WNKQRHNCNKEDLYYPHSFIQDLLWDGLHYFTEPIIKMWPFNKLRKKGMKRAIELMRYGG  360

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
              E+R+ITIGC+ KSL MMCWWAE+PNG E K+HLARVPDYLWLAEDGM M  FGSQ WD 
Sbjct  361   YESRFITIGCVSKSLDMMCWWAENPNGPEFKHHLARVPDYLWLAEDGMKMQSFGSQLWDC  420

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
               ATQA++++GMV+EYGDCL+K HFYIKESQ K+NP GD+ SM R+ TKGSWTFSDQD G
Sbjct  421   VLATQAVMSTGMVDEYGDCLKKAHFYIKESQCKKNPSGDYASMCRYFTKGSWTFSDQDQG  480

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE LKCLL L +MP +I GEK DV+RLY+AV+V LYLQSP SGGFA WEPPVP
Sbjct  481   WVVSDCTAEALKCLLALSQMPEEIAGEKADVERLYDAVNVLLYLQSPISGGFAIWEPPVP  540

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
             +PYLQVLNPSEIFADIVVE+EH E T SII+ALVAF+  +P +R KE++++IAKAV +LE
Sbjct  541   RPYLQVLNPSEIFADIVVEKEHTECTASIIAALVAFKRLHPGHRSKEISVAIAKAVHFLE  600

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
              +Q  DGSWYGYWG+CFLYGTFFAL GL + G++YEN E V  A  FFLS QN+EGGWGE
Sbjct  601   GKQLEDGSWYGYWGICFLYGTFFALAGLASVGQTYENSETVRKAVKFFLSTQNEEGGWGE  660

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
              L+SCPS  + PLEG  TNLVQTSWAMLGLM+ GQA RDPTPLHRAAKLLINAQ+ +GDF
Sbjct  661   SLESCPSEIFTPLEGNRTNLVQTSWAMLGLMFGGQATRDPTPLHRAAKLLINAQLNNGDF  720

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             PQQ+ TGVYMKNCMLHYA +R+ FPL AL EYRKR+W
Sbjct  721   PQQETTGVYMKNCMLHYAEYRNVFPLWALGEYRKRLW  757



>gb|ADM86392.1| putative beta-amyrin synthase [Bacopa monnieri]
Length=764

 Score =  1175 bits (3039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/756 (71%), Positives = 637/756 (84%), Gaps = 3/756 (0%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MW+LKI EG GPY+YSTNN+ GRQ WEYDPN GT EE+EAFEKAR+ F + R+KG H C 
Sbjct  1     MWRLKIAEGQGPYLYSTNNFVGRQTWEYDPNGGTAEEREAFEKARQEFNENRKKGVHCCA  60

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DLFMR+Q+ KES +D+L IPPVR+ E+EE+ YE  T AV KA+RLN A+QA DGHW AEN
Sbjct  61    DLFMRLQLKKESGIDLLQIPPVRVGEKEEITYETATVAVTKALRLNRAVQASDGHWSAEN  120

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
                LFFTPPL+I LYISG+I+ +LT+EHKKEL+R++YNHQNEDGGWGLYI+G STMIGSA
Sbjct  121   ---LFFTPPLIIVLYISGTINTVLTAEHKKELIRFIYNHQNEDGGWGLYIEGRSTMIGSA  177

Query  1883  LNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLSP  1704
             ++YVALRLLGEGPDDG+G++ARGRKWILDHGGAT IPSWGK YLSVLG Y+WDGCNPL P
Sbjct  178   MSYVALRLLGEGPDDGNGSVARGRKWILDHGGATGIPSWGKPYLSVLGAYDWDGCNPLPP  237

Query  1703  EFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQIDW  1524
             E WL PS  PFHPAKMWCYCRT YMPMSYLY KRY GP+TD+VL+LR EI+VK Y+QI+W
Sbjct  238   ELWLCPSFLPFHPAKMWCYCRTAYMPMSYLYGKRYHGPITDLVLSLRQEIYVKPYDQINW  297

Query  1523  NQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEAE  1344
             N+AR  CCKEDLYYPH+FIQDL+W+AL Y +EP + RWPF KIR+ A+ K I+YMRY A+
Sbjct  298   NKARHDCCKEDLYYPHTFIQDLMWDALNYVSEPVLSRWPFNKIRQRALGKIIEYMRYGAD  357

Query  1343  ETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDAA  1164
             E+RYIT G  EKSLQMMCWW+ DP GDE K HLARVPDYLWLAEDGM +  FGSQ WD+ 
Sbjct  358   ESRYITSGNAEKSLQMMCWWSHDPKGDEFKRHLARVPDYLWLAEDGMKVQSFGSQLWDST  417

Query  1163  FATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHGW  984
              ATQAIIASGMVEEYGDCL+K +F+IKESQ+K+NPKGDF +M+RH TKG+WTFSDQD GW
Sbjct  418   LATQAIIASGMVEEYGDCLKKANFFIKESQIKQNPKGDFHAMHRHFTKGAWTFSDQDQGW  477

Query  983   AVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVPQ  804
             AVSDCTAE LKCLLL+ +MP++  GE  +V+R Y+A++V LYLQ+ ESGGFA WEP   Q
Sbjct  478   AVSDCTAEGLKCLLLMSQMPNEARGENVEVERFYDAINVLLYLQNQESGGFAVWEPMSSQ  537

Query  803   PYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLEK  624
             PYLQ LNPSE+FADIVVE+EH+E T S+I ALV F+  +P++R KE+ IS+AKAV++LEK
Sbjct  538   PYLQALNPSELFADIVVEQEHVECTASVIQALVLFKHLHPSHREKEIEISVAKAVRFLEK  597

Query  623   QQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGEC  444
             +Q  DGSWYGYWG+CF+YGTF+ L GL +AGK+YEN E +     F LS QN+EGGWGE 
Sbjct  598   KQWPDGSWYGYWGICFVYGTFWVLRGLASAGKTYENSETIQKGVGFLLSTQNEEGGWGES  657

Query  443   LQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDFP  264
             L+SCP  +Y PLEG  TNLVQT+WAMLGLMY GQAERD TPL +AAKLLINAQMEDGDFP
Sbjct  658   LKSCPRTKYTPLEGNRTNLVQTAWAMLGLMYGGQAERDTTPLDKAAKLLINAQMEDGDFP  717

Query  263   QQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             QQ+ITGV+MKNCMLHYA +R+ FPL ALSEYR+RVW
Sbjct  718   QQEITGVWMKNCMLHYAQYRNIFPLWALSEYRRRVW  753



>gb|AGI15962.1| dammarenediol synthase [Panax quinquefolius]
Length=769

 Score =  1160 bits (3000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/760 (70%), Positives = 632/760 (83%), Gaps = 4/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2247
             MWKLK+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  EKARK +   ++  G H C
Sbjct  1     MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC  60

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              D+ MR Q+IKES +D+LSIPPVRL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPVRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  1886  ALNYVALRLLGEG---PDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              L+YV LRLLGEG    DDG+GA+ RGRKWILDHGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSYVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAASIPSWGKTYLAVLGVYEWEGCN  240

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             PL PEFWLFPS+FPFHPAKMW YCR TYMPMSYLY KRY GP+TD+VL+LR EI+   YE
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
             QI WNQ R  CCKEDLYYPHS +QDL+W+ L Y +EPF++RWPF K+R+  +++ ++ MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHSLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             Y A ETR+IT G  EK+LQ+M WWAEDPNGDE K+HLAR+PD+LW+AEDGM++  FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD   ATQAIIA+ MVEEYGD L+K HF+IKESQ+KENP+GDF  M R  TKG+WTFSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHG  VSDCTAE LKCLLLL +MP  I+GEKP+V+RLYEAV+V LYLQS  SGGFA WEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPEVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
             PVP+PYL++LNPSEIFADIVVE EHIE T S+I  L+AF+C +P +R KE+  S+AKA++
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE+ Q  DGSWYG+WG+CFLYGTFF L G  +AG++Y+N EAV     FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE L+SCPS ++ PL+G  TNLVQTSWAMLGLM+ GQAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             GDFPQQ+ITGVY KN MLHYA +R+ FPL AL EYRKRVW
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVW  760



>dbj|BAD15332.1| beta-amyrin synthase [Panax ginseng]
Length=769

 Score =  1159 bits (2997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/760 (70%), Positives = 633/760 (83%), Gaps = 4/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2247
             MWKLK+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  EKARK +   ++  G H C
Sbjct  1     MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC  60

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              D+ MR Q+IKES +D+LSIPP+RL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPLRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  1886  ALNYVALRLLGEG---PDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              L+YV LRLLGEG    DDG+GA+ RGRKWILDHGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSYVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAAGIPSWGKTYLAVLGVYEWEGCN  240

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             PL PEFWLFPS+FPFHPAKMW YCR TYMPMSYLY KRY GP+TD+VL+LR EI+   YE
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
             QI WNQ R  CCKEDLYYPH+ +QDL+W+ L Y +EPF++RWPF K+R+  +++ ++ MR
Sbjct  301   QIKWNQQRHICCKEDLYYPHTLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             Y A ETR+IT G  EK+LQ+M WWAEDPNGDE K+HLAR+PD+LW+AEDGM++  FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD   ATQAIIA+ MVEEYGD L+KVHF+IKESQ+KENP+GDF  M R  TKG+WTFSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKVHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHG  VSDCTAE LKCLLLL +MP  I+GEKP+V+RLYEAV+V LYLQS  SGGFA WEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPEVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
             PVP+PYL++LNPSEIFADIVVE EHIE T S+I  L+AF+C +P +R KE+  S+AKA++
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE+ Q  DGSWYG+WG+CFLYGTFF L G  +AG++Y+N EAV     FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE L+SCPS ++ PL+G  TNLVQTSWAMLGLM+ GQAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             GDFPQQ+ITGVY KN MLHYA +R+ FPL AL EYRKRVW
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVW  760



>gb|ACZ71036.1| dammarenediol synthase protein [Panax ginseng]
Length=769

 Score =  1157 bits (2993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/760 (69%), Positives = 632/760 (83%), Gaps = 4/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2247
             MWKLK+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  EKARK +   ++  G H C
Sbjct  1     MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC  60

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              D+ MR Q+IKES +D+LSIPP+RL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPLRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  1886  ALNYVALRLLGEG---PDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              L+YV LRLLGEG    DDG+GA+ RGRKWILDHGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSYVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAAGIPSWGKTYLAVLGVYEWEGCN  240

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             PL PEFWLFPS+FPFHPAKMW YCR TYMPMSYLY KRY GP+TD+VL+LR EI+   YE
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
             QI WNQ R  CCKEDLYYPH+ +QDL+W+ L Y +EPF++RWPF K+R+  +++ ++ MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHTLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             Y A ETR+IT G  EK+LQ+M WWAEDPNGDE K+HLAR+PD+LW+AEDGM++  FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD   ATQAIIA+ MVEEYGD L+K HF+IKESQ+KENP+GDF  M R  TKG+WTFSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHG  VSDCTAE LKCLLLL +MP  I+GEKP+V+RLYEAV+V LYLQS  SGGFA WEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPEVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
             PVP+PYL++LNPSEIFADIVVE EHIE T S+I  L+AF+C +P +R KE+  S+AKA++
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE+ Q  DGSWYG+WG+CFLYGTFF L G  +AG++Y+N EAV     FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE L+SCPS ++ PL+G  TNLVQTSWAMLGLM+ GQAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             GDFPQQ+ITGVY KN MLHYA +R+ FPL AL EYRKRVW
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVW  760



>gb|AGK62449.1| dammarenediol-II synthase [Panax quinquefolius]
Length=769

 Score =  1157 bits (2993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/760 (69%), Positives = 632/760 (83%), Gaps = 4/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2247
             MWKLK+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  EKARK +   ++  G H C
Sbjct  1     MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC  60

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              D+ MR Q+IKES +D+LSIPPVRL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPVRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  1886  ALNYVALRLLGEG---PDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              L+YV LRLLGEG    DDG+GA+ RGRKWILDHGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSYVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAAGIPSWGKTYLAVLGVYEWEGCN  240

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             PL PEFWLFPS+FPFHPAKMW YCR TYMPMSYLY KRY GP+TD+VL+LR EI+   YE
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
             QI WNQ R  CCKEDLYYPH+ +QDL+W+ L Y +EPF++RWPF K+R+  +++ ++ MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHTLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVZLMR  360

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             Y A ETR+IT G  EK+LQ+M WWAEDPNGDE K+HLAR+PD+LW+AEDGM++  FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD   ATQAIIA+ MVEEYGD L+K HF+IKESQ+KENP+GDF  M R  TKG+WTFSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHG  VSDCTAE LKCLLLL +MP  I+GEKP+V+RLYEAV+V LYLQS  SGGFA WEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPEVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
             PVP+PYL++LNPSEIFADIVVE EHIE T S+I  L+AF+C +P +R KE+  S+AKA++
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE+ Q  DGSWYG+WG+CFLYGTFF L G  +AG++Y+N EAV     FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE L+SCPS ++ PL+G  TNLVQTSWA+LGLM+ GQAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAILGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             GDFPQQ+ITGVY KN MLHYA +R+ FPL AL EYRKRVW
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVW  760



>gb|AED99864.1| DS synthase [Panax quinquefolius]
Length=769

 Score =  1157 bits (2992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/760 (69%), Positives = 632/760 (83%), Gaps = 4/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2247
             MWKLK+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  EKARK +   ++  G H C
Sbjct  1     MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC  60

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              D+ MR Q+IKES +D+LSIPPVRL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPVRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  1886  ALNYVALRLLGEG---PDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              L+YV LRLLGEG    DDG+GA+ RGRKWILDHGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSYVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAAGIPSWGKTYLAVLGVYEWEGCN  240

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             PL PEFWLFPS+FPFHPAKMW YCR TYMPMSYLY KRY GP+TD+VL+LR EI+   YE
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
             QI WNQ R  CCKEDLYYPH+ +QDL+W+ L Y +EPF++RWPF K+R+  +++ ++ MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHTLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             Y A ETR+IT G  EK+LQ+M WWAEDPNGDE K+HLAR+PD+LW+AEDGM++  FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD   ATQAIIA+ MVEEYGD L+K HF+IKESQ+KENP+GDF  M R  TKG+WTFSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHG  VSDCTAE LKCLLLL +MP  I+GEKP+V+RLYEAV+V LYLQS  SGGFA WEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPEVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
             PVP+PYL++LNPSEIFADIVVE EHIE T S+I  L+AF+C +P +R KE+  S+AKA++
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE+ Q  DGSWYG+WG+CFLYGTFF L G  +AG++Y+N EAV     FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE L+SCPS ++ PL+G  TNLVQTSWA+LGLM+ GQAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAILGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             GDFPQQ+ITGVY KN MLHYA +R+ FPL AL EYRKRVW
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVW  760



>gb|AIK21788.1| dammarenediol-II synthase [Panax notoginseng]
Length=769

 Score =  1156 bits (2990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/760 (69%), Positives = 630/760 (83%), Gaps = 4/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2247
             MWKLK+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  E ARK +   ++  G H C
Sbjct  1     MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVENARKDYVNNKKLHGVHPC  60

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              D+ MR Q+IKES +D+LSIPPVRL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPVRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  1886  ALNYVALRLLGEG---PDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              L++V LRLLGEG    DDG+GA+ RGRKWILDHGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSFVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAASIPSWGKTYLAVLGVYEWEGCN  240

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             PL PEFWLFPS+FPFHPAKMW YCR TYMPMSYLY KRY GP+TD+VL+LR EI+   YE
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
             QI WNQ R  CCKEDLYYPHS +QDL+W+ L Y +EPF++RWPF K+R+  +++ ++ MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHSLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             Y A ETR+IT G  EK+LQ+M WWAEDPNGDE K+HLAR+PD+LW+AEDGM++  FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD   ATQAIIA+ MVEEYGD L+K HF+IKESQ+KENP+GDF  M R  TKG+WTFSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHG  VSDCTAE LKCLLLL +MP  I+GEKP V+RLYEAV+V LYLQS  SGGFA WEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPKVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
             PVP+PYL++LNPSEIFADIVVE EHIE T S+I  L+AF+C +P +R KE+  S+AKA++
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE+ Q  DGSWYG+WG+CFLYGTFF L G  +AG++Y+N EAV     FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE L+SCPS ++ PL+G  TNLVQTSWAMLGLM+ GQAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             GDFPQQ+ITGVY KN MLHYA +R+ FPL AL EYRKRVW
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVW  760



>gb|AGS79229.1| dammarenediol-II synthase [Panax notoginseng]
Length=769

 Score =  1156 bits (2990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/760 (69%), Positives = 630/760 (83%), Gaps = 4/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2247
             MWKLK+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  E ARK +   ++  G H C
Sbjct  1     MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVENARKDYVNNKKLHGIHPC  60

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              D+ MR Q+IKES +D+LSIPPVRL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPVRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  1886  ALNYVALRLLGEG---PDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              L++V LRLLGEG    DDG+GA+ RGRKWILDHGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSFVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAASIPSWGKTYLAVLGVYEWEGCN  240

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             PL PEFWLFPS+FPFHPAKMW YCR TYMPMSYLY KRY GP+TD+VL+LR EI+   YE
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
             QI WNQ R  CCKEDLYYPHS +QDL+W+ L Y +EPF++RWPF K+R+  +++ ++ MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHSLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             Y A ETR+IT G  EK+LQ+M WWAEDPNGDE K+HLAR+PD+LW+AEDGM++  FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD   ATQAIIA+ MVEEYGD L+K HF+IKESQ+KENP+GDF  M R  TKG+WTFSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHG  VSDCTAE LKCLLLL +MP  I+GEKP V+RLYEAV+V LYLQS  SGGFA WEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPKVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
             PVP+PYL++LNPSEIFADIVVE EHIE T S+I  L+AF+C +P +R KE+  S+AKA++
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE+ Q  DGSWYG+WG+CFLYGTFF L G  +AG++Y+N EAV     FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE L+SCPS ++ PL+G  TNLVQTSWAMLGLM+ GQAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             GDFPQQ+ITGVY KN MLHYA +R+ FPL AL EYRKRVW
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVW  760



>gb|AEO27862.1| dammarenediol synthase [Panax ginseng]
Length=769

 Score =  1154 bits (2986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/760 (69%), Positives = 631/760 (83%), Gaps = 4/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2247
             MWK K+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  EKARK +   ++  G H C
Sbjct  1     MWKQKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC  60

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              D+ MR Q+IKES +D+LSIPP+RL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPLRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  1886  ALNYVALRLLGEG---PDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              L+YV LRLLGEG    DDG+GA+ RGRKWILDHGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSYVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAAGIPSWGKTYLAVLGVYEWEGCN  240

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             PL PEFWLFPS+FPFHPAKMW YCR TYMPMSYLY KRY GP+TD+VL+LR EI+   YE
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
             QI WNQ R  CCKEDLYYPH+ +QDL+W+ L Y +EPF++RWPF K+R+  +++ ++ MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHTLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             Y A ETR+IT G  EK+LQ+M WWAEDPNGDE K+HLAR+PD+LW+AEDGM++  FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD   ATQAIIA+ MVEEYGD L+K HF+IKESQ+KENP+GDF  M R  TKG+WTFSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHG  VSDCTAE LKCLLLL +MP  I+GEKP+V+RLYEAV+V LYLQS  SGGFA WEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPEVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
             PVP+PYL++LNPSEIFADIVVE EHIE T S+I  L+AF+C +P +R KE+  S+AKA++
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE+ Q  DGSWYG+WG+CFLYGTFF L G  +AG++Y+N EAV     FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE L+SCPS ++ PL+G  TNLVQTSWAMLGLM+ GQAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             GDFPQQ+ITGVY KN MLHYA +R+ FPL AL EYRKRVW
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVW  760



>gb|AED99865.1| DS synthase [Panax notoginseng]
Length=769

 Score =  1154 bits (2985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/760 (69%), Positives = 629/760 (83%), Gaps = 4/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2247
             MWKLK+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  E ARK +   ++  G H C
Sbjct  1     MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVENARKDYVNNKKLHGXHPC  60

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              D+ MR Q+IKES +D+LSIPPVRL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPVRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  1886  ALNYVALRLLGEG---PDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              L++V LRLLGEG    DDG+GA+ RGRKWILDHGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSFVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAASIPSWGKTYLAVLGVYEWEGCN  240

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             PL PEFWLFPS+FPFHPAKMW YCR TYMPMSYLY KRY GP+TD+VL+LR EI+   YE
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
             QI WNQ R  CCKEDLYYPHS +QDL+W+ L Y +EPF++RWPF K+R+  +++ ++ MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHSLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             Y A ETR+IT G  EK+LQ+M WWAEDPNGDE K+HLAR+PD+LW+AEDGM++  FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD   ATQAIIA+ MVEEYGD L+K HF+IKESQ+KENP+GDF  M R  TKG+WTFSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DH   VSDCTAE LKCLLLL +MP  I+GEKP V+RLYEAV+V LYLQS  SGGFA WEP
Sbjct  481   DHXCVVSDCTAEALKCLLLLSQMPQDIVGEKPKVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
             PVP+PYL++LNPSEIFADIVVE EHIE T S+I  L+AF+C +P +R KE+  S+AKA++
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE+ Q  DGSWYG+WG+CFLYGTFF L G  +AG++Y+N EAV     FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE L+SCPS ++ PL+G  TNLVQTSWAMLGLM+ GQAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             GDFPQQ+ITGVY KN MLHYA +R+ FPL AL EYRKRVW
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVW  760



>gb|AGI19258.1| dammarenediol synthase [Panax notoginseng]
Length=769

 Score =  1152 bits (2981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/760 (69%), Positives = 628/760 (83%), Gaps = 4/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2247
             MWK K+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  E ARK +   ++  G H C
Sbjct  1     MWKQKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVENARKDYVNNKKLHGVHPC  60

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              D+ MR Q+IKES +D+LSIPPVRL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPVRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  1886  ALNYVALRLLGEG---PDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              L++V LRLLGEG    DDG+GA+ RGRKWILDHGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSFVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAASIPSWGKTYLAVLGVYEWEGCN  240

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             PL PEFWLFPS+FPFHPAKMW YCR TYMPMSYLY KRY GP+TD+VL+LR EI+   YE
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
             QI WNQ R  CCKEDLYYPHS +QDL+W+ L Y +EPF++RWPF K+R+  +++ ++ MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHSLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             Y A ETR+IT G  EK+LQ+M WWAEDPNGDE K+HLAR+PD+LW+AEDGM++  FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD   ATQAIIA+ MVEEYGD L+K HF+IKESQ+KENP+GDF  M R  TKG+WTFSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHG  VSDCTAE LKCLLLL +MP  I+GEKP V+RLYEAV+V LYLQS  SGGFA WEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPKVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
             PVP+PYL++LNPSEIFADIVVE EHIE T S+I  L+AF+C +P +R KE+  S+AKA++
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE+ Q  DGSWYG+WG+CFLYG FF L G  +AG++Y+N EAV     FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGAFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE L+SCPS ++ PL+G  TNLVQTSWAMLGLM+ GQAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             GDFPQQ+ITGVY KN MLHYA +R+ FPL AL EYRKRVW
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVW  760



>gb|AGS16975.1| dammarenediol synthase II [Panax vietnamensis]
Length=769

 Score =  1152 bits (2979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/760 (70%), Positives = 626/760 (82%), Gaps = 4/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2247
             MWKLK+ +G  PY+YSTNN+ GRQ WE+ P AGTPEE+E  EKARK +   ++  G H C
Sbjct  1     MWKLKVAQGNDPYLYSTNNFVGRQYWEFLPEAGTPEEREEVEKARKDYVNNKKLHGIHPC  60

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              D+ MR Q+IKES +D+LSIPPVRL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPVRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             NSG L +TPPL+IALYISG+ID  LT +HKKEL+RY+YNHQNEDGGWG YI+G STMIGS
Sbjct  121   NSGSLLYTPPLIIALYISGTIDTTLTKQHKKELIRYVYNHQNEDGGWGSYIEGSSTMIGS  180

Query  1886  ALNYVALRLLGEGP---DDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              L+YV LRLLGEG    DDG+GA+ RGRKWILDHGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSYVMLRLLGEGSAESDDGNGAVERGRKWILDHGGAAGIPSWGKTYLAVLGVYEWEGCN  240

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             PL PEFWLFPS FPFHPAKMW YCR TYMPMSYLY KRY GP+TD+VL+LR EI+   YE
Sbjct  241   PLPPEFWLFPSFFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
             QI WN  R  CCKEDLYYPH+ +QDL+W+ L Y +EPF++RWPF K+R+  +++ ++ MR
Sbjct  301   QIKWNLQRHNCCKEDLYYPHTLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             Y A ETR+IT GC EK+LQ+M WWAEDPNGDE K+HLARVPD+LW+AEDGM++  FGSQ 
Sbjct  361   YGATETRFITTGCGEKALQIMSWWAEDPNGDEFKHHLARVPDFLWIAEDGMTVQSFGSQL  420

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD   ATQAIIA+ MVEEYGD L+K HFYIKESQ+KENP+GDF  M R  TKG+WTFSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFYIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHG  VSDCTAE LKCLLLL +MP  I+GEKP+V+RLYEAV+V LYLQS  SGGFA WEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPEVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
             PVP+PYL++LNPSEIFADIVVE EHIE T S+I  L+AF+C +P +R KE+  S+ KA+ 
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIENSVVKAIC  600

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE+ Q  DGSWYG+WG+CFLYGTFF L G  +AG++Y+N EAV     FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE L+SCPS ++ PL+G  TNLVQTSWAMLGLM+ GQAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             GDFPQQ+ITGVY KN MLHYA +R+ FPL AL EYRKRVW
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVW  760



>sp|Q08IT1.1|DADIS_PANGI RecName: Full=Dammarenediol II synthase [Panax ginseng]
 dbj|BAF33291.1| dammarenediol-II synthase [Panax ginseng]
Length=769

 Score =  1152 bits (2979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/760 (69%), Positives = 630/760 (83%), Gaps = 4/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2247
             MWK K  +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  EKARK +   ++  G H C
Sbjct  1     MWKQKGAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC  60

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              D+ MR Q+IKES +D+LSIPP+RL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPLRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  1886  ALNYVALRLLGEG---PDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              L+YV LRLLGEG    DDG+GA+ RGRKWILDHGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSYVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAAGIPSWGKTYLAVLGVYEWEGCN  240

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             PL PEFWLFPS+FPFHPAKMW YCR TYMPMSYLY KRY GP+TD+VL+LR EI+   YE
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
             QI WNQ R  CCKEDLYYPH+ +QDL+W+ L Y +EPF++RWPF K+R+  +++ ++ MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHTLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             Y A ETR+IT G  EK+LQ+M WWAEDPNGDE K+HLAR+PD+LW+AEDGM++  FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD   ATQAIIA+ MVEEYGD L+K HF+IKESQ+KENP+GDF  M R  TKG+WTFSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHG  VSDCTAE LKCLLLL +MP  I+GEKP+V+RLYEAV+V LYLQS  SGGFA WEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPEVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
             PVP+PYL++LNPSEIFADIVVE EHIE T S+I  L+AF+C +P +R KE+  S+AKA++
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE+ Q  DGSWYG+WG+CFLYGTFF L G  +AG++Y+N EAV     FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE L+SCPS ++ PL+G  TNLVQTSWAMLGLM+ GQAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             GDFPQQ+ITGVY KN MLHYA +R+ FPL AL EYRKRVW
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVW  760



>ref|XP_010245756.1| PREDICTED: beta-amyrin synthase-like [Nelumbo nucifera]
Length=763

 Score =  1008 bits (2607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/757 (60%), Positives = 591/757 (78%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MW+LKIG+GG PY+YSTNNY GRQIWE+DP+ GTPE++   E AR+ F   R +     G
Sbjct  1     MWRLKIGQGGDPYLYSTNNYVGRQIWEFDPDYGTPEQRAQVETARQEFRNNR-RSVKPSG  59

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             D+ +R Q++KE+   V +IPPV++ + EE+ YEA T A+++AV+ + A+QA DGHWPAEN
Sbjct  60    DVLLRFQLLKENSF-VQTIPPVKIGDNEEITYEAATAALKRAVQFHAAIQASDGHWPAEN  118

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GPLFF PPL+I LYI+G ++ +  +EH+KE++RY+YNHQNEDGGWGL+I+GHS M  +A
Sbjct  119   TGPLFFLPPLVICLYITGHLNTVFQAEHRKEILRYIYNHQNEDGGWGLHIEGHSIMFCTA  178

Query  1883  LNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             LNY+++R+LGEG + G DGA+ R RKWI+DHGGAT IPSWGK +LS+LGVYEW+G NP+ 
Sbjct  179   LNYISMRILGEGSEGGLDGAVPRARKWIIDHGGATMIPSWGKTWLSILGVYEWEGSNPMP  238

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T +VL LR E+H + Y +I 
Sbjct  239   PEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITLLVLQLREELHTQPYHEIK  298

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             W++ R  C KEDLYYPH FIQDLLW++L + TEP + RWPF K+REMA++  +K++ YE 
Sbjct  299   WSRTRHICAKEDLYYPHPFIQDLLWDSLYFLTEPLLTRWPFNKLREMALKTTMKHIHYED  358

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             + +RYITIGC+EK L M+  W EDPNGD  K+HLAR+PDY+W+AEDGM M  FGSQ WD 
Sbjct  359   DNSRYITIGCVEKVLCMLACWVEDPNGDAFKHHLARIPDYIWVAEDGMKMQSFGSQQWDT  418

Query  1166  AFATQAIIASGM-VEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
              FA QAI+AS + + E G CL+K H +IK+SQV++NP GDF  MYRH++KGSWTFSDQDH
Sbjct  419   GFAVQAIMASNLPLNEIGSCLKKGHDFIKKSQVQDNPSGDFGRMYRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LK  L+   +P + +GEK +  +L+++V++ L LQS ++GG   WEP  
Sbjct  479   GWQVSDCTAEGLKACLMFSLLPQEFVGEKMEPNKLFDSVNLLLSLQS-KNGGLTAWEPAR  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
              + +L++LNP+E FADIV+E E++E T S I ALV F   YP++R KE+   I+KAV +L
Sbjct  538   AENWLELLNPTEFFADIVIEHEYVECTASAIQALVLFMKLYPSHREKEIENFISKAVHFL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E+ Q  DGSWYG WGVCF YGT+FA+ GL AAGK+Y NC+AV  A HF LS Q + GGWG
Sbjct  598   EQIQMPDGSWYGNWGVCFTYGTWFAMGGLVAAGKTYFNCKAVQKAVHFLLSTQQESGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP+ +YIPLEG  +NLV T+WAM+GL+++GQAERD TPLHRAAKLLIN+QMEDGD
Sbjct  658   ESYLSCPNKKYIPLEGGRSNLVHTAWAMMGLIHSGQAERDATPLHRAAKLLINSQMEDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ+ITGV+MKNCMLHYA++R+ FPL AL EYR++V
Sbjct  718   FPQQEITGVFMKNCMLHYAAYRNIFPLWALGEYRRQV  754



>gb|ADX01169.1| putative beta-amyrin synthase [Bacopa monnieri]
Length=643

 Score =  1003 bits (2594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/632 (72%), Positives = 540/632 (85%), Gaps = 0/632 (0%)
 Frame = -3

Query  2051  FFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSALNYV  1872
             FFTPPL+I LYISG+I+ +LT+EHKKEL+R++YNHQNEDGGWGLYI+G STMIGSA++YV
Sbjct  1     FFTPPLIIVLYISGTINTVLTAEHKKELIRFIYNHQNEDGGWGLYIEGRSTMIGSAMSYV  60

Query  1871  ALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLSPEFWL  1692
             ALRLLGEGPDDG+G++ARGRKWILDHGGAT IPSWGK YLSVLG Y+WDGCNPL PE WL
Sbjct  61    ALRLLGEGPDDGNGSVARGRKWILDHGGATGIPSWGKPYLSVLGAYDWDGCNPLPPELWL  120

Query  1691  FPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQIDWNQAR  1512
              PS  PFHPAKMWCYCRT YMPMSYLY KRY GP+TD+VL+LR EI+VK Y+QI+WN+AR
Sbjct  121   CPSFLPFHPAKMWCYCRTAYMPMSYLYGKRYHGPITDLVLSLRQEIYVKPYDQINWNKAR  180

Query  1511  MACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEAEETRY  1332
               CCKEDLYYPH+FIQDL+W+AL Y +EP + RWPF KIR+ A+ K I+YMRY A+E+RY
Sbjct  181   HDCCKEDLYYPHTFIQDLMWDALNYVSEPVLSRWPFNKIRQRALGKIIEYMRYGADESRY  240

Query  1331  ITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDAAFATQ  1152
             IT G  EKSLQMMCWW+ DP GDE K HLARVPDYLWLAEDGM +  FGSQ WD+  ATQ
Sbjct  241   ITSGNAEKSLQMMCWWSHDPKGDEFKRHLARVPDYLWLAEDGMKVQSFGSQLWDSTLATQ  300

Query  1151  AIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHGWAVSD  972
             AIIASGMVEEYGDCL+K +F+IKESQ+K+NPKGDF +M+RH TKG+WTFSDQD GWAVSD
Sbjct  301   AIIASGMVEEYGDCLKKANFFIKESQIKQNPKGDFHAMHRHFTKGAWTFSDQDQGWAVSD  360

Query  971   CTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVPQPYLQ  792
             CTAE LKCLLL+ +MP++  GE  +V+R Y+A++V LYLQ+ ESGGFA WEP   QPYLQ
Sbjct  361   CTAEGLKCLLLMSQMPNEARGENVEVERFYDAINVLLYLQNQESGGFAVWEPMSSQPYLQ  420

Query  791   VLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLEKQQES  612
              LNPSE+FADIVVE+EH+E T S+I ALV F+  +P++R KE+ IS+AKAV++LEK+Q  
Sbjct  421   ALNPSELFADIVVEQEHVECTASVIQALVLFKHLHPSHREKEIEISVAKAVRFLEKKQWP  480

Query  611   DGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGECLQSC  432
             DGSWYGYWG+CF+YGTF+ L GL +AGK+YEN E +     F LS QN+EGGWGE L+SC
Sbjct  481   DGSWYGYWGICFVYGTFWVLRGLASAGKTYENSETIQKGVGFLLSTQNEEGGWGESLKSC  540

Query  431   PSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDFPQQDI  252
             P  +Y PLEG  TNLVQT+WAMLGLMY GQAERD TPL +AAKLLINAQMEDGDFPQQ+I
Sbjct  541   PRTKYTPLEGNRTNLVQTAWAMLGLMYGGQAERDTTPLDKAAKLLINAQMEDGDFPQQEI  600

Query  251   TGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             TGV+MKNCMLHYA +R+ FPL ALSEYR+RVW
Sbjct  601   TGVWMKNCMLHYAQYRNIFPLWALSEYRRRVW  632



>ref|XP_002270051.2| PREDICTED: beta-amyrin synthase [Vitis vinifera]
 emb|CBI30906.3| unnamed protein product [Vitis vinifera]
Length=759

 Score =   984 bits (2545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/758 (60%), Positives = 574/758 (76%), Gaps = 9/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHTC  2247
             MWKLK+ EG GP++YS NN+ GRQIWE+DP AGTPEE+E   K ++ FT  R +  P+  
Sbjct  1     MWKLKVAEGHGPWLYSLNNFVGRQIWEFDPEAGTPEEREEVRKVQENFTTNRFRYKPN--  58

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL MRMQ+IKE+++D LSIPPVRL E EEV YEA+TTAVRK+VRLN A+QAKDGHWPAE
Sbjct  59    GDLLMRMQLIKENKID-LSIPPVRLGENEEVTYEAVTTAVRKSVRLNRAIQAKDGHWPAE  117

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFFTPPL++ LY +G++++ LT EHK EL+RY+ NHQNEDGGWG +I+GHSTM+G+
Sbjct  118   NTGPLFFTPPLIMVLYFTGTLNIALTPEHKVELLRYITNHQNEDGGWGFHIEGHSTMLGT  177

Query  1886  ALNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
              LNY+++R+LG GPDD   A+A GRKWI+D GGAT  PSWGK YLSV G+YEW GCNPL 
Sbjct  178   TLNYISMRILGVGPDDK--AVAAGRKWIVDRGGATHSPSWGKCYLSVFGLYEWSGCNPLP  235

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWLFPS  P HP KMWCYCRT YMPMSYLY  R++ P+TD+VL LR E+H + Y +I+
Sbjct  236   PEFWLFPSFLPMHPDKMWCYCRTIYMPMSYLYGTRFQAPITDLVLQLREEMHTEPYHEIN  295

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             W +AR+ C KED YYPHS IQD+LW  L +  EP ++ WP  KIRE A++KAI  + +E 
Sbjct  296   WAKARLLCAKEDYYYPHSLIQDVLWGGLYHFGEPILKHWPVSKIRERAVKKAIDIIHWED  355

Query  1346  EETRYITIGCIEKSLQMMCWWAEDP--NGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E +RYIT GC+EK+  MM  WAE+P  N D  K+HLAR+PDYLW+AEDGM +  FGSQ W
Sbjct  356   ENSRYITPGCVEKAFHMMAVWAENPDSNSDAFKHHLARIPDYLWMAEDGMKVQSFGSQLW  415

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D +   QAI+ SGMVEEYG  L+K H Y+K SQ +ENP GD++S YRH +KG+WTFSD+D
Sbjct  416   DTSLCIQAILESGMVEEYGTTLKKGHDYVKLSQCQENPSGDYRSRYRHFSKGAWTFSDRD  475

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCT+E L+ LLLL + P +++GEK + QRL++AV+    LQ  +SGG A WEP 
Sbjct  476   HGWQVSDCTSEALRVLLLLSQFPKELVGEKAEPQRLFDAVNFLFSLQG-KSGGVAVWEPA  534

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               + +L+ LNPSE+FA+IV E E++E T S I  L+ F+  YPN+R KEV+    KA +Y
Sbjct  535   GAEEWLEKLNPSELFANIVTEHEYVECTSSTIQTLLLFKKLYPNHRRKEVDNFTEKATRY  594

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E  Q  DGSWYG WGVCF Y  +FAL GL A GK+Y N + V     F LSKQ   GGW
Sbjct  595   VENVQRPDGSWYGGWGVCFTYAAWFALSGLAAVGKTYSNSKTVRKGVDFLLSKQKANGGW  654

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP M Y+ LEG  TNLVQT+W ++GL+  GQ E DPTPLH+AAKLLIN+Q+++G
Sbjct  655   GESYLSCPDMVYVHLEGDHTNLVQTAWCLMGLIEAGQVESDPTPLHKAAKLLINSQLDNG  714

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQ+++TGVYM NCM HYAS+R+ FP  AL  YR+RV
Sbjct  715   DFPQEEVTGVYMNNCMQHYASYRNIFPTWALGMYRRRV  752



>gb|AHF49822.1| bAS [Maesa lanceolata]
Length=760

 Score =   984 bits (2544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/759 (59%), Positives = 577/759 (76%), Gaps = 7/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPY---IYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2253
             MW+LK+ EGGGPY   +YSTNN+ GRQIWE++P+ GTPEE++  EKAR  FT+ R +   
Sbjct  1     MWRLKVAEGGGPYEPYLYSTNNFVGRQIWEFNPDYGTPEERDEVEKARTHFTENRSR-VK  59

Query  2252  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2073
               GD+ +R+ ++KE+     +IP V++ + EE+ YEA  T +++A+    A+QA DGHWP
Sbjct  60    PSGDVLLRLHLLKENNFQQ-TIPQVKVGDNEEITYEAANTTLKRAMHFFSAMQASDGHWP  118

Query  2072  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  1893
             AEN+GPL+F PPL++ALYI+G +D+I  SEHKKE++RY+YNHQN DGGWG +I+GHS M 
Sbjct  119   AENAGPLYFLPPLVMALYITGHLDIIFPSEHKKEILRYIYNHQNGDGGWGFHIEGHSIMF  178

Query  1892  GSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              + L+Y+ +R+LG+GP  G + A+ RGRKWI DHGG   +PSWGK +LS+ G+++W GCN
Sbjct  179   CTVLSYICMRILGDGPFGGRNNAVERGRKWIHDHGGVVALPSWGKTWLSIFGLFDWSGCN  238

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             P+ PEFW+ P   P HPAKMWCYCR  YMPMSYLY KR+ GP+TD+VL LR E+H +SYE
Sbjct  239   PMPPEFWILPPYLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITDLVLQLRKELHSQSYE  298

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
              I+W + R  CCKEDLYYPH  +QDLLW++L   TEP + RWPF K+RE A++K I Y+ 
Sbjct  299   TINWKKYRHVCCKEDLYYPHPMLQDLLWDSLYILTEPLLMRWPFNKLREKALKKTIDYIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  WAE+PN D  K HLAR+PDY+W+AEDG+ M  FGSQ 
Sbjct  359   YEDENSRYITIGCVEKVLCMLSCWAEEPNSDYFKKHLARIPDYIWVAEDGIKMQSFGSQQ  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FATQA++A  M+EE    L+K H YIK+SQVK+NP GDFK M+RH++KGSWTFSDQ
Sbjct  419   WDTGFATQAVLACNMIEETSAVLKKGHDYIKKSQVKDNPSGDFKKMFRHISKGSWTFSDQ  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC L+L ++P +++GEK D Q LYEAV+V L LQS ++GG A WEP
Sbjct  479   DHGWQVSDCTAEGLKCCLMLSQLPPELVGEKHDPQLLYEAVNVILSLQS-KTGGIAAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+E FADIV+E E++E T + I A V F+  YP +R KE++  I KA+ 
Sbjct  538   VKAGAWLELLNPTEFFADIVIEHEYVECTAASIQAFVLFKKLYPGHRTKEIDAFIIKAIG  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             +L+  Q  DGSWYG WGVCF YGT+FAL G  AAGK+Y NCEAV     F LS Q   GG
Sbjct  598   FLQDIQMPDGSWYGNWGVCFTYGTWFALGGFAAAGKNYNNCEAVRKGVEFLLSSQRDNGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  +Y+PLE   +NLV TSWAM+GL++TGQAERDPTPLHRAAKLLIN+Q E+
Sbjct  658   WGESYLSCPLKKYVPLEDNRSNLVHTSWAMMGLIHTGQAERDPTPLHRAAKLLINSQFEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYR +V
Sbjct  718   GDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRNKV  756



>emb|CDP08999.1| unnamed protein product [Coffea canephora]
Length=759

 Score =   981 bits (2536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/758 (59%), Positives = 578/758 (76%), Gaps = 7/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LK+ EG   PY+YSTNN+ GRQIWE+DPN G+PEE+E  E AR  F   R Q  P  
Sbjct  1     MWRLKVAEGDNSPYLYSTNNFVGRQIWEFDPNGGSPEEREEVENARVQFWNNRYQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E      SIP V++ + +E+ +E  T A+R+AV    ALQA DGHWPA
Sbjct  59    SADLLWRMQFLREKNFKQ-SIPQVKVEDGQEITHEVATVALRRAVHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++ LYI+G ++ I  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCLYITGHLNSIFPAEHQKEILRYIYCHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +AL+Y+ +R+LGEGPD G + A +R RKWILDHG AT +PSWGK +L++LG+++W G NP
Sbjct  178   TALSYICMRILGEGPDGGLNNACSRARKWILDHGSATAMPSWGKTWLAILGLFDWSGTNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y+Q
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAEPYDQ  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             IDW + R  C KEDLYYPH  IQDL+W++L  C EP +  WPF K+RE A++  +K++ Y
Sbjct  298   IDWRKVRHVCAKEDLYYPHPLIQDLIWDSLYICAEPLLTHWPFNKLRERALQTTMKHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDY+W+AEDGM M  FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGMKMQSFGSQEW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D AFA QA++AS + EE  + LRK H ++K+SQV +NP GDF+SM+RH++KGSWTFSDQD
Sbjct  418   DTAFALQALLASDLTEEIEETLRKGHDFVKKSQVTDNPSGDFRSMHRHISKGSWTFSDQD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LL   MP +I+GEK + +RLY+AV++ LYLQS ++GG + WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSTMPPEIVGEKLEPERLYDAVNILLYLQS-KNGGLSAWEPA  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L++LNP+E FADIVVE E++E T S I AL+ F+  YP +R KE+   I  A +Y
Sbjct  537   GAQKWLELLNPTEFFADIVVEHEYVECTSSAIHALILFKKLYPGHRKKEIESFITNASKY  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q  DGSWYG WGVCF YGT+FAL GL AAGK+Y+NC+AV  A  F L  Q  +GGW
Sbjct  597   LEDVQMPDGSWYGNWGVCFTYGTWFALGGLAAAGKTYDNCQAVRKAVEFLLKSQRNDGGW  656

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE  +SCP  +Y+PLEG  +NLV T+WAM+GL+++GQA+RDP PLHRAAKLLIN+QME+G
Sbjct  657   GESYRSCPEKKYVPLEGEQSNLVHTAWAMMGLIHSGQADRDPRPLHRAAKLLINSQMENG  716

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  717   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKRV  754



>ref|XP_002269395.2| PREDICTED: beta-amyrin synthase isoform X1 [Vitis vinifera]
Length=762

 Score =   979 bits (2531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/761 (60%), Positives = 576/761 (76%), Gaps = 9/761 (1%)
 Frame = -3

Query  2432  IRKMWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GP  2256
             +R MWKLKI EG GP++YS NN+ GRQIWE+DP AGTPEE+E   K ++ FTK R +  P
Sbjct  1     MRIMWKLKIAEGHGPWLYSLNNFVGRQIWEFDPEAGTPEEREEVWKVQENFTKNRFRYKP  60

Query  2255  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2076
             +  GDL MRMQ+IKE+++D LSIPPVRL E EEV  EA+TTAVRK+VRLN A+QAKDGHW
Sbjct  61    N--GDLLMRMQLIKENQID-LSIPPVRLGENEEVTCEAVTTAVRKSVRLNRAIQAKDGHW  117

Query  2075  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  1896
             PAEN+GPLFFTPPL++ LY +G++++ LT EHK EL+RY+ NHQNEDGGWG +I+GHSTM
Sbjct  118   PAENAGPLFFTPPLIMVLYFTGTLNIALTPEHKVELLRYITNHQNEDGGWGFHIEGHSTM  177

Query  1895  IGSALNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
             +G+ LNY+++R+LG GPDD   A+A GRKWILD GGAT  PSWGK YLSV G+YEW GCN
Sbjct  178   LGTTLNYISMRVLGVGPDDK--AVAAGRKWILDRGGATYSPSWGKCYLSVFGLYEWSGCN  235

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             PL PEFWLFPS  P HP KMWCYCRT YMPMSYLY  R++ P+TD+V+ LR E+H + Y 
Sbjct  236   PLPPEFWLFPSFLPMHPDKMWCYCRTIYMPMSYLYGTRFQAPITDLVVQLREEMHTEPYH  295

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
             +I+W +AR+ C KED YYPHS +QD+LW  L +  EP ++ WP  KIRE A++KAI  + 
Sbjct  296   EINWAKARLLCAKEDYYYPHSLVQDVLWGGLYHFGEPILKHWPVSKIRERAVKKAIDIIH  355

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDP--NGDELKYHLARVPDYLWLAEDGMSMHGFGS  1182
             +E E +RYIT GC+EK+  MM  WAE+P  N D  K+HLAR+PDYLW+AEDGM +  FGS
Sbjct  356   WEDENSRYITPGCVEKAFHMMAVWAENPDSNSDVFKHHLARIPDYLWMAEDGMKVQSFGS  415

Query  1181  QNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFS  1002
             Q WD +   QAI+ SGMVEEYG  L+K H Y+K SQ +ENP GD++S YRH +KG+WTFS
Sbjct  416   QLWDTSLCIQAILESGMVEEYGTTLKKGHDYVKLSQCQENPSGDYRSRYRHFSKGAWTFS  475

Query  1001  DQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATW  822
             D+DHGW VSDCT+E L+ LLLL + P +++GEK + Q L++AV+    LQ  +SGG A W
Sbjct  476   DRDHGWQVSDCTSEALRVLLLLSQFPKELVGEKAEPQCLFDAVNFLFSLQG-KSGGLAVW  534

Query  821   EPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKA  642
             EP   + +L+ LNPSE+FA+IV E E++E T S I  L+ F+  YPN+R KEV+  I KA
Sbjct  535   EPAGAEEWLEKLNPSELFANIVTEHEYVECTSSAIQTLLLFKKLYPNHRRKEVDNFIEKA  594

Query  641   VQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQE  462
              +Y+E  Q  +GSWYG WGVCF Y  +FAL GL A GK+Y N + V     F LSKQ   
Sbjct  595   TRYVENVQRPNGSWYGGWGVCFTYAAWFALSGLAAVGKTYSNSKTVRKGVDFLLSKQKAN  654

Query  461   GGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQM  282
             GGWGE   SCP M Y+ LEG  TNLVQT+W ++GL+  GQ E+DPTPLH+AAKLLIN+Q+
Sbjct  655   GGWGESYLSCPDMVYVHLEGDRTNLVQTAWCLMGLIEAGQVEKDPTPLHKAAKLLINSQL  714

Query  281   EDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             + GDFPQ++ITGVYM NCMLHYAS+R+ FP  AL  Y +RV
Sbjct  715   DSGDFPQEEITGVYMNNCMLHYASYRNIFPTWALGMYHRRV  755



>ref|XP_010655672.1| PREDICTED: beta-amyrin synthase isoform X2 [Vitis vinifera]
 ref|XP_010655673.1| PREDICTED: beta-amyrin synthase isoform X2 [Vitis vinifera]
 ref|XP_010655674.1| PREDICTED: beta-amyrin synthase isoform X2 [Vitis vinifera]
 ref|XP_010655675.1| PREDICTED: beta-amyrin synthase isoform X2 [Vitis vinifera]
 emb|CBI30891.3| unnamed protein product [Vitis vinifera]
Length=759

 Score =   977 bits (2526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/758 (60%), Positives = 574/758 (76%), Gaps = 9/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHTC  2247
             MWKLKI EG GP++YS NN+ GRQIWE+DP AGTPEE+E   K ++ FTK R +  P+  
Sbjct  1     MWKLKIAEGHGPWLYSLNNFVGRQIWEFDPEAGTPEEREEVWKVQENFTKNRFRYKPN--  58

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL MRMQ+IKE+++D LSIPPVRL E EEV  EA+TTAVRK+VRLN A+QAKDGHWPAE
Sbjct  59    GDLLMRMQLIKENQID-LSIPPVRLGENEEVTCEAVTTAVRKSVRLNRAIQAKDGHWPAE  117

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFFTPPL++ LY +G++++ LT EHK EL+RY+ NHQNEDGGWG +I+GHSTM+G+
Sbjct  118   NAGPLFFTPPLIMVLYFTGTLNIALTPEHKVELLRYITNHQNEDGGWGFHIEGHSTMLGT  177

Query  1886  ALNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
              LNY+++R+LG GPDD   A+A GRKWILD GGAT  PSWGK YLSV G+YEW GCNPL 
Sbjct  178   TLNYISMRVLGVGPDDK--AVAAGRKWILDRGGATYSPSWGKCYLSVFGLYEWSGCNPLP  235

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWLFPS  P HP KMWCYCRT YMPMSYLY  R++ P+TD+V+ LR E+H + Y +I+
Sbjct  236   PEFWLFPSFLPMHPDKMWCYCRTIYMPMSYLYGTRFQAPITDLVVQLREEMHTEPYHEIN  295

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             W +AR+ C KED YYPHS +QD+LW  L +  EP ++ WP  KIRE A++KAI  + +E 
Sbjct  296   WAKARLLCAKEDYYYPHSLVQDVLWGGLYHFGEPILKHWPVSKIRERAVKKAIDIIHWED  355

Query  1346  EETRYITIGCIEKSLQMMCWWAEDP--NGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E +RYIT GC+EK+  MM  WAE+P  N D  K+HLAR+PDYLW+AEDGM +  FGSQ W
Sbjct  356   ENSRYITPGCVEKAFHMMAVWAENPDSNSDVFKHHLARIPDYLWMAEDGMKVQSFGSQLW  415

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D +   QAI+ SGMVEEYG  L+K H Y+K SQ +ENP GD++S YRH +KG+WTFSD+D
Sbjct  416   DTSLCIQAILESGMVEEYGTTLKKGHDYVKLSQCQENPSGDYRSRYRHFSKGAWTFSDRD  475

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCT+E L+ LLLL + P +++GEK + Q L++AV+    LQ  +SGG A WEP 
Sbjct  476   HGWQVSDCTSEALRVLLLLSQFPKELVGEKAEPQCLFDAVNFLFSLQG-KSGGLAVWEPA  534

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               + +L+ LNPSE+FA+IV E E++E T S I  L+ F+  YPN+R KEV+  I KA +Y
Sbjct  535   GAEEWLEKLNPSELFANIVTEHEYVECTSSAIQTLLLFKKLYPNHRRKEVDNFIEKATRY  594

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E  Q  +GSWYG WGVCF Y  +FAL GL A GK+Y N + V     F LSKQ   GGW
Sbjct  595   VENVQRPNGSWYGGWGVCFTYAAWFALSGLAAVGKTYSNSKTVRKGVDFLLSKQKANGGW  654

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP M Y+ LEG  TNLVQT+W ++GL+  GQ E+DPTPLH+AAKLLIN+Q++ G
Sbjct  655   GESYLSCPDMVYVHLEGDRTNLVQTAWCLMGLIEAGQVEKDPTPLHKAAKLLINSQLDSG  714

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQ++ITGVYM NCMLHYAS+R+ FP  AL  Y +RV
Sbjct  715   DFPQEEITGVYMNNCMLHYASYRNIFPTWALGMYHRRV  752



>ref|XP_010063692.1| PREDICTED: beta-amyrin synthase [Eucalyptus grandis]
 ref|XP_010063693.1| PREDICTED: beta-amyrin synthase [Eucalyptus grandis]
 gb|KCW70922.1| hypothetical protein EUGRSUZ_F04038 [Eucalyptus grandis]
 gb|KCW70923.1| hypothetical protein EUGRSUZ_F04038 [Eucalyptus grandis]
Length=761

 Score =   976 bits (2523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/757 (61%), Positives = 573/757 (76%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EG  GPY+YSTNNY GRQIWE+DP AGT EE+   E AR+ F   R +    C
Sbjct  1     MWRLKIAEGEDGPYLYSTNNYVGRQIWEFDPEAGTAEERAEVEAARQHFYDHRHQ-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ ++E E    +IPPVR+ + EE+ Y+  +TA+++AV    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREKEFKQ-TIPPVRVEDGEEITYDKASTALKRAVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFF PPL++ +YI+G +D +  +EH+KE++RY+YNHQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCVYITGHLDAVFPAEHRKEILRYIYNHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEGPD G D A AR RKWI D GG T IPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGPDGGKDNACARARKWIHDRGGVTYIPSWGKTWLSILGVFEWTGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY K++ GP+T +V  LR E+H + Y+ I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKKFVGPITPLVQQLREELHTQPYDTI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
              W + R  C KEDLYYPH  IQDL+W++L  CTEPF+ RWP  K+RE A++  +K++ YE
Sbjct  299   CWRKVRHLCAKEDLYYPHPLIQDLMWDSLYICTEPFLNRWPLNKLREKALQVTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDP+GD  K HLAR+PDYLW+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPDGDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
               FA QA++AS M EE    L + H +IK+SQVK+NP GDFKSM+RH++KGSWTFSDQDH
Sbjct  419   TGFAIQALLASNMTEEIAPVLARGHDFIKKSQVKDNPSGDFKSMHRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC LL   MP +I+GEK + +RLY++V++ L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLFSMMPPEIVGEKMEPERLYDSVNILLSLQS-KNGGLAAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
              Q +L++LNP+E FADIVVE E++E T S I ALV FR  YP +R KE+   +  AVQ+L
Sbjct  538   AQEWLEILNPTEFFADIVVEHEYVECTSSAIHALVMFRKLYPGHRKKEIENFLVNAVQFL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+     F L  Q Q+GGWG
Sbjct  598   ENIQNPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYSNCAAMRKGVAFLLQTQLQDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP   Y+PLEG  +NLV T+WAM+GL++ GQ ERDPTPLHRAAKLLIN+QMEDGD
Sbjct  658   ESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIHAGQTERDPTPLHRAAKLLINSQMEDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             +PQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYR+RV
Sbjct  718   YPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRRRV  754



>ref|XP_010245746.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Nelumbo nucifera]
Length=762

 Score =   973 bits (2515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/757 (58%), Positives = 572/757 (76%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MW+LKI +GGGPYIYSTNNY GRQ WE+DPN  T EE+   EKAR+ F K R        
Sbjct  1     MWRLKIAQGGGPYIYSTNNYVGRQTWEFDPNYYTEEERAKVEKAREEFRKNRHH-VKPSA  59

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             D+ +R+Q++KE+   V +IPP ++ + E++ YEA T  +R+A++   A+QA DGHWP+E 
Sbjct  60    DVLLRLQLLKENNF-VQTIPPAKIGDNEDITYEAATATLRRALQYYGAIQASDGHWPSEI  118

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +G LFF PPL++ LYI+G ++ +  +EH+KE++RY+YNHQNEDGGWGL+I+GHSTM  + 
Sbjct  119   AGALFFLPPLVMCLYITGHLNTVFQAEHRKEILRYIYNHQNEDGGWGLHIEGHSTMFCTT  178

Query  1883  LNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             LNY+ +R+LGEGP+ G DGA+ R RKWILDHGGAT IPSWGK +LS+LGVYEW+G NP+ 
Sbjct  179   LNYICMRILGEGPEGGLDGAVPRSRKWILDHGGATMIPSWGKTWLSILGVYEWEGSNPMP  238

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T +VL LR E+H + Y +I 
Sbjct  239   PEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLVLQLREELHTQPYNEIK  298

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             W++ R  C KEDLYYPH FIQD+LW++L +  EP + RWPF K+REMA++  +K++ YE 
Sbjct  299   WSRTRHICAKEDLYYPHPFIQDMLWDSLYFLIEPLLTRWPFNKLREMALKTTMKHIHYED  358

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E +RYIT GCIEK L M+  W EDPNGD  K+HLAR+PDY+W+AEDGM M   GSQ WD 
Sbjct  359   ENSRYITTGCIEKVLHMLACWVEDPNGDAFKHHLARIPDYIWVAEDGMKMQSLGSQQWDT  418

Query  1166  AFATQAIIASGM-VEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
              FA QAI+AS + + E G CL+K H +IK+SQ+++NP GDF+SMYRH+TKG+W  SDQD+
Sbjct  419   GFAVQAIMASNLPLNEIGSCLKKGHDFIKKSQIRDNPSGDFQSMYRHITKGAWPLSDQDN  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LK  L+   MP +++GEK   + L+++VD+ L LQS  +GG   WEP  
Sbjct  479   GWQVSDCTAEGLKACLMFSLMPPEVVGEKMKSEYLFDSVDLLLTLQS-NNGGVTAWEPAK  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
              Q +L++LNP+E+F DIV+E EH+E TGS I AL  F   YP YR  E+   I+KAV +L
Sbjct  538   GQNWLELLNPTELFEDIVLEHEHVECTGSAIQALALFMKLYPKYRRNEIESFISKAVHFL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E+ Q  DGSWYG+WG+CF Y T+FA+ GL A  K+Y NC+AV  A  F LS Q + GGWG
Sbjct  598   EQTQMPDGSWYGFWGICFTYATWFAVRGLAAVDKTYFNCQAVRKAVDFLLSSQQESGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP+ +Y PLE   +NLVQT+WAM+GLM+ GQAERD TPLHRAAKLLIN+Q+E+GD
Sbjct  658   ESYLSCPNKKYTPLENGRSNLVQTAWAMMGLMHAGQAERDATPLHRAAKLLINSQLENGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ++TGV+ KNCMLHY+S+++ FPL AL EYR+R+
Sbjct  718   FPQQELTGVFCKNCMLHYSSYKNIFPLWALGEYRRRL  754



>ref|XP_010245749.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Nelumbo nucifera]
Length=763

 Score =   972 bits (2513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/757 (59%), Positives = 578/757 (76%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MW+LKI +GGGPY+YSTNNY GRQ WE++P+ GT EE+   EKAR  FTK R       G
Sbjct  1     MWRLKIAQGGGPYMYSTNNYVGRQTWEFNPDYGTSEERAEVEKARDEFTKNRH-CVKPSG  59

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             D+ +R+Q++KE+   + +IPPVR+ E+EE++YEA T A+++AV+ + ALQA DGHWPAEN
Sbjct  60    DVLLRLQLLKENNF-IQTIPPVRIGEDEEISYEAATAALKRAVQFHSALQASDGHWPAEN  118

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             SG  FF PP+++ LYI+G ++ + T E++KE++RY+YNHQNEDGGWGL+I+GHS M  + 
Sbjct  119   SGCPFFLPPMVMCLYITGDLNKVFTEEYRKEILRYIYNHQNEDGGWGLHIEGHSIMFSTV  178

Query  1883  LNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             LNY+++R+LGEGP+ G D A+ R RKWI DHGGAT IPSWGK +LS+ GVYEW+G NP+ 
Sbjct  179   LNYISMRILGEGPEGGRDRAVPRARKWIHDHGGATSIPSWGKTWLSIFGVYEWEGSNPMP  238

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWL PS FP  P K+WCYCR TYMPM YLY KR+ GP+T ++L LR EIH + Y +I 
Sbjct  239   PEFWLLPSFFPLSPEKLWCYCRMTYMPMCYLYGKRFVGPITPLILQLREEIHTQPYHKIK  298

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             W++ R  C KEDLYYPH FIQDLLW+ L   TEP + RWPF K+RE A+++ +K++ YE 
Sbjct  299   WSRTRHMCAKEDLYYPHPFIQDLLWDTLYILTEPLLTRWPFNKLRERALKQTMKHIHYED  358

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E +RYITIGC+EK L M+  W EDPNGD  KYHL R+PDY+W+AEDGM M  +GSQ WD 
Sbjct  359   ENSRYITIGCVEKPLFMLACWVEDPNGDAYKYHLERIPDYIWVAEDGMKMQSYGSQLWDT  418

Query  1166  AFATQAIIASGM-VEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
             +FA QAI+AS +  +E G CL+K H Y+K SQV+ENP GDFK M+RH++KGSWTFSDQDH
Sbjct  419   SFAIQAIMASNLSFDEIGLCLKKGHDYLKNSQVRENPSGDFKRMFRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW +SDCTAE LK  L+   MP +I+GEK + + L++AV+V L LQS ++GG A WEP  
Sbjct  479   GWQISDCTAEALKACLMFSLMPPEIVGEKMEKECLFDAVNVLLSLQS-QNGGLACWEPAR  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
              + +L++ NP+E F++IV+E E+IE T S I ALV F+  YPN+R KEV   I+K+V Y+
Sbjct  538   SENWLELFNPTEFFSNIVIEHEYIECTASAIQALVLFKKLYPNHRKKEVESFISKSVHYI  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E+ Q  +GSWYG WG+CF+Y  +FAL GL A GK+Y+NC  V     F LS Q    GWG
Sbjct  598   EQIQMPNGSWYGNWGICFIYSAWFALGGLAAVGKTYDNCPTVRKCVDFLLSTQKDSCGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP++ Y PL+G  TNLVQT+WA++GL++ GQAERD TPLHRAAKLLIN+QME+GD
Sbjct  658   ESYLSCPNVEYTPLKGEKTNLVQTAWALMGLIHAGQAERDATPLHRAAKLLINSQMENGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQ++ITGV++KNCM+HYA++R+ FPL AL EYR RV
Sbjct  718   FPQEEITGVFLKNCMIHYAAYRNIFPLWALGEYRARV  754



>gb|ABY90140.2| beta-amyrin synthase [Bupleurum chinense]
Length=764

 Score =   972 bits (2513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/760 (59%), Positives = 573/760 (75%), Gaps = 9/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG---PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGP  2256
             MWKLKI EGG    PY+YSTNN+ GRQ W +DP  GTPEE+   E+AR  F   R Q  P
Sbjct  1     MWKLKIAEGGSSNDPYLYSTNNFVGRQTWTFDPEYGTPEERAKVEEARTNFWNNRYQVKP  60

Query  2255  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2076
                GDL  RMQ +KE   +  +IP V++ + EE++YE  TT +R+AV    ALQA DGHW
Sbjct  61    --SGDLLWRMQFLKEKNFEQ-TIPQVKVEDGEEISYETATTTLRRAVNFFSALQADDGHW  117

Query  2075  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  1896
             PAEN+GPLFF PPL++ LYI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM
Sbjct  118   PAENAGPLFFLPPLVMCLYITGHLNTVFPAEHQKEILRYIYCHQNEDGGWGLHIEGHSTM  177

Query  1895  IGSALNYVALRLLGEGPDDGD-GAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGC  1719
               +AL+Y+ +R+LGEG D G   A AR RKWILDHG  T IPSWGK +LS+LG++EW G 
Sbjct  178   SCTALSYICMRILGEGVDGGKHNACARARKWILDHGTVTAIPSWGKTWLSILGLFEWSGT  237

Query  1718  NPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSY  1539
             NP+ PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y
Sbjct  238   NPMPPEFWVLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAEPY  297

Query  1538  EQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYM  1359
             ++++W + R  C KEDLYYPH  IQDL+W++L  C EPF+ RWPF K+RE A++  +K++
Sbjct  298   DKVNWRKVRHDCAKEDLYYPHPLIQDLMWDSLYICMEPFLTRWPFNKLREKALQTTMKHI  357

Query  1358  RYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQ  1179
              YE E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDY+W+AEDGM M  FGSQ
Sbjct  358   HYEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGMKMQSFGSQ  417

Query  1178  NWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSD  999
              WD  FA QA++ASG+ +E    L K H +IK+SQV ENP GDFK+M+RH++KGSWTFSD
Sbjct  418   EWDTGFAIQALLASGLTDEIQSTLMKGHDFIKKSQVTENPSGDFKNMHRHISKGSWTFSD  477

Query  998   QDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWE  819
             QDHGW VSDCTAE LKC LL   MP  I+G K +  RL++AV++ L LQS ++GG + WE
Sbjct  478   QDHGWQVSDCTAEGLKCCLLFSRMPKDIVGSKMEDSRLFDAVNILLSLQS-KNGGISAWE  536

Query  818   PPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAV  639
             P     +L++LNP+E FADIV+E E++E T S I A+V F+  YP +R KE+ I+I+ +V
Sbjct  537   PAGSSEWLELLNPTEFFADIVIEHEYVECTSSAIQAMVMFKKLYPGHRKKEIEIAISNSV  596

Query  638   QYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEG  459
             QYL+  Q SDGSWYG WGVCF YGT+FA+ GLTAAGK+YENC+++     F L  Q  +G
Sbjct  597   QYLQDIQMSDGSWYGNWGVCFTYGTWFAIGGLTAAGKTYENCQSIRKGVEFLLDSQRNDG  656

Query  458   GWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQME  279
             GWGE   SCP+ +Y PLEG  +NLV T+WA +GL+++GQA+RDPTPLHRAAKLLIN+QME
Sbjct  657   GWGESYVSCPNKKYTPLEGCRSNLVHTTWATMGLIHSGQAKRDPTPLHRAAKLLINSQME  716

Query  278   DGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
              GDFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYR+ V
Sbjct  717   SGDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRRNV  756



>ref|XP_009779988.1| PREDICTED: beta-amyrin synthase [Nicotiana sylvestris]
 ref|XP_009779989.1| PREDICTED: beta-amyrin synthase [Nicotiana sylvestris]
 ref|XP_009779990.1| PREDICTED: beta-amyrin synthase [Nicotiana sylvestris]
Length=761

 Score =   968 bits (2503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/757 (59%), Positives = 569/757 (75%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKI EG  GPY+YSTNNY GRQ WE+DPNAGTPE+++  E+AR+ F   R K   + 
Sbjct  1     MWKLKIAEGQDGPYLYSTNNYVGRQTWEFDPNAGTPEQRKEIEEARQQFWNNRYKVKPS-  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  R+Q ++E    V +IP V++ E EE+  E  TT++R+AV    ALQA DGHWPAE
Sbjct  60    GDLLWRLQFLREKNFKV-TIPAVKVEEGEEITDEVATTSLRRAVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEGPD G + A AR RKWILDHG  T IPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGPDGGENNACARARKWILDHGSITAIPSWGKTWLSILGVFEWLGTNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y +I
Sbjct  239   PPEFWILPSFLPIHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYDQPYNEI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
             +W + R +C KEDLYYPH  +QDL+W++L  CTEP + RWPF K+R  A+   +K++ YE
Sbjct  299   NWRKVRHSCAKEDLYYPHPLVQDLMWDSLYICTEPLLTRWPFNKLRNKALEVTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
               FA QA++AS M +E  D L++ H ++KESQVK++P GDFK MYRH++KGSWTFSDQDH
Sbjct  419   TGFAIQALLASEMNDEIADTLKRGHNFLKESQVKDDPSGDFKGMYRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC LL   MP +++GE  +  RLY++V+V L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEALKCCLLFSTMPPELVGEAMEPSRLYDSVNVILSLQS-KNGGLAAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                YL++LNP+E FADIV+E E++E T S I ALV F+  YP +R K ++  +A AV+YL
Sbjct  538   ASEYLELLNPTEFFADIVIEHEYVECTASSIQALVLFKKLYPGHRTKAIDNFVANAVKYL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSWYG WGVCF YG++FAL GL AAGKSY NC AV     F L  Q  +GGWG
Sbjct  598   EDVQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKSYSNCAAVRKGVEFLLQTQRSDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E  +SCP   Y  LE   +NLVQT+WA++GL+++GQ  RDP PLHRAA+LLIN+QMEDGD
Sbjct  658   ESYRSCPDKVYRELETAKSNLVQTAWALMGLIHSGQVGRDPRPLHRAARLLINSQMEDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ+ITGV+MKNCMLHYA++R+ +PL  L+EYRK V
Sbjct  718   FPQQEITGVFMKNCMLHYAAYRNIYPLWGLAEYRKNV  754



>emb|CBI18407.3| unnamed protein product [Vitis vinifera]
Length=846

 Score =   966 bits (2497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/758 (59%), Positives = 566/758 (75%), Gaps = 8/758 (1%)
 Frame = -3

Query  2426  KMWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPH  2253
             KMW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   E AR+ F K R Q  P 
Sbjct  92    KMWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAARENFWKNRYQVKP-  150

Query  2252  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2073
               GDL  RMQ ++E      +IP V++ + EE+ YE  T AVR+      ALQA DGHWP
Sbjct  151   -SGDLLWRMQFLREKNFKQ-TIPQVKVGDGEEITYETATAAVRRGAHFFSALQASDGHWP  208

Query  2072  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  1893
             AEN+GPL+F PPL++ LYI+G +D +   E++KE++RYLY HQNEDGGWG +I+GHSTM 
Sbjct  209   AENAGPLYFLPPLVMCLYITGHLDTVFPGEYRKEILRYLYCHQNEDGGWGFHIEGHSTMF  268

Query  1892  GSALNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
              + L+Y+ +R+LGEGPD+   A ARGRKWILD GG T IPSWGK +LS+ G+++W G NP
Sbjct  269   CTTLSYICMRILGEGPDEN--ACARGRKWILDRGGVTSIPSWGKTWLSIFGLFDWSGSNP  326

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFWLFPS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T +VL LR E+ ++ Y +
Sbjct  327   MPPEFWLFPSRLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLVLELREELFLQPYNE  386

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I+W + R  C KEDLYYPH  IQDL+W+ L  CTEP + RWPF K+R+ A+   +K++ Y
Sbjct  387   INWRKVRHLCAKEDLYYPHPLIQDLMWDGLYICTEPLLTRWPFNKLRQKALEVTMKHIHY  446

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNG+  K HLAR+PDY+W+ EDG+ M  FGSQ W
Sbjct  447   EDENSRYITIGCVEKVLCMLSCWVEDPNGNYFKKHLARIPDYIWVGEDGIKMQSFGSQEW  506

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D  FA QA++A  M +E G  L+K H ++KESQVK+NP GDFKSMYRH++KGSWTFSDQD
Sbjct  507   DTGFALQAVLACNMTDEIGPTLKKGHEFVKESQVKDNPSGDFKSMYRHISKGSWTFSDQD  566

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LL   MP +I+G K + +RL+++V++ L LQS ++GG A WEP 
Sbjct  567   HGWQVSDCTAEGLKCCLLFSMMPPEIVGVKMEPERLFDSVNILLSLQS-KNGGLAAWEPA  625

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP+E FADIV+E E++E T S I ALV F+  YP +R KE++  I  A +Y
Sbjct  626   GASEWLELLNPTEFFADIVIEHEYVECTASAIQALVLFKKLYPGHRKKEIDNFITYAAKY  685

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E  Q  DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+  A  F L+ Q  +GGW
Sbjct  686   IEDIQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYHNCHAIRRAVEFLLNSQRDDGGW  745

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP  +Y PLEG  +NLV T WA++GL+ +GQAERDPTPLHRAAKLLIN QMEDG
Sbjct  746   GESYVSCPDKKYTPLEGNRSNLVHTGWALMGLISSGQAERDPTPLHRAAKLLINFQMEDG  805

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYR+RV
Sbjct  806   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRRRV  843



>ref|XP_011093795.1| PREDICTED: beta-amyrin synthase [Sesamum indicum]
Length=763

 Score =   965 bits (2495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/758 (60%), Positives = 566/758 (75%), Gaps = 7/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LKI EG   PY+YSTNNY GRQIWE+DPN GTP+ ++  EKAR+ F   R Q  P +
Sbjct  1     MWRLKIAEGVDSPYLYSTNNYVGRQIWEFDPNYGTPQLRQEVEKARQDFWANRYQVKPSS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  R+Q + E+     +IP V++ + E+V YE  TT +R+AV    ALQA DGHWPA
Sbjct  61    --DLLWRLQFLHENNFKQ-TIPQVKVGDGEDVTYETATTTLRRAVHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++ LYI+G ++ +  +EH+KE++RY+Y HQNEDGGWG +I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMILYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGFHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + L+Y+ +R+LGEGPD G + A  R RKWILDHG  T IPSWGK +LS+LGV++W G NP
Sbjct  178   TVLSYICMRILGEGPDGGENNACTRARKWILDHGTVTAIPSWGKTWLSILGVFDWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFWL PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + YEQ
Sbjct  238   MPPEFWLLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYDQPYEQ  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I+W   R  C KEDLYYPH  IQDL+W++    TEP + RWPF K+RE A++  +K++ Y
Sbjct  298   INWRSVRHRCAKEDLYYPHPLIQDLIWDSCYVLTEPLLTRWPFNKLREKALQVTMKHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDY+W+AEDGM M  FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGMKMQSFGSQEW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D  FA QA++AS + +E G+ LR  H +IK+SQVK++P GDF+SMYRH++KGSWTFSDQD
Sbjct  418   DTGFAIQALLASNLTDEIGETLRLGHDFIKKSQVKDDPSGDFRSMYRHISKGSWTFSDQD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LL   MP  I+GEK + +  Y AV++ L LQS ++GG A WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSMMPPDIVGEKMEPEGFYNAVNILLSLQS-KNGGLAAWEPA  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP+E FADIVVE E++E T S I ALV F+  YP +R KE+   IAKAV Y
Sbjct  537   GASDWLELLNPTEFFADIVVEHEYVECTSSAIQALVLFKQLYPEHRKKEIESFIAKAVGY  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q  DGSWYG WGVCF YGT+FAL GL AAGKSY NC AV  A  F L  Q  +GGW
Sbjct  597   LEDVQRPDGSWYGNWGVCFTYGTWFALGGLAAAGKSYNNCAAVRKAVDFLLKAQRDDGGW  656

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP   Y+PLE   +NLV T+WAM+GL+++GQA+RDPTPLHR AKLLIN+Q+EDG
Sbjct  657   GESYLSCPKKVYVPLEDNRSNLVHTAWAMMGLIHSGQADRDPTPLHRGAKLLINSQLEDG  716

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  717   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKRV  754



>ref|XP_009612988.1| PREDICTED: beta-amyrin synthase [Nicotiana tomentosiformis]
 ref|XP_009612989.1| PREDICTED: beta-amyrin synthase [Nicotiana tomentosiformis]
 ref|XP_009612990.1| PREDICTED: beta-amyrin synthase [Nicotiana tomentosiformis]
 ref|XP_009612991.1| PREDICTED: beta-amyrin synthase [Nicotiana tomentosiformis]
Length=761

 Score =   964 bits (2492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/757 (59%), Positives = 568/757 (75%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKI EG  GPY+YSTNNY GRQ WE+DPNAGT EE++  E+AR+ F   R K   + 
Sbjct  1     MWKLKIAEGQDGPYLYSTNNYVGRQTWEFDPNAGTQEERKEIEEARQQFWNNRYKVKPS-  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ +++      +IP V++ E EE+++E  T A+R+AV    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLRDKNFKQ-TIPAVKVEEGEEISHEVATAALRRAVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             +L+Y+ +R+LGEGPD G + A AR RKWILDHG  T IPSWGK +LS+LGV+EW G NP+
Sbjct  179   SLSYICMRILGEGPDGGENNACARARKWILDHGSVTAIPSWGKTWLSILGVFEWLGTNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ G +T ++L LR E++ + Y++I
Sbjct  239   PPEFWILPSFLPVHPAKMWCYCRMVYMPMSYLYGKRFVGSITPLILQLREELYDQPYDEI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
             +W + R  C KEDLYYPH  +QDL+W++L  CTEP + RWP  K+R  A+   +K++ YE
Sbjct  299   NWRKVRHVCAKEDLYYPHPLVQDLMWDSLYICTEPLLTRWPVNKLRNKALEVTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
               FA QA++AS M +E  D L++ H +IKESQVKENP GDFKSMYRH++KGSWTFSDQDH
Sbjct  419   TGFAIQALLASEMNDEIADTLKRGHNFIKESQVKENPSGDFKSMYRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC LL   MP +++GE  + +RLY++V+V L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEALKCCLLFSTMPPELVGEAMEPRRLYDSVNVILSLQS-KNGGLAAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                YL++LNP+E FADIV+E E++E T S I ALV F+  YP +R KE++  IA AV+YL
Sbjct  538   ASEYLELLNPTEFFADIVIEHEYVECTASSIQALVLFKKLYPGHRTKEIDNFIANAVKYL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSWYG WGVCF YG++FAL GL AAGKSY +C AV     F L  Q  +GGWG
Sbjct  598   EDVQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKSYSSCAAVRKGVEFLLQTQRSDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E  +SCP   Y  LE   +NLVQT+WA++GL+++GQ  RDP PLH AA+LLIN+QMEDGD
Sbjct  658   ESYRSCPDKVYRELETDNSNLVQTAWALMGLIHSGQVGRDPRPLHHAARLLINSQMEDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ+ITGV+MKNCMLHYA++R+ +PL  L+EYRK V
Sbjct  718   FPQQEITGVFMKNCMLHYAAYRNIYPLWGLAEYRKNV  754



>ref|NP_001234604.1| beta-amyrin synthase [Solanum lycopersicum]
 sp|E7DN63.1|BAMS_SOLLC RecName: Full=Beta-amyrin synthase; AltName: Full=Triterpenoid 
synthase 1; Short=SlTTS1 [Solanum lycopersicum]
 gb|ADU52574.1| beta-amyrin synthase [Solanum lycopersicum]
Length=761

 Score =   964 bits (2492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/757 (59%), Positives = 563/757 (74%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKI EG  GPY+YSTNNY GRQ WE+DPN GT EE+   E+AR+ F   R K   + 
Sbjct  1     MWKLKIAEGQNGPYLYSTNNYVGRQTWEFDPNGGTIEERAKIEEARQQFWNNRYKVKPS-  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  R+Q + E       IP V++ E EE+++E  T A+ +AV    ALQA DGHWPAE
Sbjct  60    SDLLWRIQFLGEKNFKQ-KIPAVKVEEGEEISHEVATIALHRAVNFFSALQATDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEGPD G + A AR RKWILDHG  T IPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGPDGGVNNACARARKWILDHGSVTAIPSWGKTWLSILGVFEWIGTNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y++I
Sbjct  239   PPEFWILPSFLPVHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYDRPYDEI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
             +W + R  C KEDLYYPH  +QDL+W++L  CTEP + RWPF K+R  A+   +K++ YE
Sbjct  299   NWKKVRHVCAKEDLYYPHPLVQDLMWDSLYICTEPLLTRWPFNKLRNKALEVTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
               FA QA++AS M +E  D LRK H +IK+SQV  NP GDFK MYRH++KGSWTFSDQDH
Sbjct  419   TGFAIQALLASEMNDEIADTLRKGHDFIKQSQVTNNPSGDFKGMYRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC LLL  MP +++G+  +  RLY++V+V L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEALKCCLLLSTMPRELVGQAMEPGRLYDSVNVVLSLQS-KNGGLAAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                YL++LNP+E FADIV+E E++E T S I ALV F+  YP +R KE+NI I  AV+YL
Sbjct  538   ASEYLELLNPTEFFADIVIEHEYVECTASSIQALVLFKKLYPGHRTKEINIFIDNAVKYL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSWYG WGVCF YG++FAL GL AAGKSY N  AV     F L  Q  +GGWG
Sbjct  598   EDVQMPDGSWYGNWGVCFTYGSWFALGGLVAAGKSYNNSAAVRKGVEFLLRTQRSDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E  +SCP   Y  LE   +NLVQT+WA++GL+++GQA+RDP PLHRAAKLLIN+QMEDGD
Sbjct  658   ESYRSCPDKVYRELETNDSNLVQTAWALMGLIHSGQADRDPKPLHRAAKLLINSQMEDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ+ITGV+MKNCMLHYA++R+ +PL  L+EYRK V
Sbjct  718   FPQQEITGVFMKNCMLHYAAYRNIYPLWGLAEYRKNV  754



>sp|E2IUA6.1|TARS_KALDA RecName: Full=Taraxerol synthase; Short=KdTAS [Kalanchoe daigremontiana]
 gb|ADK35123.1| taraxerol synthase [Kalanchoe daigremontiana]
Length=779

 Score =   964 bits (2491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/758 (58%), Positives = 573/758 (76%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKI +GG  PY+YSTNNY GRQ WE+DP AGTPEE+   E AR  F   R +     
Sbjct  20    MWKLKIAQGGKDPYLYSTNNYVGRQTWEFDPEAGTPEERAEVEAARLNFYNNRYR-VKPS  78

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  RMQ +KE      +IPPV++ + EE+ YE  TTA+++AV    ALQA DGHWPAE
Sbjct  79    ADLLYRMQFLKEKNFKQ-TIPPVKVEDGEEITYETATTALKRAVHFYSALQASDGHWPAE  137

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             NSGPLFF PPL++ LYI+G ++ +  +EH++E++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  138   NSGPLFFLPPLVMCLYITGHLNTVFPAEHQREILRYIYYHQNEDGGWGLHIEGHSTMFCT  197

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEGPD G D A+ARGRKWILDHG  T +PSWGK +LS++G+++W G NP+
Sbjct  198   ALSYICMRILGEGPDGGLDNAVARGRKWILDHGTVTAMPSWGKTWLSIMGLFDWSGSNPM  257

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFWL PS  P +PAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + YEQ+
Sbjct  258   PPEFWLLPSFLPMYPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYDQPYEQV  317

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W Q R  C KED+YYPH  IQDLLW+ L    EP + RWPF K +RE A+++ +K++ Y
Sbjct  318   NWKQVRHECAKEDIYYPHPKIQDLLWDTLYIAIEPLLTRWPFNKLVRERALQRTMKHIHY  377

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLARVPDY+W+AEDGM M  FGSQ W
Sbjct  378   EDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARVPDYIWVAEDGMKMQSFGSQQW  437

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D  FA QA++AS M +E G+ L K H ++K+SQVK+NP GDFKSM+RH++KGSWTFSDQD
Sbjct  438   DTGFAIQALLASNMSDEIGETLAKGHDFVKKSQVKDNPSGDFKSMHRHISKGSWTFSDQD  497

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LL   MP +++GEK + +RLY++V++ L LQS ++GG A WEP 
Sbjct  498   HGWQVSDCTAEGLKCCLLFSLMPPELVGEKMEPERLYDSVNILLSLQS-KNGGLAAWEPA  556

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP+E FADIV+E E++E T S I ALV F+  YP +R K++   I  A QY
Sbjct  557   GAPEWLELLNPTEFFADIVIEHEYVECTASAIQALVLFKKLYPGHRKKDIETFIKGAAQY  616

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E +Q  DGSWYG WGVCF YGT+FAL GL AAGK+Y+NC A+     F L+ Q + GGW
Sbjct  617   IEDRQMPDGSWYGSWGVCFTYGTWFALGGLAAAGKNYDNCAAIRKGTEFLLNTQCENGGW  676

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE  +SCP  RY+PLE   +NLV T+WA++GL+++ QAERD TPLHRAAKLLIN+Q+E+G
Sbjct  677   GESYRSCPEKRYVPLEENKSNLVHTAWALMGLIHSRQAERDITPLHRAAKLLINSQLENG  736

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITGV+MKNCM HYA++R+ +PL  ++EYRK++
Sbjct  737   DFPQQEITGVFMKNCMQHYAAYRNIYPLWGIAEYRKQI  774



>ref|XP_002270934.1| PREDICTED: beta-amyrin synthase [Vitis vinifera]
 ref|XP_010655248.1| PREDICTED: beta-amyrin synthase [Vitis vinifera]
Length=757

 Score =   964 bits (2491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/758 (59%), Positives = 566/758 (75%), Gaps = 7/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   E AR+ F K R Q  P  
Sbjct  1     MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAARENFWKNRYQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GDL  RMQ ++E      +IP V++ + EE+ YE  T AVR+      ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLREKNFKQ-TIPQVKVGDGEEITYETATAAVRRGAHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPL+F PPL++ LYI+G +D +   E++KE++RYLY HQNEDGGWG +I+GHSTM  
Sbjct  118   ENAGPLYFLPPLVMCLYITGHLDTVFPGEYRKEILRYLYCHQNEDGGWGFHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + L+Y+ +R+LGEGPD G + A ARGRKWILD GG T IPSWGK +LS+ G+++W G NP
Sbjct  178   TTLSYICMRILGEGPDGGRENACARGRKWILDRGGVTSIPSWGKTWLSIFGLFDWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFWLFPS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T +VL LR E+ ++ Y +
Sbjct  238   MPPEFWLFPSRLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLVLELREELFLQPYNE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I+W + R  C KEDLYYPH  IQDL+W+ L  CTEP + RWPF K+R+ A+   +K++ Y
Sbjct  298   INWRKVRHLCAKEDLYYPHPLIQDLMWDGLYICTEPLLTRWPFNKLRQKALEVTMKHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNG+  K HLAR+PDY+W+ EDG+ M  FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLSCWVEDPNGNYFKKHLARIPDYIWVGEDGIKMQSFGSQEW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D  FA QA++A  M +E G  L+K H ++KESQVK+NP GDFKSMYRH++KGSWTFSDQD
Sbjct  418   DTGFALQAVLACNMTDEIGPTLKKGHEFVKESQVKDNPSGDFKSMYRHISKGSWTFSDQD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LL   MP +I+G K + +RL+++V++ L LQS ++GG A WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSMMPPEIVGVKMEPERLFDSVNILLSLQS-KNGGLAAWEPA  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP+E FADIV+E E++E T S I ALV F+  YP +R KE++  I  A +Y
Sbjct  537   GASEWLELLNPTEFFADIVIEHEYVECTASAIQALVLFKKLYPGHRKKEIDNFITYAAKY  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E  Q  DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+  A  F L+ Q  +GGW
Sbjct  597   IEDIQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYHNCHAIRRAVEFLLNSQRDDGGW  656

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP  +Y PLEG  +NLV T WA++GL+ +GQAERDPTPLHRAAKLLIN QMEDG
Sbjct  657   GESYVSCPDKKYTPLEGNRSNLVHTGWALMGLISSGQAERDPTPLHRAAKLLINFQMEDG  716

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYR+RV
Sbjct  717   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRRRV  754



>ref|XP_010313624.1| PREDICTED: beta-amyrin synthase isoform X1 [Solanum lycopersicum]
Length=761

 Score =   962 bits (2488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/757 (59%), Positives = 562/757 (74%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKI EG  GPY+YSTNNY GRQ WE+DPN GT EE+   E+ARK F   R K   + 
Sbjct  1     MWKLKIAEGQNGPYLYSTNNYVGRQTWEFDPNGGTIEERAKIEEARKQFWNNRYKVKPS-  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  R+Q + E       IP V++ E EE+++E  T A+ +AV    ALQA DGHWPAE
Sbjct  60    SDLLWRIQFLGEKNFKQ-KIPAVKVEEGEEISHEVATIALHRAVNFFSALQATDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEGPD G + A AR RKWILDHG  T IPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGPDGGVNNACARARKWILDHGSVTAIPSWGKTWLSILGVFEWIGTNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y++I
Sbjct  239   PPEFWILPSFLPVHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYDRPYDEI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
             +W + R  C KEDLYYPH  +QDL+W++L  CTEP + RWPF K+R  A+   +K++ YE
Sbjct  299   NWKKVRHVCAKEDLYYPHPLVQDLMWDSLYICTEPLLTRWPFNKLRNKALEVTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDPNGD  K HLAR+ DYLW+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARISDYLWVAEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
               FA QA++AS M +E  D LRK H +IK+SQV  NP GDFK MYRH++KGSWTFSDQDH
Sbjct  419   TGFAIQALLASEMNDEIADTLRKGHDFIKQSQVTNNPSGDFKGMYRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC LLL  MP +++G+  +  RLY++V+V L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEALKCCLLLSTMPRELVGQAMEPGRLYDSVNVILSLQS-KNGGLAAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                YL++LNP+E FADIV+E E++E T S I ALV F+  YP +R KE+NI I  AV+YL
Sbjct  538   ASEYLELLNPTEFFADIVIEHEYVECTASSIQALVLFKKLYPGHRTKEINIFIDNAVKYL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSWYG WGVCF YG++FAL GL AAGKSY N  AV     F L  Q  +GGWG
Sbjct  598   EDVQMPDGSWYGNWGVCFTYGSWFALGGLVAAGKSYNNSAAVRKGVEFLLRTQRSDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E  +SCP   Y  LE   +NLVQT+WA++GL+++GQA+RDP PLHRAAKLLIN+QMEDGD
Sbjct  658   ESYRSCPDKVYRELETNDSNLVQTAWALMGLIHSGQADRDPKPLHRAAKLLINSQMEDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ+ITGV+MKNCMLHYA++R+ +PL  L+EYRK V
Sbjct  718   FPQQEITGVFMKNCMLHYAAYRNIYPLWGLAEYRKNV  754



>gb|ADK12003.1| beta-amyrin synthase [Aralia elata]
Length=763

 Score =   962 bits (2488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/760 (59%), Positives = 568/760 (75%), Gaps = 9/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG--GPYIYSTNNYAGRQIWEYDPN-AGTPEEQEAFEKARKGFTKQR-QKGP  2256
             MWKLKI EG    PY+YSTNN+ GRQ WE+DP+   +P E E  E+AR+ F + R Q  P
Sbjct  1     MWKLKIAEGNKNDPYLYSTNNFVGRQTWEFDPDYVASPGELEEVEQARRQFWENRYQVKP  60

Query  2255  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2076
                GDL  RMQ ++E      +IP V++ ++E V YEA TT +R+AV    ALQA DGHW
Sbjct  61    --SGDLLWRMQFLREKNFKQ-TIPQVKVGDDEAVTYEAATTTLRRAVHFFSALQASDGHW  117

Query  2075  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  1896
             PAEN+GPLFF PPL++ +YI+G +D +  +EH+KE++RY+Y HQNEDGGWG +I+GHSTM
Sbjct  118   PAENAGPLFFLPPLVMCVYITGHLDTVFPAEHRKEILRYIYCHQNEDGGWGFHIEGHSTM  177

Query  1895  IGSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGC  1719
               + L+Y+ +R+LGEGPD G + A  RGRKWILDHG  T IPSWGK +LS+LGVYEW G 
Sbjct  178   FCTTLSYICMRILGEGPDGGVNNACVRGRKWILDHGSVTAIPSWGKTWLSILGVYEWTGS  237

Query  1718  NPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSY  1539
             NP+ PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y
Sbjct  238   NPMPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPY  297

Query  1538  EQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYM  1359
              +I+W + R  C KED+YYPH  IQDLLW++L   TEP + RWPF K+RE A++  +K++
Sbjct  298   NEINWRKTRHVCAKEDIYYPHPLIQDLLWDSLYVLTEPLLTRWPFNKLREKALQTTMKHI  357

Query  1358  RYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQ  1179
              YE E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDY+W+AEDGM M  FGSQ
Sbjct  358   HYEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGMKMQSFGSQ  417

Query  1178  NWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSD  999
              WD  F  QA++AS +  E G  L K H +IK+SQVK+NP GDFK MYRH++KGSWTFSD
Sbjct  418   EWDTGFGIQALLASDLTHEIGPTLMKGHDFIKKSQVKDNPSGDFKGMYRHISKGSWTFSD  477

Query  998   QDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWE  819
             QDHGW VSDCTAE LKC L+   MP +I+G+K + +RLY++V+V L LQS ++GG A WE
Sbjct  478   QDHGWQVSDCTAEGLKCCLIFSTMPEEIVGKKMEPERLYDSVNVLLSLQS-KNGGLAAWE  536

Query  818   PPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAV  639
             P   Q +L++LNP+E FADIV+E E++E T S I ALV F+  YP +R KE++  I  AV
Sbjct  537   PAGAQEWLELLNPTEFFADIVIEHEYVECTSSAIQALVLFKKLYPGHRKKEIDNFIMNAV  596

Query  638   QYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEG  459
             +YLE  Q  DGSWYG WGVCF YG++FAL GL AAGK+Y NC AV  A  F L  Q  +G
Sbjct  597   RYLEDIQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYYNCAAVRKAVDFLLKSQMDDG  656

Query  458   GWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQME  279
             GWGE   SCP   Y+PLEG  +NLV T WA++GL+++ QAERDPTPLHRAAKLLIN+QME
Sbjct  657   GWGESYLSCPKKVYVPLEGNRSNLVHTGWALMGLIHSEQAERDPTPLHRAAKLLINSQME  716

Query  278   DGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DGDFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYR+RV
Sbjct  717   DGDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRRRV  756



>sp|Q8W3Z1.1|BAMS_BETPL RecName: Full=Beta-amyrin synthase [Betula platyphylla]
 dbj|BAB83088.1| beta-amyrin synthase [Betula platyphylla]
Length=779

 Score =   962 bits (2486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/759 (59%), Positives = 570/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LKI +GG  PYIYSTNN+ GRQ WE+DP AG+P+E+   E+AR+ F   R Q  P  
Sbjct  1     MWRLKIADGGSDPYIYSTNNFVGRQTWEFDPQAGSPQERAEVEEARRNFYDNRYQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GDL  RMQ +KE      +IPPV++ + EE+ YE  T A+R+AV    ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLKEKNFKQ-TIPPVKVEDGEEITYEKSTAALRRAVHFYSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCMYITGHLNTVFPAEHQKEILRYIYYHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +AL+Y+ +R+LGEGPD G D A AR RKWILDHGG T +PSWGK +LS+LG++EW G NP
Sbjct  178   TALSYICMRILGEGPDGGQDNACARARKWILDHGGVTHMPSWGKTWLSILGIFEWIGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y Q
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYTQPYHQ  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             ++W + R  C KED+YYPH  IQDLLW++L   TEP + RWPF K +RE A++  +K++ 
Sbjct  298   VNWKKVRHLCAKEDIYYPHPLIQDLLWDSLYIFTEPLLTRWPFNKLVREKALQVTMKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDPNGD  K H+AR+PDY+W+AEDG+ M  FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHIARIPDYIWVAEDGIKMQSFGSQE  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS + +E G  L + H +IK+SQVK+NP GDF+SM+RH++KGSWTFSDQ
Sbjct  418   WDTGFAIQALLASNLTDEIGPTLARGHDFIKKSQVKDNPSGDFESMHRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LL   MP +I+GEK + ++LY++V+V L LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLFSIMPPEIVGEKMEPEQLYDSVNVLLSLQS-KNGGLAAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LN +E FADIV+E E+IE T S +  LV F+  YP +R KE+   I  A Q
Sbjct  537   AGAQEWLELLNSTEFFADIVIEHEYIECTASAMQTLVLFKKLYPGHRKKEIENFIKNAAQ  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             +L+  Q  DGSWYG WGVCF YGT+FAL GL A GK+Y NC AV  A  F L  Q   GG
Sbjct  597   FLQVIQMPDGSWYGNWGVCFTYGTWFALGGLAAVGKTYNNCLAVRRAVDFLLRAQRDNGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP   Y+PLEG  +NLV T+WAM+GL++ GQAERDPTPLHRAAKL+IN+Q+ED
Sbjct  657   WGESYLSCPKKEYVPLEGNKSNLVHTAWAMMGLIHAGQAERDPTPLHRAAKLIINSQLED  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITGV+MKNCMLHYA++++ +PL AL+EYRK V
Sbjct  717   GDFPQQEITGVFMKNCMLHYAAYKNIYPLWALAEYRKHV  755



>gb|AHX97777.1| beta-amyrin synthase [Gentiana straminea]
Length=758

 Score =   961 bits (2484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/757 (59%), Positives = 574/757 (76%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EGG  PY+YSTNNY GRQ WEYDPNAGTPEE+   E+AR+ F   R +     
Sbjct  1     MWRLKIAEGGNDPYLYSTNNYVGRQTWEYDPNAGTPEERAEVEEARRQFWDNR-RDVKPS  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  R+Q ++E      +IP V++ + +E+ ++  T ++R+AV    ALQA DGHWPAE
Sbjct  60    GDLLWRLQFLREKNFKQ-TIPAVKVEDGQEITHQMATDSLRRAVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFF PPL++ LYI+G ++ +  +EHK+E++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCLYITGHLNSVFPAEHKREILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +RLLGEGPD G + A AR RKWILDHG  T IPSWGK +LS+LGVYEW G NP+
Sbjct  179   ALSYICMRLLGEGPDGGINNACARARKWILDHGSVTSIPSWGKTWLSILGVYEWSGTNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P +PAKMWCYCR  YMPMSYLY KR+ GP+T ++  LR+E+H   Y+Q+
Sbjct  239   PPEFWILPSFLPMYPAKMWCYCRMVYMPMSYLYGKRFVGPITPLIRELRDELHSXPYDQV  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
              W + R  C KEDLYYPH F+QDL+W++L  CTEP + RWPF K+R  A+   ++++ YE
Sbjct  299   SWKKYRHVCAKEDLYYPHPFVQDLIWDSLYVCTEPLLTRWPFNKLRAKALEVTMEHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDP GD  K HLAR+PDY+W+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPKGDYFKKHLARIPDYIWVAEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
               FA QA++A  M EE  + LRK H ++K+SQVK+NP GDFKSM+RH++KGSWTFSDQDH
Sbjct  419   TGFAIQALLACDMTEEIAETLRKGHDFVKKSQVKDNPSGDFKSMHRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LK  L    MP +I+GEK + +++Y+AV++ L LQS ++GG + WEP  
Sbjct  479   GWQVSDCTAEGLKVCLHFSTMPPEIVGEKMEPEKIYDAVNILLPLQS-KNGGLSAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +L++LNP+E FADIV+E E++E T S I AL+ F+  YP +R KE+  SI  A +YL
Sbjct  538   SSEWLELLNPTEFFADIVIEHEYVECTASSIHALILFKKLYPGHRKKEIETSIINASKYL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSWYG WGVCF YGT+FAL GL A+GK+Y+NC AV  A +F L+ Q Q+GGWG
Sbjct  598   EDVQMPDGSWYGNWGVCFTYGTWFALGGLAASGKTYDNCNAVRKAVNFLLNSQRQDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP   Y+PLEG  +NLV TSWAM+GL+++GQAERDPTPLHRAAKL+IN+QMEDGD
Sbjct  658   ESYLSCPQKIYVPLEGERSNLVHTSWAMMGLIHSGQAERDPTPLHRAAKLIINSQMEDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  718   FPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKRV  754



>sp|E2IUA9.1|LUPS_KALDA RecName: Full=Lupeol synthase; Short=KdLUS [Kalanchoe daigremontiana]
 gb|ADK35126.1| lupeol synthase [Kalanchoe daigremontiana]
Length=765

 Score =   959 bits (2478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/759 (58%), Positives = 566/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHT  2250
             MWKLKI +GG  PYI++TNN+ GRQIWE+DP A  P++    E AR  F   R K  P++
Sbjct  1     MWKLKIADGGSNPYIFTTNNFVGRQIWEFDPQATDPQQLAKVEAARLDFYHNRYKLKPNS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E      +IP V++ + EEV+YEA+T A+R+ V L  ALQA DGHWPA
Sbjct  61    --DLLWRMQFLEEKAF-TQTIPQVKVEDGEEVSYEAVTAALRRGVHLYSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GP+FF PP+++ LYI+G ++ I T EH+ E +RY+Y HQNEDGGWG +I+GHSTM G
Sbjct  118   ENAGPMFFMPPMVMCLYITGHLNAIFTEEHRSETLRYIYYHQNEDGGWGFHIEGHSTMFG  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNY+ +RLLGEGP+ G D A++RGRKWILDHGGAT IPSWGK +LS++G+ +W GCNP
Sbjct  178   TVLNYICMRLLGEGPEGGQDNAVSRGRKWILDHGGATSIPSWGKTWLSIMGLCDWSGCNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFWL PS  P HP KMWCYCR  YMPMSYLY KR+   +T ++L LR EIH++ Y+Q
Sbjct  238   MPPEFWLLPSYLPMHPGKMWCYCRMVYMPMSYLYGKRFTARITPLILQLREEIHIQPYDQ  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             IDW + R  CCKED+YYPH  +QDLLW+ L   TEP + RWP  K IR+ A++  +K++ 
Sbjct  298   IDWKKVRHVCCKEDMYYPHPLLQDLLWDTLYLTTEPLLTRWPLNKLIRKRALQTTMKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ+
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWIAEDGMKMQSFGSQH  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD AF+ QA++AS M EE G  L K H +IK+SQVK+NP GDFK MYRH++KG+WTFSDQ
Sbjct  418   WDTAFSIQALLASNMAEEIGITLAKGHDFIKKSQVKDNPSGDFKGMYRHISKGAWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LL   M  +++GE    + LY +V+V L LQS ++GG   WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLFSMMQPEVVGESMAPESLYNSVNVLLSLQS-QNGGLPAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+E F +IV+E E++E T S + ALV F+  YP +R KEV   I    +
Sbjct  537   AGAPEWLELLNPTEFFENIVIEHEYVECTSSAVQALVLFKKLYPLHRRKEVERFITNGAK  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q  DGSWYG WGVCF YG +FAL GL+AAGK+Y NC AV     F L+ Q ++GG
Sbjct  597   YLEDIQMPDGSWYGNWGVCFTYGAWFALEGLSAAGKTYNNCAAVRKGVDFLLNIQLEDGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE  QSCP  +Y+PLE   +NLVQTSWA++GL+Y GQA+RDPTPLHRAA+LLIN+Q+ED
Sbjct  657   WGESYQSCPDKKYVPLEDNRSNLVQTSWALMGLIYAGQADRDPTPLHRAAQLLINSQLED  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITGV+ +NCMLHYA++R+ FPL AL+EYR+++
Sbjct  717   GDFPQQEITGVFQRNCMLHYAAYRNIFPLWALAEYRRQI  755



>sp|O82140.1|BAMS1_PANGI RecName: Full=Beta-Amyrin Synthase 1 [Panax ginseng]
 dbj|BAA33461.1| beta-Amyrin Synthase [Panax ginseng]
Length=763

 Score =   958 bits (2477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/760 (59%), Positives = 567/760 (75%), Gaps = 9/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG--GPYIYSTNNYAGRQIWEYDPN-AGTPEEQEAFEKARKGFTKQR-QKGP  2256
             MWKLKI EG    PY+YSTNN+ GRQ WE+DP+   +P E E  E+ R+ F   R Q  P
Sbjct  1     MWKLKIAEGNKNDPYLYSTNNFVGRQTWEFDPDYVASPGELEEVEQVRRQFWDNRYQVKP  60

Query  2255  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2076
                GDL  RMQ ++E      +IP V++ ++E V YEA TT +R+AV    ALQA DGHW
Sbjct  61    --SGDLLWRMQFLREKNFRQ-TIPQVKVGDDEAVTYEAATTTLRRAVHFFSALQASDGHW  117

Query  2075  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  1896
             PAENSGPLFF PPL++ +YI+G +D +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM
Sbjct  118   PAENSGPLFFLPPLVMCVYITGHLDTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTM  177

Query  1895  IGSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGC  1719
               + L+Y+ +R+LGEGPD G + A ARGRKWILDHG  T IPSWGK +LS+LGVYEW G 
Sbjct  178   FCTTLSYICMRILGEGPDGGVNNACARGRKWILDHGSVTAIPSWGKTWLSILGVYEWIGS  237

Query  1718  NPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSY  1539
             NP+ PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y
Sbjct  238   NPMPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYGQPY  297

Query  1538  EQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYM  1359
              +I+W + R  C KED+YYPH  IQDLLW++L   TEP + RWPF K+RE A++  +K++
Sbjct  298   NEINWRKTRRVCAKEDIYYPHPLIQDLLWDSLYVLTEPLLTRWPFNKLREKALQTTMKHI  357

Query  1358  RYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQ  1179
              YE E +RYITIGC+EK L M+  W EDPNGD  + HLAR+PDY+W+AEDGM M  FGSQ
Sbjct  358   HYEDENSRYITIGCVEKVLCMLVCWVEDPNGDYFRKHLARIPDYIWVAEDGMKMQSFGSQ  417

Query  1178  NWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSD  999
              WD  F+ QA++ S +  E G  L K H +IK+SQVK+NP GDFKSMYRH++KGSWTFSD
Sbjct  418   EWDTGFSIQALLDSDLTHEIGPTLMKGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSD  477

Query  998   QDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWE  819
             QDHGW VSDCTAE LKC L+   MP +I+G+K   +RLY++V+V L LQ  ++GG + WE
Sbjct  478   QDHGWQVSDCTAEGLKCCLIFSTMPEEIVGKKIKPERLYDSVNVLLSLQR-KNGGLSAWE  536

Query  818   PPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAV  639
             P   Q +L++LNP+E FADIV+E E++E T S I ALV F+  YP +R KE++  I  AV
Sbjct  537   PAGAQEWLELLNPTEFFADIVIEHEYVECTSSAIQALVLFKKLYPGHRKKEIDNFITNAV  596

Query  638   QYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEG  459
             +YLE  Q  DGSWYG WGVCF YG++FAL GL AAGK+Y NC AV  A  F L  Q  +G
Sbjct  597   RYLEDTQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYYNCAAVRKAVEFLLKSQMDDG  656

Query  458   GWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQME  279
             GWGE   SCP   Y+PLEG  +NLV T WA++GL+++ QAERDPTPLHRAAKLLIN+QME
Sbjct  657   GWGESYLSCPKKVYVPLEGNRSNLVHTGWALMGLIHSEQAERDPTPLHRAAKLLINSQME  716

Query  278   DGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DGDFPQQ+I+GV+MKNCMLHYA++R+ +PL AL+EYR+RV
Sbjct  717   DGDFPQQEISGVFMKNCMLHYAAYRNIYPLWALAEYRRRV  756



>gb|EYU38890.1| hypothetical protein MIMGU_mgv1a001796mg [Erythranthe guttata]
Length=758

 Score =   958 bits (2476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/756 (58%), Positives = 567/756 (75%), Gaps = 6/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EG    Y+YSTN Y GRQIWE+DPN G+PE ++  +KAR+ F   R     + 
Sbjct  1     MWRLKIAEGVDSAYLYSTNKYVGRQIWEFDPNYGSPELRQEVDKARQDFWDNRHHVKPS-  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  R+Q + E++    +IP V++ + E++ YE  T  +R+AV    ALQA DGHWPAE
Sbjct  60    SDLLWRIQFLHENKFKQ-TIPQVKVADGEDITYETATATLRRAVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFF PPL++ LYI+G ++ + ++EH++E++RY+Y HQNEDGGWG +I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMILYITGHLNTVFSAEHRREILRYIYCHQNEDGGWGFHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             AL+Y+ +R+LGEGPD+   A +R RKWILDHG    IPSWGK +LS+LGV+EW G NP+ 
Sbjct  179   ALSYICMRILGEGPDEN--ACSRARKWILDHGTVKAIPSWGKTWLSILGVFEWSGSNPMP  236

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWL PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + YE+++
Sbjct  237   PEFWLLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYDQPYEEVN  296

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             W   R  C KEDLYYPH  +QDL+W+     TEP + RWP  K+RE A++  ++++ YE 
Sbjct  297   WKSIRHLCAKEDLYYPHPLLQDLMWDTCYVLTEPLLTRWPLNKLREKALKVTMEHIHYED  356

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ WD 
Sbjct  357   ENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQWDT  416

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
              FA QA++ S M EE G+ L+K H ++K+SQVKE+P GDF+SMYRH++KGSWTFSDQDHG
Sbjct  417   GFAIQALLDSDMSEEIGETLKKGHDFVKKSQVKEDPSGDFRSMYRHISKGSWTFSDQDHG  476

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE LKC LL   MP +++GEK   Q LY AV++ LYLQS ++GG A WEP   
Sbjct  477   WQVSDCTAEGLKCCLLFSMMPPELVGEKMQPQDLYNAVNILLYLQS-KNGGLAAWEPAGS  535

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
               +L++LNP+E FADIV+E E++E T S I ALV F+  +P++R KE+   I KA  YLE
Sbjct  536   SEWLELLNPTEFFADIVIEHEYVECTSSAIQALVLFKKLHPHHRKKEIETFITKAAGYLE  595

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
               Q+ DGSWYG WGVCF YG++FAL GL AAGKSY NCEAV  + +F L+ Q  +GGWGE
Sbjct  596   DVQKPDGSWYGNWGVCFTYGSWFALGGLAAAGKSYNNCEAVRKSVNFLLNSQRDDGGWGE  655

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                SCP   Y+PLEG  +NLV TSWAM+GL++ GQA+RDPTPLHRAAKLLIN+Q++DGDF
Sbjct  656   SYLSCPKKEYVPLEGNRSNLVHTSWAMMGLIHAGQADRDPTPLHRAAKLLINSQLQDGDF  715

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  716   PQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKRV  751



>ref|XP_011009932.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Populus euphratica]
 ref|XP_011009933.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Populus euphratica]
Length=758

 Score =   957 bits (2474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/756 (59%), Positives = 569/756 (75%), Gaps = 4/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKL++ EG GP+++STN + GRQIW ++PNA TPEEQ   E AR+ F   R       G
Sbjct  1     MWKLEVAEGDGPWLFSTNKFVGRQIWRFEPNAWTPEEQAQVEMAREKFRLNRFY-TKASG  59

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             D+    Q+IKE+++D L IPPVRL   EE++ E + TA+RKAVR   A+QA DGHWPAE 
Sbjct  60    DVLKNFQLIKENQID-LRIPPVRLGNGEEISREKVETALRKAVRFTSAIQASDGHWPAEF  118

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             SGPLF  PPL++ LY+S S+D +L++EHKKE++RY+YNHQNEDGGWG +I+ HSTM+G+A
Sbjct  119   SGPLFLMPPLIMVLYLSRSLDTVLSTEHKKEIIRYIYNHQNEDGGWGFHIESHSTMLGTA  178

Query  1883  LNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             LNYVALRLLGEGP+ G DGA  + RKW+LDHGGAT IP+WGK+YLSVLG YEW GCNP+ 
Sbjct  179   LNYVALRLLGEGPEGGRDGAATKARKWVLDHGGATMIPAWGKVYLSVLGTYEWSGCNPVP  238

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEF LFPS  PF P K+WC+ RT Y PMSYLY K++ GP+TD++L LR E++++ YE+ID
Sbjct  239   PEFLLFPSFLPFSPGKVWCHLRTVYTPMSYLYGKKFVGPITDLILQLRRELYIQPYEEID  298

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+AR  C KEDLY   S  Q+LL + + Y +E  +++WPF K+RE A+++AIK++ YE 
Sbjct  299   WNKARHLCLKEDLYTSRSIAQNLLLDGVHYLSERLLKQWPFSKLREQALQEAIKHIHYED  358

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E TRY+T   IEKSL MM  WAEDP  D  K+HLARVPD LWLAEDGM     GSQ WDA
Sbjct  359   ESTRYMTHASIEKSLNMMACWAEDPTSDAFKFHLARVPDILWLAEDGMKTQSIGSQLWDA  418

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
             AFATQAIIAS +V+EYG  LRK H ++K SQ++EN  GDF+SMYRH++KG+WT S +DHG
Sbjct  419   AFATQAIIASNLVDEYGSTLRKAHEFLKLSQIQENAYGDFRSMYRHISKGAWTLSVKDHG  478

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE L+ LLLL +MP +I+GE  D +RL+ A+D  L LQS ++GGF+ WEP   
Sbjct  479   WQVSDCTAEALRALLLLSQMPAEIVGETIDTERLHNAIDFLLSLQS-KNGGFSVWEPARG  537

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
             Q +L+VLNP++ F D++VE E++E T S I  LV F+  +P YR KE+ +S+A A  Y+E
Sbjct  538   QRWLEVLNPTQAFGDVMVETEYVECTASAIQVLVLFKSLHPGYRRKEIEVSVANASSYIE  597

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
               Q SDGSWYG WG+C+ YGT+FAL GL + GK+Y N   V  A  F LSKQ+  GGWGE
Sbjct  598   DAQMSDGSWYGNWGICYTYGTYFALKGLASVGKTYRNSRTVRKACEFLLSKQHNSGGWGE  657

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                SC + +Y   EG  +N+VQT+WAM+GL+Y GQAE+DP PLH+AA+LLIN+QME+G+F
Sbjct  658   SYLSCANSKYTETEGNKSNVVQTAWAMMGLIYAGQAEKDPAPLHQAARLLINSQMENGEF  717

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PQQ ITG  ++ CMLHYAS ++ FPL AL EYRKRV
Sbjct  718   PQQQITGASLRTCMLHYASFKNIFPLWALGEYRKRV  753



>ref|XP_006364890.1| PREDICTED: beta-amyrin synthase-like [Solanum tuberosum]
Length=761

 Score =   957 bits (2473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/757 (60%), Positives = 565/757 (75%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKI EG  GPY+YSTNNY GRQ WE+DPNAGT EE+   E+AR+ F   R K   + 
Sbjct  1     MWKLKIAEGQKGPYLYSTNNYVGRQTWEFDPNAGTIEERAEIEEARQQFWNNRYKVKPS-  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  RMQ + E     + IP V++ E+EE+++E  T A+ +AV    ALQA DGHWPAE
Sbjct  60    SDLLWRMQFLGEKNFKQI-IPAVKVEEDEEISHEVATIALHRAVNFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFF PPL++ +YI+G ++ +  +EH+KE++RYLY HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYLYCHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEGPD G + A AR RKWILDHG  T IPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGPDGGVNNACARARKWILDHGSVTAIPSWGKTWLSILGVFEWIGTNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y +I
Sbjct  239   PPEFWILPSFLPVHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYDQPYNEI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
             +W + R  C KEDLYYPH  +QDL+W++L  CTEP + RWPF K+R  A+   +K++ YE
Sbjct  299   NWKKVRHVCAKEDLYYPHPLVQDLMWDSLYICTEPLLTRWPFNKLRNKALEVTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
               FA QA++AS M +E  D LRK H +IK+SQV +NP GDFK MYRH++KGSWTFSDQDH
Sbjct  419   TGFAIQALLASEMNDEIADTLRKGHDFIKQSQVTDNPSGDFKGMYRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC LL   MP +++G+  +  RLY++V+V L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEALKCCLLFSTMPRELVGQAMEPGRLYDSVNVILSLQS-KNGGLAAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                YL++LNP+E FADIV+E E++E T S I ALV F+  YP +R KE+NI I  AV+YL
Sbjct  538   ASEYLELLNPTEFFADIVIEHEYVECTASSIQALVLFKKLYPGHRTKEINIFIDNAVKYL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSWYG WGVCF YG++FAL GL AAGKSY NC AV     F L  Q  +GGWG
Sbjct  598   EDVQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKSYNNCAAVRKGVEFLLRTQRSDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E  +SCP   Y  LE   +NLVQT+WA++GL+++GQ +RDP PLHRAAKLLIN+QMEDGD
Sbjct  658   ESYRSCPDKVYRELETNDSNLVQTAWALMGLIHSGQVDRDPRPLHRAAKLLINSQMEDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ+ITGV+MKNCMLHYA++R+ +PL  L+EYRK V
Sbjct  718   FPQQEITGVFMKNCMLHYAAYRNIYPLWGLAEYRKNV  754



>sp|Q9MB42.1|BAMS_GLYGL RecName: Full=Beta-amyrin synthase [Glycyrrhiza glabra]
 dbj|BAA89815.1| beta-amyrin synthase [Glycyrrhiza glabra]
Length=765

 Score =   957 bits (2473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/759 (59%), Positives = 573/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LKI EGG  PYIYSTNN+ GRQ WEYDP+ GTPEE+   + AR  F   R Q  P  
Sbjct  1     MWRLKIAEGGKDPYIYSTNNFVGRQTWEYDPDGGTPEERAQVDAARLHFYNNRFQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             CGDL  R Q+++E+     +I  V++ + EE+ YE  TTAVR+A     ALQ  DGHWPA
Sbjct  59    CGDLLWRFQILRENNFKQ-TIASVKIGDGEEITYEKATTAVRRAAHHLSALQTSDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             + +GPLFF PPL+  +YI+G +D +   E++KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   QIAGPLFFLPPLVFCMYITGHLDSVFPEEYRKEILRYIYYHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ +R+LGEGPD G D A AR RKWI DHGG T IPSWGK +LS+LGV++W G NP
Sbjct  178   TALNYICMRILGEGPDGGQDNACARARKWIHDHGGVTHIPSWGKTWLSILGVFDWCGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+  + YE+
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTEPYEK  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             ++W +AR  C KEDLYYPH  +QDL+W++L   TEP + RWPF K +RE A++  +K++ 
Sbjct  298   VNWKKARHQCAKEDLYYPHPLLQDLIWDSLYLFTEPLLTRWPFNKLVREKALQVTMKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDPNGD  K HLARVPDYLW++EDGM+M  FGSQ 
Sbjct  358   YEDETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMTMQSFGSQE  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WDA FA QA++A+ +VEE    L K H +IK+SQV++NP GDFKSMYRH++KGSWTFSDQ
Sbjct  418   WDAGFAVQALLATNLVEEIAPTLAKGHDFIKKSQVRDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LLL  +P +I+GEK + +RLY++V+V L LQS + GG + WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQS-KKGGLSAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP+E FADIVVE E++E TGS I ALV F+  YP +R KE+   IA AV+
Sbjct  537   AGAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFIANAVR  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             +LE  Q +DGSWYG WGVCF YG++FAL GL AAGK++ NC A+  A  F L+ Q ++GG
Sbjct  597   FLEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTFANCAAIRKAVKFLLTTQREDGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   S P   Y+PLEG+ +N+V T+WA++GL++ GQAERDP PLHRAAKL+IN+Q+E+
Sbjct  657   WGESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQAERDPAPLHRAAKLIINSQLEE  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GD+PQQ+ITGV+MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  717   GDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  755



>gb|AIK19223.1| triterpene synthase [Eugenia uniflora]
Length=761

 Score =   956 bits (2472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/757 (59%), Positives = 563/757 (74%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EG  GP +YSTNNY GRQIWE+DP AGT EE+   E AR+ F   R +    C
Sbjct  1     MWRLKIAEGEDGPCLYSTNNYVGRQIWEFDPEAGTLEERAEVEAARRHFYDHRHQ-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ ++E +    +I PVR+ + EE+ Y+ ++TA+R+ V+   ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREKKFKQ-TIKPVRVEDGEEITYDKVSTALRRTVQFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPL+  PPL++ +YI+G +D +  +EH KE++RY+YNHQNEDGGWG +I+GHSTM  +
Sbjct  119   IAGPLYLLPPLVMCIYITGHLDAVFPAEHCKEILRYIYNHQNEDGGWGFHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEGPD G D A AR RKWILD GG T IPSWGK +LS+ G+++W G NP+
Sbjct  179   ALSYICMRILGEGPDGGQDNACARARKWILDRGGVTSIPSWGKTWLSIFGLFDWSGTNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T +V  LR E+H + Y+ I
Sbjct  239   PPEFWILPSFLPIHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLVQQLREELHTQPYDTI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
              W + R  C KEDLYYPH  +QDL+W++L   TEPF+ RWPF K+RE A++  +K++ YE
Sbjct  299   CWRKVRHLCAKEDLYYPHPLVQDLMWDSLYIFTEPFLNRWPFNKLREKALQVTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDP GD  K HLAR+PDYLW+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPEGDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
              AFA QA++AS M EE    L + H +IK+SQVK+NP GDFK M+RH++KGSWTFSDQDH
Sbjct  419   TAFAVQALLASNMTEEIAPVLARGHDFIKKSQVKDNPSGDFKRMHRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC LL   MP +I+GEK + ++LY+AV++ L LQS ++GG + WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLFSMMPPEIVGEKMEPEKLYDAVNILLSLQS-KNGGLSAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
              Q +L++LNP+E F DIV+E +++E T S I ALV FR  YP +R +E+   I  AV++L
Sbjct  538   AQAWLELLNPTEFFEDIVIEHQYVECTSSAIQALVLFRKLYPGHRKEEIENCIPNAVRFL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSWYG WGVCF YG++FAL GL AAGK+Y NC AV     F L  Q Q+GGWG
Sbjct  598   ENIQNPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYSNCAAVRKGVAFLLRTQLQDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP   Y+PLEG  +N VQT WAM+GL++ GQAERDPTPLHRAAKLLIN+QMEDGD
Sbjct  658   ESYLSCPKKEYVPLEGNRSNRVQTGWAMMGLIHAGQAERDPTPLHRAAKLLINSQMEDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             +PQQ+ITG Y+KN MLHYA++R+ FPL AL+EYR+ V
Sbjct  718   YPQQEITGAYLKNGMLHYAAYRNIFPLWALAEYRRLV  754



>sp|O82146.1|BAMS2_PANGI RecName: Full=Beta-Amyrin Synthase 2 [Panax ginseng]
 dbj|BAA33722.1| beta-Amyrin Synthase [Panax ginseng]
Length=761

 Score =   956 bits (2471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/758 (58%), Positives = 568/758 (75%), Gaps = 7/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+L   +GG  PY+YSTNN+ GRQ WE+DP+ GTP E+   E+AR  F   R Q  P +
Sbjct  1     MWRLMTAKGGNDPYLYSTNNFIGRQTWEFDPDYGTPAERAEVEEARLHFWNNRYQVKPSS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               D+  RMQ +KE     + IP V++ + EE+ YEA TT +R+AV    ALQA DGHWPA
Sbjct  61    --DVLWRMQFLKEKNFKQI-IPQVKVEDGEEITYEAATTTLRRAVHYFSALQADDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++ LYI+G ++ +  +EH+ E++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCLYITGHLNTVFPAEHRIEILRYIYCHQNDDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +AL+Y+ +R+LGEG D G + A AR RKWILDHG  T IPSWGK +LS+LG+++W G NP
Sbjct  178   TALSYICMRILGEGRDGGENNACARARKWILDHGSVTAIPSWGKTWLSILGLFDWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ P   P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ ++Y++
Sbjct  238   MPPEFWILPPFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQAYDE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I+W + R  C KEDLYYPH  IQDL+W++L   TEPF+ RWPF K+RE A++  +K++ Y
Sbjct  298   INWRKVRHNCAKEDLYYPHPLIQDLMWDSLYIFTEPFLTRWPFNKLREKALQTTMKHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDY+W+AEDGM M  FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLACWVEDPNGDYFKQHLARIPDYIWVAEDGMKMQSFGSQEW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D  FA QA++AS +++E    L K H +IK+SQVKENP GDFKSM+RH++KGSWTFSDQD
Sbjct  418   DTGFAIQALLASDLIDEIRPTLMKGHDFIKKSQVKENPSGDFKSMHRHISKGSWTFSDQD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LL   MP +I+G+K +  +L++AV++ L LQS ++GG A WEP 
Sbjct  478   HGWQVSDCTAEALKCCLLFSRMPTEIVGDKMEDNQLFDAVNMLLSLQS-KNGGLAAWEPA  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP+E F DIV+E E++E T S I A+V F+  YP +R KE+ +SI  AVQY
Sbjct  537   GSSEWLELLNPTEFFEDIVIEHEYVECTSSAIQAMVMFKKLYPGHRKKEIEVSITNAVQY  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q  DGSWYG WGVCF YGT+FA+ GLTAAGK+Y NC+ +  A  F +  Q  +GGW
Sbjct  597   LEDIQMPDGSWYGNWGVCFTYGTWFAMGGLTAAGKTYNNCQTLHKAVDFLIKSQRSDGGW  656

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP+  Y PLEG  +NLV TSWAM+GL+++ QAERDPTPLHRAAKLLIN+QME G
Sbjct  657   GESYLSCPNKEYTPLEGNRSNLVHTSWAMMGLIHSRQAERDPTPLHRAAKLLINSQMESG  716

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITGV+MKNCMLHYA+ R+ +PL AL+EYRK V
Sbjct  717   DFPQQEITGVFMKNCMLHYAASRNIYPLWALAEYRKNV  754



>dbj|BAE53429.1| beta-amyrin synthase [Lotus japonicus]
Length=762

 Score =   955 bits (2469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/758 (58%), Positives = 573/758 (76%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLK+ +GG  PYI+STNN+ GRQ WEYDP+AGTPEE+   E+AR+ F   R K    C
Sbjct  1     MWKLKVADGGKDPYIFSTNNFVGRQTWEYDPDAGTPEERAQVEEARQDFYNNRYK-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  R Q+++E+     +IP V++ + EE+ YE  TT +++A     ALQ  DGHWPA+
Sbjct  60    GDLLWRFQVLRENNFKQ-TIPSVKIEDGEEITYEKATTTLKRAAHHLAALQTSDGHWPAQ  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPLFF PPL+  +YI+G ++ +   E++KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFQPPLVFCMYITGHLNSVFPEEYRKEILRYIYVHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             ALNY+ +R+LGEGPD G D A AR RKWILDHGG T IPSWGK +LS+LG+++W G NP+
Sbjct  179   ALNYICMRMLGEGPDGGQDNACARARKWILDHGGVTHIPSWGKTWLSILGIFDWKGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+  + YE++
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKV  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W +AR  C KED+YYPH  IQDL+W++L   TEP + RWPF K +RE A+   +K++ Y
Sbjct  299   NWKKARHQCAKEDIYYPHPLIQDLMWDSLYLFTEPLLTRWPFNKLVREKALEVTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW++EDGM M  FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARIPDYLWVSEDGMCMQSFGSQEW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA FA QA++A+ +V+E G  L K H +IK+SQV++NP GDFK+M+RH++KGSWTFSDQD
Sbjct  419   DAGFAVQALLATNLVDELGPTLAKGHDFIKKSQVRDNPSGDFKNMHRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LLL  +P  I+GEK + + L+++V++ L LQS + GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSMLPPDIVGEKMEPECLFDSVNLLLSLQS-KKGGLAAWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L++LNP+E FADIVVE E++E TGS I ALV F+  YP +R KE+   I++AV++
Sbjct  538   GAQEWLELLNPTEFFADIVVEHEYVECTGSAIGALVLFKKLYPGHRKKEIENFISEAVRF  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q +DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+  A  F L+ Q  +GGW
Sbjct  598   LEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTYANCAAIRKAVKFLLTTQRGDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   S P   Y+P EG  +N+V T+WA++GL+++GQAERDPTPLHRAAKLLIN+Q+E+G
Sbjct  658   GESYLSSPKKIYVPFEGNRSNVVHTAWALMGLIHSGQAERDPTPLHRAAKLLINSQLEEG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             D+PQQ+ITGV+MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  718   DWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  755



>ref|XP_007023608.1| Beta-Amyrin Synthase [Theobroma cacao]
 gb|EOY26230.1| Beta-Amyrin Synthase [Theobroma cacao]
Length=758

 Score =   955 bits (2468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/759 (59%), Positives = 572/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MWKLKI EG  GPY+YSTNNY GRQ WE+DP+AGTPEE+   E+AR+ F K R Q  P  
Sbjct  1     MWKLKIAEGVDGPYLYSTNNYVGRQTWEFDPDAGTPEERAEVEEARQNFYKDRYQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GDL  RMQ ++E      +IP V++ E E+++YE  T A+R+AV    ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLREQNFKQ-TIPAVKIEEGEQISYEKATAALRRAVHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL+ + YI+G ++ +   EH++E++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVFSTYITGHLNTVFPEEHRREILRYIYYHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +AL+Y+ +R+LG  PD G D A AR RKWILDHG  T +PSWGK +LS+LGV++W G NP
Sbjct  178   TALSYICMRILGVEPDGGQDNACARARKWILDHGSVTHMPSWGKTWLSILGVFDWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++  LR E++++ Y +
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLIEQLREELYLQPYNE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W + R  C  ED+YYPH  IQDL+W++L  CTEP + RWP  K +RE A++  IK++ 
Sbjct  298   INWRKVRHLCAPEDIYYPHPLIQDLMWDSLYICTEPLLTRWPLNKLVREKALQVTIKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  WAE+PN D  K HLAR+PDYLW+AEDGM M  FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWAEEPNSDYFKKHLARIPDYLWVAEDGMKMQSFGSQE  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS + +E G  L++ H +IK+SQVK+NP GDFK MYRH++KGSWTFSDQ
Sbjct  418   WDTGFAIQALLASNLTDEIGPVLKRGHDFIKKSQVKDNPSGDFKKMYRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LL+  +P +I+GEK + Q+LY AV+V L LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLMSMLPPEIVGEKMEPQQLYNAVNVLLSLQS-KNGGLAAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP+E FADIVVE E++E T S I AL  F+  YP +R KE++  I  AV+
Sbjct  537   AGAQDWLEMLNPTEFFADIVVEHEYVECTASAIHALFLFKKLYPGHRKKEIDNFITNAVR  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q  DGSWYG WGVCF YG++FAL GL AAGK+Y NC AV     F L  Q + GG
Sbjct  597   YLENIQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYTNCLAVRKGVEFLLRTQRENGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE  +SCP  RY+PLE   +NLV T+WAM+GL++ GQAERDPTPLHRAAKL+IN+Q+ED
Sbjct  657   WGESYKSCPDKRYVPLEEGRSNLVHTAWAMMGLIHAGQAERDPTPLHRAAKLIINSQLED  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  717   GDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKRV  755



>gb|AGG09939.1| beta-amyrin synthase [Panax quinquefolius]
 gb|AGK62450.1| beta-amyrin synthase [Panax quinquefolius]
Length=761

 Score =   955 bits (2468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/758 (58%), Positives = 568/758 (75%), Gaps = 7/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGP-YIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+L   +GG   Y+YSTNN+ GRQ WE+DP+ GTP E+   E+AR  F   R Q  P  
Sbjct  1     MWRLMTAKGGNDLYLYSTNNFIGRQTWEFDPDYGTPAERAEVEEARLHFWNNRYQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GD+  RMQ +KE     + IP V++ + EE+ YEA TT +R+AV    ALQA DGHWPA
Sbjct  59    SGDVLWRMQFLKEKNFKQI-IPQVKVEDGEEITYEAATTTLRRAVHYFSALQADDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++ LYI+G ++ +  +EH+ E++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCLYITGHLNTVFPAEHRIEILRYIYCHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +AL+Y+ +R+LGEG + G + A AR RKWILDHG  T IPSWGK +LS+LG+++W G NP
Sbjct  178   TALSYICMRILGEGRNGGENNACARARKWILDHGSVTAIPSWGKTWLSILGLFDWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ P   P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ ++Y++
Sbjct  238   MPPEFWILPPFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQAYDE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I+W + R  C KEDLYYPH  IQDL+W++L   TEPF+ RWPF K+RE A++  +K++ Y
Sbjct  298   INWRKVRHNCAKEDLYYPHPLIQDLMWDSLYIFTEPFLTRWPFNKLREKALQTTMKHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDY+W+AEDGM M  FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGMKMQSFGSQEW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D  FA QA++AS + +E    L K H +IK+SQVKENP GDFKSM+RH++KGSWTFSDQD
Sbjct  418   DTGFAIQALLASDLTDEIRPTLMKGHDFIKKSQVKENPSGDFKSMHRHISKGSWTFSDQD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LL   MP +I+G+K +  +L++AV++ L LQS ++GG A WEP 
Sbjct  478   HGWQVSDCTAEALKCCLLFSRMPTEIVGDKMEDNQLFDAVNILLSLQS-KNGGLAAWEPA  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP+E F DIV+E E++E T S I A+V F+  YP +R KE+ +SI  AVQY
Sbjct  537   GSSEWLELLNPTEFFEDIVIEHEYVECTSSAIQAMVMFKKLYPGHRKKEIEVSITNAVQY  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q+ DGSWYG WGVCF YGT+FA+ GLTAAGK+Y N + +  A  F +  Q  +GGW
Sbjct  597   LEDIQKPDGSWYGNWGVCFTYGTWFAMGGLTAAGKTYNNSQTLHKAVDFLIKSQRSDGGW  656

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP+  Y PLEG  +NLV TSWAM+GL+++GQAERDPTPLHRAAKLLIN+QME G
Sbjct  657   GESYLSCPNKEYTPLEGNRSNLVHTSWAMMGLIHSGQAERDPTPLHRAAKLLINSQMESG  716

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYRK V
Sbjct  717   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKNV  754



>ref|XP_004488915.1| PREDICTED: beta-amyrin synthase-like [Cicer arietinum]
Length=762

 Score =   954 bits (2467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/759 (58%), Positives = 572/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LKI +GG  PYI+STN + GRQIWEYD  AG+ EE+E  E+AR  F   R Q  P  
Sbjct  1     MWRLKIADGGKDPYIFSTNEFVGRQIWEYDSEAGSKEEREQVEQARLNFYNNRFQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             C DL  R Q+++E+     +I  V++ + EE+ YE  T+A+R+      ALQ  DGHWPA
Sbjct  59    CADLLWRFQVLRENNFKQ-TIDSVKIEDGEEITYEKATSALRRGTHHLAALQTSDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             + +GPLFF PPL+  +YI+G +D + + EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   QIAGPLFFLPPLVFCVYITGHLDSVFSEEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ +R+LGEGP+ G D A AR RKWI DHGG T IPSWGK +LS+LGV++W G NP
Sbjct  178   TALNYICMRILGEGPNGGLDNACARARKWIRDHGGVTHIPSWGKTWLSILGVFDWCGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+H + YE+
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELHTQPYEK  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W +AR  C KEDLYYPH FIQDL+W++L   TEPF+ RWPF K IRE A+   +K++ 
Sbjct  298   INWTKARHLCAKEDLYYPHPFIQDLIWDSLYIFTEPFLTRWPFNKLIREKALEVTMKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW++EDGM+M  FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARIPDYLWISEDGMTMQSFGSQE  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WDA FA QA++A+ ++EE G  L K H +IK+SQV+ENP GDFKSM+RH++KGSWTFSDQ
Sbjct  418   WDAGFAVQALLATNLIEEIGPALAKGHDFIKKSQVRENPSGDFKSMHRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LLL  +P +++GEK + +RLY++V++ L LQS + GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMLPPEVVGEKMEPERLYDSVNLLLSLQS-KKGGLAAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP+E FADIVVE E++E TGS I ALV F+  YP +R KE+   I  AV+
Sbjct  537   AGAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFIVNAVR  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             +LE  Q S+GSWYG WGVCF YGT+FAL GL AAGK++ NC A+  A  F L+ Q  +GG
Sbjct  597   FLEDTQTSNGSWYGNWGVCFTYGTWFALGGLAAAGKTFTNCSAIRKAVQFLLTTQRDDGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   S P   Y+PLE + +N+V T+WA++GL++ GQAE +PTPLHRAAKLLIN+Q+E+
Sbjct  657   WGESYLSSPKKIYVPLERSRSNVVHTAWALMGLIHAGQAEINPTPLHRAAKLLINSQLEE  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GD+PQQ+ITGV+MKNCMLHY  +R  +PL AL+EYR+RV
Sbjct  717   GDWPQQEITGVFMKNCMLHYPMYRDIYPLWALAEYRRRV  755



>dbj|BAE43642.1| beta-amyrin synthase [Euphorbia tirucalli]
Length=762

 Score =   954 bits (2466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/758 (59%), Positives = 558/758 (74%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGP-YIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKI EGG   Y+YSTNNY GRQ W +DP   TP+E    ++AR  F   R     + 
Sbjct  1     MWKLKIAEGGNDEYLYSTNNYVGRQTWVFDPQPPTPQELAQVQQARLNFYNNRYHVKPS-  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  R Q ++E      +IP  ++ E E++ YE  TTA+R+AV    ALQA DGHWPAE
Sbjct  60    SDLLWRFQFLREKNFKQ-TIPQAKINEGEDITYEKATTALRRAVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFF PPL++ LYI+G +D +  + H+ E++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCLYITGHLDTVFPAPHRLEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              L+Y+ +RLLGEGP+ G D A +R RKWI+DHGGAT IPSWGK +LS+LGVYEW G NP+
Sbjct  179   VLSYICMRLLGEGPNGGQDNACSRARKWIIDHGGATYIPSWGKTWLSILGVYEWSGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ P+  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+H + Y  I
Sbjct  239   PPEFWILPTFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLRQELHTQPYHHI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYMRY  1353
             +W + R  C  ED+YYPH  IQDL+W++L   TEP + RWPF KI R+ A+   +K++ Y
Sbjct  299   NWTKTRHLCAHEDVYYPHPLIQDLMWDSLYIFTEPLLTRWPFNKIIRKKALEVTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  WAEDPNG   K HLAR+PDY+W+AEDGM M  FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWAEDPNGVPFKKHLARIPDYMWVAEDGMKMQSFGSQQW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D  FA QA++AS + EE G  L+K H +IK+SQVKENP GDFKSM+RH++KGSWTFSDQD
Sbjct  419   DTGFAIQALLASNLTEEIGQVLKKGHDFIKKSQVKENPSGDFKSMHRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LL   MP +I+GEK D Q LY AV++ + LQS ++GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLFSMMPPEIVGEKMDAQHLYNAVNILISLQS-KNGGLAAWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L++LNP+E FADIV+E E++E T S I AL+ F+  YP +R KE+   I  AV+Y
Sbjct  538   GAQQWLEMLNPTEFFADIVIEHEYVECTASAIHALIMFKKLYPGHRKKEIENFITNAVKY  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q +DG WYG WGVCF YGT+FA+ GL AAGK+Y NC A+  A  F L  Q Q+GGW
Sbjct  598   LEDVQTADGGWYGNWGVCFTYGTWFAVGGLAAAGKNYNNCAAMRKAVDFLLRTQKQDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP  +Y+PLE   +NLV TSWA++GL+  GQ +RDPTPLHRAAKLLIN+Q+EDG
Sbjct  658   GESYLSCPHKKYVPLEDNRSNLVHTSWALMGLISAGQMDRDPTPLHRAAKLLINSQLEDG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYR RV
Sbjct  718   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRNRV  755



>gb|AAO33580.1|AF478455_1 multifunctional beta-amyrin synthase [Lotus japonicus]
Length=762

 Score =   954 bits (2466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/758 (58%), Positives = 566/758 (75%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLK+ +GG  PYI+S NN+ GRQ WEYDP+AGTPEE+   E+AR+ F   R K   TC
Sbjct  1     MWKLKVADGGKNPYIFSINNFVGRQTWEYDPDAGTPEERAQVEEARQDFYNNRYK-VKTC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GD   R Q+++E+     +IP V++ + E+V Y+ +TT VR+A      LQ  DGHWPA+
Sbjct  60    GDRLWRFQVMRENNFKQ-TIPSVKIEDGEKVTYDKVTTTVRRAAHHLAGLQTSDGHWPAQ  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPL FTPPL+  +YI+G +D +    ++KE++RY Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLLFTPPLIFCMYITGHLDSVFPEVYRKEILRYTYVHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              LNY+ +R+LGEGPD G D A AR RKWI DHGGAT I SWGK +LS+LG+++W G NP+
Sbjct  179   VLNYICMRILGEGPDGGQDNACARARKWIHDHGGATHIASWGKTWLSILGIFDWSGTNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+  + YE++
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKV  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W +AR  C KEDLYYPH  IQDL+W++L   TEPF+ RWPF K IRE A++  +K++ Y
Sbjct  299   NWKKARHQCAKEDLYYPHPLIQDLMWDSLYLFTEPFLTRWPFNKLIRERALQVTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E   +RYITIGC+EK L M+  W EDPNG   K HLARVPDYLWLAEDGM M  FGSQ W
Sbjct  359   EDHNSRYITIGCVEKVLCMLACWVEDPNGIAFKRHLARVPDYLWLAEDGMCMQSFGSQEW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA FA QA++++ +++E G  L K H +IK SQVK+NP GDFKSM+RH++KG+WTFSDQD
Sbjct  419   DAGFAVQALLSTNLIDELGPALAKGHDFIKNSQVKDNPSGDFKSMHRHISKGAWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE  KC LLL  +P +I+GEK + +RL++ V++ L LQS + GGFA WEP 
Sbjct  479   HGWQVSDCTAEGFKCCLLLSMLPPEIVGEKIEPERLFDTVNLLLSLQS-KKGGFAVWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L++LNP E F DIV+E E +E TGS I ALV F+ HYP +R KE+   IA AV+Y
Sbjct  538   GAQEWLELLNPIEFFEDIVIEHELVECTGSAIGALVLFKNHYPEHRKKEIEDCIANAVRY  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
              E  Q +DGSWYG  G+CF+YGT+FAL GL AAGK+Y NC A+     F L+ Q+++GGW
Sbjct  598   FEDIQTADGSWYGNAGICFIYGTWFALGGLEAAGKTYANCAAIRKGVKFLLTTQSKDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP   Y+PLEG  +N+VQT+WA++GL++ GQAERDPTPLHRAAKLLIN+Q+EDG
Sbjct  658   GESYLSCPKKIYVPLEGNRSNVVQTAWALMGLIHAGQAERDPTPLHRAAKLLINSQLEDG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             D+PQQDITGVY+KNC LHY  +R+ F  MAL+EYR+RV
Sbjct  718   DWPQQDITGVYVKNCTLHYPMYRNNFTTMALAEYRRRV  755



>ref|XP_010245752.1| PREDICTED: taraxerol synthase-like [Nelumbo nucifera]
 ref|XP_010245753.1| PREDICTED: taraxerol synthase-like [Nelumbo nucifera]
 ref|XP_010245754.1| PREDICTED: taraxerol synthase-like [Nelumbo nucifera]
Length=764

 Score =   953 bits (2464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/759 (58%), Positives = 578/759 (76%), Gaps = 6/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MW+LKI +GGGP+IYSTNNY GRQIWE+DPN GTPEE    E+AR+ F   R K     G
Sbjct  1     MWRLKIAQGGGPFIYSTNNYIGRQIWEFDPNYGTPEEIAQVEQARQEFWNNRFK-VKPGG  59

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             D+ +R+Q++KE+   V +IPPVR+ E+EEV+YEA T  +R+AVR + ALQA DGHWPAEN
Sbjct  60    DVLLRLQLLKENNF-VQTIPPVRIGEDEEVSYEAATAVLRRAVRFHAALQASDGHWPAEN  118

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             SG  FF PPL+I LYI+G ++ I++ EH KE++RY+YNHQNEDGGWGL+I+G S M  + 
Sbjct  119   SGSNFFVPPLIICLYITGDLNKIISEEHCKEILRYIYNHQNEDGGWGLHIEGQSIMFSTV  178

Query  1883  LNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             LNY+++R+LGEGP+ G DGA+ R RKWI DHGGAT IPSWGK +LSV+G+YEW+G NP++
Sbjct  179   LNYISMRILGEGPEGGRDGAVPRARKWIHDHGGATSIPSWGKAWLSVIGLYEWEGNNPMA  238

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWL PS FP  P  +WCY R  Y+PMSYLYAKR+ GP+T +VL LR EIH + Y +I 
Sbjct  239   PEFWLLPSFFPLSPENLWCYARLVYLPMSYLYAKRFVGPITPLVLQLREEIHSEPYHKIR  298

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             W++ R  C KEDL+YPH FIQDLLW+ L    EP + RWPF K+RE A+++ +K++ YE 
Sbjct  299   WSKTRHMCAKEDLHYPHPFIQDLLWDTLYILIEPLLMRWPFNKLRERALKQTMKHIHYED  358

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMH-GFGSQNWD  1170
             + +RYITI C+EKS+ M+  W EDPNGD  K+HLAR+PDY+W+AEDGM +    GSQ+WD
Sbjct  359   QNSRYITIACVEKSILMLACWVEDPNGDAYKHHLARIPDYMWVAEDGMKLQCCSGSQSWD  418

Query  1169  AAFATQAIIASGM-VEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             A+F  QAI+AS +  +E G CL+K H +IK SQV++NP GDFK MYRH++KGSWTFS+QD
Sbjct  419   ASFVAQAIMASNLSFDEIGLCLKKGHDFIKNSQVRDNPSGDFKRMYRHISKGSWTFSNQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCT E LK  L+L  MP +I+GEK + +R+++AV++ L LQS E+GG   WEP 
Sbjct  479   HGWQVSDCTGEGLKACLMLSLMPPEIVGEKLEEERIFDAVNILLSLQS-ENGGLPCWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               + + ++ NP+EIF+++ +E E++E T + I ++V F   YPN+R +E+   I+KA  Y
Sbjct  538   KSKKWWELFNPTEIFSNVTIENEYVECTATTIQSIVLFMKLYPNHRKEEIESFISKATHY  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E++Q  +GSWYG WG+CF+YGT+FAL GL A GK Y++C AV     F LS Q + GGW
Sbjct  598   IEQKQMPNGSWYGNWGICFIYGTWFALRGLAAVGKGYDDCVAVRKGVDFLLSIQKETGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP+  Y PL+G  TNLVQT+WA++GL++ GQAERD TPLHRAAKLLIN+QME+G
Sbjct  658   GESYLSCPNEEYTPLKGGKTNLVQTAWALMGLIHGGQAERDTTPLHRAAKLLINSQMENG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             DFPQ++ITG  +K CM+HYA++R+ FPL AL EYR RV+
Sbjct  718   DFPQEEITGASIKTCMIHYATYRNIFPLWALGEYRTRVF  756



>ref|XP_006582958.1| PREDICTED: beta-amyrin synthase isoform X1 [Glycine max]
Length=762

 Score =   953 bits (2464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/758 (58%), Positives = 571/758 (75%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI +GG  PYI+STNN+ GRQ WE+DP AG+PEE+   E AR+ F   R K    C
Sbjct  1     MWRLKIADGGNDPYIFSTNNFVGRQTWEFDPEAGSPEERAQVEAARQHFYHNRFK-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  R Q+++E+     +IP V + + EE+ Y+ +T+AVR+      ALQ  DGHWPA+
Sbjct  60    ADLLWRFQVLRENNFKQ-TIPRVTIEDGEEITYQKVTSAVRRGAHHLAALQTSDGHWPAQ  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPLFF PPL+  +YI+G+++ +   EH+KE++RY Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFLPPLVFCMYITGNLESVFPEEHRKEILRYTYYHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             ALNY+ +R+LGEGP+ G D A AR RKWI DHGG T IPSWGK +LS+LGV++W G NP+
Sbjct  179   ALNYICMRMLGEGPNGGHDNACARARKWIRDHGGVTHIPSWGKTWLSILGVFDWCGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+  + YE++
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKV  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W +AR  C KEDLYYPH  IQDL+W++L   TEP + RWPF K IRE A++  +K++ Y
Sbjct  299   NWKKARHQCAKEDLYYPHPLIQDLIWDSLYIFTEPLLTRWPFNKLIREKALQVTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLARVPDYLW++EDGM+M  FGSQ W
Sbjct  359   EDETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMTMQSFGSQEW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA FA QA++A+ ++EE G    K H +IK+SQVK+NP GDFKSM+RH++KGSWTFSDQD
Sbjct  419   DAGFAVQALLATNIIEEIGPTFAKGHDFIKKSQVKDNPFGDFKSMHRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LLL  +P +I+GEK + +RLY++V+V L LQS + GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQS-KKGGLAAWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L++LNP+E FADIVVE E++E TGS I ALV F+  YP +R KE+   I  AV++
Sbjct  538   GAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFITNAVRF  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q +DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+  A  F L+ Q ++GGW
Sbjct  598   LEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTYTNCAAIRKAVKFLLTTQREDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   S P   Y+PLEG+ +N+V T+WA++GL++ GQA+RDP PLHRAAKLLIN+Q+E+G
Sbjct  658   GESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQADRDPMPLHRAAKLLINSQLEEG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             D+PQQ+ITGV+MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  718   DWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  755



>ref|XP_009344015.1| PREDICTED: beta-amyrin synthase [Pyrus x bretschneideri]
Length=761

 Score =   953 bits (2463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/758 (59%), Positives = 573/758 (76%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLK+ +GG  PYIYSTN++ GRQI+E+DP AGT EE+   E+AR  F   R +   + 
Sbjct  1     MWKLKVADGGNDPYIYSTNSFVGRQIFEFDPEAGTTEERAEMEEARLHFYNNRHQVKPS-  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ ++E      +IPPV++   EE+ YE  T ++R++V    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREKNFKQ-TIPPVKVEVGEEITYEKATASLRRSVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCVYITGHLNTVFHAEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             ALNY+ +R+LGEGPD G D A AR RKWILDHG  T IPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALNYICMRILGEGPDGGQDNACARARKWILDHGSVTHIPSWGKTWLSILGVFEWFGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y++I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDEI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W   R  C KED+YYPH +IQD LW++L  CTEP + RWPF K IR+ A+   ++++ Y
Sbjct  299   NWKGVRHHCAKEDIYYPHPWIQDFLWDSLYICTEPLLTRWPFNKLIRKRALEVTMEHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  WAEDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D  FA QA++AS + +E    L + H ++K+SQVK+NP GDFKSM+RH++KGSWTFSDQD
Sbjct  419   DTGFAIQALLASNLTDEIAPTLARGHDFVKKSQVKDNPSGDFKSMHRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LLL  MP +++GEK + +RLY+AV+V + LQS ++GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSMMPPELVGEKMEPERLYDAVNVLITLQS-KNGGLAAWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP+E FADIVVE E++E T S I ALV F+  YP +R KE++  I  A QY
Sbjct  538   GAAEWLEMLNPTEFFADIVVEHEYVECTSSAIQALVLFKKLYPGHRKKEIDQFITNAAQY  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q  DGSWYG WGVCF YGT+FAL GLTAAGK++ NC  +  A  F L+ QN+ GGW
Sbjct  598   LENIQMEDGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCAVIRKAVSFLLTMQNENGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP   Y+PLEG  +NLV T+WAM+GL+Y GQAERDP PLHRAAKL+IN+QME+G
Sbjct  658   GESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIYAGQAERDPAPLHRAAKLIINSQMENG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYRK V
Sbjct  718   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKWV  755



>gb|ADE88148.1| beta-amyrin synthase [Glycyrrhiza uralensis]
Length=762

 Score =   953 bits (2463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/759 (58%), Positives = 571/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LKI EGG  PYIYSTNN+ GRQ WEYDP  G+ EE+   + AR  F   R Q  P  
Sbjct  1     MWRLKIAEGGKDPYIYSTNNFVGRQTWEYDPGGGSAEERAQVDAARLHFYNNRFQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             CGDL  R Q+++E+     +I  V++ + EE+ YE  TTAVR+A     ALQ  DGHWPA
Sbjct  59    CGDLLWRFQILRENNFKQ-TIASVKIGDGEEITYEKATTAVRRAAHHLSALQTSDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             + +GPLFF PPL+  +YI+G +D +   E++KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   QIAGPLFFLPPLVFCMYITGHLDSVFPEEYRKEILRYIYYHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ +R+LGEGPD G D A AR RKWI DHGG T IPSWGK +LS+LGV++W G NP
Sbjct  178   TALNYICMRILGEGPDGGQDNACARARKWIHDHGGVTHIPSWGKTWLSILGVFDWCGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+  + YE+
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTEPYEK  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             ++W +AR  C KEDLYYPH  +QDL+W++L   TEP + RWPF K +RE A++  +K++ 
Sbjct  298   VNWKKARHQCAKEDLYYPHPLLQDLIWDSLYLFTEPLLTRWPFNKLVREKALQVTMKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDPNGD  K HLARVPDYLW++EDGM+M  FGSQ 
Sbjct  358   YEDETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMTMQSFGSQE  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WDA FA QA++A+ +VEE    L K H +IK+SQV++NP GDFKSMYRH++KGSWTFSDQ
Sbjct  418   WDAGFAVQALLATNLVEEIAPTLAKGHDFIKKSQVRDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LLL  +P +I+GEK + +RLY++V+V L LQS + GG + WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQS-KKGGLSAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP+E FADIVVE E++E TGS I ALV F+  YP +R KE+   IA AV+
Sbjct  537   AGAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFIANAVR  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             +LE  Q +DGSWYG WGVCF YG++FAL GL AAGK++ NC A+  A  F L+ Q ++GG
Sbjct  597   FLEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTFANCAAIRKAVKFLLTTQREDGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   S P   Y+PLEG+ +N+V T+WA++GL++ GQAERDP PLHRAAKL+IN+Q+E+
Sbjct  657   WGESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQAERDPAPLHRAAKLIINSQLEE  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GD+PQQ+ITGV+MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  717   GDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  755



>ref|XP_010027664.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
Length=761

 Score =   952 bits (2462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/757 (58%), Positives = 558/757 (74%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EG  GPY+YSTNNY GRQ W++DP AGT EE    E AR+ F   R +    C
Sbjct  1     MWRLKIAEGEDGPYLYSTNNYVGRQTWKFDPEAGTTEEHAQVEAARQHFYDHRHQ-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ ++E +    +IPPVR+ + EE+ Y+  +TA+R+ V    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREQQFKQ-AIPPVRVEDGEEITYDKASTALRRTVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPL+F PPL++ +YI+G ++ +  +EH+KE++RYLYNHQNEDGGWG +I+GHSTM  +
Sbjct  119   IAGPLYFLPPLVMCVYITGHLNTVFPAEHRKEILRYLYNHQNEDGGWGFHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDGD-GAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEGPD G   A  R RKWILD GG T IPSWGK +LS+ G+++W G NP+
Sbjct  179   ALSYICMRILGEGPDGGQYNACTRARKWILDRGGVTYIPSWGKTWLSIFGLFDWSGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCRT YMPMSYLY KR+ GP+T  V  LR E+H + Y+ I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRTVYMPMSYLYGKRFVGPITPFVQQLRKELHTQPYDMI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
              W + R  C KEDLYYPH  +QDL+W++L    EP +  WPF ++RE A++  +K++ YE
Sbjct  299   CWRKVRHLCAKEDLYYPHPLVQDLIWDSLYIFIEPLLNHWPFNRLREKALQVTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDP+ D  K HLAR+PDYLW+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPDSDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
               FA QA++AS M EE G  L + H +IK+SQVK+NP GDFKSM+RH+TKGSWTFSDQDH
Sbjct  419   TGFAIQALLASNMTEEIGPVLARGHDFIKKSQVKDNPSGDFKSMHRHITKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC LL   MP +I+GEK   +RLY+AV++ L LQS ++GG   WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLFSMMPPEIVGEKMKPERLYDAVNILLSLQS-KNGGLPAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +L++LNP+E F DIV+E E++E T S I ALV FR  YP +R KE+   I+ +V+YL
Sbjct  538   APAWLELLNPTEFFEDIVIEHEYVECTSSAIQALVLFRKLYPEHREKEIEDFISNSVEYL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+     F L  Q Q+GGWG
Sbjct  598   ENVQLPDGSWYGCWGVCFTYGSWFALGGLAAAGKTYSNCAAMRKGVAFLLRTQLQDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP   Y+PLEG  +NLVQT+WAM+GL+  GQAERDPTPLHRAAKLLIN+QMEDGD
Sbjct  658   ESYLSCPKKEYVPLEGNRSNLVQTAWAMMGLIQAGQAERDPTPLHRAAKLLINSQMEDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             +PQQ++TGV+ KNCMLHY ++R+ +PL AL+EYR RV
Sbjct  718   YPQQELTGVFNKNCMLHYPNYRNTYPLWALAEYRTRV  754



>ref|XP_004305792.1| PREDICTED: beta-amyrin synthase-like [Fragaria vesca subsp. vesca]
Length=764

 Score =   951 bits (2457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/762 (59%), Positives = 572/762 (75%), Gaps = 11/762 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG---GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGP  2256
             MWKLKI EGG    PYIYSTNN+ GRQ WE+DP+AGT EE+   E+AR  F   R Q  P
Sbjct  1     MWKLKIAEGGEDSSPYIYSTNNFVGRQTWEFDPDAGTDEERAEVEEARLQFYNNRYQVKP  60

Query  2255  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2076
                GDL  RMQ ++E +    +IPPV++ + E + +E  T A+R++V    ALQA DGHW
Sbjct  61    --SGDLLWRMQFLREKKFKP-TIPPVKIEDGEAITHEKTTDALRRSVHFFSALQASDGHW  117

Query  2075  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  1896
             PAEN+GPLFF PPL+I +YI+G ++ +   EH+KE++RYLY HQNEDGGWGL+I+GHSTM
Sbjct  118   PAENAGPLFFLPPLVICMYITGHLNSVFPEEHRKEILRYLYYHQNEDGGWGLHIEGHSTM  177

Query  1895  IGSALNYVALRLLGEGPDDG--DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDG  1722
               + L+Y+ +R+LGEGPDDG  D A +R RKWILDHGG T +PSWGK +LS+LG+++W G
Sbjct  178   FSTGLSYICMRILGEGPDDGGQDNACSRARKWILDHGGVTHMPSWGKTWLSILGLFDWSG  237

Query  1721  CNPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKS  1542
              NP+ PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+ ++ 
Sbjct  238   SNPMPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELFIQP  297

Query  1541  YEQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIK  1365
             Y +I+W + R  C KED+YYPH +IQDLLW++L   TEP + RWPF K IRE A++  +K
Sbjct  298   YNEINWKKVRHLCAKEDIYYPHPWIQDLLWDSLYISTEPLLTRWPFNKLIREKALQVTMK  357

Query  1364  YMRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFG  1185
             ++ YE E +RYITIGC+EK L M+  WAEDPNGD  K HLAR+PDYLW++EDGM M  FG
Sbjct  358   HIHYEDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVSEDGMKMQSFG  417

Query  1184  SQNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTF  1005
             SQ WD  F+ QA++A+ + +E G  L + H +IK+SQVK+NP GDFK M+RH++KGSWTF
Sbjct  418   SQQWDTGFSIQALLATNLTDEIGPALARGHDFIKKSQVKDNPSGDFKCMHRHISKGSWTF  477

Query  1004  SDQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFAT  825
             SDQDHGW VSDCTAE LKC LLL  MP +I+GEK + +RLY++V+V L LQS ++GG + 
Sbjct  478   SDQDHGWQVSDCTAEGLKCCLLLSMMPSEIVGEKMEPERLYDSVNVLLSLQS-KNGGLSA  536

Query  824   WEPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAK  645
             WEP     +L++LNP+E FADIV+E E++E T S I ALV F+  YP +R KE+  SI K
Sbjct  537   WEPAGAAEWLELLNPTEFFADIVIEHEYVECTSSAIQALVLFKKLYPGHRKKEIEHSITK  596

Query  644   AVQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQ  465
             ++ YLE  Q  DGSWYG WGVCF YGT+FAL GL AAG+++    A+     F L  Q +
Sbjct  597   SIHYLENIQMPDGSWYGNWGVCFTYGTWFALGGLAAAGETFRTSAAMRKGVSFLLKAQRE  656

Query  464   EGGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQ  285
              GGWGE   SCP   YIPLEG  +NLV T+WAM+GL++ GQAERDPTPLHRAAK +IN+Q
Sbjct  657   NGGWGESYLSCPQKTYIPLEGNRSNLVHTAWAMMGLIHAGQAERDPTPLHRAAKFIINSQ  716

Query  284   MEDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             +E+GDFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  717   LENGDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKRV  758



>ref|XP_010063691.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW70924.1| hypothetical protein EUGRSUZ_F04039 [Eucalyptus grandis]
Length=761

 Score =   950 bits (2456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/755 (58%), Positives = 562/755 (74%), Gaps = 5/755 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EG   PY+YSTNNY GRQIWE+DP AGT EE    E AR+ F   R +    C
Sbjct  1     MWRLKIAEGKDSPYLYSTNNYVGRQIWEFDPEAGTTEEHAEVEAARQHFHDHRHQ-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  R+Q ++E +    +IPPV++ + EE+ Y+  +TA+R+ V    ALQA+DGHWPAE
Sbjct  60    GDLLWRLQFLREKQFKQ-TIPPVKVEDGEEITYDKASTALRRTVHFFSALQARDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPL+F PPL++ +YI+G ++ +  +EH+KE++RYLYNHQN DGGWG +I+GHSTM  +
Sbjct  119   IAGPLYFLPPLVMGVYITGHLNAVFPAEHRKEILRYLYNHQNGDGGWGFHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEGPD G D A  R RKWILD GG T IPSWGK +LS+ G+++W G NP+
Sbjct  179   ALSYICMRILGEGPDGGQDNACTRARKWILDRGGVTYIPSWGKTWLSIFGLFDWSGTNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T +V  LR E+H + Y+ I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLVQQLREELHTQPYDMI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
              W + R  C KEDLYYPH  +QDL+W++L   TEP + RWPF K+R  A++  IK++ YE
Sbjct  299   CWRKVRHLCAKEDLYYPHPLVQDLIWDSLYIFTEPLLNRWPFNKLRGKALQVTIKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDP+ D  K HLAR+PDYLW+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPDSDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
               FA QA++AS M EE G  L + H +IK+SQVK+NP GDFKSM+RH+TKGSWTFSDQDH
Sbjct  419   TGFAIQALLASNMTEEIGPVLARGHDFIKKSQVKDNPSGDFKSMHRHITKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC LLL  M  +I+GEK + ++LY+AV++ L LQS ++GG   WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLLSMMRPEIVGEKMEPEKLYDAVNILLSLQS-KNGGLPAWEPTG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +L++LNP+E F DIV+E E++E T S I+ALV F+  YP +R KE+   I+ +VQYL
Sbjct  538   APAWLELLNPTEFFEDIVLEHEYVECTSSAINALVLFQKLYPGHRKKEIADFISNSVQYL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q+ DGSWYG WGVCF YG +FAL GL AAGK+Y NC A+     F L  Q Q+GGWG
Sbjct  598   ENVQKPDGSWYGCWGVCFTYGLWFALGGLAAAGKTYSNCAAMRKGVAFLLRTQLQDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP   Y+PLEG  +NLVQT+WAM+GL++ GQAERDPTPLHRAAKLLIN+QMEDGD
Sbjct  658   ESYLSCPKKEYVPLEGNRSNLVQTAWAMMGLIHAGQAERDPTPLHRAAKLLINSQMEDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             +PQQ+ITGV+ KNCMLHY ++R+ +PL AL+EYR+
Sbjct  718   YPQQEITGVFNKNCMLHYPNYRNIYPLWALAEYRR  752



>ref|XP_010531942.1| PREDICTED: beta-amyrin synthase-like [Tarenaya hassleriana]
Length=760

 Score =   950 bits (2455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/759 (57%), Positives = 574/759 (76%), Gaps = 7/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLKIG+G G  PY++S N + GRQ WE+D  +GTPEE+ A E+AR+ F + R +    
Sbjct  1     MWKLKIGKGEGESPYLHSKNGFVGRQTWEFDEESGTPEERAAVEEARRRFYQNRPR-VKA  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ +KE +++ L IPPV++ + E++ +  +T A+R+ V    ALQ+ DGHWPA
Sbjct  60    SSDLLWRMQFLKERKLEQL-IPPVKVGDAEKITHVKLTNALRRGVHFFSALQSDDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL+  LYI+G +D + T+EH+KE++RY+Y HQNEDGGWGL+I+ HSTM  
Sbjct  119   ENAGPLFFLPPLVFCLYITGHLDNVFTAEHRKEVLRYIYCHQNEDGGWGLHIESHSTMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             ++LNY+ +R+LGEGPD G + A  R R+WILDHGG T IPSWGK +LS+LGV+EW GCNP
Sbjct  179   TSLNYICMRILGEGPDGGQENACKRARQWILDHGGVTFIPSWGKTWLSILGVFEWSGCNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ P+  PFHPAKMWCYCR  YMPMSYLY +R+ GPLT +VL LR E++++ YE+
Sbjct  239   MPPEFWILPAFLPFHPAKMWCYCRMVYMPMSYLYGRRFVGPLTPLVLQLRQELYLQPYEK  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYMR  1356
             I+W +AR  C KED YYPH  +QDL+W+ L    EPF+  WPF K+ RE A++  ++++ 
Sbjct  299   INWTKARCLCAKEDTYYPHPLVQDLIWDCLYVFGEPFLTNWPFNKLLREKALKVVMEHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E + YITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ 
Sbjct  359   YEDENSCYITIGCVEKVLCMLACWVEDPNGDCFKKHLARIPDYLWVAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS +  E  + L++ H +IK+SQV++NP GDFK MYRH+++G+WTFSDQ
Sbjct  419   WDTGFAIQALLASNLSNEVSNVLKRGHDFIKKSQVRDNPTGDFKGMYRHISRGAWTFSDQ  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE +KC LLL  M  +++G K D ++LY++V++ L LQS E+GG   WEP
Sbjct  479   DHGWQVSDCTAEGIKCCLLLSMMSPEVVGPKIDPEKLYDSVNILLSLQS-ENGGVTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+E FADIV+E E+ E + S + AL+ F+  YP++R +E+N  I KAV+
Sbjct  538   AGAPKWLELLNPTEFFADIVIEHEYNECSSSAVQALLLFKQLYPDHRTEEINAFIQKAVK  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             Y+E  Q +DGSWYG WGVCF YGT+FAL GL AAGK+Y+NC A+    HF L  Q   GG
Sbjct  598   YIETIQMADGSWYGNWGVCFTYGTWFALGGLEAAGKTYDNCLALRKGVHFLLETQRGNGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RY+PLEG  +NLVQTSWA++GL++ GQAERD  PLHRAAKL+IN+Q+E+
Sbjct  658   WGESYLSCPRKRYVPLEGERSNLVQTSWALMGLLHAGQAERDQVPLHRAAKLIINSQLEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ++TGV+MKNCMLHYAS+R+ FPL ALSEYR+RV
Sbjct  718   GDFPQQEVTGVFMKNCMLHYASYRNIFPLWALSEYRRRV  756



>gb|KHN39383.1| Beta-amyrin synthase [Glycine soja]
Length=773

 Score =   949 bits (2453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/768 (57%), Positives = 571/768 (74%), Gaps = 15/768 (2%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI +GG  PYI+STNN+ GRQ WE+DP AG+PEE+   E AR+ F   R K    C
Sbjct  1     MWRLKIADGGNDPYIFSTNNFVGRQTWEFDPEAGSPEERAQVEAARQHFYHNRFK-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  R Q+++E+     +IP V + + EE+ Y+ +T+AVR+      ALQ  DGHWPA+
Sbjct  60    ADLLWRFQVLRENNFKQ-TIPRVTIEDGEEITYQKVTSAVRRGAHHLAALQTSDGHWPAQ  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPLFF PPL+  +YI+G+++ +   EH+KE++RY Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFLPPLVFCMYITGNLESVFPEEHRKEILRYTYYHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             ALNY+ +R+LGEGP+ G D A AR RKWI DHGG T IPSWGK +LS+LGV++W G NP+
Sbjct  179   ALNYICMRMLGEGPNGGHDNACARARKWIRDHGGVTHIPSWGKTWLSILGVFDWCGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+  + YE++
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKV  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W +AR  C KEDLYYPH  IQDL+W++L   TEP + RWPF K IRE A++  +K++ Y
Sbjct  299   NWKKARHQCAKEDLYYPHPLIQDLIWDSLYIFTEPLLTRWPFNKLIREKALQVTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLARVPDYLW++EDGM+M  FGSQ W
Sbjct  359   EDETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMTMQSFGSQEW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA FA QA++A+ ++EE G    K H +IK+SQVK+NP GDFKSM+RH++KGSWTFSDQD
Sbjct  419   DAGFAVQALLATNIIEEIGPTFAKGHDFIKKSQVKDNPFGDFKSMHRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSP----------E  843
             HGW VSDCTAE LKC LLL  +P +I+GEK + +RLY++V+V L LQ+           +
Sbjct  479   HGWQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQASTIKFRETIYSK  538

Query  842   SGGFATWEPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEV  663
              GG A WEP   Q +L++LNP+E FADIVVE E++E TGS I ALV F+  YP +R KE+
Sbjct  539   KGGLAAWEPAGAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEI  598

Query  662   NISIAKAVQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFF  483
                I  AV++LE  Q +DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+  A  F 
Sbjct  599   ENFITNAVRFLEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTYTNCAAIRKAVKFL  658

Query  482   LSKQNQEGGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAK  303
             L+ Q ++GGWGE   S P   Y+PLEG+ +N+V T+WA++GL++ GQA+RDP PLHRAAK
Sbjct  659   LTTQREDGGWGESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQADRDPMPLHRAAK  718

Query  302   LLINAQMEDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             LLIN+Q+E+GD+PQQ+ITGV+MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  719   LLINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  766



>gb|ACV21067.1| beta-amyrin synthase [Glycyrrhiza uralensis]
Length=762

 Score =   949 bits (2453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/759 (58%), Positives = 571/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LKI EGG  PYIYSTNN+ GRQ WEYDP+ G+ EE+   + AR  F   R Q  P  
Sbjct  1     MWRLKIAEGGKDPYIYSTNNFVGRQTWEYDPDGGSAEERAQVDAARLHFYNNRFQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             CGDL  R Q+++E+     +I  V++ + EE+ YE  TTAVR+A     ALQ  DGHWPA
Sbjct  59    CGDLLWRFQILRENNFKQ-TIASVKIGDGEEITYEKATTAVRRAAHHLSALQTSDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             + +GPLFF PPL+  +YI+G +D +   E++KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   QIAGPLFFLPPLVFCMYITGHLDSVFPEEYRKEILRYIYYHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ +R+LGEGPD G D A AR RKWI DHGG T IPSWGK +LS+LGV++  G NP
Sbjct  178   TALNYICMRILGEGPDGGQDNACARARKWIHDHGGVTHIPSWGKTWLSILGVFDRCGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+  + YE+
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTEPYEK  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             ++W +AR  C KEDLYYPH  +QDL+W++L   TEP + RWPF K +RE A++  +K++ 
Sbjct  298   VNWKKARHQCAKEDLYYPHPLLQDLIWDSLCLFTEPLLTRWPFNKLVREKALQVTMKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDPNGD  K HLARVPDYLW++EDGM+M  FGSQ 
Sbjct  358   YEDETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMTMQSFGSQE  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WDA FA QA++A+ +VEE    L K H +IK+SQV++NP GDFKSMYRHV+KGSWTFSDQ
Sbjct  418   WDAGFAVQALLATNLVEEIAPTLAKGHDFIKKSQVRDNPSGDFKSMYRHVSKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LLL  +P +I+GEK + +RLY++V+V L LQS + GG + WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQS-KKGGLSAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP+E FADIVVE E++E TGS I ALV F+  YP +R KE+   IA AV+
Sbjct  537   AGAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFIANAVR  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             +LE  Q +DGSWYG WGVCF YG++FAL GL AAGK++ NC A+  A  F L+ Q ++GG
Sbjct  597   FLEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTFANCAAIRKAVKFLLTTQREDGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   S P   Y+PLEG+ +N+V T+WA++GL++ GQAERDP PLHRAAKL+IN+Q+E+
Sbjct  657   WGESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQAERDPAPLHRAAKLIINSQLEE  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GD+PQQ+ITGV+MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  717   GDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  755



>ref|XP_007214978.1| hypothetical protein PRUPE_ppa001812mg [Prunus persica]
 gb|EMJ16177.1| hypothetical protein PRUPE_ppa001812mg [Prunus persica]
Length=761

 Score =   949 bits (2452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/758 (59%), Positives = 570/758 (75%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLK+ +GG  PYIYSTNN+ GRQI+E+DP AGTPEE+   E+AR  F   R +     
Sbjct  1     MWKLKVADGGNDPYIYSTNNFVGRQIFEFDPEAGTPEERAEVEEARLNFYNNRHQ-VKPS  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ +KE+     +IPPV++ + EE+ YE  T ++R++V    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLKENNFKQ-TIPPVKVEDGEEITYEKATASLRRSVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFF PPL++  YI+G ++ +  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCTYITGHLNTVFPAEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEGPD G D A AR RKWILDHG  T +PSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGPDGGQDNACARVRKWILDHGSVTHMPSWGKTWLSILGVFEWSGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y +I
Sbjct  239   PPEFWVLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYNEI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W   R  C KED+YYPH +IQD++W++L  CTEP + RWPF K +RE A++  +K++ Y
Sbjct  299   NWKGVRHHCAKEDIYYPHPWIQDIMWDSLYICTEPLLTRWPFNKLVREKALQVTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  WAEDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQEW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D  FA QA++AS + +E G  L + H +IK+SQVK+NP GDFKSMYRH++KGSWTFSDQD
Sbjct  419   DTGFAIQALLASNLTDEIGPTLARGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LL   M   I+GEK + +RLY++++V L LQS ++GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLFSMMRPDIVGEKMEPERLYDSINVLLSLQS-KNGGLAAWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP+E FADIVVE E++E T S I ALV F+  YP +R KE++  I  A QY
Sbjct  538   GAADWLEMLNPTEFFADIVVEHEYVECTSSAIQALVLFKKLYPGHRKKEIDHFITNATQY  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q  DGSWYG WGVCF YG++FAL GL AAGK++ NC A+    +F L  Q + GGW
Sbjct  598   LESIQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTFINCLAMRKGVNFLLKTQRENGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP   Y+PLEG  +NLV T WAM+GL++ GQA+RDP PLHRAAKL+IN+QME+G
Sbjct  658   GESYLSCPKKEYVPLEGNRSNLVHTGWAMMGLIHAGQADRDPAPLHRAAKLIINSQMENG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYRK V
Sbjct  718   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKWV  755



>ref|XP_003531781.1| PREDICTED: beta-amyrin synthase-like isoform 1 [Glycine max]
Length=762

 Score =   949 bits (2452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/758 (58%), Positives = 568/758 (75%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EGG   YI+STNN+ GRQ WE+DP AGTPEE+   E ARK F   R K    C
Sbjct  1     MWRLKIAEGGNEAYIFSTNNFVGRQTWEFDPEAGTPEERAQVEAARKDFYHHRFK-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  R Q+++E+     +IP V++ + EE+ Y+ +T+ VR+      ALQ  DGHWPA+
Sbjct  60    ADLLWRFQILRENNFKQ-TIPSVKIEDGEEITYQKVTSTVRRGAHHLAALQTSDGHWPAQ  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPLFF PPL+  +YI+G ++ +   EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFLPPLVFCMYITGHLESVFPEEHRKEILRYIYYHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDGD-GAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             ALNY+ +R+LGEGP+ G   A AR R WI DHGG T IPSWGK +LS+LGV++W G NP+
Sbjct  179   ALNYICMRILGEGPNGGHYNACARARNWIRDHGGVTHIPSWGKTWLSILGVFDWCGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+  + YE++
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKV  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W +AR    KEDLYYPH  +QDL+W++L   TEP + RWPF K IRE A++  +K++ Y
Sbjct  299   NWKKARHQYAKEDLYYPHPLVQDLIWDSLYIFTEPLLTRWPFNKLIREKALQVTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW++EDGM+M  FGSQ W
Sbjct  359   EDETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARIPDYLWVSEDGMTMQSFGSQEW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA FA QA +A+ ++EE G  L K H +IK+SQVK+NP GDFKSMYRH++KGSWTFSDQD
Sbjct  419   DAGFAVQAFLATNLIEEIGPTLAKGHDFIKKSQVKDNPLGDFKSMYRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE+LKC LLL  +P +I+GEK + +RLY++V+V L LQS + GG A WE  
Sbjct  479   HGWQVSDCTAESLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQS-KKGGLAAWELA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L++LNP+E FADIVVE E++E TGS I ALV F+  YP +R KE+   IA AV++
Sbjct  538   GAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKNLYPGHRKKEIENFIANAVRF  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q +DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+  A  F LS Q ++GGW
Sbjct  598   LEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTYINCAAIRKAVKFLLSTQREDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   S P   Y+PLEG+ +N+V T+WA++GL++ GQA+RDP PLHRAAKLLIN+Q+E+G
Sbjct  658   GESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQADRDPKPLHRAAKLLINSQLEEG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             D+PQQ+ITGV+MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  718   DWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  755



>sp|A8CDT2.1|BAS_BRUGY RecName: Full=Beta-amyrin synthase; Short=BgbAS [Bruguiera gymnorhiza]
 dbj|BAF80443.1| beta amyrin synthase [Bruguiera gymnorhiza]
Length=759

 Score =   949 bits (2452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/759 (59%), Positives = 569/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW++KI EGG  PY+YSTNNY GRQ WE+DP+AGTPEE+   E+AR+ F K R Q  P  
Sbjct  1     MWRIKIAEGGKDPYLYSTNNYVGRQTWEFDPDAGTPEERAEVEEARQNFYKNRYQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             CGDL  R+Q + E   +  +IP VR+ E E + YE  T A+R+ V+   ALQA DGHWPA
Sbjct  59    CGDLLWRLQFLGEKNFEQ-TIPQVRIEEGEGITYEKATRALRRTVQFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +GPLFF PPL++ +YI+G +D +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   EIAGPLFFLPPLVMCVYITGHLDAVFPAEHRKEILRYIYYHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ +R++GEGP+ G D A AR RKWI DHG  T IPSWGK +LS+LGVY+W G NP
Sbjct  178   TALNYICMRIIGEGPNGGQDDACARARKWIHDHGSVTNIPSWGKTWLSILGVYDWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++  LR E+  + Y+Q
Sbjct  238   MPPEFWMLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLIQQLREELFTQPYDQ  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYMR  1356
             I+W + R  C  EDLYYPH F+QDL+W+ L   TEP + RWP  +I R+ A+   +K++ 
Sbjct  298   INWKKTRHQCAPEDLYYPHPFVQDLIWDCLYIFTEPLLTRWPLNEIIRKKALEVTMKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDY+W+AEDGM M  FGSQ 
Sbjct  358   YEDESSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGMKMQSFGSQE  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++A+ + +E GD LR+ H +IK+SQV++NP GDFKSMYRH++KGSWTFSDQ
Sbjct  418   WDTGFAIQALLATNLTDEIGDVLRRGHDFIKKSQVRDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LL   MP +I+GE    +RLY++V+V L LQS ++GG + WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLFSMMPPEIVGEHMVPERLYDSVNVLLSLQS-KNGGLSAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP+E FADIV+E E++E T S I ALV F+  YP +R KE++  I  AV+
Sbjct  537   AGAQEWLELLNPTEFFADIVIEHEYVECTSSAIHALVLFKKLYPGHRKKEIDNFIVNAVR  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q SDG WYG WGVCF YGT+FAL GL AAGK+Y NC A+  A  F L  Q   GG
Sbjct  597   YLESIQTSDGGWYGNWGVCFTYGTWFALGGLAAAGKTYNNCLAMRKAVDFLLRIQRDNGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RY+PLEG  +NLV T+WA++ L++ GQ +RDPTPLHRAA+L+IN+Q+ED
Sbjct  657   WGESYLSCPEKRYVPLEGNRSNLVHTAWALMALIHAGQMDRDPTPLHRAARLMINSQLED  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYR+RV
Sbjct  717   GDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRRRV  755



>ref|XP_011085901.1| PREDICTED: beta-amyrin synthase-like [Sesamum indicum]
Length=763

 Score =   948 bits (2451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/758 (59%), Positives = 559/758 (74%), Gaps = 7/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LKI EG   PY+YSTNNY GRQIWE+DPN GTP+ ++  EKAR+ F   R Q  P +
Sbjct  1     MWRLKIAEGVDSPYLYSTNNYVGRQIWEFDPNYGTPQLRQEVEKARQDFWANRYQVKPSS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  R+Q + E+     +IP V++ + E+V YE  TT +R+AV    ALQA DGHWPA
Sbjct  61    --DLLWRLQFLHENNFKQ-TIPQVKVGDGEDVTYEMATTTLRRAVHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++ LYI+G ++ +  +EH+  ++R  Y HQNEDGGWG +I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMILYITGHLNTVFPAEHRYTVIRCTYTHQNEDGGWGFHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +AL+Y+ +R+LGEGPD G + A  R RKWILDHG  T IPSWGK +LS+LGV++W G NP
Sbjct  178   TALSYICMRILGEGPDGGENNACTRARKWILDHGTVTAIPSWGKTWLSILGVFDWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFWL PS  P HPAKM CYCR  YMPMSYLY KR+ GP+T ++L LR E++ + YEQ
Sbjct  238   MPPEFWLLPSFLPMHPAKMMCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYDQPYEQ  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I+W   R  C KEDLYYPH  IQDL+W++    TEP + RWPF K+RE A++  +K++ Y
Sbjct  298   INWRSVRHRCAKEDLYYPHPLIQDLIWDSCYVLTEPLLTRWPFNKLREKALQVTMKHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDY+W+AEDGM M  FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGMKMQSFGSQEW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D +FA QA++AS + +E G+ LR  H +IK+SQVK++P GDF+SMYRH++KGSWTFSDQD
Sbjct  418   DTSFAIQALLASNLTDEIGETLRLGHDFIKKSQVKDDPSGDFRSMYRHISKGSWTFSDQD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LL   MP  I+GEK + +  Y AV++ L LQ  ++GG A WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSMMPPDIVGEKMEPEGFYNAVNILLSLQR-KNGGLAVWEPA  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP+E F DIVVE E++E T S I ALV F+  YP +  KE+   IAKAV Y
Sbjct  537   GASDWLELLNPTEFFVDIVVEHEYVECTSSAIQALVLFKQLYPEHWKKEIESFIAKAVGY  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q  DGSWYG WGVCF YGT+FAL GL AAGKSY NC AV  A  F L  Q   GGW
Sbjct  597   LEDVQRPDGSWYGNWGVCFTYGTWFALGGLAAAGKSYNNCAAVRKAVDFLLKAQRDNGGW  656

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP   Y+PLE   +NLV T+WAM+GL+++GQA+RDPTPLHR AKLLIN+Q+EDG
Sbjct  657   GESYLSCPKKVYVPLEDNRSNLVHTAWAMMGLIHSGQADRDPTPLHRGAKLLINSQLEDG  716

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  717   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKRV  754



>gb|AIS39794.1| mixed amyrin synthase 2 [Ilex asprella var. asprella]
Length=761

 Score =   948 bits (2450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/758 (59%), Positives = 566/758 (75%), Gaps = 7/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LKI EGG  PY+YSTNNY GRQIWE+DP+ GTPEE+   E+AR  F   R Q  P  
Sbjct  1     MWRLKIAEGGNDPYLYSTNNYVGRQIWEFDPDYGTPEERAEVEEARLQFWNNRYQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             CGDL  RMQ ++E      +IP V++ + EE+ YE  TT +R+AV    ALQA DGHWPA
Sbjct  59    CGDLLWRMQFLREKNFKQ-TIPQVKVEDGEEITYETATTTLRRAVHFFAALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +GPL+F PPL++ LYI+G  + +  +E++KE++RYLY HQNEDGGWG +I+GHS M  
Sbjct  118   EIAGPLYFLPPLVMCLYITGHFNTVFPAEYRKEILRYLYCHQNEDGGWGFHIEGHSIMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + L+Y+ +R+LGEGP  G + A AR RKWILDHG  T IPSWGK +LS+ GV+EW G NP
Sbjct  178   TTLSYICMRILGEGPHGGKNNACARARKWILDHGSVTAIPSWGKTWLSIFGVFEWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PE+W  P+  P HPA MWCYCR  Y+PMSYLY KR+ GP+T +VL LR E++ + Y +
Sbjct  238   MPPEYWSLPTFLPIHPANMWCYCRLIYLPMSYLYGKRFVGPITPLVLQLREELYDQPYHE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I W++ R  CCKEDLYYPH  IQDLLW+ L  CTEP + RWPF K+RE +++ A+K++ Y
Sbjct  298   IKWSKVRHLCCKEDLYYPHPLIQDLLWDGLYICTEPLLTRWPFNKLREKSLQTAMKHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLARVPDY+W+AEDG+ M  FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARVPDYIWVAEDGIKMQSFGSQEW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D  FA QA++ASG+  +    L K H ++K+SQVK+NP GDFKSMYRH++KGSWTFSDQD
Sbjct  418   DTVFALQALLASGLTNDIEPTLSKGHDFVKQSQVKDNPSGDFKSMYRHISKGSWTFSDQD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LL   MP +I+GEK + QRLY++V++ L LQS ++GG A WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSLMPQEIVGEKMEPQRLYDSVNILLSLQS-KNGGLAAWEPI  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 ++++LNP+E FADIV+E E++E T S I +LV F   YP +R KE+   I  AV++
Sbjct  537   RAYDWMELLNPTEFFADIVIEHEYVECTSSAIQSLVLFNKLYPGHRTKEIESFITNAVRF  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q SDGSWYG WGVCF YGT+FAL GL AAGK+Y NC +V  A  F L  Q  +GGW
Sbjct  597   LEDVQMSDGSWYGNWGVCFTYGTWFALGGLEAAGKTYNNCLSVRKAVDFLLKSQRDDGGW  656

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP+ ++ PLEG  +NLV T WAM+GL+++GQAERDPTPLHRAAKLLIN+QME+G
Sbjct  657   GESYVSCPNKKFTPLEGNRSNLVHTGWAMMGLIHSGQAERDPTPLHRAAKLLINSQMENG  716

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITGV+ KNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  717   DFPQQEITGVFNKNCMLHYAAYRNIYPLWALAEYRKRV  754



>gb|AIE17466.1| oxidosqualene cyclase [Centella asiatica]
Length=764

 Score =   947 bits (2449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/761 (58%), Positives = 564/761 (74%), Gaps = 10/761 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG----PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKG  2259
             MW+LKI EGG      Y+YSTNN+ GRQ WE+DPN G+ EE+   E+AR  F   R Q  
Sbjct  1     MWRLKIAEGGNGEHDQYLYSTNNFVGRQTWEFDPNHGSLEERAEVEQARLHFWNNRYQIK  60

Query  2258  PHTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGH  2079
             P   GDL  RMQ ++E      +IP V++ + EE+ YE  TT +R+ V    ALQA DGH
Sbjct  61    P--SGDLLWRMQFLQEKNFKQ-TIPQVKVEDGEEITYETATTTLRRGVHFFAALQADDGH  117

Query  2078  WPAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHST  1899
             WPAEN+GPLFF PPL++ LYI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHST
Sbjct  118   WPAENAGPLFFLPPLVMCLYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHST  177

Query  1898  MIGSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDG  1722
             M  +AL+Y+ +R+LG+G D G + A AR RKWILDHG  T IPSWGK +LS+LG+++W G
Sbjct  178   MFCTALSYICMRILGQGRDGGQENACARARKWILDHGTVTAIPSWGKTWLSILGLFDWSG  237

Query  1721  CNPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKS  1542
              NP+ PEFW+ P   P HPAKMWCYCRT YMPMSYLY KR+ GP+T ++L LR E++ + 
Sbjct  238   SNPMPPEFWILPRFLPMHPAKMWCYCRTVYMPMSYLYGKRFVGPITPLILQLREELYDQP  297

Query  1541  YEQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKY  1362
             Y+QI+W +AR  C KEDLYYPH  ++DL+W++L   TEPF+ RWP  K+RE A++  +K+
Sbjct  298   YDQINWRKARHNCAKEDLYYPHPLLRDLMWDSLYIFTEPFLNRWPLNKLREKALQTTMKH  357

Query  1361  MRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGS  1182
             + YE E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGS
Sbjct  358   IHYEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGS  417

Query  1181  QNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFS  1002
             Q WD  FA QA++AS + +E    L K H +IK SQV ENP GDFKSM+RH++KGSWTFS
Sbjct  418   QEWDTGFAIQALLASDLTDEIRPVLMKGHDFIKNSQVTENPSGDFKSMHRHISKGSWTFS  477

Query  1001  DQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATW  822
             DQDHGW VSDCTAE LKC LL   MP +I+G K + + L++AV+V L LQS ++GG A W
Sbjct  478   DQDHGWQVSDCTAEALKCCLLFSRMPSEIVGNKMEDRWLFDAVNVLLSLQS-KNGGLAAW  536

Query  821   EPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKA  642
             EP     +L++LNP+E FADIV+E E++E T S I A+V F   YP +R KE  ++I+ A
Sbjct  537   EPAGSSEWLELLNPTEFFADIVIEHEYVECTSSAIQAMVMFMKLYPGHRKKETEMTISSA  596

Query  641   VQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQE  462
             VQYLE  Q  DGSWYG WGVCF YGT+FAL GLTAAGK+Y NC ++  A  F L  Q   
Sbjct  597   VQYLENVQMPDGSWYGNWGVCFTYGTWFALGGLTAAGKTYSNCHSIRKAVDFLLRSQCSN  656

Query  461   GGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQM  282
             GGWGE   SCP+  Y PLEG  +NLV T+WAM+GL+++GQA R+PTPLHRAAKLLIN+Q+
Sbjct  657   GGWGESYLSCPNKEYTPLEGNRSNLVHTAWAMMGLIHSGQAYRNPTPLHRAAKLLINSQL  716

Query  281   EDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             + GDFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYRK V
Sbjct  717   DSGDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKHV  757



>ref|XP_010027785.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW83384.1| hypothetical protein EUGRSUZ_B00318 [Eucalyptus grandis]
Length=761

 Score =   947 bits (2449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/757 (58%), Positives = 555/757 (73%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EG  GPY+YSTNNY GRQ WE+DP AGT EE    E AR+ F   R +    C
Sbjct  1     MWRLKIAEGEDGPYLYSTNNYVGRQTWEFDPEAGTTEEHAEVEAARQHFYDHRHQ-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ ++E +    +IPPVR+ + EE+ Y+  +TA+R+ V    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREQQFKQ-TIPPVRVEDGEEITYDKASTALRRTVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPL+F PPL++ +YI+G ++ +  +EH+KE++RYLYNHQNEDGGWG +I+GHSTM  +
Sbjct  119   IAGPLYFLPPLVMCVYITGHLNTVFPAEHRKEILRYLYNHQNEDGGWGFHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDGD-GAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEGPD G   A  R RKWILD GG T IPSWGK +LS+ G+++W G NP+
Sbjct  179   ALSYICMRILGEGPDGGQYNACTRARKWILDRGGVTYIPSWGKTWLSIFGLFDWSGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYL  KR+ GP+T  V  LR E+H + Y+ I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLCGKRFVGPITPFVQQLREELHTQPYDMI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
              W + R  C KEDLYYPH  +QDL+W++L    EP +  WPF ++RE A++  +K++ YE
Sbjct  299   CWRKVRHLCAKEDLYYPHPLVQDLIWDSLYIFIEPLLNHWPFNRLREKALQVTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDP  D  K HLAR+PDYLW+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPESDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
               FA QA++AS M EE G  L + H +IK+SQVK+NP GDFKSM+RH+TKGSWTFSDQDH
Sbjct  419   TGFAIQALLASNMTEEIGPVLARGHDFIKKSQVKDNPSGDFKSMHRHITKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC LL   MP +I+GEK   +RLY+AV++ L LQS ++GG   WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLFSMMPPEIVGEKMKPERLYDAVNILLSLQS-KNGGLPAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +L++LNP+E F DIV+E E++E T S I ALV FR  YP +R KE+   I+ +V+YL
Sbjct  538   APAWLELLNPTEFFEDIVIEHEYVECTSSAIQALVLFRKLYPEHREKEIEDFISNSVEYL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+     F L  Q Q+GGWG
Sbjct  598   ENVQLPDGSWYGCWGVCFTYGSWFALGGLAAAGKTYSNCAAMRKGVAFLLRTQLQDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP   Y+PLEG  +NLVQT+WAM+GL+  GQAERDPTPLHRAAKLLIN+QMEDGD
Sbjct  658   ESYLSCPKKEYVPLEGNRSNLVQTAWAMMGLIQAGQAERDPTPLHRAAKLLINSQMEDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             +PQQ++TGV+ KNCMLHY ++R+ +PL AL+EYR RV
Sbjct  718   YPQQELTGVFNKNCMLHYPNYRNTYPLWALAEYRTRV  754



>gb|AHI17180.1| beta-amyrin synthase, partial [Glycine max]
Length=762

 Score =   947 bits (2448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/759 (58%), Positives = 568/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LKI EGG  PYIYSTNN+ GRQ WEYDP  G+ EE+   + AR  F   R Q  P  
Sbjct  1     MWRLKIAEGGKDPYIYSTNNFVGRQTWEYDPGGGSAEERAQVDAARLHFYNNRFQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             CGDL  R Q+++E+     +I  V++ + EE+ YE  TTAVR+A     ALQ  DGHWPA
Sbjct  59    CGDLLWRFQILRENNFKQ-TIASVKIGDGEEITYEKATTAVRRAAHHLSALQTSDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             + +GPLFF PPL+  +YI+G +D +   E++KE++RY+Y HQN DGGWGL+I+GHSTM  
Sbjct  118   QIAGPLFFLPPLVFCMYITGHLDSVFPEEYRKEILRYIYYHQNMDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ +R+LGEGP+ G D A AR RKWI DHGG T IPSWGK +LS+LGV++W G NP
Sbjct  178   TALNYICMRMLGEGPNGGHDNACARARKWIRDHGGVTHIPSWGKTWLSILGVFDWCGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+  + YE+
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEK  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             ++W +AR  C KEDLYYPH  IQDL+W++L   TEP + RWPF K IRE A++  +K++ 
Sbjct  298   VNWKKARHQCAKEDLYYPHPLIQDLIWDSLYIFTEPLLTRWPFNKLIREKALQVTMKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDPNGD  K HLARVPDYLW++EDGM+M  FGSQ 
Sbjct  358   YEDETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMTMQSFGSQE  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WDA FA QA++A+ ++EE G    K H +IK+SQVK+NP GDFKSM+RH++KGSWTFSDQ
Sbjct  418   WDAGFAVQALLATNIIEEIGPTFAKGHDFIKKSQVKDNPFGDFKSMHRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LLL  +P +I+GEK + +RLY++V+V L LQS + GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQS-KKGGLAAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP+E FAD VVE E++E TGS I ALV F+  YP +R KE+   I  AV+
Sbjct  537   AGAQEWLELLNPTEFFADTVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFITNAVR  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             +LE  Q +DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+  A  F L+ Q ++GG
Sbjct  597   FLEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTYTNCAAIRKAVKFLLTTQREDGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   S P   Y+PLEG+ +N+V T+WA++GL++ GQA+RDP PLHRAAKLLIN+Q+E+
Sbjct  657   WGESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQADRDPMPLHRAAKLLINSQLEE  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GD+PQQ+ITGV+MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  717   GDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  755



>gb|ACH88048.1| beta-amyrin synthase [Nigella sativa]
 gb|ACH88049.1| beta-amyrin synthase [Nigella sativa]
Length=761

 Score =   946 bits (2446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/759 (58%), Positives = 564/759 (74%), Gaps = 7/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGP---YIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2253
             MWKLKI +  GP   Y+YSTNNY GRQ WE+DP+AGTPEE+   EKAR+ F K R     
Sbjct  1     MWKLKIADATGPFSEYLYSTNNYIGRQTWEFDPDAGTPEERAEVEKARQDFHKNRFD-IK  59

Query  2252  TCGDLFMRMQMIKESEVDV-LSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2076
              CGD+ +R+QM+KE++    LSIPPV+L E +  +YE +TT +R+AVR   A+Q  DGHW
Sbjct  60    PCGDVLLRLQMLKENKDRFDLSIPPVKLSENQIASYEDVTTTLRRAVRFVSAMQTSDGHW  119

Query  2075  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  1896
              A+  GPL+F PPL+ ALYI+G++D I + EHKKE++RY+Y HQNEDGGWG +I+GHSTM
Sbjct  120   AADIGGPLYFMPPLVFALYITGTLDTIFSPEHKKEILRYMYVHQNEDGGWGFHIEGHSTM  179

Query  1895  IGSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGC  1719
              G+ LNY+ +R+LGEGPD G D A ARGRKWI DHGG T IPSWGK +LS+LG+YEW GC
Sbjct  180   FGTTLNYICMRMLGEGPDGGEDNACARGRKWIRDHGGVTWIPSWGKTWLSILGLYEWSGC  239

Query  1718  NPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSY  1539
             NP+ PEFW+ PS  PFHPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+H++ Y
Sbjct  240   NPMPPEFWVLPSFLPFHPAKMWCYCRLVYMPMSYLYGKRFVGPITGLILTLREELHLQPY  299

Query  1538  EQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYM  1359
             ++I W ++R AC KEDLYYPH  +Q+LLW+ L    E  + RWP  K+R+ A++  +K++
Sbjct  300   DEIRWFKSRNACAKEDLYYPHPLVQNLLWDTLNVFGETVLTRWPMSKLRDKALQVTMKHI  359

Query  1358  RYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQ  1179
              YE E +RYITIGC+EKSL M+  W EDP+ D  K HLARV DYLW+AEDGM M  FGSQ
Sbjct  360   HYEDENSRYITIGCVEKSLCMLACWVEDPDSDAFKKHLARVQDYLWVAEDGMRMQSFGSQ  419

Query  1178  NWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSD  999
             NWD  FA   ++AS + +E  D L K H Y+K+SQVK+NP GDF+SM+RH++KGSWTFSD
Sbjct  420   NWDTGFALHGLLASNLHDEIWDTLNKGHDYVKQSQVKDNPSGDFRSMHRHLSKGSWTFSD  479

Query  998   QDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWE  819
             QDHGW VSDCT E L   LL+ ++  + +G K + + LY++V++ L LQS ++GG A WE
Sbjct  480   QDHGWQVSDCTGEGLMVCLLMSQLSPEYVGPKMEPEGLYDSVNILLSLQS-KNGGLAAWE  538

Query  818   PPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAV  639
             P     +L+V+NP+E F DIV+E E++E T S I+AL  F+  YP +R KE+   IAKAV
Sbjct  539   PVSAPEWLEVINPTEFFQDIVIEHEYVECTASGIAALELFKKLYPGHRKKEIESFIAKAV  598

Query  638   QYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEG  459
              +LE+ Q  DGSWYG WG+CF+YGT+FAL GL A G +  N   V  A  F LS Q + G
Sbjct  599   HFLEETQMPDGSWYGNWGICFIYGTWFALRGLAAVGNNCNNSPTVRKACDFLLSTQLESG  658

Query  458   GWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQME  279
             GWGE  +SCP  ++IPLE   TNLV T+WA++GL+  GQA+RDPTPLHRA K+LIN QME
Sbjct  659   GWGESYKSCPEKKFIPLEDKRTNLVHTAWALMGLINGGQAQRDPTPLHRAVKVLINGQME  718

Query  278   DGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKR  162
             +GDFPQQ+ITGV+MKNCMLHYA+ R+ FPL AL EYR++
Sbjct  719   NGDFPQQEITGVFMKNCMLHYAAFRNMFPLWALGEYRRK  757



>sp|A8C980.1|GERS_RHISY RecName: Full=Germanicol synthase; Short=RsM1 [Rhizophora stylosa]
 dbj|BAF80441.1| multifunctional triterpene synthase [Rhizophora stylosa]
Length=759

 Score =   945 bits (2443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/759 (58%), Positives = 566/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LKI EGG  PY+YSTNNY GRQIWE+DP+AGTPEE+   E+AR+ F K R Q  P  
Sbjct  1     MWRLKIAEGGNDPYLYSTNNYVGRQIWEFDPDAGTPEERAKAEEARQNFYKNRYQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GDL  R+Q ++E      +IP VR+ E EE+  E  TTA+R+AV+   ALQA DGHWPA
Sbjct  59    SGDLLWRLQFLREKNFKQ-TIPQVRIEEGEEITREKATTALRRAVQFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++ + I+G +D +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCMCITGHLDTVFPAEHRKEILRYIYYHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ +R+LGEGP+ G D A  R RKWI DHG  T IPSWGK +LS+LGVY+W GCNP
Sbjct  178   TALNYICMRILGEGPNGGQDDACTRARKWIHDHGSVTNIPSWGKTWLSILGVYDWSGCNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ G +T ++  LR E+  + Y+Q
Sbjct  238   MPPEFWMLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGLITPLIQQLREELFTQPYDQ  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYMR  1356
             I+W +    C  EDLYYPH FIQDL+W+ L    EP + RWP   I R+ A+   +K++ 
Sbjct  298   INWKKNCHQCAPEDLYYPHPFIQDLIWDCLYISMEPLLTRWPLNMIIRKKALELTMKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE   +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDY+W+AEDGM M  FGSQ 
Sbjct  358   YEDGSSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGMKMQSFGSQQ  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++A+ + +E G  LR+ H +IK+SQV++NP GDFKSMYRH++KGSWTFSDQ
Sbjct  418   WDTGFAIQALLATNLTDEIGGVLRRGHDFIKKSQVQDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LL   MP +I+GE  + +RLY++V+V L LQS ++GG + WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLFSMMPPEIVGEHMEPERLYDSVNVLLSLQS-KNGGLSAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP+E FADIV+E E++E T S I ALV F+  YP +R KE+   IAK+V+
Sbjct  537   AGAQDWLELLNPTEFFADIVIEHEYVERTSSAIHALVLFKKLYPGHRKKEIEDFIAKSVR  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             +LE  Q SDG+WYG WGVCF YGT+FAL GL AAGK+Y +C A+  A  F L  Q  +GG
Sbjct  597   FLESIQTSDGTWYGNWGVCFTYGTWFALGGLAAAGKTYNSCLAMRKAVDFLLRIQKDDGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  +Y+PLE   +NLV T+WAM+ L++ GQ +RDPTPLHRAAKL+IN+Q+ED
Sbjct  657   WGESYLSCPEKKYVPLEANHSNLVHTAWAMMALVHAGQMDRDPTPLHRAAKLMINSQLED  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITGV+ +NCMLHYA++R+ +PL AL+EY +RV
Sbjct  717   GDFPQQEITGVFNRNCMLHYAAYRNIYPLWALAEYCRRV  755



>ref|XP_009369010.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=761

 Score =   945 bits (2442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/759 (59%), Positives = 572/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MWKLK+ +GG  PYIYSTNN+ GRQI+E+DP AGT EE+   E+AR  F   R Q  P  
Sbjct  1     MWKLKVADGGNDPYIYSTNNFVGRQIFEFDPEAGTTEERAEVEEARLHFYNNRYQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GDL  RMQ ++E      + PP+++ + EE+ +E  TT++R++V    ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLREKNFKQTN-PPIKVEDGEEITHEKATTSLRRSVHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++ ++I+  ++ I  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCVHITEHLNTIFHAEHRKEILRYIYCHQNQDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +AL+Y+ +R+LGEGPD G D A AR RKWILDHG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TALSYICMRILGEGPDGGQDNACARARKWILDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y++
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W   R  C KED+YYPH +IQD LW++L  CTEP + RWPF K IR+ A+   ++++ 
Sbjct  298   INWKGVRHHCAKEDIYYPHPWIQDFLWDSLYICTEPLLTRWPFNKLIRKRALEVTMEHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  WAEDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQ  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS + +E    L + H ++K SQVK+NP GDFKSM+RH++KGSWTFSDQ
Sbjct  418   WDTGFAIQALLASNLTDEIAPTLARGHDFVKNSQVKDNPSGDFKSMHRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LLL  MP +++GEK + +RLY+AV+V + LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMMPPELVGEKMEPERLYDAVNVLITLQS-KNGGLAAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+E FADIVVE E++E T S I ALV F+  YP +R KE++  I  A Q
Sbjct  537   AGAAEWLEMLNPTEFFADIVVEHEYVECTSSAIQALVLFKKLYPGHRNKEIDQFITNAAQ  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q  DGSWYG WGVCF YGT+FAL GLTAAGK++ NC  +  A +F L+ Q + GG
Sbjct  597   YLENIQMEDGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCAVIRKAINFLLTIQKENGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP   Y+PLEG  +NLV T+WAM+GL+Y GQAERDP PLHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIYAGQAERDPAPLHRAAKLIINSQMEN  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYRK V
Sbjct  717   GDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKWV  755



>ref|XP_007214977.1| hypothetical protein PRUPE_ppa001810mg [Prunus persica]
 gb|EMJ16176.1| hypothetical protein PRUPE_ppa001810mg [Prunus persica]
Length=761

 Score =   945 bits (2442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/759 (59%), Positives = 570/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MWKLK+ +GG  PYIYSTN++ GRQI+E+DP AGTPEE+   E+AR  F   R Q  P  
Sbjct  1     MWKLKVADGGNDPYIYSTNDFVGRQIFEFDPEAGTPEERAEVEEARLNFYNNRYQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GDL  RMQ +KE+     +IPPV++ + EE+ YE  T ++R++V    ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLKENNFKQ-TIPPVKVEDGEEITYEKATASLRRSVHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++  YI+G ++ +  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCTYITGHLNTVFPAEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +AL+Y+ +R+LGEGPD G + A AR RKWILDHG  T +PSWGK +LS+LGV+EW G NP
Sbjct  178   TALSYICMRILGEGPDGGQNNACARARKWILDHGSVTHMPSWGKTWLSILGVFEWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y+ 
Sbjct  238   MPPEFWMLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDA  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W   R  C KED+YYPH +IQD++W++L  CTEP + RWPF K +RE A++  +K++ 
Sbjct  298   INWKGVRHLCAKEDIYYPHPWIQDIMWDSLYICTEPLLTRWPFNKLVREKALQVTMKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  WAEDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQ  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS + +E G  L + H +IK+SQVK+NP GDFKSM+RH++KGSWTFSDQ
Sbjct  418   WDTGFAIQALLASNLTDEIGPTLARGHDFIKKSQVKDNPSGDFKSMHRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LL   M   I+GEK + QRLY++V+V L LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLFSTMRPDIVGEKMEPQRLYDSVNVLLSLQS-KNGGLAAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+E FADIVVE E++E T S I +LV F+  YP +R KE++  I  A +
Sbjct  537   AGAAEWLEMLNPTEFFADIVVEHEYVECTSSAIQSLVLFKKLYPGHRKKEIDNFITNATE  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q  DGSWYG WGVCF YG++FAL GL AAGK++ NC  V    +F L+ Q + GG
Sbjct  597   YLENIQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTFNNCLTVRKGVNFLLTTQRENGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP   Y+PLE   +NLV T+WAM+GL+  GQAERDP PLHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEENRSNLVHTAWAMMGLIQAGQAERDPAPLHRAAKLIINSQMEN  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYRK V
Sbjct  717   GDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKWV  755



>ref|XP_010531951.1| PREDICTED: camelliol C synthase-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010531958.1| PREDICTED: camelliol C synthase-like isoform X8 [Tarenaya hassleriana]
Length=762

 Score =   944 bits (2441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/760 (58%), Positives = 565/760 (74%), Gaps = 8/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEG---GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2253
             MWKLKIGEG      Y+YSTNN+ GRQ W +D +AG+PEE  A E++R+ F + R +   
Sbjct  1     MWKLKIGEGKKEDTDYLYSTNNFLGRQTWVFDADAGSPEELAAVEESRRSFYENRYR-IK  59

Query  2252  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2073
                DL  RMQ +KE + + L IPPV++ + E++ +E +T A+R+ VRL  ALQ+ DGHWP
Sbjct  60    ASSDLLWRMQFLKEKKFEQL-IPPVKVADAEKITHETLTNALRRGVRLFSALQSDDGHWP  118

Query  2072  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  1893
             AEN+GPLFF PPL+  LYI+G +D + T+EH+KE +RY+Y HQNEDGGWGL+I+GHSTM 
Sbjct  119   AENAGPLFFLPPLVFCLYITGYLDEVFTAEHRKEALRYIYCHQNEDGGWGLHIEGHSTMF  178

Query  1892  GSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              +ALNY+ +R+LGEGPD G + A  R R+WIL HGG T IPSWGK +LS+LGV++W G N
Sbjct  179   CTALNYICMRILGEGPDGGRENACRRARQWILGHGGVTYIPSWGKAWLSILGVFDWSGSN  238

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             P+ PEFW+ PS  P HPAKM CYCRT YMP+SYLY KR+   +T + L LR E++++ YE
Sbjct  239   PMPPEFWILPSFLPIHPAKMLCYCRTVYMPLSYLYGKRFVAQITPLALQLREELYLQPYE  298

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYM  1359
              I+WN+AR  C KEDLYYPH  IQDL+W+ L    EPF+ RWP  K+ RE A++ A+K++
Sbjct  299   TINWNKARHLCAKEDLYYPHPLIQDLIWDCLHTFMEPFLTRWPLNKLLREKALKVAMKHI  358

Query  1358  RYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQ  1179
              YE E +RYIT+GCIEK+L M+  W EDPNGD  K HLAR+PD+LW+AEDGM M  FGSQ
Sbjct  359   HYEDENSRYITLGCIEKALCMLACWVEDPNGDYFKKHLARIPDFLWIAEDGMKMQTFGSQ  418

Query  1178  NWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSD  999
              WD  FA QA++AS +  E  D L++ H +IK SQV ENP  DFKSM RH++KG+WTFSD
Sbjct  419   QWDTGFAIQALLASNLSNEISDVLKRGHNFIKMSQVTENPSDDFKSMCRHISKGAWTFSD  478

Query  998   QDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWE  819
             +DHGW VSDCTA+ LKC L+L  MP  I+G K D +RLY++V++ L LQS ++GG   WE
Sbjct  479   RDHGWQVSDCTADGLKCCLMLSTMPSDIVGPKMDPERLYDSVNIILSLQS-KNGGVTAWE  537

Query  818   PPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAV  639
             P     +L++ N  E FAD ++E +H E T S I ALV FR  YP++R KE++I I KAV
Sbjct  538   PARAYGWLELFNAIEFFADTMIEYQHAECTSSAIQALVLFRKLYPDHRAKEIDIFIEKAV  597

Query  638   QYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEG  459
             +Y+++ Q  DGSWYG WGVCF YGT+FAL GL AAGK+Y+NC       HF L+ Q   G
Sbjct  598   EYIQRIQMPDGSWYGSWGVCFTYGTWFALTGLAAAGKTYDNCLVTRKGVHFLLTTQKDNG  657

Query  458   GWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQME  279
             GWGE   SCP  RY+ L+G  +NLVQTSWAM+GL+++GQAERDP PLHRAAKL+IN+Q+E
Sbjct  658   GWGESYLSCPEKRYVQLDGERSNLVQTSWAMMGLLHSGQAERDPNPLHRAAKLIINSQLE  717

Query  278   DGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
              GDFPQQ+ITG +MKNCMLHY+++R+ FPL AL+EYR+RV
Sbjct  718   KGDFPQQEITGAFMKNCMLHYSAYRNTFPLWALAEYRRRV  757



>gb|KHN38108.1| Beta-amyrin synthase [Glycine soja]
Length=783

 Score =   944 bits (2440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/778 (57%), Positives = 569/778 (73%), Gaps = 25/778 (3%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EGG   YI+STNN+ GRQ WE+DP AGTPEE+   E ARK F   R K    C
Sbjct  1     MWRLKIAEGGNEAYIFSTNNFVGRQTWEFDPEAGTPEERAQVEAARKDFYHHRFK-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  R Q+++E+     +IP V++ + EE+ Y+ +T+ VR+      ALQ  DGHWPA+
Sbjct  60    ADLLWRFQILRENNFKQ-TIPSVKIEDGEEITYQKVTSTVRRGAHHLAALQTSDGHWPAQ  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPLFF PPL+  +YI+G ++ +   EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFLPPLVFCMYITGHLESVFPEEHRKEILRYIYYHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             ALNY+ +R+LGEGP+ G D A AR R WI DHGG T IPSWGK +LS+LGV++W G NP+
Sbjct  179   ALNYICMRILGEGPNGGHDNACARARNWIRDHGGVTHIPSWGKTWLSILGVFDWCGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+  + YE++
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKV  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W +AR  C KEDLYYPH  +QDL+W++L   TEP + RWPF K IRE A++  +K++ Y
Sbjct  299   NWKKARHQCAKEDLYYPHPLVQDLIWDSLYIFTEPLLTRWPFNKLIREKALQVTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW++EDGM+M  FGSQ W
Sbjct  359   EDETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARIPDYLWVSEDGMTMQSFGSQEW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA FA QA +A+ ++EE G  L K H +IK+SQVK+NP GDFKSMYRH++KGSWTFSDQD
Sbjct  419   DAGFAVQAFLATNLIEEIGPTLAKGHDFIKKSQVKDNPLGDFKSMYRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQS------------  849
             HGW VSDCTAE+LKC LLL  +P +I+GEK + +RLY++V+V L LQ+            
Sbjct  479   HGWQVSDCTAESLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQARLTINDDMMGSF  538

Query  848   --------PESGGFATWEPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRC  693
                      + GG A WE    Q +L++LNP+E FADIVVE E++E TGS I ALV F+ 
Sbjct  539   LKFNTTSFSKKGGLAAWELAGAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKN  598

Query  692   HYPNYRPKEVNISIAKAVQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENC  513
              YP +R KE+   IA AV++LE  Q +DGSWYG WGVCF YG++FAL GL AAGK+Y NC
Sbjct  599   LYPGHRKKEIENFIANAVRFLEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTYTNC  658

Query  512   EAVCNAAHFFLSKQNQEGGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAER  333
              A+  A  F LS Q ++GGWGE   S P   Y+PLEG+ +N+V T+ A++GL++ GQA+R
Sbjct  659   AAIRKAVKFLLSTQREDGGWGESYLSSPKKIYVPLEGSRSNVVHTALALMGLIHAGQADR  718

Query  332   DPTPLHRAAKLLINAQMEDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DP PLHRAAKLLIN+Q+E+GD+PQQ+ITGV+MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  719   DPKPLHRAAKLLINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  776



>emb|CDP15852.1| unnamed protein product [Coffea canephora]
Length=757

 Score =   944 bits (2440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/759 (58%), Positives = 565/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LKI EG   PY+YSTNN+ GRQIWE++PN G+PEE+E  E AR  F   R Q  P  
Sbjct  1     MWRLKIAEGYNSPYLYSTNNFIGRQIWEFNPNGGSPEEREEVENARTQFWNNRCQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             C DL  RMQ ++E      SIP V + + +E+ +   TTAVR+AV    ALQA DGHWPA
Sbjct  59    CSDLLWRMQFLREKNFKQ-SIPQVTVEDGKEITHAMATTAVRRAVLFFAALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++ LYI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFVPPLVMCLYITGHLNSVFPAEHQKEILRYIYYHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG--DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
             +AL+Y+ +R+LGEGPD G  + A +R RKWILDHG  T IPSWGK +LS+LG+++W G N
Sbjct  178   TALSYICMRILGEGPDGGGLNNACSRARKWILDHGSVTAIPSWGKTWLSILGLFDWYGTN  237

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             P+ PEFW+ PS  P HPAK+WCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y+
Sbjct  238   PMPPEFWILPSFLPVHPAKVWCYCRLIYMPMSYLYGKRFVGPITPLILQLREELYAEPYD  297

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
             QI+W + R  C  EDLYYPH  IQDL+W++L    EP + RWPF K+RE A++  +K++ 
Sbjct  298   QINWRKVRHICATEDLYYPHPLIQDLIWDSLHIFAEPLLTRWPFNKLRERALQTTMKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+   L M+  W EDPNGD  K HLAR+PDY+W+AEDGM M  FGSQ 
Sbjct  358   YEDENSRYITIGCV---LCMLACWVEDPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQV  414

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD +FA QA++A G+ EE G+ LRK H ++K+SQV +NP GDF+SMYRH++KG+WTFSDQ
Sbjct  415   WDTSFALQALLAGGLTEEIGETLRKGHDFLKKSQVTDNPSGDFRSMYRHISKGAWTFSDQ  474

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LL   MP +I+GEK + +RLY+AV++ L LQS ++GG   WEP
Sbjct  475   DHGWQVSDCTAEALKCCLLFSTMPPEIVGEKLEPERLYDAVNILLSLQS-KNGGLPAWEP  533

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+EI A+  VE E+   T S I+ALV F+  +P +R KE+   IA A +
Sbjct  534   VRADNWLELLNPTEILANCAVEHEYAVCTSSAINALVMFQQLFPGHREKEIENFIANASK  593

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q  DGSWYG WGVCF YGT+FAL GL AAGK+Y+NC+A+  A  F L  Q  +GG
Sbjct  594   YLENVQMPDGSWYGDWGVCFTYGTWFALGGLVAAGKTYDNCQAISKAVDFLLKSQRNDGG  653

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE  +SC  M+YIPL+G  +NLV T+WAM+GL+Y GQA+RDP PLH AAKLL+N+QME+
Sbjct  654   WGESYRSCSEMKYIPLKGERSNLVHTAWAMMGLIYAGQADRDPRPLHHAAKLLMNSQMEN  713

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITG +  NCMLHYA++R+ FPL AL+EYRKRV
Sbjct  714   GDFPQQEITGAFKNNCMLHYATYRNIFPLWALAEYRKRV  752



>ref|XP_007135871.1| hypothetical protein PHAVU_010G165100g [Phaseolus vulgaris]
 gb|ESW07865.1| hypothetical protein PHAVU_010G165100g [Phaseolus vulgaris]
Length=763

 Score =   944 bits (2440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/758 (58%), Positives = 575/758 (76%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LK+ +GG  PYI+STNN+ GRQIWEYDP AG+ EE+   E+AR  F + R +    C
Sbjct  1     MWRLKVADGGEDPYIFSTNNFVGRQIWEYDPEAGSSEERAEVEEARNNFYRNRFE-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  R Q+++E+     +I  V++ + EE+ YE ++ AVR+      ALQ  DGHWPA+
Sbjct  60    GDLLWRFQVLRENNFKQ-TIASVKIEDGEEITYEKVSAAVRRGAYHLSALQTSDGHWPAQ  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GP+FF PPL+  +YI+G ++ +   EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPMFFLPPLVFCIYITGHLESVFPEEHRKEILRYIYYHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             ALNY+ +R+LGEGP+ G D A AR RKWI DHGG T IPSWGK +LS+LGV++W G NP+
Sbjct  179   ALNYICMRILGEGPNGGHDNACARARKWIQDHGGVTHIPSWGKTWLSILGVFDWCGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+  + YE++
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKV  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W +AR  C KEDLYYPH  IQDL+W++L   TEP + RWPF K +RE A++  +K++ Y
Sbjct  299   NWKKARHQCAKEDLYYPHPLIQDLIWDSLYIFTEPLLTRWPFNKLVREKALQVTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLARVPDYLW++EDGM+M  FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARVPDYLWMSEDGMTMQSFGSQEW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA FA QA++A+ +V+E G  L K H++IKESQV++NP GDFK M+RH++KGSWTFSDQD
Sbjct  419   DAGFAVQALLAANLVDEIGPALGKGHYFIKESQVRDNPSGDFKGMHRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LLL  +P +I+GEK + +RLY++V+V L LQS + GG + WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSTLPQEIVGEKMEPERLYDSVNVLLSLQS-KKGGLSAWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L++LNP+E FADIVVE E++E TGS I ALV F+  YP +R KE+   I+ AV++
Sbjct  538   GAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKMYPGHRKKEIENFISNAVRF  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q +DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+  A  F L++Q ++GGW
Sbjct  598   LENTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTYTNCAAIRKAVRFLLTRQREDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   S P   Y+PLEG  +N+V T+WA++GL++ GQA+RDPTPLHRAAKLLIN+Q+E+G
Sbjct  658   GESYLSSPKKIYVPLEGGRSNVVHTAWALMGLIHAGQADRDPTPLHRAAKLLINSQLEEG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             D+PQQ+ITGV+MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  718   DWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  755



>ref|XP_010065062.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW70925.1| hypothetical protein EUGRSUZ_F04040 [Eucalyptus grandis]
Length=761

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/757 (58%), Positives = 558/757 (74%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKI EG  G Y+YSTNNY GRQ WE+DP AG  EE+   E   + F   R +    C
Sbjct  1     MWKLKIAEGEDGSYLYSTNNYVGRQTWEFDPEAGNAEERAEVEATCQHFYDHRHQ-VKAC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ ++E +    +I PVR+ + EE+ Y+  +TA+R+ V    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREKQFRQ-TISPVRVEDGEEITYDKASTALRRTVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPL+F PPL++ +YI+G ++ +  +EH+KE++RYLYNHQN DGGWG +I+GHSTM  +
Sbjct  119   IAGPLYFLPPLVMCVYITGHLNAVFPAEHRKEILRYLYNHQNGDGGWGFHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y  +R+LGEGPD G D A  R RKWILD GG T IPSWGK +LS+ G+++W G NP+
Sbjct  179   ALSYRCMRILGEGPDGGQDNACTRARKWILDRGGVTYIPSWGKTWLSIFGLFDWSGTNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T +V  LR E+H + Y+ I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLVQQLREELHTQPYDTI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
              W +    C KEDLYYPH  +QDL+W++L   TEP + RWPF K+RE A++  +K++ YE
Sbjct  299   CWRKVCHLCAKEDLYYPHPLVQDLIWDSLYIFTEPLLNRWPFNKLREKALQVTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDP+ D  K HLAR+PDYLW+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPDSDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
               FA QA++AS M EE    L + H +IK+SQVK+NP GDFKSM+RH++KGSWTFSDQDH
Sbjct  419   TGFAIQALLASNMTEEIAPVLARGHDFIKKSQVKDNPSGDFKSMHRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC LL   MP +I+GEK + ++LY+AV++ L LQS E+GG   WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLFSMMPPEIVGEKMEPEKLYDAVNILLSLQS-ENGGLPAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +L++LNP+E FADIV++ E++E T S I ALV FR  YP +R KE+   I+ +V+YL
Sbjct  538   APAWLELLNPTEFFADIVIQHEYVECTSSAIQALVLFRKLYPGHRKKEIADFISNSVKYL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q+ DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+     F L  Q Q+GGWG
Sbjct  598   ENVQKPDGSWYGCWGVCFTYGSWFALGGLAAAGKTYSNCAAMRKGVAFLLRTQLQDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP   Y+PLEG  +NLVQT+WAM+G++Y GQAERDPTPLHRAAKLLIN+QMEDGD
Sbjct  658   ESYLSCPKEEYVPLEGNRSNLVQTAWAMMGMIYAGQAERDPTPLHRAAKLLINSQMEDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             +PQQ+ITGV+ KNCMLHYA++R+ +PL AL+EY +RV
Sbjct  718   YPQQEITGVFSKNCMLHYANYRNIYPLWALAEYCRRV  754



>ref|XP_004305793.1| PREDICTED: beta-amyrin synthase-like [Fragaria vesca subsp. vesca]
Length=769

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/758 (57%), Positives = 561/758 (74%), Gaps = 8/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG--GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLK+ EGG    YIYSTNN+ GRQ WE+DPNAGT EE+   E AR  F   R +    
Sbjct  1     MWKLKVAEGGDSSAYIYSTNNFVGRQTWEFDPNAGTDEERAEVEAARLHFYNNRHQ-VKA  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GDL  RMQ ++E +    +IPPV++ + E + +E  T A+R++V    ALQA DGHWPA
Sbjct  60    NGDLLWRMQFLREKKFKQ-TIPPVKVEDGEVITHEKTTDALRRSVHFFSALQASDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL+I LYI+G +D +   EH+KE++RY+Y HQNEDGGWGL+++GHSTM  
Sbjct  119   ENAGPLFFLPPLVIGLYITGHLDSVFHEEHRKEILRYIYYHQNEDGGWGLHVEGHSTMFS  178

Query  1889  SALNYVALRLLGEGPDDG--DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
             +AL+Y+++R LGEG DDG  D A  R RKWILDHGG T IPSWGK +LS LG+++W GCN
Sbjct  179   TALSYISMRFLGEGSDDGGQDNACPRARKWILDHGGVTHIPSWGKTWLSFLGLFDWSGCN  238

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             P+ PEFW+ PS  P HPAKMWCYCR  YMPMSYLY +R+ GP+T ++L LR E+ V+ Y 
Sbjct  239   PVPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGRRFVGPITPLILQLREELFVQPYN  298

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYM  1359
             +I+W + R  C KED+YYPH +IQ+LLW++L   TEP + RWPF K IRE A++  +K++
Sbjct  299   EINWKKIRHLCAKEDIYYPHPWIQNLLWDSLYISTEPLLTRWPFNKLIREKALQVTMKHI  358

Query  1358  RYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQ  1179
              YE E +RYITIGC+EK L M+  WAEDPNG+  K HLAR+PDYLW+AEDGM M  FGSQ
Sbjct  359   HYEDENSRYITIGCVEKVLCMLACWAEDPNGEYFKKHLARIPDYLWIAEDGMKMQSFGSQ  418

Query  1178  NWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSD  999
              WD  FA QA++A+ + +E G  L + H +IK SQVK+NP GDFKSM+RH++KGSWTFSD
Sbjct  419   MWDTGFAIQALLATNLTDEIGPTLARGHDFIKISQVKDNPSGDFKSMHRHISKGSWTFSD  478

Query  998   QDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWE  819
             QDHGW VSDCTAE LKC LLL  MP + +GEK + +RLY++V+V L LQS ++GG + WE
Sbjct  479   QDHGWQVSDCTAEGLKCCLLLSMMPSETVGEKMEPERLYDSVNVLLSLQS-KNGGLSAWE  537

Query  818   PPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAV  639
             P     +L++LNP+E FADIV+E E++E T S I ALV F+  YP +R KE+   I  A 
Sbjct  538   PAGAAEWLELLNPTEFFADIVIEHEYVECTSSAIQALVLFKKLYPGHRKKEIEHFITNAT  597

Query  638   QYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEG  459
              Y+E  Q  DGSWYG WG+CF YGT+FAL GL AAGK++  C A+  A  F L+ Q + G
Sbjct  598   HYIENTQMPDGSWYGNWGICFTYGTWFALGGLAAAGKTFSTCAAMRKAVRFLLTTQKENG  657

Query  458   GWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQME  279
             GWGE   S P   YIPLEG  +NLV T+WAM+ L+++GQAER+ TPL RA K +IN+Q+E
Sbjct  658   GWGESYLSSPQKTYIPLEGNRSNLVHTAWAMMALIHSGQAERNRTPLRRATKFIINSQLE  717

Query  278   DGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             +GDFPQQ++TGV++KNCMLHYA++R+ FPL AL+EYR+
Sbjct  718   NGDFPQQELTGVFLKNCMLHYAAYRNIFPLWALAEYRR  755



>ref|XP_003604121.1| Beta-amyrin synthase [Medicago truncatula]
 emb|CAD23247.1| beta-amyrin synthase [Medicago truncatula]
 gb|AES86318.1| beta-amyrin synthase [Medicago truncatula]
Length=762

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/758 (58%), Positives = 569/758 (75%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKIGEG   PY++STNN+ GRQ WEYDP AG+ EE+   E+ARK F   R K    C
Sbjct  1     MWKLKIGEGKNEPYLFSTNNFVGRQTWEYDPEAGSEEERAQVEEARKNFYDNRFK-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  R Q+++E+   + +I  V++ + EE+ YE  TT +R+      ALQ  DGHWPA+
Sbjct  60    GDLLWRFQVLRENNF-MQTIDGVKIEDGEEITYEKATTTLRRGTHHLAALQTSDGHWPAQ  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPLFF PPL+  +YI+G +D +   EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFMPPLVFCVYITGHLDSVFPREHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             ALNY+ +R+LGEGPD G D A AR R WI  HGG T IPSWGK +LS+LG+++W G NP+
Sbjct  179   ALNYICMRILGEGPDGGQDNACARARNWIRAHGGVTYIPSWGKTWLSILGLFDWLGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+H + YE+I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELHTQPYEKI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W ++R  C KED+YYPH  IQDL+W++L   TEP + RWPF K +R+ A+   +K++ Y
Sbjct  299   NWTKSRHLCAKEDIYYPHPLIQDLIWDSLYIFTEPLLTRWPFNKLVRKRALEVTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RY+TIGC+EK L M+  W EDPNGD  K HLARV DYLW++EDGM+M  FGSQ W
Sbjct  359   EDENSRYLTIGCVEKVLCMLACWVEDPNGDAYKKHLARVQDYLWMSEDGMTMQSFGSQEW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA FA QA++A+ + +E    L K H +IK+SQV ENP GDFKSM+RH++KGSWTFSDQD
Sbjct  419   DAGFAVQALLAANLNDEIEPALAKGHDFIKKSQVTENPSGDFKSMHRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LLL  +P +I+GEK + +RLY++V+V L LQS + GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQS-KKGGLAAWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L++LNP+E FADIVVE E++E TGS I ALV F+  YP +R KE+   I++AV++
Sbjct  538   GAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFISEAVRF  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E  Q +DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+  A  F L+ Q ++GGW
Sbjct  598   IEDIQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTYTNCAAIRKAVKFLLTTQREDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   S P   Y+PLEG+ +N+V T+WA++GL++ GQAERDPTPLHRAAKLLIN+Q+E+G
Sbjct  658   GESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQAERDPTPLHRAAKLLINSQLEEG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             D+PQQ+ITGV+MKNCMLHY  +R  +PL AL+EYR+RV
Sbjct  718   DWPQQEITGVFMKNCMLHYPMYRDIYPLWALAEYRRRV  755



>sp|E2IUA7.1|GLUTS_KALDA RecName: Full=Glutinol synthase; Short=KdGLS [Kalanchoe daigremontiana]
 gb|ADK35124.1| glutinol synthase [Kalanchoe daigremontiana]
Length=767

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/757 (57%), Positives = 562/757 (74%), Gaps = 8/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHT  2250
             MWKLKI +GG  PYI++TNN+ GRQIWE+DP A  P++    E AR  F   R K  P++
Sbjct  1     MWKLKIADGGSNPYIFTTNNFVGRQIWEFDPQATDPQQLAKVEAARLDFYHNRYKLKPNS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E +    +IP V++ + EEV+YEA+T A+R+ V L  ALQA DGHWPA
Sbjct  61    --DLLWRMQFLEEKDFRQ-NIPQVKVEDGEEVSYEAVTAALRRGVHLYSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GP+FF PP+++ LYI+G ++ I T EH+ E +RY+Y HQNEDGGWG +I+GHSTM G
Sbjct  118   ENAGPMFFMPPMVMCLYITGHLNAIFTEEHRSETLRYIYYHQNEDGGWGFHIEGHSTMFG  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNY+ +RLLGEGP+ G D A++RGRKWILDHGGAT IPSWGK +LS++G+ +W GCNP
Sbjct  178   TVLNYICMRLLGEGPEGGQDNAVSRGRKWILDHGGATSIPSWGKTWLSIMGLCDWSGCNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFWL PS  P HP KMWCYCR  YMPMSYLY KR+   +T ++L LR EIH++ Y+Q
Sbjct  238   MPPEFWLLPSYLPMHPGKMWCYCRMVYMPMSYLYGKRFTARITPLILQLREEIHIQPYDQ  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             IDW + R  CCKED+YYPH  +QDLLW+ L   TEP + RWP  K IR+ A++K +K++ 
Sbjct  298   IDWKKVRHVCCKEDMYYPHPLLQDLLWDTLYLTTEPLLTRWPLNKLIRQRALQKTMKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIG +EK L M+  W EDPNGD  K HLARVPDY W+AEDGM +  FGSQ+
Sbjct  358   YEDENSRYITIGTVEKVLCMLACWVEDPNGDYFKKHLARVPDYFWVAEDGMKIQSFGSQH  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  F+ QA++AS M +E G  L K H+ IKESQVK+NP GDF+SMYRH++KGSWTFSDQ
Sbjct  418   WDTVFSAQALLASDMADEIGTTLAKAHYCIKESQVKDNPSGDFRSMYRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW +SDCTAE LKC LL   M  +++GE    +RL+++V++ LYLQS ++GG   WEP
Sbjct  478   DHGWQLSDCTAEGLKCCLLFSLMQPEVVGEAMPPERLFDSVNILLYLQS-KNGGMPGWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+E F +IV+E E++E T S + ALV F+  +P +R KEV   I    +
Sbjct  537   AGASEWLELLNPTEFFENIVIEHEYVECTSSAVQALVLFKKLHPGHRRKEVERFITNGAK  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             Y+E  Q  DG+WYG WGVCF YG +FAL GL AAGK+Y NC AV     F L  Q ++GG
Sbjct  597   YIEDIQMPDGAWYGNWGVCFTYGAWFALGGLAAAGKTYNNCAAVRKGVDFLLRIQLEDGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE  QSCP  +Y+PLE   +NLV TSWA++GL+ +GQA+RDP PLHRAAKLLIN+Q+ED
Sbjct  657   WGESYQSCPDKKYVPLEDNRSNLVHTSWALMGLLCSGQADRDPNPLHRAAKLLINSQLED  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             GDFPQQ+ITGV+  NCMLH+A++RS FP+ AL+EY++
Sbjct  717   GDFPQQEITGVFKMNCMLHFAAYRSIFPVWALAEYKR  753



>gb|AAO33579.1|AF478454_1 putative beta-amyrin synthase [Lotus japonicus]
Length=750

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/746 (58%), Positives = 564/746 (76%), Gaps = 5/746 (1%)
 Frame = -3

Query  2390  PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCGDLFMRMQMIKE  2211
             PYI+STNN+ GRQ WEYDP+AGTPEE+   E+AR+ F   R K    CGDL  R Q+++E
Sbjct  1     PYIFSTNNFVGRQTWEYDPDAGTPEERAQVEEARQDFYNNRYK-VKPCGDLLWRFQVLRE  59

Query  2210  SEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAENSGPLFFTPPLM  2031
             +     +IP V++ + EE+ YE  TT +++A     ALQ  DGHWPA+ +GPLFF PPL+
Sbjct  60    NNFKQ-TIPSVKIEDGEEITYEKATTTLKRAAHHLAALQTSDGHWPAQIAGPLFFQPPLV  118

Query  2030  IALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSALNYVALRLLGE  1851
               +YI+G ++ +   E++KE++RY+Y HQNEDGGWGL+I+GHSTM  +ALNY+ +R+LGE
Sbjct  119   FCMYITGHLNSVFPEEYRKEILRYIYVHQNEDGGWGLHIEGHSTMFCTALNYICMRMLGE  178

Query  1850  GPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLSPEFWLFPSNFP  1674
             GPD G D A AR RKWILDHGG T IPSWGK +LS+LG+++W G NP+ PEFW+ PS  P
Sbjct  179   GPDGGQDNACARARKWILDHGGVTHIPSWGKTWLSILGIFDWKGSNPMPPEFWILPSFLP  238

Query  1673  FHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQIDWNQARMACCKE  1494
              HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+  + YE+++W +AR  C KE
Sbjct  239   MHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKVNWKKARHQCAKE  298

Query  1493  DLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRYEAEETRYITIGC  1317
             D+YYPH  IQDL+W++L   TEP + RWPF K +RE A+   +K++ YE E +RYITIGC
Sbjct  299   DIYYPHPLIQDLMWDSLYLFTEPLLTRWPFNKLVREKALEVTMKHIHYEDENSRYITIGC  358

Query  1316  IEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDAAFATQAIIAS  1137
             +EK L M+  W EDPNGD  K HLARVPDYLW++EDGM M  FGSQ WDA FA QA++A+
Sbjct  359   VEKVLCMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMCMQSFGSQEWDAGFAVQALLAT  418

Query  1136  GMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHGWAVSDCTAET  957
              +V+E G  L K H +IK+SQV++NP GDFK+M+RH++KGSWTFSDQDHGW VSDCTAE 
Sbjct  419   NLVDELGPTLAKGHDFIKKSQVRDNPSGDFKNMHRHISKGSWTFSDQDHGWQVSDCTAEG  478

Query  956   LKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVPQPYLQVLNPS  777
             LKC LLL  +P  I+GEK + + L+++V++ L LQS + GG A WEP   Q +L++LNP+
Sbjct  479   LKCCLLLSMLPPDIVGEKMEPECLFDSVNLLLSLQS-KKGGLAAWEPAGAQEWLELLNPT  537

Query  776   EIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLEKQQESDGSWY  597
             E FADIVVE E++E TGS I ALV F+  YP +R KE+   I++AV++LE  Q +DGSWY
Sbjct  538   EFFADIVVEHEYVECTGSAIGALVLFKKLYPGHRKKEIENFISEAVRFLEDTQTADGSWY  597

Query  596   GYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGECLQSCPSMRY  417
             G WGVCF YG++FAL GL AAGK+Y NC A+  A  F L+ Q  +GGWGE   S P   Y
Sbjct  598   GNWGVCFTYGSWFALGGLAAAGKTYANCAAIRKAVKFLLTTQRGDGGWGESYLSSPKKIY  657

Query  416   IPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDFPQQDITGVYM  237
             +P EG  +N+V T+WA++GL+++GQAERDPTPLHRAAKLLIN+Q+E+GD+PQQ+ITGV+M
Sbjct  658   VPFEGNRSNVVHTAWALMGLIHSGQAERDPTPLHRAAKLLINSQLEEGDWPQQEITGVFM  717

Query  236   KNCMLHYASHRSYFPLMALSEYRKRV  159
             KNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  718   KNCMLHYPMYRDIYPMWALAEYRRRV  743



>ref|XP_008380418.1| PREDICTED: beta-amyrin synthase [Malus domestica]
Length=761

 Score =   942 bits (2436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/759 (59%), Positives = 570/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MWKLK  +GG  PYIYSTNN+ GRQI+E+DP AGT EE+   E+AR  F   R Q  P  
Sbjct  1     MWKLKXADGGNDPYIYSTNNFVGRQIFEFDPEAGTTEERAEVEEARLHFYNNRYQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GD   RMQ ++E      +IPP ++ + EE+ +E  T ++R++V    ALQA DGHWPA
Sbjct  59    SGDFLWRMQFLREXNFKQ-TIPPXKVEDGEEITHEKATASLRRSVHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCVYITGHLNTVFHAEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +AL+Y+ +R+LGEGPD G D A AR RKWILDHG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TALSYICMRILGEGPDGGQDNACARARKWILDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y++
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W   R  C KED+YYPH +IQD LW++L  CTEP + RWPF K IR+ A+   +K++ 
Sbjct  298   INWKGVRHHCAKEDIYYPHPWIQDFLWDSLYICTEPLLTRWPFNKMIRKRALEVTMKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  WAEDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQ  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS + +E    L + H ++K+SQVK+NP GDFKSM+RH++KGS TFSDQ
Sbjct  418   WDTGFAIQALLASNLTDEIAPTLARGHDFVKKSQVKDNPSGDFKSMHRHISKGSXTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LLL  MP +++GEK + +RLY+AV+V + LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMMPPELVGEKMEPERLYDAVNVLISLQS-KNGGLAAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+E FADIVVE E++E T S I ALV F+  YP +R KE++  I  A Q
Sbjct  537   AGAAEWLEMLNPTEFFADIVVEHEYVECTSSAIQALVLFKKLYPGHRKKEIDQFITNAAQ  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q  DGSWYG WGVCF YGT+FAL GLTAAGK++ NC  +  A +F L+ Q + GG
Sbjct  597   YLENIQMEDGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCXVIRKAINFLLAIQKENGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP   Y+PLEG  +NLV T+WAM+GL+Y GQAERDP PLHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIYAGQAERDPAPLHRAAKLIINSQMEN  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYRK V
Sbjct  717   GDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKWV  755



>ref|XP_008228023.1| PREDICTED: beta-amyrin synthase [Prunus mume]
Length=761

 Score =   942 bits (2436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/759 (59%), Positives = 569/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MWKLK+ +GG  PYIYSTN++ GRQI+E+D  AGTPEE+   E+AR  F   R Q  P  
Sbjct  1     MWKLKVADGGNDPYIYSTNDFVGRQIFEFDAEAGTPEERAEVEEARLNFYNNRYQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GDL  RMQ +KE      +IPPV++ + EE+ YE  T ++R++V    ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLKEKNFKQ-TIPPVKVEDGEEITYEKATASLRRSVHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++  YI+G ++ +  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM G
Sbjct  118   ENAGPLFFLPPLVMCTYITGHLNTVFPAEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFG  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +AL+Y+ +R+LGE PD G D A AR RKWILDHG  T +PSWGK +LS+LGV+EW G NP
Sbjct  178   TALSYICMRILGEEPDGGQDNACARARKWILDHGSVTHMPSWGKTWLSILGVFEWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y +
Sbjct  238   MPPEFWMLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAEPYHE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W   R  C KED+YYPH +IQD++W++L  CTEP + RWPF K IRE A++  +K++ 
Sbjct  298   INWKGVRHLCAKEDIYYPHPWIQDIMWDSLYICTEPLLNRWPFNKLIREKALQVTMKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWDEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQ  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS + +E G  L + H +IK+SQVK+NP GDFKSMYRH++KGSWTFSDQ
Sbjct  418   WDTGFAIQALLASNLTDEIGPTLARGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LL   M  +IIGEK + +RLY++V+V L LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLFSMMRPEIIGEKMEPERLYDSVNVLLSLQS-KNGGLAAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+E F DIVVE E++E T S I ALV F+  YP +R KE++  I  A +
Sbjct  537   AGAADWLEMLNPTEFFEDIVVEHEYVECTSSAIQALVLFKKLYPGHRKKEIDHFITNATE  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q  DGSWYG WGVCF YG++FAL GL AAGK++ NC A+    +F L  Q + GG
Sbjct  597   YLENIQIPDGSWYGNWGVCFTYGSWFALGGLAAAGKTFNNCLAMRKGVNFLLKTQRENGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP   Y+PLEG  +NLV T+WAM+GL++ GQA+RDP PLHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIHAGQADRDPAPLHRAAKLIINSQMEN  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITGV+ KNCMLHYA++R+ +PL AL+EYRK+V
Sbjct  717   GDFPQQEITGVFQKNCMLHYATYRNIYPLWALAEYRKQV  755



>gb|AFM82492.1| lupeol synthase [Eleutherococcus trifoliatus]
Length=763

 Score =   942 bits (2436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/759 (58%), Positives = 562/759 (74%), Gaps = 7/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEG--GGPYIYSTNNYAGRQIWEYDPN-AGTPEEQEAFEKARKGFTKQRQKGPH  2253
             MWKLKI EG    PY+YSTNN+ GRQ WE+DP+  G+P E E  E+AR+ F + R K   
Sbjct  1     MWKLKIAEGDKNDPYLYSTNNFVGRQTWEFDPDYVGSPGELEEVEEARRQFWENRYK-VK  59

Query  2252  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2073
              CGDL  RMQ ++E      +IP V++ ++E V Y+A TT +R+AV    ALQA DGHWP
Sbjct  60    PCGDLLWRMQFLREKNFKQ-TIPQVKVGDDEAVTYDAATTTLRRAVHFFSALQASDGHWP  118

Query  2072  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  1893
             AE +GPLFF PPL++ +YI+G +D +  ++H+KE++RY+Y HQNE+GG GL+I+GHSTM 
Sbjct  119   AEIAGPLFFLPPLVMCVYITGHLDTVFPAKHRKEILRYIYCHQNENGGGGLHIEGHSTMF  178

Query  1892  GSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
             G+  +Y+ +R+LG+GPD G + A A+GRKWILDHG AT IPSWGK +LS+LGVYEW G N
Sbjct  179   GTTFSYICMRILGKGPDGGVNNACAKGRKWILDHGSATAIPSWGKTWLSILGVYEWTGSN  238

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             P+ PEFWL PS+   HPAKM CYCR  Y+PMSYLY KR+ GP+T ++L L+ E++ + Y 
Sbjct  239   PMPPEFWLLPSSLSVHPAKMLCYCRMVYLPMSYLYGKRFVGPITPLILQLKEELYAQPYN  298

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
             +I W + R  C KED+YYPH  IQDLLW++L    EP + RWPF K+RE A++  +K++ 
Sbjct  299   EIRWGKVRHVCAKEDIYYPHPLIQDLLWDSLHVLAEPLLTRWPFNKLREKALQTTMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ 
Sbjct  359   YEDENSRYITIGCVEKILCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQE  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  F  QA++AS +  E G  L K H +IK+SQVK+NP GDFKSMYRH++KGSWTFSDQ
Sbjct  419   WDIGFGIQALLASDLTHELGPTLMKGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQ  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC L+   MP +I+G+K + + LY +V+V L LQS ++GG A WEP
Sbjct  479   DHGWQVSDCTAEGLKCCLIFSTMPEEIVGKKMEPELLYNSVNVLLSLQS-KNGGVAAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++ NP+E FAD ++E E++E T S I AL  F+  YP +R KE++  I  A++
Sbjct  538   ATAQDWLELFNPTEFFADTIIEHEYVECTSSAIQALTLFKKLYPGHRKKEIDNFITNAIR  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             ++E  Q  DGSWYG WGVCF YGT+FAL GL A GK+Y NC AV  A +F L  Q  +GG
Sbjct  598   FIEDIQIPDGSWYGNWGVCFTYGTWFALGGLAAGGKTYNNCAAVRKAVNFLLESQLDDGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP   Y+PLEG  +NLV T WA++GL+++GQAERDPTPLHRAAKLLIN+QMED
Sbjct  658   WGESHLSCPRKVYVPLEGNRSNLVHTGWALMGLIHSGQAERDPTPLHRAAKLLINSQMED  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITG +MKNCMLHYA +R+ +PL AL+EYR+RV
Sbjct  718   GDFPQQEITGAFMKNCMLHYAVYRNIYPLWALAEYRRRV  756



>ref|XP_007214979.1| hypothetical protein PRUPE_ppa001817mg [Prunus persica]
 gb|EMJ16178.1| hypothetical protein PRUPE_ppa001817mg [Prunus persica]
Length=761

 Score =   941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/759 (58%), Positives = 570/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MWKLK+ +GG  PYIYSTN++ GRQI+E+D  AGTPEE+   E+AR  F   R Q  P  
Sbjct  1     MWKLKVADGGNDPYIYSTNDFVGRQIFEFDAEAGTPEERAEVEEARLNFYNNRYQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GDL  RMQ +KE      +IPPV++ + EE+ YE  T ++R++V    ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLKEKNFKQ-TIPPVKVEDGEEITYEKATASLRRSVHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++  YI+G ++ +  +EH++E++RY+Y HQN+DGGWGL+I+GHSTM G
Sbjct  118   ENAGPLFFLPPLVMCTYITGHLNTVFPAEHRREILRYIYYHQNQDGGWGLHIEGHSTMFG  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +AL+Y+ +R+LG+GPD G D A AR RKWILDHG  T +PSWGK +LS+LGV+EW G NP
Sbjct  178   TALSYICMRILGDGPDGGQDNACARARKWILDHGSVTHMPSWGKTWLSILGVFEWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y +
Sbjct  238   MPPEFWMLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFIGPITPLILQLREELYAQPYHE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W   R  C KED+YYPH +IQD++W++L  CTEP + RWPF K IRE A++  +K++ 
Sbjct  298   INWKGVRHLCAKEDIYYPHPWIQDIMWDSLYICTEPLLNRWPFNKLIREKALQVTMKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  WAEDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQ  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS + +E G  L + H +IK+SQVK+NP GDFKSMYRH++KGSWTFSDQ
Sbjct  418   WDTGFAIQALLASNLTDEIGPTLARGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LL   M  +IIGEK + +RLY++V+V L LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLFSMMRPEIIGEKMEPERLYDSVNVLLSLQS-KNGGLAAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+E F DIVVE E+++ T S I ALV F+  YP +R KE++  I  A +
Sbjct  537   AGAADWLEMLNPTEFFEDIVVEHEYVDCTSSAIQALVLFKKLYPGHRKKEIDHFITNATE  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q  DGSWYG WGVCF YG++FAL GL AAGK++ NC A+    +F L  Q + GG
Sbjct  597   YLENIQMPDGSWYGSWGVCFTYGSWFALGGLAAAGKTFNNCLAMRKGVNFLLKTQRENGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP   Y+PLEG  +NLV T+WAM+GL++ GQA+RDP  LHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIHAGQADRDPARLHRAAKLIINSQMEN  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITGV+ KNCMLHYA++R+ +PL AL+EYRK+V
Sbjct  717   GDFPQQEITGVFQKNCMLHYATYRNIYPLWALAEYRKQV  755



>gb|AAO33578.1|AF478453_1 beta-amyrin synthase [Medicago truncatula]
Length=762

 Score =   941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/758 (58%), Positives = 568/758 (75%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKIGEG   PY++STNN+ GRQ WEYDP AG+ EE+   E+ARK F   R K    C
Sbjct  1     MWKLKIGEGKNEPYLFSTNNFVGRQTWEYDPEAGSEEERAQVEEARKNFYDNRFK-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  R Q+++E+   + +I  V++ + EE+ YE  TT +R+      ALQ  DGHWPA+
Sbjct  60    GDLLWRFQVLRENNF-MQTIDGVKIEDGEEITYEKATTTLRRGTHHLAALQTSDGHWPAQ  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPLFF PPL+  +YI+G +D +   EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFMPPLVFCVYITGHLDSVFPREHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             ALNY+ +R+LGEGPD G D A AR R WI  HGG T IPSWGK +LS+LG+++W G NP+
Sbjct  179   ALNYICMRILGEGPDGGQDNACARARNWIRAHGGVTYIPSWGKTWLSILGLFDWLGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+H + YE+I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELHTQPYEKI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W ++R  C KED+YYPH  IQDL+W++L   TEP + RWPF K +R+ A+   +K++ Y
Sbjct  299   NWTKSRHLCAKEDIYYPHPLIQDLIWDSLYIFTEPLLTRWPFNKLVRKRALEVTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RY+TIGC+EK L M+  W EDPNGD  K HLARV DYLW++EDGM+M  FGSQ W
Sbjct  359   EDENSRYLTIGCVEKVLCMLACWVEDPNGDAYKKHLARVQDYLWMSEDGMTMQSFGSQEW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA FA QA++A+ + +E    L K H +IK+SQV ENP GDFKSM+RH++KGSWTFSDQD
Sbjct  419   DAGFAVQALLAANLNDEIEPALAKGHDFIKKSQVTENPSGDFKSMHRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LLL  +P +I+GEK + +RLY++V+V L LQS + GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQS-KKGGLAAWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L++LNP+E FADIVVE E++E TGS I ALV F+  YP +R KE+   I++AV++
Sbjct  538   GAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFISEAVRF  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E  Q +DGSWYG WGVCF YG++ AL GL AAGK+Y NC A+  A  F L+ Q ++GGW
Sbjct  598   IEDIQTADGSWYGNWGVCFTYGSWVALGGLAAAGKTYTNCAAIRKAVKFLLTTQREDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   S P   Y+PLEG+ +N+V T+WA++GL++ GQAERDPTPLHRAAKLLIN+Q+E+G
Sbjct  658   GESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQAERDPTPLHRAAKLLINSQLEEG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             D+PQQ+ITGV+MKNCMLHY  +R  +PL AL+EYR+RV
Sbjct  718   DWPQQEITGVFMKNCMLHYPMYRDIYPLWALAEYRRRV  755



>gb|AIE17465.1| oxidosqualene cyclase [Centella asiatica]
Length=761

 Score =   940 bits (2430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/757 (57%), Positives = 557/757 (74%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKIG+G    Y++STNNY GRQ WE+DP  GTPEE+   E AR  F   R K     
Sbjct  1     MWRLKIGDGTHDSYLFSTNNYVGRQTWEFDPEYGTPEERAEVEDARLQFWNNRHK-VRAN  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  R+Q ++E      +IP V++ + EE+ YE +TT +R+AV     LQ+  GHWPAE
Sbjct  60    GDLLWRLQFLREKNFKQ-TIPQVKVEDGEEITYETVTTTLRRAVHFWAELQSDHGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GP++F PPL+  +YI+G ++ +  +EH+KE++RY+Y  QNEDGGWG +I+GHSTM  +
Sbjct  119   IAGPMYFLPPLVFCMYITGHLNTVFPAEHRKEILRYIYCQQNEDGGWGFHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             ALNY+ +R+LGEGPD G D A ARGRKWI+DHG  T IPSWGK +LS+LG+Y+W G NP+
Sbjct  179   ALNYITMRILGEGPDGGIDNACARGRKWIIDHGSVTAIPSWGKTWLSILGLYDWSGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFWL PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + YE I
Sbjct  239   PPEFWLLPSILPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLRKELYSRPYETI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
              W   R  C KE +YYPH  IQDL+W+ L   TEP + RWPF K+RE A++  +K++ YE
Sbjct  299   KWKSVRHICAKEGVYYPHPLIQDLMWDGLYIFTEPLLTRWPFNKLRERALQTTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  WAEDP+GD  K HLARVPDY+WLAEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWAEDPDGDCFKKHLARVPDYIWLAEDGMKMQSFGSQQWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
             A FA QA++AS M +E    L+K HF+IKESQVK+NP GDFKSM+RHV+KGSWTFSDQDH
Sbjct  419   AGFAIQALLASDMTDEIQTTLKKGHFFIKESQVKDNPSGDFKSMHRHVSKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC LL   MP +I+GEK +  +L++AV++ L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLFSMMPPEIVGEKMEDSQLFDAVNILLSLQS-KNGGLAAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +L++LNP+E F DIV+E E+ E T S I ALV F+  YP +R K++   +   V++L
Sbjct  538   SSEWLELLNPTEFFEDIVIEHEYAECTSSAIQALVLFKKLYPGHRKKKIESFLRSTVRFL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  +G WYG WGVCF YGT+ A+ GL AAGK+Y N + V  A  F L +Q  +GGWG
Sbjct  598   ENIQTPEGGWYGNWGVCFTYGTWLAMGGLAAAGKTYNNSKTVRKAVEFLLKRQCSDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E  +SCP  RY+PLEG  +NLV T+WA++ L+++GQAERDPTPLHRAAKLLIN+QME GD
Sbjct  658   ESYRSCPEKRYVPLEGNRSNLVHTAWALMSLIHSGQAERDPTPLHRAAKLLINSQMETGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ++TGV+M+NCMLHY ++R+ +PL AL+EYRK+V
Sbjct  718   FPQQEVTGVFMRNCMLHYTTYRNTYPLWALAEYRKKV  754



>ref|XP_006364889.1| PREDICTED: delta-amyrin synthase-like [Solanum tuberosum]
Length=760

 Score =   939 bits (2426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/757 (57%), Positives = 556/757 (73%), Gaps = 6/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHTC  2247
             MWKL I +G   Y+YSTNNY GRQ WE+DPN+GT EE    EKAR+ F     K  P++ 
Sbjct  1     MWKLTIAQGQDAYLYSTNNYVGRQTWEFDPNSGTAEELAEIEKARQQFWNNHYKIKPNS-  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  RMQ ++E       I  V++ E EE+++E  T A+R+AV    ALQA DGHWPAE
Sbjct  60    -DLLWRMQFLREKNFKQ-RIGAVKVEEGEEISHEIATIALRRAVHFFSALQATDGHWPAE  117

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             ++GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  118   SAGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  177

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+YV +R+LGEGPD G + A AR RKWILDHG    IPSWGK +LS+LG +EW G NP+
Sbjct  178   ALSYVCMRILGEGPDGGVNNACARARKWILDHGSVIAIPSWGKTWLSILGAFEWIGTNPM  237

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCRT YMPMSYLY KR+ GP+T ++L LR E++ + Y++I
Sbjct  238   PPEFWILPSFLPVHPAKMWCYCRTVYMPMSYLYGKRFVGPITPLILQLREELYDQPYDEI  297

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
             +W + R  C KEDLYYPH  +QDL+W++L  CTEP + RWPF K+R  A+   +K++ YE
Sbjct  298   NWKKVRHVCAKEDLYYPHPLVQDLMWDSLYICTEPLLTRWPFNKLRNKALEVTMKHIHYE  357

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYIT+GC+EK L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M G GSQ+WD
Sbjct  358   DENSRYITMGCVEKVLSMLACWVEDPNGDHFKKHLARIPDYLWVAEDGMKMQGCGSQSWD  417

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
             A+ A QA++AS M +E  D LRK H +IK+SQVK+NP GDFK MYRH++KGSW F+DQDH
Sbjct  418   ASLAIQALLASEMNDEISDTLRKGHDFIKQSQVKDNPSGDFKGMYRHISKGSWAFADQDH  477

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE L C LL   MP +++GE  D  RLY++V+V L LQS ++GG A WEP  
Sbjct  478   GWQVSDCTAEALTCCLLFSTMPPELVGEAMDPVRLYDSVNVILSLQS-KNGGLAGWEPAG  536

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                YL++LNP+E F DIV+E EH+E T S I ALV F+  YP +R  EV+  I   V+Y+
Sbjct  537   AAEYLELLNPTEFFEDIVIEHEHVECTSSAIQALVRFKKIYPGHRTTEVDNFINNGVKYI  596

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q+ DGSWYG WGVCF+Y ++FAL GL A G SY NC AV     F L  Q  +GGWG
Sbjct  597   EDVQKPDGSWYGNWGVCFIYASWFALGGLAAVGLSYRNCAAVRKGVEFLLRTQRSDGGWG  656

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E  +SCP   Y  LE   +NLVQT+WA++GL+++GQ +RDP PLHRAAKLLIN+QMEDGD
Sbjct  657   ESYRSCPDKVYRELETEHSNLVQTAWALMGLIHSGQVDRDPRPLHRAAKLLINSQMEDGD  716

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ+I GV+++NCM+HYAS+R+ FPL  L+EYR+ V
Sbjct  717   FPQQEIIGVFLRNCMMHYASYRNIFPLWGLAEYRRNV  753



>ref|XP_010027674.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Eucalyptus grandis]
Length=755

 Score =   937 bits (2422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/757 (58%), Positives = 552/757 (73%), Gaps = 11/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EG  GPY+YSTNNY GRQ W++DP AGT EE    E AR+ F   R +    C
Sbjct  1     MWRLKIAEGEDGPYLYSTNNYVGRQTWKFDPEAGTTEEHAQVEAARQHFYDHRHQ-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ ++E +    +IPPVR+ + EE+ Y+  +TA+R+ V    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREQQFKQ-AIPPVRVEDGEEITYDKASTALRRTVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPL+F PPL++ +YI+G ++ +  +EH+KE++RYLYNHQNEDGGWG +I+GHSTM  +
Sbjct  119   IAGPLYFLPPLVMCVYITGHLNTVFPAEHRKEILRYLYNHQNEDGGWGFHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDGD-GAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEGPD G   A  R RKWILD GG T IPSWGK +LS+ G+++W G NP+
Sbjct  179   ALSYICMRILGEGPDGGQYNACTRARKWILDRGGVTYIPSWGKTWLSIFGLFDWSGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCRT YMPMSYLY KR+ GP+T  V  LR E+H + Y+ I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRTVYMPMSYLYGKRFVGPITPFVQQLRKELHTQPYDMI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
              W + R  C KEDLYYPH  +QDL+W++L    EP +  WPF ++RE A++  +K++ YE
Sbjct  299   CWRKVRHLCAKEDLYYPHPLVQDLIWDSLYIFIEPLLNHWPFNRLREKALQVTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDP+ D  K HLAR+PDYLW+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPDSDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
               FA QA++AS M EE G  L + H +IK+SQVK+NP GDFKSM+RH+TKGSWTFSDQDH
Sbjct  419   TGFAIQALLASNMTEEIGPVLARGHDFIKKSQVKDNPSGDFKSMHRHITKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC LL   MP +I+GEK   +RLY+AV++ L LQS ++GG   WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLFSMMPPEIVGEKMKPERLYDAVNILLSLQS-KNGGLPAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +L      E F DIV+E E++E T S I ALV FR  YP +R KE+   I+ +V+YL
Sbjct  538   APAWL------EFFEDIVIEHEYVECTSSAIQALVLFRKLYPEHREKEIEDFISNSVEYL  591

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+     F L  Q Q+GGWG
Sbjct  592   ENVQLPDGSWYGCWGVCFTYGSWFALGGLAAAGKTYSNCAAMRKGVAFLLRTQLQDGGWG  651

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP   Y+PLEG  +NLVQT+WAM+GL+  GQAERDPTPLHRAAKLLIN+QMEDGD
Sbjct  652   ESYLSCPKKEYVPLEGNRSNLVQTAWAMMGLIQAGQAERDPTPLHRAAKLLINSQMEDGD  711

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             +PQQ++TGV+ KNCMLHY ++R+ +PL AL+EYR RV
Sbjct  712   YPQQELTGVFNKNCMLHYPNYRNTYPLWALAEYRTRV  748



>ref|XP_009591746.1| PREDICTED: beta-amyrin synthase-like [Nicotiana tomentosiformis]
Length=761

 Score =   937 bits (2422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/757 (59%), Positives = 558/757 (74%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKI +G  GPY+YSTNNY GRQIW +DPNAG+PEE+   E+AR+ F   R K     
Sbjct  1     MWKLKIAQGQDGPYLYSTNNYVGRQIWAFDPNAGSPEERAEIEEARQQFWNNRYK-IKPS  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ ++        IP V++ E EE+  E  TT++R+AV    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLRGKTFKQ-KIPAVKVEEGEEITDEVATTSLRRAVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NGGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEGPD G + A AR RKWILDHG  T IPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGPDGGVNNACARARKWILDHGSVTAIPSWGKTWLSILGVFEWLGTNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCY R  YMPMSYLY KR+ GP+T ++L LR E++ + Y +I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYTRMVYMPMSYLYGKRFVGPITPLILQLRGELYDQPYREI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
             +W + R  C KEDL+YPH  +QDL+W+ L  CTEP + RWPF K+R  A+   +K++ YE
Sbjct  299   NWKKVRHLCAKEDLFYPHPLVQDLMWDILYICTEPLLTRWPFNKLRNKALEVTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW+AEDGM + G GSQ WD
Sbjct  359   DESSRYITIGCVEKVLCMLACWVEDPNGDCFKKHLARIPDYLWVAEDGMKLQGLGSQLWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
              AFA QA++AS M +E  D LRK H +IK+SQVKENP GDF+ MYRH++KGSWTFSDQDH
Sbjct  419   TAFAIQALLASEMNDEISDTLRKGHDFIKKSQVKENPSGDFRGMYRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE L C LL   MP +++GE  +   LY+AV+V L LQS ++GG + WEP  
Sbjct  479   GWGVSDCTAEALTCCLLFSTMPSELVGEAMEPALLYDAVNVILSLQS-KNGGLSVWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                YL++LNP+E FADIV+E E++E TGS I ALV F+  YP +R  EV+  I  AV+Y 
Sbjct  538   ASEYLELLNPTEFFADIVIEHEYVECTGSSIQALVLFKKLYPGHRTNEVDNFIDNAVKYF  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSWYG WGVCF+Y ++FAL GL AAGKSY NC AV     F L  Q  +GGWG
Sbjct  598   EDVQMPDGSWYGCWGVCFIYASWFALGGLAAAGKSYSNCAAVRKGVEFLLRTQRSDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E  +SCP   Y  LE   +NLVQT+WA++GL+++GQ +RDP PLHRAA+LLIN+Q+EDGD
Sbjct  658   ESYRSCPDKVYRELETDNSNLVQTAWALMGLIHSGQVDRDPRPLHRAARLLINSQLEDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ++TGV+MKNCMLHYA +R+ FPL  L+EYRK V
Sbjct  718   FPQQELTGVFMKNCMLHYALYRNIFPLWGLAEYRKNV  754



>gb|KEH17471.1| beta-amyrin synthase [Medicago truncatula]
Length=763

 Score =   937 bits (2422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/759 (57%), Positives = 568/759 (75%), Gaps = 7/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EGG  PY++STNN+ GRQ WEYDP AG+ EE+   E+ARK F   R K    C
Sbjct  1     MWRLKIAEGGNNPYLFSTNNFVGRQTWEYDPEAGSEEERAQVEEARKNFYNNRFK-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  R Q++KE+     +I  V++ +EEE+ YE  TTA+R+      ALQ  DGHWPA+
Sbjct  60    GDLLWRFQVLKENNFKQ-TIAGVKIEDEEEITYEKATTALRRGTHHLAALQTSDGHWPAQ  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPLF+ PPL+  LYI+G +D +   EH+KE++RY+Y HQNEDGGWGL+I+GHS M  +
Sbjct  119   IAGPLFYVPPLVFCLYITGHLDSVFPPEHRKEILRYIYCHQNEDGGWGLHIEGHSIMFST  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             ALNY+ +R+LG+GPD G + A AR R WI  HGG T IPSWGK +LS+LG+++W G NP+
Sbjct  179   ALNYICMRILGQGPDGGQNNACARARHWIRVHGGVTHIPSWGKTWLSILGLFDWSGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFWL PS  P HPAKMWCYCR  Y+PMSYLY KR+ GP+T +VL LR E+H + Y ++
Sbjct  239   PPEFWLLPSFLPMHPAKMWCYCRLVYLPMSYLYGKRFVGPITPLVLQLREELHTQPYGKV  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W +AR  C KED+YYPH  IQDL+W++    TEP + RWPF K +RE A++ A+K++ Y
Sbjct  299   NWKKARHLCAKEDIYYPHPLIQDLIWDSFYLFTEPLLTRWPFNKLVREKALQVAMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYIT+ C+EK+L M+  W EDPNGD  K HLARVPDYLW++EDGM+M   GSQ W
Sbjct  359   EDENSRYITVACVEKALCMLACWVEDPNGDAFKKHLARVPDYLWISEDGMTMQSLGSQGW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             + +F+ QA++A+G+ EE G  L K H +IK+SQV +NP GDFKSMYRH++KGSWTFSDQD
Sbjct  419   NTSFSVQALLATGLTEEIGPVLAKGHDFIKKSQVSDNPSGDFKSMYRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSD TAE LKC LLL   P   +GEK + +RLY++V++ L LQ  ++GG A WEP 
Sbjct  479   HGWQVSDSTAEGLKCCLLLSMFPPATVGEKMEPERLYDSVNLLLSLQG-KNGGLAAWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L++LNP+E+F D+V+E E++E TG+ I ALV F+  YP +R  E++  IA AV++
Sbjct  538   GGQEWLELLNPTELFEDMVIEHEYVECTGTTIEALVLFKKLYPGHRKNEIDNLIANAVRF  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q++DGSWYG WG+CF YG++FAL GL AAGK+Y NC+A+  A  F L+ Q  +GGW
Sbjct  598   LEDTQKTDGSWYGSWGICFTYGSWFALGGLAAAGKNYTNCDAIRKAVKFLLTIQRNDGGW  657

Query  452   GECLQSCPSMRYIPLEGTG-TNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             GE   SCP   Y+PLEG+  +N+VQT+WA++GL++ GQAE DPTPLHRAAKLLIN+Q++ 
Sbjct  658   GESYLSCPKKVYVPLEGSQESNVVQTAWALMGLIHAGQAETDPTPLHRAAKLLINSQLKQ  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GD+PQQ++TGV+MKNCMLHY  +R+ FPL AL+EYR+RV
Sbjct  718   GDWPQQELTGVFMKNCMLHYPMYRNIFPLWALAEYRRRV  756



>ref|XP_006374734.1| hypothetical protein POPTR_0014s00350g [Populus trichocarpa]
 gb|ERP52531.1| hypothetical protein POPTR_0014s00350g [Populus trichocarpa]
Length=762

 Score =   937 bits (2421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/758 (58%), Positives = 566/758 (75%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EG    Y+YSTN + GRQ WEYDP  G+PEE+   E+AR  F   R +     
Sbjct  1     MWRLKIAEGSSNDYLYSTNKFVGRQTWEYDPEGGSPEERAEVEEARLNFYNNRYE-VKPS  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ +KE      +I  V++ E EE+ YE  TT +++AV    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLKEKNFKQ-TIAQVKIEEGEEITYEKATTTLKRAVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFF PPL++ LYI+G +D I ++EH++E++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCLYITGHLDSIFSAEHRREILRYIYYHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              L+Y+ +R+LGEGP+ G D A AR RKWI +HG  T IPSWGK +LS+LGV++W G NP+
Sbjct  179   VLSYICMRILGEGPNGGQDNACARARKWIHEHGTVTHIPSWGKTWLSILGVFDWSGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFWL P+  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y QI
Sbjct  239   PPEFWLLPTFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAEPYNQI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W + R  C  EDLYYPH  IQDL+W++L   TEPF+ RWPF K +R+ A+   +K++ Y
Sbjct  299   NWKKTRHLCAAEDLYYPHPLIQDLIWDSLYVFTEPFLTRWPFNKLVRKKALEVTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDP+G   K HLAR+PDYLW+AEDGM M  FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWVEDPDGISFKKHLARIPDYLWVAEDGMKMQSFGSQQW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D  FA QA++AS   +E GD L++ H +IK+SQVK+NP GDFKSMYRH++KGSWTFSDQD
Sbjct  419   DTGFAIQALLASNFTDEIGDVLKRGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE +KC LL   MP +I+G+K + +RL+++V++ L LQS E+GG A WEP 
Sbjct  479   HGWQVSDCTAEGMKCCLLFSMMPPEIVGQKLEPERLFDSVNILLSLQS-ENGGLAAWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP+E FADIV+E E++E T S I ALV F+  YP +R KE++  I  AV+Y
Sbjct  538   GAHKWLELLNPTEFFADIVIEHEYVECTASAIQALVLFKKLYPGHRKKEIDNFITNAVRY  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q  +G WYG WGVCF YGT+FAL GL A+GK+Y+NC A+    +F L+ Q  +GGW
Sbjct  598   LESIQTPEGGWYGNWGVCFTYGTWFALGGLAASGKTYDNCTAMQKGLNFLLNIQKDDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP+ +YIPLEG  +NLV T+WAM+GL+Y GQ +RD TPLHRAAKL+IN+Q+EDG
Sbjct  658   GESYFSCPNKKYIPLEGNRSNLVHTAWAMMGLIYAGQMDRDITPLHRAAKLIINSQLEDG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITGV+MKNCMLHYA++R+ +P+ +L+EYR+RV
Sbjct  718   DFPQQEITGVFMKNCMLHYAAYRNIYPMWSLAEYRRRV  755



>gb|ABL07607.1| beta-amyrin synthase [Polygala tenuifolia]
Length=762

 Score =   937 bits (2421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/758 (56%), Positives = 568/758 (75%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LK+GEG   PY++STN+Y GRQ WE+DP+AGTPEE+   E AR+ F   R +    C
Sbjct  1     MWRLKVGEGKNDPYLFSTNDYTGRQTWEFDPDAGTPEERAEVEAARQAFYDNRFQF-KNC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  R Q +++      +IP V++ + +++ YE  T  VR+A      LQ+  GHWPA+
Sbjct  60    GDLLWRFQFLRDKNFKQ-TIPKVKVEDGQQITYEMATDTVRRAAHHLGGLQSSHGHWPAQ  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPLFF PPL+  LYI+G ++ +   EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFMPPLVFCLYITGHLNTVFPEEHRKEILRYIYYHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEGP+ G + A  R RKWILDHGG T IPSWGK +LSVLG+++W G NP+
Sbjct  179   ALSYICMRMLGEGPEGGLNNACVRARKWILDHGGVTHIPSWGKTWLSVLGIFDWSGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++  LR E+  + +E+I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLIKQLREELFTQPFEEI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W +AR  C  ED+YYPH ++QDL+W+ L  C+EP + RWPF K IRE A++  +K++ Y
Sbjct  299   NWKKARHQCASEDIYYPHPWVQDLIWDTLYICSEPLLTRWPFNKLIREKALQVTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLARVPDYLWL+EDGM +  FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWVEDPNGDAYKKHLARVPDYLWLSEDGMCVQSFGSQEW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA FA QA++A+ +V+E    L K H +IK+SQVK+NP GDFKSM+RH++KGSWTFSDQD
Sbjct  419   DAGFAVQALLAANLVDEIAPVLAKGHDFIKKSQVKDNPSGDFKSMHRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LK  L +  +P +I+GEK + +RL+++V+V   LQS + GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKVCLQMSLLPPEIVGEKMEPERLFDSVNVLFSLQS-KKGGLAAWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L++LNP+E FADIVVE E++E TGS I ALV F+  YP +R KE++  I  AV++
Sbjct  538   GAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIDNFIINAVRF  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q +DGSWYG WGVCF YG++FAL GL AAGK++ NC A+  A HF L+ Q ++GGW
Sbjct  598   LEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTFSNCAAIRKAVHFLLTTQKEDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   S P   Y+PLE + +N+VQT+WAM+GL++ GQA+RDPTPLHRAAKLLINAQ+E+G
Sbjct  658   GESYLSSPKKIYVPLEISRSNVVQTAWAMMGLIHAGQADRDPTPLHRAAKLLINAQLENG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             D+PQQ++TGV+MKNCMLHY  +R+ +P+ AL+EY++RV
Sbjct  718   DWPQQEVTGVFMKNCMLHYPMYRNIYPMWALAEYKRRV  755



>ref|XP_010537755.1| PREDICTED: camelliol C synthase-like isoform X1 [Tarenaya hassleriana]
Length=762

 Score =   936 bits (2420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/758 (59%), Positives = 563/758 (74%), Gaps = 7/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG--GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLKI EG    PY+ STNN+ GRQ W+YDP+AGTPEE++A E AR+ F   R +   +
Sbjct  1     MWKLKIAEGDEEDPYLKSTNNFLGRQTWDYDPDAGTPEERDAVEDARRNFYDNRSRVKAS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ +KE +    +IP V++ +  ++ YEA+T AVR+ V    ALQA DGHWPA
Sbjct  61    -SDLLWRMQFLKEKKFKQ-AIPQVKVEDALKITYEAVTDAVRRGVHFFSALQADDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL+  LYI+G +D I T++H+KE+ RY+Y HQNEDGGWGL+I+GHS M  
Sbjct  119   ENAGPLFFLPPLVFCLYITGHLDEIFTADHRKEIFRYIYCHQNEDGGWGLHIEGHSIMFS  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ +R+LGEGPD G + A  R R+WILDHGG T IPSWGK +LS+LGVY+W G NP
Sbjct  179   TALNYICMRILGEGPDGGQENACKRARQWILDHGGVTYIPSWGKTWLSILGVYDWSGSNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T +VL LR E++V+ Y +
Sbjct  239   MPPEFWILPSFVPVHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLVLQLRKELYVQPYSK  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYMR  1356
             I+WN AR  C KED Y PH  IQD LW+ L   TEPF+  WPF K+ RE A++ A+K++ 
Sbjct  299   INWNIARHLCAKEDAYCPHPLIQDFLWDCLYVFTEPFLLCWPFNKLLREKALQAAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGCIEK L M+  W EDPNGD  K HLARVPDYLW+AEDGM M  FGSQ 
Sbjct  359   YEDENSRYITIGCIEKVLCMLACWVEDPNGDHFKKHLARVPDYLWIAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS +  E  D LRK H ++K+SQV ENP  DFK MYRH++KG+WTFSD+
Sbjct  419   WDTGFAIQALLASNLSNEIPDILRKGHDFMKKSQVGENPSCDFKGMYRHISKGAWTFSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW  SDCTAE  KC LL   M  +I+G K D Q+LYE+V++ L LQS ++GG   WEP
Sbjct  479   DHGWQASDCTAEGFKCCLLFSMMSPEIVGSKMDPQQLYESVNILLSLQS-KNGGVTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP+E+FADIVVE E+ E T S I ALV F+  +PN+  KE+N  I KAV+
Sbjct  538   ARGQNWLELLNPTEVFADIVVEHEYNECTSSAIQALVLFKQLHPNHMTKEINSFIKKAVR  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             Y+E  Q  DGSWYG WGVCF Y T+FAL GL AAGK+Y++C A+    HF L+ Q   GG
Sbjct  598   YIENIQMPDGSWYGSWGVCFTYSTWFALAGLAAAGKTYKSCLAIQKGVHFLLTTQKDNGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYIPLEG  +NLVQT+WAM+GL++ GQ ERDP PLHRAAKL+IN+Q+E+
Sbjct  658   WGESYLSCPRKRYIPLEGERSNLVQTAWAMMGLIHAGQGERDPVPLHRAAKLIINSQLEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKR  162
             GDFPQQ+ITG +MKNC+LHYA++R+ FPL AL++YR++
Sbjct  718   GDFPQQEITGAFMKNCLLHYATYRNTFPLWALADYRRQ  755



>gb|ACM89978.1| putative beta amyrin synthase [Malus domestica]
Length=762

 Score =   936 bits (2420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/759 (58%), Positives = 570/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MWKLK+ +GG  PYIYSTNN+ G QI+E+DP AGT EE+   E+AR  F   R Q  P  
Sbjct  1     MWKLKVADGGNDPYIYSTNNFVGMQIFEFDPEAGTTEERAEVEEARLHFYNNRYQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GDL  RMQ ++E      +IPP ++ + EE+ +E  T ++R++V    ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLREKNFKQ-TIPPFKVEDGEEITHEKATASLRRSVHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCVYITGHLNTVFHAEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +AL+Y+ +R+LGEGPD G D A AR RKWILDHG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TALSYICMRILGEGPDGGQDNACARARKWILDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y++
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W   R  C KED+YYPH +IQD LW++L  CTEP + RWPF K IR+ A+   +K++ 
Sbjct  298   INWKGVRHHCAKEDIYYPHPWIQDFLWDSLYICTEPLLTRWPFNKLIRKRALDVTMKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  WAEDPNGD  K HLAR+PDYLW+AEDG+ M  FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGLKMQSFGSQL  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD   A QA++AS + +E    L + H ++K+SQVK+NP GDFKSM+RH++KGSWTFSDQ
Sbjct  418   WDTGCAIQALLASNLTDEIAPTLARGHDFVKKSQVKDNPSGDFKSMHRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSD TA+ LKC LLL  MP +++GE+ + +RLY+AV+V + LQS ++GG A WEP
Sbjct  478   DHGWQVSDSTADGLKCCLLLSMMPPEMVGEQMEPERLYDAVNVIISLQS-KNGGLAAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+E FADIVVE E++E T S I ALV F+  YP +R KE++  I  A Q
Sbjct  537   AGAADWLEMLNPTEFFADIVVEHEYVECTSSAIQALVLFKKLYPGHRKKEIDQFITNAAQ  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q +DGSWYG WGVCF YGT+FAL GLTAAGK++ NC  +  A  F L+ Q + GG
Sbjct  597   YLENTQMADGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCAVIRKAISFLLTIQKENGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP   Y+PLEG  +NLV T+WAM+GL++ GQAERDPTPLHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIHAGQAERDPTPLHRAAKLIINSQMEN  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITGV MKNCMLHYA++R+  PL AL+EYRKRV
Sbjct  717   GDFPQQEITGVIMKNCMLHYAAYRNIHPLWALAEYRKRV  755



>ref|XP_010696136.1| PREDICTED: beta-amyrin synthase-like [Beta vulgaris subsp. vulgaris]
Length=764

 Score =   936 bits (2418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/759 (58%), Positives = 559/759 (74%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LK+GEG   PY+YSTNN+ GRQ WE+DPN GTPE  E  E+AR+ F   R K    C
Sbjct  1     MWRLKVGEGANDPYLYSTNNFVGRQTWEFDPNYGTPEAIEEVEQARRNFYDNRFK-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  R+Q ++E      +IP V++ +EEE+ YE  TT +++AV    ALQ++ GHWPAE
Sbjct  60    GDLLWRLQFLREKNFKQ-TIPQVKVGDEEEITYETATTTLKRAVNYFTALQSEHGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GP FF PPL+  LYI+G ++ +   EH++E++R +Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPQFFLPPLVFCLYITGHLNSVFGPEHRREILRSIYYHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDGD-GAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             ALNY+ LR+LG GPD+GD  A  R RKWILDHG  T IPSWGK +LS+LG+++W G NP+
Sbjct  179   ALNYICLRMLGIGPDEGDDNACPRARKWILDHGSVTHIPSWGKTWLSILGLFDWSGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+  P+T ++  LR E++ K YEQI
Sbjct  239   PPEFWIIPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVAPITPLIEQLREELYDKPYEQI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
              W + R  C  EDLYYPH  IQDL+W+ L   TEPF+ RWP  K IR+ A+   +K++ Y
Sbjct  299   SWKKVRHLCAPEDLYYPHPLIQDLMWDTLYIFTEPFLTRWPLNKLIRKKALEVTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLARV DY+W+AEDG+ M  FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWVEDPNGDHFKKHLARVADYIWIAEDGLKMQSFGSQEW  418

Query  1172  DAAFATQAIIASGM-VEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             D  F+ QA++AS + ++E G  L+K HF+IKESQVK+NP GDFKSM+RH++KGSWTFSDQ
Sbjct  419   DCGFSVQALLASNLSLDEIGPALKKGHFFIKESQVKDNPSGDFKSMHRHISKGSWTFSDQ  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC L+L  MP +I+GEK D +RL+++V+V L LQS   GG A WEP
Sbjct  479   DHGWQVSDCTAEGLKCCLILSTMPPEIVGEKMDPERLFDSVNVLLSLQS-NKGGLAAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP+E F DIVVE E++E T S I ALV F+  YP +R KE+   I  AV+
Sbjct  538   AGAQEWLELLNPTEFFEDIVVEHEYVECTASAIQALVLFKKLYPGHRKKEIENFIINAVK  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             +LE  Q  +G WYG WG+CF+YGT+FAL GL AAGK+Y NC AV     F L+ Q ++GG
Sbjct  598   FLENTQYPNGGWYGNWGICFIYGTWFALGGLAAAGKTYYNCGAVRKGVEFLLTTQKEDGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP   ++PLEG  +NLVQT WA++GL++ GQ ERD TPL RAAKLLIN+Q+E+
Sbjct  658   WGESYISCPDKEFVPLEGK-SNLVQTGWALMGLLHAGQVERDLTPLRRAAKLLINSQLEN  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITGV+MKNCMLHY  +R+ +PL AL+EYRKRV
Sbjct  717   GDFPQQEITGVFMKNCMLHYPMYRNIYPLWALAEYRKRV  755



>ref|XP_010472733.1| PREDICTED: amyrin synthase LUP2 isoform X1 [Camelina sativa]
Length=763

 Score =   936 bits (2418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/761 (56%), Positives = 568/761 (75%), Gaps = 7/761 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LKIGEG G  PY++S+NN+ GRQ WE+DP AGTPEE+ A E+AR+ F   R +    
Sbjct  1     MWRLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTPEERAAVEEARRKFVDNRSR-VKG  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             C DL  RMQ +KE++ + + IPPV++ + E + ++  T A+R+ V    ALQA DGHWP 
Sbjct  60    CSDLLWRMQFLKEAKFEQV-IPPVKIDDGEGITHQNATDALRRGVSFFSALQASDGHWPG  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +GPLFF PPL+  LYI+G ++ +  +EH+KE++R++Y HQNEDGGWGL+I+  S M  
Sbjct  119   EITGPLFFLPPLVFCLYITGHLEKVFDAEHRKEMLRHIYCHQNEDGGWGLHIESKSMMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ LRLLGEGPD G D A  R R WILD GG T IPSWGKI+LS+LG+Y+W G NP
Sbjct  179   TALNYICLRLLGEGPDGGRDNACKRARDWILDRGGVTYIPSWGKIWLSILGIYDWSGTNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PE WL PS  P H  K+ CYCR  YMPMSYLY KR+ GP+T ++L LR E+H++ Y+ 
Sbjct  239   MPPEIWLLPSFLPIHLGKVLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPYKS  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+WN++R    KED+Y+PH  +QDL+W+AL    EPF+ RWP  K +RE A+R+A+K++ 
Sbjct  299   INWNKSRRLYAKEDMYFPHPLVQDLVWDALYVFVEPFLTRWPLNKLVREKALRRAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E + YITIGC+EK L M+  W E+PNGD  K HLAR+PDY+W+AEDGM M  FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QAI+AS + +E GD L+K H YIK+SQ++ENP GD++SMYRH++KG+WT SD+
Sbjct  419   WDTGFAVQAILASDLSDETGDVLKKGHDYIKKSQIRENPSGDYESMYRHISKGAWTLSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE  KC LLL  MP +++G+K D ++LY++V++ L  QS + GG   WEP
Sbjct  479   DHGWQVSDCTAEAFKCCLLLSMMPAEVVGQKMDPEQLYDSVNLLLSFQS-DKGGMTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  ++++LNP+E  A++VVE E++E T S++ ALV F+  YP+++ KE++ SI KAVQ
Sbjct  538   VRAYEWIELLNPTEFLANLVVEREYVECTSSVMKALVLFKQLYPDHKTKEISRSIEKAVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             +LE +Q  DGSWYG+WGVCF+Y T+F L GL AAGK+Y+N +A+     F L+ Q  +GG
Sbjct  598   FLENEQRPDGSWYGFWGVCFIYATWFGLGGLAAAGKTYQNSQAIRKGVEFLLTTQKDDGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYIP EG  +NLVQT+WA++GL+  GQAERDP PLHRAAKL+IN+QME+
Sbjct  658   WGESYLSCPEQRYIPSEGKSSNLVQTAWAIMGLINAGQAERDPIPLHRAAKLIINSQMEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVWT  153
             GDFPQQ+I GV+MKNC+ HYA++R+ FPL AL+EYRK V+ 
Sbjct  718   GDFPQQEIVGVFMKNCLTHYATYRNTFPLWALAEYRKAVFV  758



>ref|XP_010655243.1| PREDICTED: beta-Amyrin Synthase 1 [Vitis vinifera]
 emb|CBI18392.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   936 bits (2418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/754 (58%), Positives = 557/754 (74%), Gaps = 7/754 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   E AR+ F K R Q  P +
Sbjct  1     MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERNEVEAARENFWKNRYQVKPSS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E      +IP V++ + E + YE  T A+R++     ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-TIPQVKVGDGEAITYETATIALRRSAHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             ENSGPL+F PPL++ LYI+G +D++   E  KE++RYLY HQNEDGGWG +I+G STM  
Sbjct  118   ENSGPLYFLPPLVMCLYITGHLDIVFPGEFLKEILRYLYCHQNEDGGWGFHIEGQSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + L+Y+ +R+LGEG D G D A ARGRKWI D GG T IPSWGK +LS+ G+++W G NP
Sbjct  178   TTLSYICMRILGEGRDGGRDNACARGRKWIHDRGGVTSIPSWGKTWLSLFGLFDWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFWL PS  P HPA+M+CY R  YMPMSYLY KR+ GP+T +VL LR E+ ++ Y +
Sbjct  238   MPPEFWLLPSFLPMHPARMFCYSRMVYMPMSYLYGKRFIGPITPLVLELREELFLQPYNE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I+W + R  C KEDLYYPH  IQDL+W++L  CTEP + RWPFKK+R+ A+   +K++ Y
Sbjct  298   INWKKVRHLCAKEDLYYPHPLIQDLMWDSLYICTEPLLTRWPFKKLRKKALEVTMKHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDY+W+AEDG+ M  FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGIKMQSFGSQEW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D +FA QA++A  M +E G  L+K H +IKESQVK+NP GDFKSMYRH++KGSWTFSDQD
Sbjct  418   DTSFALQALLACNMTDELGLALKKGHEFIKESQVKDNPSGDFKSMYRHISKGSWTFSDQD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LL   M  KI+G K + +RL+++V++ L LQS ++GG A WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSMMAPKIVGMKMEPERLFDSVNILLSLQS-KNGGLAAWEPA  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP+E F DIV+E E++E T S I ALV F+  YP +R  E++  I  A +Y
Sbjct  537   GASKWLELLNPTEFFTDIVIEHEYVECTASAIQALVLFKKLYPGHRKNEIDNFITNAAKY  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E  Q  DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+  A  F L  Q  +GGW
Sbjct  597   IEDMQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYHNCLAIGRAVEFLLKSQRDDGGW  656

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP  +Y PL+G  +NLVQT WA++GL+ +GQAERDPTPLH+AAKLLIN+QMEDG
Sbjct  657   GENCTSCPDKKYTPLKGNRSNLVQTGWALMGLLSSGQAERDPTPLHKAAKLLINSQMEDG  716

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEY  171
             DFPQQ+ITG +MKNCMLHYA++R+ FPL AL++Y
Sbjct  717   DFPQQEITGAFMKNCMLHYATYRNTFPLWALAQY  750



>ref|XP_006425178.1| hypothetical protein CICLE_v10027855mg [Citrus clementina]
 gb|ESR38418.1| hypothetical protein CICLE_v10027855mg [Citrus clementina]
Length=785

 Score =   935 bits (2417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/767 (58%), Positives = 568/767 (74%), Gaps = 17/767 (2%)
 Frame = -3

Query  2423  MWKLKIGEGGG---PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2253
             MWKLK+GEG G    YIYSTNNYAGRQIW++DP AG+ EE+   E AR  F   R     
Sbjct  1     MWKLKVGEGNGEKDAYIYSTNNYAGRQIWQFDPEAGSDEERAQVEAARLHFYNNRDHLKP  60

Query  2252  TCGDLFMRMQMIKESEVDVLSIPPVRLR---EEEEVNYE-AITTAVRKAVRLNCALQAKD  2085
             +  DL  RMQ +KE +    +IP V+++   +EEE+ YE A TTA+R+ VR   ALQA D
Sbjct  61    S-ADLLWRMQFLKEKKFKQ-TIPQVKIKVDGDEEEITYETAATTALRRGVRFFSALQAID  118

Query  2084  GHWPAENSGPLFFTPPLMIALYISGSIDMIL--TSEHKKELVRYLYNHQNEDGGWGLYID  1911
             GHWPAEN+GPLFF PPL++ LYI+G ++ +    SEH+KE++RY++ HQNEDGGWGL+I+
Sbjct  119   GHWPAENAGPLFFLPPLVMCLYITGHLNTVFPAESEHRKEILRYIHYHQNEDGGWGLHIE  178

Query  1910  GHSTMIGSALNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYE  1731
             GHSTM  +ALNY+ LR+LG+ P     A A  R WILD GG T IPSWGKI+LS+LGV++
Sbjct  179   GHSTMFCTALNYICLRILGQPPHHI--ACATARNWILDRGGVTLIPSWGKIWLSILGVFD  236

Query  1730  WDGCNPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIH  1551
             W GCNP+ PEFW+ PS  P HP KMWCYCR  YMPMSYLY KR+ G +T +V+ LR E++
Sbjct  237   WSGCNPMPPEFWILPSFLPMHPGKMWCYCRMVYMPMSYLYGKRFVGAITPLVVELRQELY  296

Query  1550  --VKSYEQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAM  1380
               V+ Y +++W +AR  C KED YYPH +IQDL+W+ L   TEP + RWPF K IRE A+
Sbjct  297   PEVEPYHKVNWGKARHLCAKEDAYYPHPWIQDLIWDTLYVFTEPLLTRWPFSKFIREKAL  356

Query  1379  RKAIKYMRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMS  1200
             +  + ++ YE   +RYITIGC+EK L M+  W E PNGD  K HLAR+PDYLW+AEDGM 
Sbjct  357   QVTMDHIHYEDHNSRYITIGCVEKVLCMLACWVEHPNGDSFKKHLARIPDYLWVAEDGMK  416

Query  1199  MHGFGSQNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTK  1020
             M  FGSQ WD  FA QA++AS +++E G  L++ H +IK SQVK+NP GDFK MYRH++K
Sbjct  417   MQSFGSQQWDTGFAIQALLASNLIDEIGPVLKRGHEFIKASQVKDNPSGDFKRMYRHISK  476

Query  1019  GSWTFSDQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPES  840
             GSWTFSDQDHGW VSDCTAE LKC LLL  MP +I+GEK + +RLY++V++ L LQS + 
Sbjct  477   GSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPTEIVGEKMEPERLYDSVNLLLSLQS-KI  535

Query  839   GGFATWEPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVN  660
             GG   WEP     +L++LNP+E FADIV+E E++E T S I AL  F   YP +R KE++
Sbjct  536   GGLPAWEPVGAHKWLELLNPTEFFADIVIEHEYVECTSSAIQALTMFSKLYPGHRKKEID  595

Query  659   ISIAKAVQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFL  480
               I KA+ YLE  Q +DGSWYG WGVCF YGT+FAL GL AAGK+Y N   V  A HF L
Sbjct  596   KFIGKAIGYLEDAQMADGSWYGCWGVCFTYGTWFALGGLAAAGKTYTNSPTVRKAVHFLL  655

Query  479   SKQNQEGGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKL  300
             + Q Q GGWGE  +SCP  +YIPLEG  +NLVQT+WAM+GL++ GQAERDPTPLHRAAKL
Sbjct  656   NSQTQNGGWGESFRSCPQKKYIPLEGNRSNLVQTAWAMMGLLHAGQAERDPTPLHRAAKL  715

Query  299   LINAQMEDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             LIN+Q+EDGDFPQ++ITGV+M+NCMLHYA++R+ +PL AL+EY +++
Sbjct  716   LINSQLEDGDFPQEEITGVFMRNCMLHYAAYRNIYPLWALAEYCRKL  762



>gb|AGA17940.1| beta-amyrin synthase [Withania somnifera]
Length=762

 Score =   935 bits (2416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/758 (58%), Positives = 561/758 (74%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKI +G  GPY+YSTNNY GRQ WE+DPNAGT EE+   E+AR+ F   R K   + 
Sbjct  1     MWKLKIAKGQDGPYLYSTNNYIGRQTWEFDPNAGTAEERAEIEEARQQFWNNRYKVKPS-  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  RMQ + E       IP V++ E EE+++E  T A+R+AV    ALQA DGHWPAE
Sbjct  60    SDLLWRMQFLGEKNFKQ-GIPAVKVEEGEEISHEVATNALRRAVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCMYITGHLNSVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEGP  G + A AR RKWILDHG  T IPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGPYGGKNNACARARKWILDHGSVTAIPSWGKTWLSILGVFEWIGTNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+FPS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y +I
Sbjct  239   PPEFWIFPSFLPVHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLRVELYDQPYNEI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
             +W + R  C KEDLYYPH  +QDL+W++L  CTEP + RWPF K+R  A++  +K++ YE
Sbjct  299   NWKKVRHVCAKEDLYYPHPLVQDLMWDSLYICTEPLLTRWPFNKLRNKALQVTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDPNGD  K HL+R+PDYLW+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPNGDYFKRHLSRIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGD-CLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
               FA QA++A+ M  E  D  LRK H +IK+SQVK+NP GDFK MYRH++KGSWTFSDQD
Sbjct  419   TGFAIQALLATEMNNEIADTTLRKGHDFIKQSQVKDNPSGDFKGMYRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW  SD TA+ L+C LL   MP +++GE  +  RLY++V+V L LQS ++GG A WEP 
Sbjct  479   HGWQASDTTAKALRCCLLFSMMPSELVGEAIEPARLYDSVNVILSLQS-KNGGLAAWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 YL++LNP+E FADIV+E E++E T S I AL+ F+  YP  R KE+N SI  AV+Y
Sbjct  538   GASEYLELLNPTEFFADIVIEHEYVECTASSIQALILFKKLYPGKRTKEINNSIHNAVKY  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q  DGSWYG WGVCF YG++FAL GL AAG+SY NC AV     F L  Q  +GGW
Sbjct  598   LEDVQMPDGSWYGNWGVCFTYGSWFALGGLAAAGRSYSNCSAVRRGVEFLLRTQRSDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GEC +SCP   Y   E   +NLVQT+WA++GL+++GQ +RD  PLHRAAKLLIN+QMEDG
Sbjct  658   GECYRSCPDKVYREPETDDSNLVQTAWALMGLIHSGQVDRDLRPLHRAAKLLINSQMEDG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITGV+MKNCMLHYA++R+ +PL  L+EYRK V
Sbjct  718   DFPQQEITGVFMKNCMLHYAAYRNIYPLWGLAEYRKNV  755



>ref|XP_010052732.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010052734.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010052735.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010052736.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 gb|KCW76806.1| hypothetical protein EUGRSUZ_D01163 [Eucalyptus grandis]
Length=761

 Score =   934 bits (2414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/759 (58%), Positives = 560/759 (74%), Gaps = 9/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ--KGPH  2253
             MW+LKI     G  +YSTNN+AGRQIW +DP AGT EE    E AR+ F   R   K  H
Sbjct  1     MWRLKIAAAEDGASLYSTNNFAGRQIWTFDPEAGTMEECAEVEAARQHFYHHRHHVKPSH  60

Query  2252  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2073
                DL  RMQ ++E +    +IPPVR+ + EE++ + ++TA+R+AV    ALQA DGHWP
Sbjct  61    ---DLLWRMQFLREKQFKQ-TIPPVRVEDGEEISEDKVSTALRRAVHFFSALQASDGHWP  116

Query  2072  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  1893
             AEN+GPLFF PPL++ +YI+G ++ + T EH+KE++RY+YNHQNEDGGWGL+I+GHSTM 
Sbjct  117   AENAGPLFFLPPLVMCVYITGHLNAVFTVEHRKEILRYIYNHQNEDGGWGLHIEGHSTMF  176

Query  1892  GSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              + L+Y+ +R+LGEGPD G + A  R RKWI DHGG T IPSWGK +LS+LGV++W G  
Sbjct  177   CTVLSYICMRILGEGPDGGREDACTRARKWIHDHGGVTYIPSWGKTWLSILGVFDWSGSK  236

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             P+ PEFW+ PS  P HPAK+WCYCR  YMPMSYLY K++ GP+T +V  LR E+H + Y 
Sbjct  237   PMPPEFWMLPSFLPMHPAKIWCYCRLVYMPMSYLYGKKFVGPITPLVQQLREELHTQPYN  296

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
              I W + R  C KEDLYYPH  ++DL+W++L   TEPF+  WPFKK+RE A++  +K++ 
Sbjct  297   MICWRKVRHLCAKEDLYYPHFLVKDLMWDSLYIFTEPFLNCWPFKKLREKALQVTMKHIH  356

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIG +EK L ++  W EDP+GD  K HLAR+PDYLW+AEDGM M  FGSQ 
Sbjct  357   YEDENSRYITIGAVEKVLCILACWVEDPDGDSFKKHLARIPDYLWVAEDGMKMQSFGSQE  416

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS M EE    L + H +IK+SQVK+NP G+FKSM+RH++KGSWTFSDQ
Sbjct  417   WDTGFAIQALLASNMTEEIAPVLARGHDFIKKSQVKDNPSGNFKSMHRHISKGSWTFSDQ  476

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE+LKC LL   MP  I+GEK + ++LY+AV+V L LQS ++GG A WEP
Sbjct  477   DHGWQVSDCTAESLKCCLLFSMMPPDIVGEKMEPEKLYDAVNVLLSLQS-KNGGLAAWEP  535

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP+E   DIV+E E++E T S I AL  FR  YP +R +E+   I+ AVQ
Sbjct  536   AGAQEWLELLNPTEFLEDIVIEHEYVECTSSAIHALALFRRFYPRHREEEIEDFISNAVQ  595

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q  DGSWYG WGVCF YG++FAL GL A+GK+Y+NC A+     F L  Q Q+GG
Sbjct  596   YLENAQNPDGSWYGDWGVCFTYGSWFALGGLAASGKTYDNCAAMRKGVAFLLRAQLQDGG  655

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SC    YIPLEG  +NLVQT+WA++GL++ GQAERDPTPLHRAAKLLIN+Q ED
Sbjct  656   WGESYLSCLKKEYIPLEGNRSNLVQTAWAVMGLIHAGQAERDPTPLHRAAKLLINSQTED  715

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GD+PQQ+ITG + KNCMLHYA++R+  PL AL+EYR+RV
Sbjct  716   GDYPQQEITGAFKKNCMLHYAAYRNIHPLWALAEYRRRV  754



>ref|NP_001234597.1| delta-amyrin synthase [Solanum lycopersicum]
 sp|E7DN64.1|DAMS_SOLLC RecName: Full=Delta-amyrin synthase; AltName: Full=Alpha-amyrin 
synthase; AltName: Full=Beta-amyrin synthase; AltName: Full=Triterpenoid 
synthase 2; Short=SlTTS2 [Solanum lycopersicum]
 gb|ADU52575.1| multifunctional triterpenoid synthase [Solanum lycopersicum]
Length=763

 Score =   934 bits (2414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/758 (57%), Positives = 560/758 (74%), Gaps = 7/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHT  2250
             MWKLKI +G    Y+YSTNNY GRQIWE+DPNAGT EEQ   E+AR+ +   R K  P++
Sbjct  1     MWKLKIAKGQDDRYLYSTNNYIGRQIWEFDPNAGTIEEQAKIEEARQHYWNNRYKVKPNS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E       I  V++ E EE+++E  T A+ +AV    ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-RIRAVKVEEGEEISHEIATVALHRAVHFFSALQATDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E++GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ESAGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +A++Y+ +R+LGEGP+ G + A AR RKWILDHG    IPSWGK +LS+LG +EW G NP
Sbjct  178   TAMSYICMRILGEGPEGGVNNACARARKWILDHGSVIAIPSWGKTWLSILGAFEWIGTNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCRT YMPMSYLY KR+ GP+T ++L LR E++ ++Y++
Sbjct  238   MPPEFWILPSFLPVHPAKMWCYCRTVYMPMSYLYGKRFVGPITPLILKLREELYDQTYDE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I+W + R  C KEDLYYPH F+QDL+W++L  CTEP + RWPF K+R  A+   +K++ Y
Sbjct  298   INWKKVRHVCAKEDLYYPHPFVQDLMWDSLYICTEPLLTRWPFNKLRNKALEVTMKHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYIT+GC+EK L M+  W EDPNGD  K HLAR+PD+LW+AEDGM M G GSQ+W
Sbjct  358   EDENSRYITMGCVEKVLSMLACWVEDPNGDHFKKHLARIPDFLWVAEDGMKMQGCGSQSW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA+ A QA++AS M +E  D L+  H +IK+SQVK+NP GDFK MYRH++KGSW F+DQD
Sbjct  418   DASLAIQALLASEMNDEISDTLKNGHDFIKQSQVKDNPSGDFKVMYRHISKGSWAFADQD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
              GW VSDCTAE LKC LL   MP +I+GE  D  RLY++V+V L LQS ++GG + WEP 
Sbjct  478   LGWQVSDCTAEALKCCLLFSTMPPEIVGEAMDPVRLYDSVNVILSLQS-KNGGLSAWEPA  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 YL++LNP+E F DIV+E EH+E T S I ALV F+  YP +R  EV+  I   V+Y
Sbjct  537   GAPEYLELLNPTEFFEDIVIEHEHVECTSSAIQALVRFKKLYPGHRTTEVDNFINNGVKY  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E  QE DGSWYG WGVCF+Y ++FAL GL A G SY NC AV  +  F L  Q  +GGW
Sbjct  597   IEDVQEPDGSWYGNWGVCFIYASWFALGGLAAVGLSYSNCAAVRKSVEFLLRTQRSDGGW  656

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE  +SCP   Y  LE   +NLVQT+WA++GL+++GQ ERDP PLHRAAKLLIN QMEDG
Sbjct  657   GESYRSCPDKVYRELETEHSNLVQTAWALMGLIHSGQVERDPRPLHRAAKLLINFQMEDG  716

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITGV+++NCM+HYA +R+ FPL  L+EYR+ V
Sbjct  717   DFPQQEITGVFLRNCMMHYALYRNIFPLWGLAEYRRNV  754



>ref|XP_011031247.1| PREDICTED: beta-amyrin synthase [Populus euphratica]
 ref|XP_011031248.1| PREDICTED: beta-amyrin synthase [Populus euphratica]
Length=760

 Score =   934 bits (2413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/758 (58%), Positives = 561/758 (74%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EG     +YSTNN+ GRQ WEYDP+ G+PEE+   E+AR  F   R       
Sbjct  1     MWRLKIAEGVSSNELYSTNNFVGRQTWEYDPHGGSPEERAEVEEARLSFYNNRYH-VKPS  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ +KE       IP V + + EE+ YE  T A+++AV    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLKEKNFKQ-KIPQVIIEDGEEITYEKATNALKRAVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFF PPL++ LYI+G +D + + EH++E++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCLYITGHLDSVFSVEHRREILRYIYYHQNEDGGWGLHIEGHSTMFST  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              L+Y+ +R+LGEGP  G D A AR RKWI DHG AT IPSWGK +LS+LGV++W G NP+
Sbjct  179   VLSYICMRILGEGPSGGQDNACARARKWIHDHGTATHIPSWGKTWLSILGVFDWSGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFWL PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T +VL LR E+  + Y+Q+
Sbjct  239   PPEFWLLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPVTPLVLQLREELFAEPYDQV  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W + R  C  EDLYYPH  IQDL+W++L   TEPF+ RWPF K +R+ A+   +K++ Y
Sbjct  299   NWRKTRHLCAAEDLYYPHPLIQDLVWDSLYVFTEPFLTRWPFHKLVRKKALEVTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDP+GD  K HLAR+PDYLW+AEDGM M  FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWVEDPDGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D  FA QA++AS   +E  D L++ H +IK+SQVK+NP GDFKSMYRH++KGSWTFSDQD
Sbjct  419   DTGFAIQALLASNFTDEIRDVLKRGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LLL  MP +I+GE+ + +RL+++V+V L LQS E+GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSMMPPEIVGEQLEPERLFDSVNVLLSLQS-ENGGLAAWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L++LNP+E FADIVVE E++E T S I AL  F+  YP +R KE++  +  AV+Y
Sbjct  538   GAQKWLELLNPTEFFADIVVEHEYVECTASAIQALSLFKNLYPGHRKKEIDNFVTNAVRY  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q  +G WYG WGVCF YG++FAL GL AAGK+Y  C A+    +F LS Q  +GGW
Sbjct  598   LESIQTPEGGWYGNWGVCFTYGSWFALGGLAAAGKTYSTCAAMRQGVNFLLSIQKNDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP  +Y+PLEG  +NLV T+WAM+GL++ GQ +RD  PLHRAAKL+IN+Q+EDG
Sbjct  658   GESYLSCPKKKYVPLEGNRSNLVHTAWAMMGLIHAGQMDRDSAPLHRAAKLIINSQLEDG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EY++RV
Sbjct  718   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYQRRV  755



>gb|ACB87531.1| beta-amyrin synthase [Artemisia annua]
Length=761

 Score =   934 bits (2413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/757 (57%), Positives = 563/757 (74%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EG   PY+YSTNN+ GRQIWE+D N GTPEE+   E+AR  F   R +   + 
Sbjct  1     MWRLKIAEGRNDPYLYSTNNFVGRQIWEFDSNYGTPEERAEVEQARVDFWNHRHEVKPS-  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              D+  RMQ ++E   +  +IP V++ + EEV+YE  TT +R++V    ALQA DGHWPAE
Sbjct  60    SDVLWRMQFLREKGFEQ-TIPQVKIEDGEEVSYEKATTTLRRSVNFFAALQADDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPL+F  PL+I LYI+G ++ +  +E++KE++RY+Y HQNEDGGWG +I+GHSTM  +
Sbjct  119   NAGPLYFMQPLVICLYITGHLNTVFPAEYRKEILRYMYCHQNEDGGWGFHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              L+Y+ +RLLGEGPD G DGA  + RKWILDHG  T IPSWGK +LS+LGV EW G NP+
Sbjct  179   TLSYICMRLLGEGPDGGLDGACTKARKWILDHGSVTTIPSWGKTWLSILGVCEWAGTNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P +PAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR+E++ + Y++I
Sbjct  239   PPEFWILPSFLPMYPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLRDELYAQPYDEI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
              W   R  C KEDLYYPH  +QDL+W++L   TEP +  WPF K+RE A++  +K++ YE
Sbjct  299   KWRSIRHLCAKEDLYYPHPLLQDLMWDSLYVFTEPVLNHWPFNKLREKALQTTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIG +EK+L M+  W EDPNG   K H+AR+PDYLW+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGSVEKALCMLACWVEDPNGVCFKKHIARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
             A FA QA++A+ + +E G  L K H +IK SQVK+NP GDFKSM+RH++KGSWTFSDQDH
Sbjct  419   AGFAIQALLATDLTDEIGSTLMKGHEFIKASQVKDNPSGDFKSMHRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC LL   MP +I+GEK   ++L +AV+V L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEALKCCLLFATMPPEIVGEKMKPEQLNDAVNVILSLQS-KNGGLAAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +L++LNP+E FADIV+E E++E T S I ALV F+  YP +R KE+   +  +  YL
Sbjct  538   SSEWLEILNPTEFFADIVIEHEYVECTSSAIQALVMFKKKYPGHRKKEIENFLLGSSGYL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             EK Q  DGSWYG WGVCF YGT+FAL GL+A GK+Y+NC A+  A  F L  Q ++GGWG
Sbjct  598   EKIQMEDGSWYGNWGVCFTYGTWFALGGLSAVGKTYDNCPAIRKAVKFLLETQLEDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E  +SCP  +YIPLEG  +NLV T+WAM+GL+++ QAERD TPLHRAAKLLIN+Q+E GD
Sbjct  658   ESYKSCPEKKYIPLEGGRSNLVHTAWAMMGLIHSRQAERDATPLHRAAKLLINSQLETGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ+I GV+MKNCMLHYA +R+ +P+ AL++YRK+V
Sbjct  718   FPQQEIAGVFMKNCMLHYALYRNIYPMWALADYRKQV  754



>emb|CBI18393.3| unnamed protein product [Vitis vinifera]
Length=872

 Score =   933 bits (2412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/755 (58%), Positives = 555/755 (74%), Gaps = 9/755 (1%)
 Frame = -3

Query  2426  KMWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPH  2253
             KMW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GT EE+   E AR+ F K R Q  P 
Sbjct  80    KMWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTTEERAEVEAARENFWKNRFQVKPS  139

Query  2252  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2073
             +  DL  RMQ ++E      +IP  ++ + EE+ YE  T AVR+      ALQA DGHWP
Sbjct  140   S--DLLWRMQFLREKNFKQ-TIPQAKVGDGEEITYETATAAVRRGAHFFSALQASDGHWP  196

Query  2072  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  1893
             AEN+GPL+F PPL++ LYI+G +D +   E++KE++RYLY HQNEDGGWGL+I+GHSTM 
Sbjct  197   AENAGPLYFLPPLVMCLYITGHLDTVFPGEYRKEILRYLYCHQNEDGGWGLHIEGHSTMF  256

Query  1892  GSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              + L+Y+ +R+LGEG D G D A ARGRKWILD GG T IPSWGK +LS+ G+++W G N
Sbjct  257   CTTLSYICMRILGEGRDGGRDNACARGRKWILDRGGVTSIPSWGKTWLSIFGLFDWSGSN  316

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             P+ PEFWLFPS  P HPAKMWCY R  YMPMSYLY KR+ GP+T +VL LR E+ +++Y 
Sbjct  317   PMPPEFWLFPSRLPMHPAKMWCYSRLVYMPMSYLYGKRFVGPITPLVLELREELFLQAYN  376

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
             +I+W + R  C KEDLYYPH  IQDL+W++L  CTEP + RWPF K+R+ A+   +K++ 
Sbjct  377   EINWKKVRHLCAKEDLYYPHPLIQDLMWDSLYICTEPLLTRWPFNKLRQKALEVTMKHIH  436

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITI  +EK+L M+  W EDPNGD  K HLAR+PD++W+AEDG+ M  FGSQ 
Sbjct  437   YEDENSRYITIASVEKALCMLTCWVEDPNGDYFKKHLARIPDFIWVAEDGIKMQTFGSQE  496

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++A  M  E G  L+K H +IKESQVK+NP GDFKSMYR +++GSWTFSDQ
Sbjct  497   WDTGFALQALLACNMTNEIGPTLKKGHEFIKESQVKDNPSGDFKSMYRKISQGSWTFSDQ  556

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LL   M  +I+G +P  +RL+++V++ L LQS ++GG A WEP
Sbjct  557   DHGWQVSDCTAEGLKCCLLFSMMAPEIVGMEP--ERLFDSVNILLSLQS-KNGGLAVWEP  613

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++ NPSEIF DIV+E E++E T S I ALV F+  YP +R KE++  I  A +
Sbjct  614   AGASEWLELFNPSEIFEDIVIEHEYVECTASAIQALVLFKKLYPQHRTKEIDNFITNATK  673

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             Y+E QQ  DGSWYG WGVCF YG++FAL GL AAG++Y NC A+  A  F L  Q  +GG
Sbjct  674   YIEDQQMPDGSWYGNWGVCFTYGSWFALGGLAAAGRTYHNCLAIGRAVEFLLKSQRDDGG  733

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SC   +   LEG  +NLVQT WA++GL+ +GQAERDPTPLHRAAKLLIN+QMED
Sbjct  734   WGESYISCQDKKLTHLEGNKSNLVQTGWALMGLLSSGQAERDPTPLHRAAKLLINSQMED  793

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEY  171
             GDFPQQ+ITG +MKNCMLHYA +R+ FPL AL+EY
Sbjct  794   GDFPQQEITGAFMKNCMLHYADYRNIFPLWALAEY  828


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 12/53 (23%)
 Frame = -3

Query  329  PTPLHRAAKLLINAQMEDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEY  171
            PTPLH+  +L            +++ITG +MKNCMLHYA++R+ FPL AL++Y
Sbjct  12   PTPLHKPIRL------------RKEITGAFMKNCMLHYAAYRNIFPLWALAQY  52



>ref|XP_010063690.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
Length=761

 Score =   933 bits (2411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/755 (58%), Positives = 553/755 (73%), Gaps = 5/755 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EG  GPY+YSTNNY GRQ WE+DP AG  EE+   E   + F   R +    C
Sbjct  1     MWRLKIAEGEDGPYLYSTNNYVGRQTWEFDPEAGNAEERAEVEATCQHFYDHRHQ-VKAC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ ++E +    +I PVR+ + EE+ Y+  +TA+R+ V    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREKQFRQ-TISPVRVEDGEEITYDKASTALRRTVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPL+F PPL+I +YI+G ++ +  +EH+KE++RYLYNHQN DGGWG +I+GHSTM  +
Sbjct  119   IAGPLYFLPPLVICVYITGHLNAVFPAEHRKEILRYLYNHQNGDGGWGFHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEGPD G D A  R RKWILD GG T IPSWGK +LS+ G++ W G NP+
Sbjct  179   ALSYICMRILGEGPDGGQDNACTRARKWILDRGGVTYIPSWGKTWLSIFGLFNWSGTNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ G +T +V  LR E+H + Y+ I
Sbjct  239   PPEFWILPSFLPIHPAKMWCYCRMVYMPMSYLYGKRFVGLITPLVQQLREELHTQPYDMI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
              W + R  C KEDLYYPH  +QDL+W++L   TEP + RWPF K+R  A++  IK++ YE
Sbjct  299   CWRKVRHLCAKEDLYYPHPLVQDLIWDSLYIFTEPLLNRWPFNKLRGKALQVTIKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDP+ D  K HLAR+PDYLW+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPDSDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
               FA QA++AS M EE G  L + H +IK+SQVK+NP GDFKSM+RH+TKGSWTFSDQDH
Sbjct  419   TGFAIQALLASNMTEEIGPVLARGHDFIKKSQVKDNPSGDFKSMHRHITKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
              W V DCTAE LKC LLL  M  +I+GEK + ++LY+AV++ L LQS ++GG   WEP  
Sbjct  479   SWQVYDCTAEGLKCCLLLSMMRPEIVGEKMEPEKLYDAVNILLSLQS-KNGGLPAWEPTG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +L++LNP+E F DIV+E E++E T   I+ALV F+  YP +R KE+   I+ +VQYL
Sbjct  538   APAWLELLNPTEFFEDIVLEHEYVECTSLAINALVLFQKLYPGHRKKEIADFISNSVQYL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q+ DGSWYG WGVCF YG++FAL GL AAGK+Y NC A      F L  Q Q+GGWG
Sbjct  598   ENVQKPDGSWYGCWGVCFTYGSWFALGGLAAAGKTYSNCAATRKGVTFLLRTQLQDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP   Y+PLEG  +NLVQT+WAM+GL++ GQAERDPTPLHRAAKLLIN+QMEDGD
Sbjct  658   ESYLSCPKKEYVPLEGNRSNLVQTAWAMMGLIHAGQAERDPTPLHRAAKLLINSQMEDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             +PQQ+ITGV+ KNCMLHY ++R+ +PL AL+EYR+
Sbjct  718   YPQQEITGVFNKNCMLHYPNYRNIYPLWALAEYRR  752



>ref|XP_002265019.2| PREDICTED: beta-amyrin synthase-like [Vitis vinifera]
Length=767

 Score =   932 bits (2410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/754 (58%), Positives = 554/754 (73%), Gaps = 9/754 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GT EE+   E AR+ F K R Q  P +
Sbjct  1     MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTTEERAEVEAARENFWKNRFQVKPSS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E      +IP  ++ + EE+ YE  T AVR+      ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-TIPQAKVGDGEEITYETATAAVRRGAHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPL+F PPL++ LYI+G +D +   E++KE++RYLY HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGPLYFLPPLVMCLYITGHLDTVFPGEYRKEILRYLYCHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + L+Y+ +R+LGEG D G D A ARGRKWILD GG T IPSWGK +LS+ G+++W G NP
Sbjct  178   TTLSYICMRILGEGRDGGRDNACARGRKWILDRGGVTSIPSWGKTWLSIFGLFDWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFWLFPS  P HPAKMWCY R  YMPMSYLY KR+ GP+T +VL LR E+ +++Y +
Sbjct  238   MPPEFWLFPSRLPMHPAKMWCYSRLVYMPMSYLYGKRFVGPITPLVLELREELFLQAYNE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I+W + R  C KEDLYYPH  IQDL+W++L  CTEP + RWPF K+R+ A+   +K++ Y
Sbjct  298   INWKKVRHLCAKEDLYYPHPLIQDLMWDSLYICTEPLLTRWPFNKLRQKALEVTMKHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITI  +EK+L M+  W EDPNGD  K HLAR+PD++W+AEDG+ M  FGSQ W
Sbjct  358   EDENSRYITIASVEKALCMLTCWVEDPNGDYFKKHLARIPDFIWVAEDGIKMQTFGSQEW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D  FA QA++A  M  E G  L+K H +IKESQVK+NP GDFKSMYR +++GSWTFSDQD
Sbjct  418   DTGFALQALLACNMTNEIGPTLKKGHEFIKESQVKDNPSGDFKSMYRKISQGSWTFSDQD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LL   M  +I+G +P  +RL+++V++ L LQS ++GG A WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSMMAPEIVGMEP--ERLFDSVNILLSLQS-KNGGLAVWEPA  534

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++ NPSEIF DIV+E E++E T S I ALV F+  YP +R KE++  I  A +Y
Sbjct  535   GASEWLELFNPSEIFEDIVIEHEYVECTASAIQALVLFKKLYPQHRTKEIDNFITNATKY  594

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E QQ  DGSWYG WGVCF YG++FAL GL AAG++Y NC A+  A  F L  Q  +GGW
Sbjct  595   IEDQQMPDGSWYGNWGVCFTYGSWFALGGLAAAGRTYHNCLAIGRAVEFLLKSQRDDGGW  654

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SC   +   LEG  +NLVQT WA++GL+ +GQAERDPTPLHRAAKLLIN+QMEDG
Sbjct  655   GESYISCQDKKLTHLEGNKSNLVQTGWALMGLLSSGQAERDPTPLHRAAKLLINSQMEDG  714

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEY  171
             DFPQQ+ITG +MKNCMLHYA +R+ FPL AL+EY
Sbjct  715   DFPQQEITGAFMKNCMLHYADYRNIFPLWALAEY  748



>gb|ACA13386.1| beta-amyrin synthase [Artemisia annua]
Length=761

 Score =   932 bits (2410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/757 (57%), Positives = 563/757 (74%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EG   PY+YSTNN+ GRQIWE+DPN GTPEE+   E+AR  F   R +   + 
Sbjct  1     MWRLKIAEGRNDPYLYSTNNFVGRQIWEFDPNYGTPEERAEVEQARVDFWNHRHEVKPS-  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              D+  RMQ ++E   +  +IP V++ + EE++YE  TT +R++V    ALQA DGHWPAE
Sbjct  60    SDVLWRMQFLREKGFEQ-TIPQVKIEDGEEISYEKATTTLRRSVNFFAALQADDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPL+F  PL+I LYI+G ++ +  +E++KE++RY+Y HQNEDGGWG +I+GHSTM  +
Sbjct  119   NAGPLYFMQPLVICLYITGHLNTVFPAEYRKEILRYIYCHQNEDGGWGFHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              L+Y+ +RLLGEG D G DGA  + RKWILDHG  T IPSWGK +LS+LGV EW G NP+
Sbjct  179   TLSYICMRLLGEGRDGGLDGACTKARKWILDHGSVTTIPSWGKTWLSILGVCEWAGTNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P +PAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR+E++ + Y++I
Sbjct  239   PPEFWILPSFLPMYPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLRDELYAQPYDEI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
              W   R  C KEDLYYPH  +QDL+W++L   TEP +  WPF K+RE A++  +K++ YE
Sbjct  299   KWRSIRHLCAKEDLYYPHPLLQDLMWDSLYVFTEPVLNHWPFNKLREKALQTTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIG +EK+L M+  W EDPNG   K H+AR+PDYLW+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGSVEKALCMLACWVEDPNGVCFKKHIARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
             A FA QA++A+ + +E G  L K H +IK SQVK+NP GDFKSM+RH++KGSWTFSDQDH
Sbjct  419   AGFAIQALMATDLTDEIGSTLMKGHEFIKASQVKDNPSGDFKSMHRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC LL   MP +I+GEK   ++L +AV+V L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEALKCCLLFATMPPEIVGEKMKPEQLNDAVNVILSLQS-KNGGLAAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +L++LNP+E FADIV+E E++E T S I ALV F+  YP +R KE+   +  +  YL
Sbjct  538   SSEWLEILNPTEFFADIVIEHEYVECTSSAIQALVMFKKKYPGHRKKEIENFLLGSSGYL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             EK Q  DGSWYG WGVCF YGT+FAL GL+A GK+Y+NC A+  A  F L  Q ++GGWG
Sbjct  598   EKIQMEDGSWYGNWGVCFTYGTWFALGGLSAVGKTYDNCPAIRKAVKFLLETQLEDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E  +SCP  +YIPLEG  +NLV T+WAM+GL+++ QAERD TPLHRAAKLLIN+Q+E GD
Sbjct  658   ESYKSCPEKKYIPLEGGRSNLVHTAWAMMGLIHSRQAERDATPLHRAAKLLINSQLETGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ+I GV+MKNCMLHYA +R+ +P+ AL++YRK+V
Sbjct  718   FPQQEIAGVFMKNCMLHYALYRNIYPMWALADYRKQV  754



>gb|KEH28511.1| beta-amyrin synthase [Medicago truncatula]
Length=764

 Score =   932 bits (2409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/758 (57%), Positives = 561/758 (74%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKI EGG  PY++STN++ GRQ WEYDP AG+ EE+   E+ARK F   R     TC
Sbjct  1     MWKLKIAEGGNEPYLFSTNSFVGRQTWEYDPEAGSEEERAQVEEARKNFYNNR-FNVKTC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  R Q+++E+     +I  V++ + EE+ YE  T  +RK  R   ALQ +DGHWPA+
Sbjct  60    GDLLWRFQVLRENNFKQ-TIDSVKIEDGEEITYEKATKTLRKGTRHLVALQTQDGHWPAQ  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPLF+ PPL+  +YI+G +D +   EH+KE++RY+Y HQNEDGGWGL I+GHSTM  +
Sbjct  119   IAGPLFYMPPLVFCVYITGHLDSVFPQEHRKEILRYIYCHQNEDGGWGLQIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             ALNY+ +R+LGEGPD G D A AR R WI DHGG T+IPSWGK +LS+LGVY+W G NP+
Sbjct  179   ALNYICMRILGEGPDGGQDNACARARNWIRDHGGVTRIPSWGKTWLSILGVYDWSGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+H + YE+ 
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELHTQPYEKT  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W ++R  C KEDLYYPH  IQDL+W++L   TEP + RWPF K +R+ A+   +K++ Y
Sbjct  299   NWTKSRHLCAKEDLYYPHPLIQDLIWDSLYIFTEPLLTRWPFNKLVRKRALEVTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITI  +EK L M+  W EDPNGD  K HLARVPDYLW++EDGM+M  FGSQ W
Sbjct  359   EDENSRYITIASVEKVLCMLACWVEDPNGDAYKKHLARVPDYLWMSEDGMTMQTFGSQVW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D +FA QA++A+ ++EE    L K H +IK+SQV++NP GDFKSMYRH++KGSWTFSDQD
Sbjct  419   DTSFAIQALLATNLIEETAPALVKGHDFIKKSQVRDNPSGDFKSMYRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
              GW +SDCTAE LKC L L  +P +I+GEK + +RLY++V++ L LQS ++GG A WEP 
Sbjct  479   QGWQLSDCTAEGLKCCLHLSMLPPEIVGEKMEPERLYDSVNILLSLQS-KNGGLAAWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L+VLNP+E F DIVVE E++E T S I AL+ F+  YP +R KE+   I++AV++
Sbjct  538   GAPKWLEVLNPTEFFVDIVVEHEYVECTASAIQALILFKKLYPGHRKKEIENFISEAVRF  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E  Q +DGSWYG WGVCF YG +FAL GL AAGK+Y NC  +  A  F L  Q ++GGW
Sbjct  598   IEDIQTADGSWYGNWGVCFTYGCWFALGGLAAAGKTYTNCATIRKAVKFLLRIQGKDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP   YI LEG  +N+VQT+WA++ L++ GQAERDPTPLHRAAKLLIN+Q+E+G
Sbjct  658   GESYLSCPKKMYIQLEGRRSNVVQTAWALMALIHGGQAERDPTPLHRAAKLLINSQLEEG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             ++PQQDI+G +MKNCMLHY  +R  FPL AL+EYR++V
Sbjct  718   NWPQQDISGAFMKNCMLHYPMYRDIFPLWALTEYRRQV  755



>ref|XP_002513298.1| Cycloartenol synthase, putative [Ricinus communis]
 gb|EEF48701.1| Cycloartenol synthase, putative [Ricinus communis]
Length=744

 Score =   932 bits (2409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/759 (58%), Positives = 550/759 (72%), Gaps = 26/759 (3%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LKI E G   PY+YSTNNY GRQIWE+DP+AGTPEE+   E+AR+ F   R +   +
Sbjct  1     MWRLKIAEEGSSDPYLYSTNNYVGRQIWEFDPDAGTPEERAQVEEARRVFHNNRHQVKPS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E + +   +  V++ E EE+  E  T A+R+AV    ALQA DGHWPA
Sbjct  61    -SDLLWRMQYMREKKFEQ-KVGKVKIEEGEEITNEKATEALRRAVHFFSALQASDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++ +YI+G +D IL SEH+KE++RY+YNHQNEDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVMCMYITGHLDTILPSEHRKEILRYIYNHQNEDGGWGLHIEGHSTMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + L+Y+ +RLLGE PD G D A  R R WIL HGG T IPSWGK +LS+LGVY+W G NP
Sbjct  179   TVLSYICMRLLGEAPDGGQDNACQRARTWILQHGGVTYIPSWGKTWLSILGVYDWSGSNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFWL PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+H + Y+Q
Sbjct  239   MPPEFWLLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLRQELHTQPYDQ  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             ++W + R  C +EDLYYPH  IQDL+W+AL   TEP + RWP  K IR  A+R  + ++ 
Sbjct  299   VNWKRTRHQCAREDLYYPHPLIQDLMWDALYIFTEPLLTRWPLNKFIRNKALRVTMNHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDP+GD  K HLAR+PDY+W+AEDGM M  FGSQ 
Sbjct  359   YEDENSRYITIGCVEKVLCMLACWVEDPDGDYFKKHLARIPDYIWVAEDGMKMQSFGSQQ  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS + EE GD L++ H +IK+SQVK+NP GDFKSMYRH++KGSWTFSDQ
Sbjct  419   WDTGFAIQALLASNLTEEIGDVLKRGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQ  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LL   MP +I+GEK + ++LY+AV++ L LQ            
Sbjct  479   DHGWQVSDCTAEGLKCCLLFSMMPSEIVGEKMEPKQLYDAVNILLSLQ------------  526

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                     VLNP+E FADIV+E E++E T S I ALV F+  YP +R KE+   I+ AV+
Sbjct  527   --------VLNPTEFFADIVIEHEYVECTASAIHALVLFKRLYPGHRKKEIENFISNAVR  578

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q  +G WYG WGVCF YGT+FAL GL AAGK+Y NC A+     F L  Q  +GG
Sbjct  579   YLESIQSEEGGWYGNWGVCFTYGTWFALGGLAAAGKTYNNCVAMRKGVDFLLRIQKDDGG  638

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  +Y+ LEG   NLV T+W M+GL+  GQ +RDP PLH AAKL+IN+Q+ED
Sbjct  639   WGESYISCPQKKYVALEGKRWNLVHTAWGMMGLINGGQMDRDPKPLHAAAKLIINSQLED  698

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYR RV
Sbjct  699   GDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRNRV  737



>ref|XP_010063688.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW70933.1| hypothetical protein EUGRSUZ_F04050 [Eucalyptus grandis]
Length=761

 Score =   932 bits (2408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/757 (57%), Positives = 553/757 (73%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKI EG   PY+YSTNNY GRQ WE+DP AG  EE+   E   + F   R +    C
Sbjct  1     MWKLKIAEGEDDPYLYSTNNYVGRQTWEFDPKAGNAEERAEVEATCQHFYDHRHQ-VKAC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ ++E +    +I PVR+ + EE+ Y+  +TA+R+ V    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREKQFKQ-TISPVRVEDGEEITYDKASTALRRTVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPL+F PPL++ +YI+G ++ +  +EH+KE++ YLYNHQN DGGWG +I+GHSTM  +
Sbjct  119   IAGPLYFLPPLVMCVYITGHLNAVFPAEHRKEILHYLYNHQNGDGGWGFHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEGPD G D A  R RKWILD GG T IPSWGK +LS+ G+++W G NP+
Sbjct  179   ALSYICMRILGEGPDGGQDNACTRARKWILDRGGVTYIPSWGKTWLSIFGLFDWSGTNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T +V  LR E+H + Y+ I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLVQQLREELHTQPYDTI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
              W +    C KEDLYYPH  +QDL+W++L    EP + RWPF K+RE A++  +K++ YE
Sbjct  299   CWRKVCHLCAKEDLYYPHPLVQDLIWDSLYIFAEPLLNRWPFNKLREKALQVTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDP+ D  K HLAR+PDYLW+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPDSDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
               FA QA++AS M EE    L + H +IK+SQVK+NP GDFKSM+RH+TKGSWTFSDQDH
Sbjct  419   TGFAIQALLASNMTEEIAPVLARGHDFIKKSQVKDNPSGDFKSMHRHITKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE L+C LL   MP +I+GEK + ++LY+AV++ L LQS ++GG   WEP  
Sbjct  479   GWQVSDCTAEGLRCCLLFSMMPPEIVGEKMEPEKLYDAVNILLSLQS-KNGGLPAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +L++LNP+E F DIV+E E++E T S I ALV  R  YP +R KE+   I+ +V+YL
Sbjct  538   APAWLELLNPTEFFEDIVIEHEYVECTSSAIQALVLLRKLYPGHRKKEIADFISNSVKYL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q+ DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+     F L  Q Q+GGWG
Sbjct  598   ENVQKPDGSWYGCWGVCFTYGSWFALGGLAAAGKTYSNCTAMREGVAFLLRTQLQDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP   Y+PLEG  +NLVQT+WAM+GL++ GQAERDPTPLH AAKLLIN+QMEDGD
Sbjct  658   ESYLSCPKKEYVPLEGNRSNLVQTAWAMMGLIHAGQAERDPTPLHHAAKLLINSQMEDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             +PQQ+ITGV+ KNCMLHY ++R+ +PL AL+EY +RV
Sbjct  718   YPQQEITGVFNKNCMLHYPNYRNIYPLWALAEYCRRV  754



>ref|XP_009344148.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=760

 Score =   931 bits (2405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/759 (58%), Positives = 566/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MWKLK+ +GG  PYIYSTNN+ GRQI+E+DP AGT EE+   E+AR  F   R Q  P +
Sbjct  1     MWKLKVADGGNDPYIYSTNNFVGRQIFEFDPEAGTTEERAEVEEARLHFYNNRYQVKPSS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E      +IPPV++ + EE+ YE    A+R++V    ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-TIPPVKVEDGEEITYEKAIAALRRSVHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++  YI+G ++ +  +EH+KE++RYLY HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCTYITGHLNTVFLAEHRKEILRYLYYHQNQDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNY+ +R+LGEGPD G D A AR RKWI DHG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TVLNYICMRILGEGPDGGQDNACARARKWIHDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             L PEFW+ PS  P HPAKMWCY R  YMPMSYLY KR+ GP+T ++L LR E++ + Y++
Sbjct  238   LPPEFWILPSFLPMHPAKMWCYSRMFYMPMSYLYGKRFVGPITSLILQLREELYAQPYDE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W   R  C K D+YYPH +IQD LW++L  CTEP +  WPF K IR+ A+   +K++ 
Sbjct  298   INWKGVRHHCAKVDIYYPHPWIQDFLWDSLYVCTEPLLTHWPFNKLIRKRALEVTMKHVH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIG +EK L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ 
Sbjct  358   YEDENSRYITIGAVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQTFGSQQ  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS + +E    L + H +IK+SQVK+NP GDFKSMYRH++KGSWTFSDQ
Sbjct  418   WDTGFAIQALLASNLTDEIAPTLARGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE+LKC LLL  MP +I+GEK + ++LY+AV+V + L+S ++GG   WEP
Sbjct  478   DHGWQVSDCTAESLKCCLLLSMMPPEIVGEKMEPEQLYDAVNVLISLRS-KNGGLPAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++ NP+E+FADIVVE E++E T S I ALV F+  YP +R +E++  I  A  
Sbjct  537   AGAAEWLEMFNPTELFADIVVEHEYVECTSSAIQALVLFKKLYPGHRKEEIDQFITAAAL  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q +DGSWYG WGVCF YGT+FAL GLTAAGK++ NC A+  A  F L+ Q + GG
Sbjct  597   YLENVQMADGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCAAIRKAISFLLAIQKENGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP   Y+PLEG  +NLVQT+WAM+GL++ GQAERDPTPLHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVQTAWAMMGLIHVGQAERDPTPLHRAAKLIINSQMEN  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+I+G +MKNCMLHYA++R+ +PL AL+EY +RV
Sbjct  717   GDFPQQEISGAFMKNCMLHYAAYRNIYPLWALAEYCRRV  755



>gb|ADM89633.1| beta-amyrin synthase [Bupleurum chinense]
Length=762

 Score =   930 bits (2404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/758 (56%), Positives = 560/758 (74%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG--GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LKIGEG     Y+YSTNNY GRQ WE+DPN G+PEE+   ++AR  F + R K   +
Sbjct  1     MWRLKIGEGSEDDKYLYSTNNYVGRQTWEFDPNYGSPEEKAQVDEARLNFWQNRYKVKPS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GD+  +MQ ++E      +IP V++ + E+++YE  +  V++A     ALQA DGHWPA
Sbjct  61    -GDVLWQMQFLREKGFKQ-TIPQVKIEDGEDISYEKASVTVKRAAHYFAALQASDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++ +YI+G ++ +  + H++E++RYLY HQNEDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVMCVYITGHLNQVFPAPHREEILRYLYCHQNEDGGWGLHIEGHSTMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +AL+Y+ +R+LGEGPD G + A +R RKWILDHG  T +PSWGK +LS+LGV+EW G NP
Sbjct  179   TALSYICMRILGEGPDGGVNNACSRARKWILDHGSVTHMPSWGKTWLSILGVFEWSGSNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+  P+T ++  LR E++ + Y+ 
Sbjct  239   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVAPMTPLISQLREELYDQPYDH  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I+W + R  C  ED+YYPH  +QDL+W++L  CTEP + RWPF KIRE A+   +K++ Y
Sbjct  299   INWPKVRHCCAPEDIYYPHPLVQDLIWDSLYICTEPLLTRWPFNKIREKALATTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  WAEDP+GD  K HLAR+PDYLW+AEDGM M  FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWAEDPDGDYFKKHLARIPDYLWVAEDGMKMQSFGSQEW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D  F  QA++A+ + +E G  L++ H ++K SQVK+NP GDFKSMYRH++KGSWTFSDQD
Sbjct  419   DTGFGLQALLATDLTDELGPTLKRGHEFVKASQVKDNPSGDFKSMYRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LL   M  +I+G+K + +RLY++V++ L LQS ++GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLFSMMSPEIVGKKFEPERLYDSVNLLLSLQS-KNGGLAAWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L++LNP+E F DIV+E E++E T S I  LV F   YP +R KE+N  I  A +Y
Sbjct  538   GAQEWLELLNPTEFFQDIVIEHEYVECTASAIQGLVLFSKLYPAHRKKEINAFIVNAAKY  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q  DGSWYG WGVCF YG++FAL GL AAGK+Y NC AV     F L  Q  +GGW
Sbjct  598   LEDIQIPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYNNCAAVRKGVDFLLKSQLDDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP  +Y  +EG+ +NLVQT+WA +GL+++GQ ERDPTPLHRAAKL+IN+Q E G
Sbjct  658   GESYLSCPLKKYTQIEGSRSNLVQTAWATMGLIHSGQVERDPTPLHRAAKLIINSQEEKG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
              FPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  718   GFPQQEITGVFMKNCMLHYAAYRNLYPLWALAEYRKRV  755



>emb|CBI30890.3| unnamed protein product [Vitis vinifera]
Length=753

 Score =   929 bits (2402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/727 (60%), Positives = 549/727 (76%), Gaps = 9/727 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHTC  2247
             MW LK+ EG GP++YS NNY GRQIWE+DP AGTPEE+E   K ++ FTK R +  P+  
Sbjct  1     MWMLKVAEGHGPWLYSLNNYLGRQIWEFDPEAGTPEEREEVRKVQENFTKNRFRYKPN--  58

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL MRMQ+IKE+++D LSIPPVRL E+E+V YEA+TTAV+KAVRLN A+QAKDGHWPAE
Sbjct  59    GDLLMRMQLIKENQID-LSIPPVRLGEKEKVTYEAVTTAVKKAVRLNRAIQAKDGHWPAE  117

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFFTPPL++ LY +G++++ LT EHK EL+RY+ NHQNEDGGWG +I+GHSTM+G+
Sbjct  118   NAGPLFFTPPLIMVLYFTGTLNIALTPEHKVELLRYITNHQNEDGGWGFHIEGHSTMLGT  177

Query  1886  ALNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
              L+Y+++R+LG GPDD    +A GRKWILD GGAT  PSWGK YLSV G+YEW GCNPL 
Sbjct  178   TLSYISMRILGVGPDDK--VVAAGRKWILDRGGATYSPSWGKCYLSVFGLYEWSGCNPLP  235

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWLFPS  P HP KMWCY RT YMPMSYLY  R++ P+TD+VL LR E+H + Y +ID
Sbjct  236   PEFWLFPSYLPMHPDKMWCYSRTVYMPMSYLYGTRFQAPITDLVLQLREEMHTEPYHEID  295

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             W +AR+ C KED YYPHS IQD++W  L +  EP ++RWP  KIRE A++KAI+ + +E 
Sbjct  296   WAKARLLCTKEDYYYPHSLIQDMIWGGLYHFGEPILKRWPVSKIRETAVKKAIEIIHWED  355

Query  1346  EETRYITIGCIEKSLQMMCWWAEDP--NGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E +RY+T GC+ K+  MM  WAE+P  N +  K+HLAR+PDYLWLAEDGM +  FGSQ W
Sbjct  356   ENSRYLTPGCVHKAFHMMAVWAENPDSNLNAFKHHLARIPDYLWLAEDGMKVQSFGSQLW  415

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA+F  QAI+ SGMVEEYG  L+K H +IK SQ +ENP GD++S YRH +KG+WTFSD+D
Sbjct  416   DASFCIQAILESGMVEEYGTALKKGHDFIKLSQCQENPSGDYRSRYRHFSKGAWTFSDRD  475

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCT+E L+ LLLL + P +++GEK + Q L++A++     Q  +SGG A WEP 
Sbjct  476   HGWQVSDCTSEALRVLLLLSQFPEELVGEKAEPQCLFDAINFLFSFQG-KSGGLALWEPA  534

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               + +L+ LNPSE+FA+IV E E++E T S I  L+ F+  YPN+R KEV+  I KA  Y
Sbjct  535   GAEEWLEKLNPSELFANIVTEHEYVECTSSAIQTLLLFKKLYPNHRRKEVDNFIEKATGY  594

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E  Q  DGSWYG WG+CF Y  +FAL GL A GK+Y N + V     F LSKQ   GGW
Sbjct  595   VENVQRPDGSWYGGWGICFTYAAWFALSGLAAVGKTYSNSKTVRKGVDFLLSKQKANGGW  654

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             G    SCP M Y+ LEG  TNLVQT+W ++GL+  GQ ERDPTPLH AAKLLIN+Q+++G
Sbjct  655   GGSYLSCPDMLYVHLEGDHTNLVQTAWCLMGLIEAGQVERDPTPLHNAAKLLINSQLDNG  714

Query  272   DFPQQDI  252
             DFPQQ+I
Sbjct  715   DFPQQEI  721



>ref|XP_006488698.1| PREDICTED: beta-amyrin synthase-like [Citrus sinensis]
Length=829

 Score =   929 bits (2401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/767 (58%), Positives = 562/767 (73%), Gaps = 17/767 (2%)
 Frame = -3

Query  2423  MWKLKIGEGGGP---YIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2253
             MWKLK+GEG G     IYSTNNYAGRQIWE+DP AGT EE+   E AR  F   R     
Sbjct  1     MWKLKVGEGNGEKDESIYSTNNYAGRQIWEFDPEAGTDEERAQVEAARLHFYNNRDHLKP  60

Query  2252  TCGDLFMRMQMIKESEVDVLSIPPVRLR---EEEEVNYE-AITTAVRKAVRLNCALQAKD  2085
             +  DL  RMQ +KE +    +IP V+++   +EEE+ YE A TTA+R+ VR   ALQA D
Sbjct  61    S-ADLLWRMQFLKEKKFKQ-TIPQVKIKVDGDEEEITYETAATTALRRGVRFFSALQASD  118

Query  2084  GHWPAENSGPLFFTPPLMIALYISGSIDMIL--TSEHKKELVRYLYNHQNEDGGWGLYID  1911
             GHWPAEN+GPLFF PPL++ LYI+G ++ +    SEH+KE++RY++ HQNEDGGWGL+I+
Sbjct  119   GHWPAENAGPLFFLPPLVMCLYITGHLNNVFPAESEHRKEILRYIHYHQNEDGGWGLHIE  178

Query  1910  GHSTMIGSALNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYE  1731
             G STM  +ALNY+ LR+LG+ P     A A  R WILD GG T IPSWGK +LS+LGV++
Sbjct  179   GASTMFCTALNYICLRILGQPPHHI--ACATARNWILDRGGVTLIPSWGKTWLSILGVFD  236

Query  1730  WDGCNPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIH  1551
             W GCNP+ PEFW+ PS  P HP KMWCYCR  YMPMSYLY KR+ G +T +V+ LR E++
Sbjct  237   WSGCNPMPPEFWILPSFLPMHPGKMWCYCRMVYMPMSYLYGKRFVGAITPLVVELRQELY  296

Query  1550  --VKSYEQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAM  1380
                + Y +++W +AR  C KED YYPH +IQDL+WN L   TEP + RWPF K IRE A+
Sbjct  297   PEAEPYHKVNWGKARHLCAKEDAYYPHPWIQDLIWNTLYVFTEPLLTRWPFNKFIREKAL  356

Query  1379  RKAIKYMRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMS  1200
             +  + ++ YE   +RYITIGC+EK L M+  W E PNGD  K HLAR+PDYLW+AEDGM 
Sbjct  357   QVTMDHIHYEDHNSRYITIGCVEKVLCMLACWVEHPNGDSFKKHLARIPDYLWVAEDGMK  416

Query  1199  MHGFGSQNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTK  1020
             M  FGSQ WD  FA QA++AS +++E G  L++ H +IK SQVK+NP GDFK MYRH++K
Sbjct  417   MQSFGSQQWDTGFAIQALLASNLIDEIGPVLKRGHEFIKASQVKDNPSGDFKRMYRHISK  476

Query  1019  GSWTFSDQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPES  840
             GSWTFSDQDHGW VSDCTAE LKC LLL  MP +I+GEK + +RLY++V++ L LQS + 
Sbjct  477   GSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPTEIVGEKMEPERLYDSVNILLSLQS-KI  535

Query  839   GGFATWEPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVN  660
             GG   WEP     +L++LNP+E FADIV+E E++E T S I AL  F   YP +R KE++
Sbjct  536   GGLPAWEPVGAHKWLELLNPTEFFADIVIEHEYVECTSSAIQALTMFSKLYPGHRKKEID  595

Query  659   ISIAKAVQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFL  480
               I KA+ YLE  Q +DGSWYG WGVCF YGT+FAL GL AAGK+Y N   V  A HF L
Sbjct  596   KFIGKAIGYLEDAQMADGSWYGCWGVCFTYGTWFALGGLAAAGKTYTNSPTVRKAVHFLL  655

Query  479   SKQNQEGGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKL  300
             + Q Q GGWGE  +SCP  +YIPLEG  +NLVQT+W M+GL++ GQAERDP PLHRAAKL
Sbjct  656   NSQTQNGGWGESFRSCPQKKYIPLEGNRSNLVQTAWGMMGLLHAGQAERDPAPLHRAAKL  715

Query  299   LINAQMEDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             LIN+Q+EDGDFPQ++ITGV+M+NCMLHYA++R+ +PL AL+EY +R+
Sbjct  716   LINSQLEDGDFPQEEITGVFMRNCMLHYAAYRNIYPLWALAEYCRRL  762



>ref|XP_003521102.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Glycine max]
 ref|XP_006576766.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Glycine max]
Length=762

 Score =   929 bits (2400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/758 (56%), Positives = 562/758 (74%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI +GG  PYI+STNN+ GRQ WE+DP AGTPEE+   E AR+ F   R K    C
Sbjct  1     MWRLKIADGGKDPYIFSTNNFVGRQTWEFDPEAGTPEERAQVEAARQNFYNNRFKF-KAC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  R Q+++E+     +I  V++ + EE+ YE +T  + +A    CALQ  DGHWPA+
Sbjct  60    GDLLWRFQILRENNFKE-TISSVKIEDGEEITYEKVTATMTRAAHYLCALQTSDGHWPAQ  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +G +FF PPL+  +YI+G +D +   E+KKE++RY+Y HQNEDGGWGL+I+GHS M  +
Sbjct  119   IAGAMFFVPPLVFCMYITGHLDSVFPEEYKKEILRYMYYHQNEDGGWGLHIEGHSNMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             ALNY+ +R+LGEGP+ G D A AR RKWI DHGG T IPSWGK +LS+LGVY+W G  P+
Sbjct  179   ALNYICMRVLGEGPNGGHDNACARARKWIHDHGGVTHIPSWGKTWLSILGVYDWYGSKPV  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HP+K+WCYCR TY+PMSYLY KR+ GP+T ++L LR E+  + YE++
Sbjct  239   PPEFWVLPSFLPMHPSKIWCYCRLTYLPMSYLYGKRFVGPITPLILQLREELFTQPYEKV  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W +AR  C KED Y+PHS IQDL+W++L    EP + RWPF K +RE A++  +K++ Y
Sbjct  299   NWKKARNQCAKEDRYHPHSLIQDLVWDSLYIFIEPLLTRWPFNKLVREKALQVTMKHILY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK+L M+  W EDPNGD  K HLARVPDYLW++EDGM+M  FGSQ W
Sbjct  359   EDENSRYITIGCVEKALYMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMAMQSFGSQGW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA+   QA++A+ ++EE G  L K H +IK++QVK++P GDFKSMYRH++KGSWTFSDQD
Sbjct  419   DASLVIQALLATNLMEEIGPTLAKAHDFIKKTQVKDDPLGDFKSMYRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
              GW VSDCTAETL C LLL  +P +I+GEK + QRLY++V++ L LQS   GG A WEP 
Sbjct  479   QGWQVSDCTAETLNCCLLLSILPSEIVGEKMEPQRLYDSVNILLSLQS-RKGGLAAWEPS  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L++LNP+E   +IVVE ++ E TGS I ALV F+  YP +R KE+  SIA AVQ+
Sbjct  538   GTQEWLEILNPTEFLGNIVVEHDYAECTGSAIQALVLFKKLYPRHREKEIKNSIANAVQF  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q ++GSWYG WGVC++YGT+FAL GL AAGK+Y NC A+     F LS Q ++GGW
Sbjct  598   LEDTQTANGSWYGSWGVCYIYGTWFALRGLAAAGKTYTNCAAIRKGVKFLLSTQKEDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP   Y+PLEG+ + +V T+WA+LGL+  GQAERD T LHRAAKLLIN+Q+++G
Sbjct  658   GESYLSCPKQIYVPLEGSRSTVVHTAWALLGLILAGQAERDTTSLHRAAKLLINSQLKEG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             D+PQQ++TGV+ + CMLHY  +R+ +P+ AL+EYR+ V
Sbjct  718   DWPQQELTGVFNRTCMLHYPMYRNIYPMWALAEYRRLV  755



>emb|CBI18382.3| unnamed protein product [Vitis vinifera]
Length=885

 Score =   928 bits (2398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/769 (56%), Positives = 559/769 (73%), Gaps = 19/769 (2%)
 Frame = -3

Query  2432  IRKMWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKG  2259
             + KMW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   E AR+ F K R Q  
Sbjct  102   LEKMWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAARENFWKNRFQVK  161

Query  2258  PHTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGH  2079
             P +  DL  RMQ ++E      +IP V++ + EE+ YE  T AVR+      ALQA DGH
Sbjct  162   PSS--DLLWRMQFLREKNFKQ-TIPQVKVGDGEEITYETATAAVRRGAHFFSALQASDGH  218

Query  2078  WPAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHST  1899
             WPAEN+G L+F PPL++ LYI+G ++ +   E++KE++RYLY HQNEDGGWGL+I+GHST
Sbjct  219   WPAENAGALYFLPPLVMCLYITGHLETVFPREYRKEILRYLYCHQNEDGGWGLHIEGHST  278

Query  1898  MIGSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDG  1722
             M  + L+Y+ +R+LGEG D G D A ARGRKWILD GG T IPSWGK +LS+ G+++W G
Sbjct  279   MFCTTLSYICMRILGEGRDGGRDNACARGRKWILDRGGVTSIPSWGKTWLSIFGLFDWSG  338

Query  1721  CNPLSPEFWLFPSNFPF------------HPAKMWCYCRTTYMPMSYLYAKRYRGPLTDV  1578
              NP+ PEFWLFPS  P               AKMWCYCR  YMPMSYLY KR+ GP+T +
Sbjct  339   SNPMPPEFWLFPSRLPIIQVTHEYLKIQPGDAKMWCYCRLVYMPMSYLYGKRFVGPITPL  398

Query  1577  VLALRNEIHVKSYEQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK  1398
             VL LR E+ ++ Y +I+W + R  C KEDLYYPH  IQDL+W++L  CTEP + RWPF K
Sbjct  399   VLELRKELFLQPYNEINWKKVRHLCAKEDLYYPHPLIQDLMWDSLYICTEPLLTRWPFNK  458

Query  1397  IREMAMRKAIKYMRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWL  1218
             +R+ A+   +K++ YE E +RYITIGC+EK L M+  W EDP+GD  K HLAR+PDY+W+
Sbjct  459   LRQKALEVTMKHIHYEDENSRYITIGCVEKVLCMLSCWVEDPDGDYFKKHLARIPDYIWV  518

Query  1217  AEDGMSMHGFGSQNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSM  1038
              EDG+ M  FGSQ WD  FA QA++A  M +E G  L+K H ++KESQVK+NP GDFKSM
Sbjct  519   GEDGIKMQSFGSQEWDTGFALQALLACNMTDEIGPTLKKGHEFVKESQVKDNPSGDFKSM  578

Query  1037  YRHVTKGSWTFSDQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLY  858
             YRH++KGSWTFSDQDHGW VSDCTAE LKC LL   M  +I+G K + +RL+++V++ L 
Sbjct  579   YRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMAPEIVGTKMEPERLFDSVNILLS  638

Query  857   LQSPESGGFATWEPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNY  678
             LQS ++GG   WEP     +L++LNP+E+F D+V+E E++E T S I ALV F+  YP +
Sbjct  639   LQS-KNGGIVGWEPAGASEWLELLNPTEMFEDLVIEHEYVECTASAIQALVLFKKLYPRH  697

Query  677   RPKEVNISIAKAVQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCN  498
             R +E++  I  A +Y+E QQ  DGSWYG WGVCF YG++FAL GL AAG++Y NC A+ +
Sbjct  698   RTEEIDNFITNATKYIEDQQMPDGSWYGNWGVCFTYGSWFALGGLAAAGRTYHNCLAIGS  757

Query  497   AAHFFLSKQNQEGGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPL  318
             A  F L  Q  +GGWGE   SC   ++ PL+G  +NLVQT WA++GL+ +GQAERDPTPL
Sbjct  758   AVEFLLKSQRDDGGWGESYISCQEKKHTPLKGNKSNLVQTGWALMGLLSSGQAERDPTPL  817

Query  317   HRAAKLLINAQMEDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEY  171
             HRAAKLLIN+QMEDGDFPQQ+ITG ++KNCM HYA +R+ FPL AL+EY
Sbjct  818   HRAAKLLINSQMEDGDFPQQEITGAFLKNCMSHYADYRNIFPLWALAEY  866


 Score =   110 bits (274),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = -3

Query  1103  KVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHGWAVSDCTAETLKCLLLLGEMP  924
             K H +IK+SQV++NP GDF+SMYR++ KGSWTF D+DHGW VS+CT ++LKC  LL  MP
Sbjct  2     KGHDFIKKSQVRDNPSGDFRSMYRYIFKGSWTFLDRDHGWQVSNCTTKSLKC-CLLSVMP  60

Query  923   HKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVPQPYLQVL  786
              +I+GEK + +RLY++V + L LQS ++GG +  E      +L+ +
Sbjct  61    PEIVGEKIEPERLYDSVKLLLSLQS-KNGGLSARESAGASKWLEKM  105



>ref|XP_002269328.2| PREDICTED: beta-Amyrin Synthase 1-like [Vitis vinifera]
Length=773

 Score =   928 bits (2398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/758 (57%), Positives = 558/758 (74%), Gaps = 11/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   E AR+ F K R Q  P +
Sbjct  1     MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAARENFWKNRFQVKPSS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E      +IP V++ + EE+ YE  T AVR+      ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-TIPQVKVGDGEEITYETATAAVRRGAHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+G L+F PPL++ LYI+G ++ +   E++KE++RYLY HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGALYFLPPLVMCLYITGHLETVFPREYRKEILRYLYCHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + L+Y+ +R+LGEG D G D A ARGRKWILD GG T IPSWGK +LS+ G+++W G NP
Sbjct  178   TTLSYICMRILGEGRDGGRDNACARGRKWILDRGGVTSIPSWGKTWLSIFGLFDWSGSNP  237

Query  1712  LSPEFWLFPSNFPF----HPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVK  1545
             + PEFWLFPS  P     + AKMWCYCR  YMPMSYLY KR+ GP+T +VL LR E+ ++
Sbjct  238   MPPEFWLFPSRLPIIQSINAAKMWCYCRLVYMPMSYLYGKRFVGPITPLVLELRKELFLQ  297

Query  1544  SYEQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIK  1365
              Y +I+W + R  C KEDLYYPH  IQDL+W++L  CTEP + RWPF K+R+ A+   +K
Sbjct  298   PYNEINWKKVRHLCAKEDLYYPHPLIQDLMWDSLYICTEPLLTRWPFNKLRQKALEVTMK  357

Query  1364  YMRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFG  1185
             ++ YE E +RYITIGC+EK L M+  W EDP+GD  K HLAR+PDY+W+ EDG+ M  FG
Sbjct  358   HIHYEDENSRYITIGCVEKVLCMLSCWVEDPDGDYFKKHLARIPDYIWVGEDGIKMQSFG  417

Query  1184  SQNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTF  1005
             SQ WD  FA QA++A  M +E G  L+K H ++KESQVK+NP GDFKSMYRH++KGSWTF
Sbjct  418   SQEWDTGFALQALLACNMTDEIGPTLKKGHEFVKESQVKDNPSGDFKSMYRHISKGSWTF  477

Query  1004  SDQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFAT  825
             SDQDHGW VSDCTAE LKC LL   M  +I+G K + +RL+++V++ L LQS ++GG   
Sbjct  478   SDQDHGWQVSDCTAEGLKCCLLFSMMAPEIVGTKMEPERLFDSVNILLSLQS-KNGGIVG  536

Query  824   WEPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAK  645
             WEP     +L++LNP+E+F D+V+E E++E T S I ALV F+  YP +R +E++  I  
Sbjct  537   WEPAGASEWLELLNPTEMFEDLVIEHEYVECTASAIQALVLFKKLYPRHRTEEIDNFITN  596

Query  644   AVQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQ  465
             A +Y+E QQ  DGSWYG WGVCF YG++FAL GL AAG++Y NC A+ +A  F L  Q  
Sbjct  597   ATKYIEDQQMPDGSWYGNWGVCFTYGSWFALGGLAAAGRTYHNCLAIGSAVEFLLKSQRD  656

Query  464   EGGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQ  285
             +GGWGE   SC   ++ PL+G  +NLVQT WA++GL+ +GQAERDPTPLHRAAKLLIN+Q
Sbjct  657   DGGWGESYISCQEKKHTPLKGNKSNLVQTGWALMGLLSSGQAERDPTPLHRAAKLLINSQ  716

Query  284   MEDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEY  171
             MEDGDFPQQ+ITG ++KNCM HYA +R+ FPL AL+EY
Sbjct  717   MEDGDFPQQEITGAFLKNCMSHYADYRNIFPLWALAEY  754



>ref|XP_006351975.1| PREDICTED: beta-amyrin synthase-like [Solanum tuberosum]
Length=761

 Score =   927 bits (2397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/758 (57%), Positives = 556/758 (73%), Gaps = 7/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHT  2250
             MWKLKI +G   PY+YSTNNY GRQ WE+DPNAG  EE    E+AR+ F   R K  P++
Sbjct  1     MWKLKIAKGQDDPYLYSTNNYVGRQTWEFDPNAGMKEEHAEIEEARQHFWNNRYKVKPNS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E       I  V++ E +E+++E  T A+R+AV    ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-RIGAVKVEEGKEISHEIATIALRRAVHFFSALQATDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + L+Y+ +R+LGEGPD G + A AR RKWILDHG  T IPSWGK +LS+LG +EW G NP
Sbjct  178   TTLSYICMRILGEGPDGGKNNACARARKWILDHGSVTAIPSWGKTWLSILGAFEWLGTNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P +PAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y++
Sbjct  238   IPPEFWILPSFLPMNPAKMWCYCRMVYMPMSYLYGKRFIGPITPLILQLRVELYNQPYDE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I+W + R  C KEDLYYPH ++QDL+W++L  CTEP + RWPF K+R  A+   +K++ Y
Sbjct  298   INWKRVRHLCAKEDLYYPHPWVQDLMWDSLNICTEPLLTRWPFNKLRNKALEVTMKHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+ K L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ W
Sbjct  358   EDENSRYITIGCVNKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQAW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D +FA QA++AS M +E  D LRK H +IK SQVK+NP GDFK MYRH++KGSWTFSDQD
Sbjct  418   DTSFAIQALLASEMNDEILDTLRKGHDFIKTSQVKDNPSGDFKGMYRHISKGSWTFSDQD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSD TAE LKC L    MP +++GE  +  RLY++VDV L  QS ++GG A WEP 
Sbjct  478   HGWQVSDSTAEALKCCLFFSTMPSELVGEAIEPARLYDSVDVILTFQS-KNGGLAAWEPA  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 YL++LNP+E+FADIV+E E++E TG+ I ALV F+  YP +R  E++  I  AV+Y
Sbjct  537   GASQYLELLNPTELFADIVIEHEYVECTGASIQALVLFKKLYPGHRTTEIDNFIDNAVKY  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             L+  Q+ DGSWYG WGVCF Y ++FAL GL AAGKSY N  AV     F L +Q  +GGW
Sbjct  597   LDDVQKPDGSWYGSWGVCFTYASWFALGGLAAAGKSYSNSAAVRKGVEFLLLRQRSDGGW  656

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP   Y  LE   +NLVQT+WA++GL+++GQ +RDP PLH AA+LLIN+QMEDG
Sbjct  657   GESYHSCPDKVYRELETEHSNLVQTAWALMGLIHSGQVDRDPRPLHCAARLLINSQMEDG  716

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITGV MKNCMLHYA++++ FPL  L+EY K V
Sbjct  717   DFPQQEITGVVMKNCMLHYAAYKNIFPLWGLAEYCKNV  754



>sp|E2IUA8.1|FRIES_KALDA RecName: Full=Friedelin synthase; Short=KdFRS [Kalanchoe daigremontiana]
 gb|ADK35125.1| friedelin synthase [Kalanchoe daigremontiana]
Length=767

 Score =   927 bits (2397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/756 (57%), Positives = 553/756 (73%), Gaps = 6/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKI EGG  PYIY+TNN+ GRQIWE+DP A  P++    E AR  F   R K   + 
Sbjct  1     MWKLKIAEGGSDPYIYTTNNFVGRQIWEFDPQATDPQQLAKVEAARLNFYNHRHKIKPS-  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  R+Q ++E +    +I  V++ + EEV+YEA T A+++ V    ALQA DGHWPAE
Sbjct  60    SDLLWRLQFLEEKDFRQ-NIAQVKVEDGEEVSYEAATAALKRGVHFYSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GP+FF  PL++ LYI+G ++ I T EH++E +RY+Y HQNEDGGWG +I+G STM G+
Sbjct  119   NAGPMFFMSPLVMCLYITGHLNTIFTEEHRRETLRYIYYHQNEDGGWGFHIEGQSTMFGT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              LNY+ +RLLGEGP+ G D A++RGRKWILDHGGAT IPSWGK +LS++G+ +W GCNP+
Sbjct  179   VLNYICMRLLGEGPEGGQDNAVSRGRKWILDHGGATAIPSWGKTWLSIMGLCDWSGCNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFWL PS  P HPAKMWCYCR  YMPMSYLY KR+   +T ++L LR E+H + Y+QI
Sbjct  239   PPEFWLLPSYLPMHPAKMWCYCRMVYMPMSYLYGKRFTTHITPLILQLREELHTQPYDQI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W + R  CCKED YYPH  +QDL+W+ L   TEP + RWP  K IRE A++K +K++ Y
Sbjct  299   NWKKVRHVCCKEDTYYPHPILQDLIWDTLYLTTEPLLTRWPLNKLIRERALKKTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYI IG +EK L M+  W EDPNGD  K HLARVPDY W+AEDGM +  FGSQ+W
Sbjct  359   EDENSRYIVIGAVEKVLCMLACWVEDPNGDYFKKHLARVPDYFWVAEDGMKIQSFGSQHW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D AF  QA++AS M +E    L K H  IK+SQVK+NP GDF+SMYRH++KG+WTFSDQD
Sbjct  419   DTAFFVQALLASDMTDEIRTTLAKAHDCIKKSQVKDNPSGDFRSMYRHISKGAWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW +SDCTAE LKC LL   M  +++GE    +RLY++V+V LYLQS ++GG   WEP 
Sbjct  479   HGWQLSDCTAEGLKCCLLFSLMQPEVVGEAMPPERLYDSVNVLLYLQS-KNGGMPGWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP+E F +IV+E E++E T S + ALV F+  YP +R KEV   I    +Y
Sbjct  538   GESEWLELLNPTEFFENIVIEHEYVECTSSAVQALVLFKKLYPLHRRKEVERFITNGAKY  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q  DGSWYG WGVCF YG +FAL GL+AAGK+Y NC AV     F L+ Q ++GGW
Sbjct  598   LEDIQMPDGSWYGNWGVCFTYGAWFALEGLSAAGKTYNNCAAVRKGVDFLLNIQLEDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE  QSCP  +Y+PLE   +NLVQTSWA++GL+Y GQA+RDPTPLHRAAKLLIN+Q+EDG
Sbjct  658   GESYQSCPDKKYVPLEDNRSNLVQTSWALMGLIYAGQADRDPTPLHRAAKLLINSQLEDG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             DFPQQ+I GV+  NC LH+A++R+ FP+ AL+ YR+
Sbjct  718   DFPQQEIAGVFKMNCTLHFAAYRNIFPIWALAVYRR  753



>gb|EPS65499.1| beta-amyrin synthase, partial [Genlisea aurea]
Length=754

 Score =   927 bits (2396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/755 (56%), Positives = 559/755 (74%), Gaps = 7/755 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EG  GPY+YSTNNY GRQIWE+DP+ G+PE +   EKAR+ F + R +    C
Sbjct  1     MWRLKIAEGEDGPYLYSTNNYVGRQIWEFDPDYGSPELRAEVEKARRDFWENRYR-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  R+Q + E +    +IP VR+ E+E V+YE  T AVR++V    ALQA DGHWPAE
Sbjct  60    GDLLWRLQFLHEKKFQQ-TIPKVRVAEDENVSYEKATAAVRRSVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPL+F PPL+I+LYI G ++ +  S H+KE++RYLY HQNEDGGWG +I+GHS M  +
Sbjct  119   NAGPLYFLPPLVISLYIMGHLNAVFPSPHQKEILRYLYCHQNEDGGWGFHIEGHSIMFCT  178

Query  1886  ALNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             AL+Y+ +R+LGEGPD+   A AR RKWI+DHG     PSWGK +LS+ G+Y+W G NP+ 
Sbjct  179   ALSYICMRVLGEGPDND--ACARARKWIMDHGTLKASPSWGKTWLSIFGLYDWSGSNPMP  236

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+  P+T ++L LR E++ + YE I+
Sbjct  237   PEFWILPSYLPVHPAKMWCYCRMVYMPMSYLYGKRFVAPITPLILELRRELYDEPYENIN  296

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             W   R  C KED+YYPH +IQD +W++    TEP + RWPF KIRE A+R  ++++ YE 
Sbjct  297   WRSIRHLCAKEDMYYPHPWIQDFIWDSCYLITEPLLARWPFNKIREKALRVTMEHIHYED  356

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E +RYITIGC+EK L M+  W EDP+GD +K HLARVPDY+W+AEDGM M  FGSQ WDA
Sbjct  357   ENSRYITIGCVEKVLCMLACWVEDPDGDYVKKHLARVPDYIWVAEDGMKMQSFGSQMWDA  416

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQ-VKENPKGDFKSMYRHVTKGSWTFSDQDH  990
              FA QA++AS + +E G+ LR+ H ++K+SQ VK++P GDFK M+RH++KGSWTFSDQDH
Sbjct  417   GFAIQALLASDLTDEIGETLRRGHDFVKKSQVVKDDPSGDFKKMHRHISKGSWTFSDQDH  476

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC L+   MP +I+GE+ D   L+ +V++ L LQS ++GG A WEP  
Sbjct  477   GWQVSDCTAEGLKCCLIFSTMPREIVGEEMDPGLLFNSVNLLLSLQS-KNGGLAAWEPAG  535

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +L++LNP+E FADIV+E E++E T S I  LV F   +P++R KE+   +  A  +L
Sbjct  536   ASEWLELLNPTEFFADIVIEHEYVECTSSAIHGLVMFSKMFPHHRKKEIETFVTSAADFL  595

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSWYG WGVCF YG++FAL GL AAG++Y+NC AV     F L  Q  +GGWG
Sbjct  596   EDIQRPDGSWYGNWGVCFTYGSWFALGGLKAAGRNYQNCSAVRRGVDFLLKTQTADGGWG  655

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E  +SCP  +Y+PLEG  +NLV T+WAM+GL+++GQ ERDP P+HR+AKLLIN+Q+E GD
Sbjct  656   ESYRSCPDKQYVPLEGNRSNLVHTAWAMMGLIHSGQFERDPIPIHRSAKLLINSQLESGD  715

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             FPQQ+I+GV+MKNCMLHYA +R+ FP+ AL+EYR+
Sbjct  716   FPQQEISGVFMKNCMLHYALYRNVFPIWALAEYRR  750



>ref|XP_003521100.1| PREDICTED: beta-amyrin synthase-like isoformX1 [Glycine max]
 ref|XP_006576765.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Glycine max]
Length=762

 Score =   927 bits (2396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/758 (57%), Positives = 568/758 (75%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI +GG  PYI+STNN+ GRQ WE+DP AGTPEE+   E AR+ F   R K    C
Sbjct  1     MWRLKIADGGKDPYIFSTNNFVGRQTWEFDPEAGTPEERAQVEAARQNFYNNRFK-VKAC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  R Q+++E      SIP V++ + EE+ YE + + +R+A     ALQ  DGHWPA+
Sbjct  60    GDLLWRFQILREKNFKQ-SIPSVKIEDGEEITYEKVISTLRRAAHHLSALQTSDGHWPAQ  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPLFF PPL+  +YI+G +D++   E++KE++RY+Y HQNEDGGWGL+I+GHSTM G+
Sbjct  119   IAGPLFFLPPLVFCMYITGHLDLVFPEEYRKEILRYIYYHQNEDGGWGLHIEGHSTMFGT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              LNY+ +R+LGEGP+ G + A ARG+KWI DHGG T IPSWGK +LS+LGV++W G NP+
Sbjct  179   TLNYICMRILGEGPNGGHENACARGKKWIHDHGGVTHIPSWGKTWLSILGVFDWCGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+  + YE++
Sbjct  239   PPEFWIIPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKV  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W + R  C KEDLYYPHS IQDL+W++L   TEP +  WPF K IRE A++  + ++ Y
Sbjct  299   NWKKVRHQCAKEDLYYPHSLIQDLVWDSLYMFTEPLLTCWPFNKLIREKALQVTMNHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDP GD  K HLARV DYLW++EDGM+M  FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWVEDPQGDAFKKHLARVSDYLWVSEDGMTMQSFGSQEW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA FA QA++A+ +++E G  L K H +IK+SQV++NP GDFKSMYRH+TKGSWTFSDQD
Sbjct  419   DAGFAVQALLATKLIDEIGHSLAKGHDFIKKSQVRDNPSGDFKSMYRHITKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LLL ++  +I+GEK   +R Y++V++ L LQS + GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSKLSPEIVGEKVKPERFYDSVNILLSLQS-KKGGIAAWEPI  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L++LNP+E F DIV+E E++E TGS I ALV F+  YP +R  E+   I  AVQ+
Sbjct  538   GAQEWLELLNPTEFFEDIVIEHEYVECTGSAIQALVLFQKLYPEHRKTEIKNFIVNAVQF  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q ++GSWYG WGVC+ YG++FAL GL AAGK+Y NC A+  A  F L+ Q ++GGW
Sbjct  598   LEDTQTTNGSWYGCWGVCYTYGSWFALGGLAAAGKTYTNCNAIRKAVKFLLTTQREDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   S P   YIPLEG+ +N+VQT+WA++GL+Y GQ+ERD TPLH+AAKLLIN+Q+E+G
Sbjct  658   GESYLSSPKKIYIPLEGSRSNVVQTAWALMGLIYAGQSERDLTPLHQAAKLLINSQLEEG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             D+PQQ+ITGV++KNCM+HY  +R+ FP+ AL+EYR+RV
Sbjct  718   DWPQQEITGVFLKNCMMHYPMYRNIFPMWALAEYRRRV  755



>ref|XP_010417511.1| PREDICTED: amyrin synthase LUP2-like isoform X2 [Camelina sativa]
Length=764

 Score =   927 bits (2395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/757 (56%), Positives = 562/757 (74%), Gaps = 7/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LKIGEG G  PY++S+NN+ GRQ WE+DP  GTPEE+ A E AR+ F   R +    
Sbjct  1     MWRLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKTGTPEERAAVEGARRKFVDNRSR-VKG  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             C DL  RMQ +KE++ + + IPPV++ +   + +   T A+R+ V    ALQA DGHWP 
Sbjct  60    CSDLLWRMQFLKEAKFEQV-IPPVKIDDGVGITHGNATDALRRGVSFFSALQASDGHWPG  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +GPLFF PPL+  LYI+G ++ I  +EH+KE++R++Y HQNEDGGWGL+I+  S M  
Sbjct  119   EITGPLFFLPPLVFCLYITGHLEEIFDAEHRKEMLRHIYCHQNEDGGWGLHIESKSMMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ LRLLGEGP+ G D A  R R WILD GG T IPSWGKI+LS++G+Y+W G NP
Sbjct  179   TALNYICLRLLGEGPNGGRDNACKRARDWILDRGGVTYIPSWGKIWLSIIGIYDWSGTNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PE WL PS  P H  K+ CYCR  YMPMSYLY KR+ GP+T ++L LR E+H++ YE 
Sbjct  239   MPPEIWLLPSFLPIHLGKVLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPYES  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+WN+ R    KED+Y+PH  +QDL+W+AL    EPF+ RWP  K +RE A+R+A+K++ 
Sbjct  299   INWNKTRRLYAKEDMYFPHPLVQDLVWDALYLFVEPFLTRWPLNKLVRERALRRAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E + YITIGC+EK L M+  W E+PNGD  K HLAR+PDY+W+AEDGM M  FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QAI+AS + +E GD L+K H YIK+SQV+ENP GD++SMYRH++KG+WT SD+
Sbjct  419   WDTGFAVQAILASDLSDETGDVLKKGHDYIKKSQVRENPSGDYESMYRHISKGAWTLSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE  KC LLL  MP +++G+K D ++L+++V++ L  QS ++GG   WEP
Sbjct  479   DHGWQVSDCTAEAFKCCLLLSMMPAEVVGQKMDPEQLFDSVNLMLSFQS-DNGGMTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  ++++LNP+E  A++V E E++E T S++ ALV F+  YP+++ KE++ SI KAVQ
Sbjct  538   ARAYEWIELLNPTEFLANLVAEREYVECTSSVMQALVLFKQLYPDHKTKEISRSIEKAVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             +LE +Q  DGSWYG WGVCF+Y T+FAL GL AAGK+Y+N +A+     F L+ Q  +GG
Sbjct  598   FLENEQRPDGSWYGNWGVCFIYATWFALGGLAAAGKTYQNSQAIRKGVEFLLTIQKDDGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYIP EG  +NLVQTSWA++GL+  GQAERDP PLHRAAKL+IN+QME+
Sbjct  658   WGESYLSCPEQRYIPSEGKRSNLVQTSWAIMGLISAGQAERDPKPLHRAAKLIINSQMEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             GDFPQQ+I GV+MKNCM+HYA++R+ FPL AL+EYRK
Sbjct  718   GDFPQQEIVGVFMKNCMIHYATYRNTFPLWALAEYRK  754



>ref|XP_010531947.1| PREDICTED: camelliol C synthase-like isoform X1 [Tarenaya hassleriana]
Length=762

 Score =   926 bits (2394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/760 (57%), Positives = 565/760 (74%), Gaps = 8/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEG---GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2253
             MWKLKIGEG      Y+YSTNN+ GRQ WE+DP+A +PEE  A E++R+ F K R +   
Sbjct  1     MWKLKIGEGRKEDTDYLYSTNNFLGRQTWEFDPDAASPEELVAVEESRRNFFKNRSR-VK  59

Query  2252  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2073
                DL  RMQ +KE + + L IPPV++ + E++ +E +T A+R+ VRL  ALQ+ DGHWP
Sbjct  60    ASSDLLWRMQFLKEKKFEQL-IPPVKVGDAEKITHETLTNALRRGVRLFSALQSDDGHWP  118

Query  2072  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  1893
             AEN+GPLFF PPL+  LYI+G +D + T+EH+KE +RY+Y HQNEDGGWGL+I+GHSTM 
Sbjct  119   AENAGPLFFLPPLVFCLYITGYLDEVFTAEHRKEALRYIYCHQNEDGGWGLHIEGHSTMF  178

Query  1892  GSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              +ALNY+ +R+LGEGPD G + A  R R+WIL HGG T IPSWGK +LS+LGV++W G N
Sbjct  179   CTALNYICMRILGEGPDGGRENACRRARQWILGHGGVTYIPSWGKAWLSILGVFDWSGSN  238

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             P+ PEFW+ PS  P HPAKM C CR  YMP+SYLY KR+   +T ++L LR E++++ YE
Sbjct  239   PMPPEFWILPSFLPIHPAKMLCNCRMVYMPLSYLYGKRFAAQITPLILQLREELYLQPYE  298

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYM  1359
              I+WN+AR  C K DLYYPH  IQDL+W+ L    EPF+ RWPF K+ RE A++ A++++
Sbjct  299   TINWNKARHLCAKVDLYYPHPLIQDLIWDCLHTLMEPFLTRWPFNKLLREKALKVAMEHI  358

Query  1358  RYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQ  1179
              YE E +RYIT+GC+EK+L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ
Sbjct  359   HYEDENSRYITLGCVEKALCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQ  418

Query  1178  NWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSD  999
              WD  FA QA++AS +  E  D L++ H +IK SQV ENP  DFKSMYRH++KG+WTFSD
Sbjct  419   LWDTGFAIQALLASNLSNEISDVLKRGHNFIKMSQVTENPSDDFKSMYRHISKGAWTFSD  478

Query  998   QDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWE  819
             +DHGW VSDCTA+ LKC L+L  MP  ++G K D +RLY++V++ L LQS ++GG   WE
Sbjct  479   RDHGWQVSDCTADGLKCCLMLSTMPPDMVGPKMDPERLYDSVNIILSLQS-KNGGVTAWE  537

Query  818   PPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAV  639
             P     +L++ NP+E FAD ++E ++ E T S I ALV FR  YP++R KE+N  I KAV
Sbjct  538   PARAYGWLELFNPTEFFADTLIEYQYAECTSSAIQALVLFRKLYPDHRTKEINTFIEKAV  597

Query  638   QYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEG  459
             +Y+++ Q  +GSWYG WGVCF YGT+FAL GL AAGK+Y+NC       HF L+ Q   G
Sbjct  598   EYIQRMQMPNGSWYGSWGVCFTYGTWFALAGLAAAGKTYDNCLVTRKGVHFLLTTQKDNG  657

Query  458   GWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQME  279
             GWGE   SCP  RY+ L+G  +NLVQTSWAM+GL+++GQ ERDP PLHRAAKL+IN+Q+E
Sbjct  658   GWGESYLSCPEKRYVQLDGEKSNLVQTSWAMMGLLHSGQGERDPEPLHRAAKLIINSQLE  717

Query  278   DGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
              GDFPQ +ITG +MKNCMLHY+++R+ FPL AL+EYR+RV
Sbjct  718   SGDFPQHEITGAFMKNCMLHYSAYRNTFPLWALAEYRRRV  757



>ref|XP_009344016.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=761

 Score =   926 bits (2394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/758 (57%), Positives = 564/758 (74%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLK+ +GG  PYIYSTNN+ GRQI+E+DP AGT EE+   E+AR  F   R +     
Sbjct  1     MWKLKVADGGNDPYIYSTNNFVGRQIFEFDPEAGTTEERAEVEEARLHFYNNRHQ-VKPS  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ ++E      +IPPV++ + EE+ +E  T ++R+++ L  ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREKNFKQ-TIPPVKIEDGEEITHEKATASLRRSIHLFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFF PPL+I +YI+G ++ +  +EH+KE++RY+Y HQN+DGGWG +I+GHS M  +
Sbjct  119   NAGPLFFLPPLVICIYITGHLNTVFHAEHRKEILRYIYYHQNQDGGWGFHIEGHSIMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEG D G D A AR RKWILDHG  T +PSWGK +LS+LGV+EW GCNP+
Sbjct  179   ALSYICMRILGEGSDGGQDNACARARKWILDHGSVTHMPSWGKTWLSILGVFEWSGCNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P +PAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+  + Y++I
Sbjct  239   PPEFWILPSFLPIYPAKMWCYCRMIYMPMSYLYGKRFVGPITPLILQLREELLAQPYDEI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +WN  R  C KED+YYPH +IQD LW++L  CTEP + RWP  K IR+ A+  A++++ Y
Sbjct  299   NWNGVRHHCAKEDIYYPHPWIQDFLWDSLYICTEPLLTRWPLNKLIRKRALEVAMEHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIG +EK+L MM  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ W
Sbjct  359   EDENSRYITIGSVEKALCMMACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQMW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA FA QA++AS + +E    L + H ++K+SQVK+NP GDFKSM+RH++KGSWTFSDQD
Sbjct  419   DAGFAIQALLASNLTDEIAPTLARGHDFVKKSQVKDNPSGDFKSMHRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW +SD TAE LKC LLL  MP +++GEK + + LYEAV++ +YLQS ++GG A WE  
Sbjct  479   HGWTLSDSTAEGLKCCLLLSMMPPELVGEKMEPEWLYEAVNIIIYLQS-KNGGLAVWERA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP+E F DIV+E E++E T + I A+V F+  YP +R KE +  I  A QY
Sbjct  538   GAAKWLEILNPTEFFVDIVLEHEYLECTAAAIQAIVLFKKLYPGHRKKETDQFITNAAQY  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E  Q  DGSWYG WGVCF YGT+FAL GLTAAGK++ NC  +  A  F L  QN+ GGW
Sbjct  598   VENTQMEDGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCAVIRKAISFLLRMQNENGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP   Y+PLEG  +NLVQT+WAM+GL+Y GQAERDP PLHRAAKL+IN+Q+E+G
Sbjct  658   GESYLSCPKREYVPLEGNRSNLVQTAWAMMGLIYGGQAERDPAPLHRAAKLIINSQLENG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+I GV+  NCMLHY ++R+ FPL AL+EYRK V
Sbjct  718   DFPQQEIAGVFKMNCMLHYPTYRNVFPLWALAEYRKWV  755



>sp|Q9LRH8.1|BAMS_PEA RecName: Full=Beta-amyrin synthase [Pisum sativum]
 dbj|BAA97558.1| beta-amyrin synthase [Pisum sativum]
Length=758

 Score =   926 bits (2394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/758 (57%), Positives = 562/758 (74%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EGG  PY++STNN+ GRQ WEYDP AG+ EE+   E+AR+ F   R +    C
Sbjct  1     MWRLKIAEGGNDPYLFSTNNFVGRQTWEYDPEAGSEEERAQVEEARRNFYNNRFE-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  R Q+++E+     +I  V++ +EEE+ YE  TT +R+       LQ  DGHWPA+
Sbjct  60    GDLLWRFQVLRENNFKQ-TIGGVKIEDEEEITYEKTTTTLRRGTHHLATLQTSDGHWPAQ  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPLFF PPL+  +YI+G +D +   EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFMPPLVFCVYITGHLDSVFPPEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             ALNY+ +R+LGEGPD G D A  R R WI  HGG T IPSWGK +LS+LGV++W G NP+
Sbjct  179   ALNYICMRILGEGPDGGEDNACVRARNWIRQHGGVTHIPSWGKTWLSILGVFDWLGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E+H + YE+I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELHTEPYEKI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W + R  C KED+YYPH  IQDL+W++L   TEP + RWPF K +R+ A+   +K++ Y
Sbjct  299   NWTKTRHLCAKEDIYYPHPLIQDLIWDSLYIFTEPLLTRWPFNKLVRKRALEVTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RY+TIGC+EK L M+  W EDPNGD  K H+ARVPDYLW++EDGM+M  FGSQ W
Sbjct  359   EDENSRYLTIGCVEKVLCMLACWVEDPNGDAFKKHIARVPDYLWISEDGMTMQSFGSQEW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA FA QA++A+ ++EE    L K H +IK+SQV ENP GDFKSM+RH++KGSWTFSDQD
Sbjct  419   DAGFAVQALLATNLIEEIKPALAKGHDFIKKSQVTENPSGDFKSMHRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LLL  +P +I+GEK + +RL+++V++ L LQS + GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSLLPPEIVGEKMEPERLFDSVNLLLSLQS-KKGGLAAWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L++LNP+E FADIVVE E++E TGS I ALV F+  YP +R KE+   I  AV++
Sbjct  538   GAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFIFNAVRF  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q  DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+     F L+ Q ++GGW
Sbjct  598   LEDTQTEDGSWYGNWGVCFTYGSWFALGGLAAAGKTYTNCAAIRKGVKFLLTTQREDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   S P   Y+PLEG  +N+V T+WA++GL++ GQ+ERDPTPLHRAAKLLIN+Q+E G
Sbjct  658   GESYLSSPKKIYVPLEGNRSNVVHTAWALMGLIHAGQSERDPTPLHRAAKLLINSQLEQG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             D+PQQ+ITGV+MKNCMLHY  +R  +PL AL+EYR+RV
Sbjct  718   DWPQQEITGVFMKNCMLHYPMYRDIYPLWALAEYRRRV  755



>gb|AIU41743.1| beta-amyrin synthase [Chlorophytum borivilianum]
Length=758

 Score =   926 bits (2393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/757 (57%), Positives = 560/757 (74%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPN-AGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EGG P++ +TNN+ GRQIWE+D N  G+ EE    E AR+ F+  R    H+ 
Sbjct  1     MWRLKIAEGGNPWLRTTNNHVGRQIWEFDSNYQGSHEELLEIENARRNFSDNRFNQKHS-  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL MR+Q  +E+ +  + IP V+L++ E+V  EA+T  +R+A+     +QA DGHWP +
Sbjct  60    ADLLMRIQFERENPLREV-IPQVKLKDNEDVTEEAVTRTLRRALNYYSVIQAHDGHWPGD  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
               GP+F  P L+I L I+G+++ +L+ EHKKE++RYLYNHQNEDGGWGL+I+G STM GS
Sbjct  119   YGGPMFLMPGLVITLSITGALNAVLSEEHKKEMIRYLYNHQNEDGGWGLHIEGPSTMFGS  178

Query  1886  ALNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
              LNYV LRLLGEG ++GDGA+   R WIL+HGGAT I SWGK++LSVLG +EW G NP+ 
Sbjct  179   VLNYVTLRLLGEGANEGDGAMENARNWILNHGGATAITSWGKMWLSVLGCFEWSGSNPMP  238

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+  P+T ++L LR E+H + Y+QI+
Sbjct  239   PEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVAPITPLILQLREELHTQPYDQIN  298

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRYE  1350
             W + R  C  EDLYYPH  IQDL+W+ +  C EPF+ RWP  K +R+ A+   +K++ YE
Sbjct  299   WKKTRHQCAPEDLYYPHPLIQDLMWDCIYICGEPFLTRWPLNKTLRKRALEVTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
               FA QA++A+ +  E  D L+K H ++K+SQVK+NP  D+++M+RH++KGSWTFSDQDH
Sbjct  419   TGFALQALLAANLTNEIADVLKKGHDFVKKSQVKDNPSDDYRAMHRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC LL   MP +I+GE+ + QRLY+AV++ L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLFSMMPPEIVGEQTEPQRLYDAVNLLLSLQS-KNGGLAAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
              Q +L++LNP+E FADIV+E E++E T S I ALV F+  +P +R KE+   I  AVQYL
Sbjct  538   AQKWLEMLNPTEFFADIVIEHEYVECTSSAIQALVLFKSLHPGHRTKEIEKFIDNAVQYL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             +  Q+ DG WYG WGVCF YGT+FAL GL AAGKSY NC A+  A  F L  Q  +GGWG
Sbjct  598   QDIQDPDGGWYGNWGVCFTYGTWFALGGLAAAGKSYNNCFAMRKAVDFLLRTQRDDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP+ +Y+PLEG  TNLV T+WAM+GL++  Q  RDPTPLHRAAKL+IN+Q+EDGD
Sbjct  658   ESYLSCPNKKYVPLEGGRTNLVHTAWAMMGLIHAQQMNRDPTPLHRAAKLIINSQLEDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ++ GV+M+NCMLHY+++R  FP+ AL+EYR+ V
Sbjct  718   FPQQELMGVFMRNCMLHYSAYRHIFPVWALAEYRRHV  754



>ref|XP_010429762.1| PREDICTED: amyrin synthase LUP2-like [Camelina sativa]
 ref|XP_010429763.1| PREDICTED: amyrin synthase LUP2-like [Camelina sativa]
Length=761

 Score =   926 bits (2392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/757 (56%), Positives = 562/757 (74%), Gaps = 7/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LKIGEG G  PY++S+NN+ GRQ WE+DP  GTPEE+ A E+AR+ +   R +    
Sbjct  1     MWRLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKTGTPEERAAVEEARRKYVDNRSR-VKG  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             C DL  RMQ +KE++ + L IPPVR+ +   + +   T A+R+ V    ALQA DGHWP 
Sbjct  60    CSDLLWRMQFLKEAKFEQL-IPPVRIDDGVGITHGNATDALRRGVSFFSALQASDGHWPG  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +GPLFF PPL+  LYI+G ++ I  +EH+KE++R++Y HQNEDGGWGL+I+  S M  
Sbjct  119   EITGPLFFLPPLVFCLYITGHLEEIFDAEHRKEMLRHIYCHQNEDGGWGLHIESKSMMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ LRLLGEGP+ G D A  R R WILD GG T IPSWGKI+LS++G+Y+W G NP
Sbjct  179   TALNYICLRLLGEGPNGGRDNACKRARDWILDRGGVTYIPSWGKIWLSIIGIYDWSGTNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PE WL PS  P H  K+ CYCR  YMPMSYLY KR+ GP+T ++L LR E+H++ YE 
Sbjct  239   MPPEIWLLPSFLPIHLGKVLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPYES  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+WN+ R    KED+Y+PH  +QDL+W+AL    EPF+ RWP  K +R+ A+R+A+K++ 
Sbjct  299   INWNKTRRLYAKEDMYFPHPLVQDLVWDALYLFVEPFLTRWPLNKLVRDKALRRAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E + YITIGC+EK L M+  W E+PNGD  K HLAR+PDY+W+AEDGM M  FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARLPDYMWVAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QAI+AS + +E GD L+K H YIK+SQV+ENP GD++SMYRH++KG+WT SD+
Sbjct  419   WDTGFAVQAILASDLSDETGDVLKKGHDYIKKSQVRENPSGDYESMYRHISKGAWTLSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE  KC LLL  MP +++G+K D ++L+++V++ L  QS ++GG   WEP
Sbjct  479   DHGWQVSDCTAEAFKCCLLLSMMPAEVVGQKMDPEQLFDSVNLMLSFQS-DNGGMTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  ++++LNP+E  A++V E E++E T S++ ALV F+  YP+++ KE++ SI KAVQ
Sbjct  538   ARAYEWIELLNPTEFLANLVAEREYVECTSSVMQALVLFKQLYPDHKTKEISRSIEKAVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             +LE +Q  DGSWYG WGVCF+Y T+FAL GL AAGK+Y+N +A+     F L+ Q   GG
Sbjct  598   FLENEQRPDGSWYGNWGVCFIYATWFALGGLAAAGKTYQNSQAIRKGVEFLLTIQKDNGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYIP EG  +NLVQT+WA++GL+  GQAERDP PLHRAAKL+IN+QME+
Sbjct  658   WGESYLSCPEQRYIPSEGKSSNLVQTAWAIMGLISAGQAERDPIPLHRAAKLIINSQMEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             GDFPQQ+I GV+MKNCM+HYA++R+ FPL AL+EYRK
Sbjct  718   GDFPQQEIVGVFMKNCMIHYATYRNTFPLWALAEYRK  754



>ref|XP_008362478.1| PREDICTED: beta-amyrin synthase [Malus domestica]
Length=750

 Score =   926 bits (2392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/752 (57%), Positives = 555/752 (74%), Gaps = 8/752 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MWKLK+ +GG  PYIYSTNN+ GRQI+E+DP AGT E++   E+AR  F   R Q  P++
Sbjct  1     MWKLKVADGGNDPYIYSTNNFVGRQIFEFDPEAGTTEZRAEVEEARLHFYNNRYQVKPNS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E      +IPPV + + EE+ YE  T A+R++V    ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-TIPPVXVEDGEEITYEKATAALRRSVHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++  YI+G +      EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCTYITGHLXTXXXXEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ +R+LGEGPD G D A AR R WILDHG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TALNYICMRILGEGPDGGQDNACARARXWILDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P  P K+WC+CRT Y PMSYLY  R+ GP+T ++L LR E++ + Y++
Sbjct  238   MPPEFWILPSFLPMXPGKIWCFCRTVYKPMSYLYGIRFVGPITPLILQLREELYAQPYDE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W   R  C K D+YYPH +IQD LW++L  CTEP + RWPF K IR+ A+   ++++ 
Sbjct  298   INWKGVRHHCAKVDIYYPHPWIQDFLWDSLYVCTEPLLTRWPFNKLIRKRALEVTMEHVH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYIT GC++K L M+  W EDPNGD  K HLAR+ DYLW+AEDGM M  FGSQ 
Sbjct  358   YEDENSRYITJGCVZKVLCMLACWXEDPNGDYFKKHLARIXDYLWVAEDGMKMQSFGSQQ  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD   A QA++AS + +E    L + H ++K+SQVK+NP GDFKSMYRH++KGSWTFSDQ
Sbjct  418   WDTGLAIQALLASNLTDEIAPTLARGHDFVKKSQVKDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LLL  MP +I+GEK + ++LY+AV+V + LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMMPPEIVGEKMEPEQLYDAVNVLISLQS-KNGGLAAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+E F DIV+E EH+E T S I ALV F+  YP +R +E++  I  A +
Sbjct  537   AGAAEWLEMLNPTEFFEDIVIEHEHVECTSSAIQALVLFKKLYPGHRKEEIDQFITAAAR  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q +DGSWYG WGVCF YGT+FAL GLTAAGK++ NC A+  A  F L+ Q + GG
Sbjct  597   YLENVQMADGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCAAMRKAVSFLLAIQKENGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP   Y+PLEG  +NLV T+WAM+GL++ GQAERDPTPLHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIHAGQAERDPTPLHRAAKLIINSQMEN  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMAL  180
             GDFPQQ+ITGV++KNCMLHY ++R+ FP+ AL
Sbjct  717   GDFPQQEITGVFLKNCMLHYPAYRNIFPMWAL  748



>ref|XP_002310349.1| beta-Amyrin synthase family protein [Populus trichocarpa]
 gb|EEE90799.1| beta-Amyrin synthase family protein [Populus trichocarpa]
Length=760

 Score =   926 bits (2392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/758 (58%), Positives = 558/758 (74%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EG     +YSTN + GRQ WEYDP+ G+PEE+   E+AR  F   R       
Sbjct  1     MWRLKIAEGVSSNELYSTNKFVGRQTWEYDPHGGSPEERAEVEEARLSFYNNRYH-VKPS  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ +KE       IP V + + EE+ YE  T A+++AV    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLKEKNFKQ-KIPQVIIEDGEEITYEKATNALKRAVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFF PPL++ LYI+G +D + + EH++E++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCLYITGHLDSVFSVEHRREILRYIYYHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              L+Y+ +R+LGEGP  G D A AR RKWI DHG AT IPSWGK +LS+LGV++W G NP+
Sbjct  179   VLSYICMRILGEGPSGGQDNACARARKWIHDHGTATHIPSWGKTWLSILGVFDWSGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFWL PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T +VL LR E+  + Y Q+
Sbjct  239   PPEFWLLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPVTPLVLQLREELFAEPYGQV  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W + R  C  EDLYYPH  IQDL+W++L   TEPF+ RWPF K +R+ A+   +K++ Y
Sbjct  299   NWRKTRHLCAAEDLYYPHPLIQDLVWDSLYVFTEPFLTRWPFHKLVRKKALEVTMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDP+GD  K HLAR+PDYLW+AEDGM M  FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWVEDPDGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D  FA QA++AS   +E  D L++ H +IK+SQVK+NP GDFKSMYRH++KGSWTFSDQD
Sbjct  419   DTGFAIQALLASNFTDEIIDVLKRGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LL   MP +I+GE+ + +RL+++V+V L LQS E+GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLFSMMPPEIVGEQLEPERLFDSVNVLLSLQS-ENGGLAAWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L++LNP+E FADIVVE E++E T S I AL+ F+  YP +R KE++  +  A +Y
Sbjct  538   GAQKWLELLNPTEFFADIVVEHEYVECTASAIQALLLFKNLYPGHRKKEIDNFVTNAARY  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q  +G WYG WGVCF YGT+FAL GL AAGK+Y  C A+    +F L+ Q  +GGW
Sbjct  598   LESIQTPEGGWYGNWGVCFTYGTWFALGGLAAAGKTYSTCTAMRQGVNFLLNIQKDDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP  +Y+PLEG  +NLV T+WAM+GL++ GQ +RD  PLHRAAKL+IN+Q+EDG
Sbjct  658   GESYLSCPKKKYVPLEGNRSNLVHTAWAMMGLIHAGQMDRDSAPLHRAAKLIINSQLEDG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITGV+MKNCMLHYA++R+ +PL AL+EY++RV
Sbjct  718   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYQRRV  755



>gb|ABK76265.1| beta-amyrin synthase [Vaccaria hispanica]
Length=760

 Score =   926 bits (2392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/760 (58%), Positives = 561/760 (74%), Gaps = 10/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LKI EG   PY+YSTNN+ GRQ WE+D + GTPE  +  E+AR+ F K R Q  P  
Sbjct  1     MWRLKIAEGANDPYLYSTNNFVGRQTWEFDTDYGTPEAIKEVEEARQDFYKNRFQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             CGDL  R Q ++E      +IP V+L + EEV YEA T  V++AV    A+QA+DGHWPA
Sbjct  59    CGDLLWRFQFLREKNFKQ-TIPQVKLGDGEEVTYEAATATVKRAVNYLAAIQAEDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +GP FF PPL+  LYI+G ++ +    H++E++R +Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   EIAGPQFFLPPLVFCLYITGHLNSVFNVHHREEILRSIYYHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDGD-GAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ LR+LG GPD+GD  A  R RKWILDHG  T IPSWGK +LS+LG+++W G NP
Sbjct  178   TALNYICLRMLGVGPDEGDDNACPRARKWILDHGSVTHIPSWGKTWLSILGLFDWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P +PAKMWCYCR  YMPMSYLY KR+ GP+T ++  LR E+  + YE 
Sbjct  238   MPPEFWILPSFMPMYPAKMWCYCRMVYMPMSYLYGKRFVGPITPLIKQLREELFNEPYED  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I W + R  C +EDLYYPH  IQDL+W++L   TEP + RWPF   IR+ A++  + ++ 
Sbjct  298   IKWKKVRHFCAQEDLYYPHPLIQDLMWDSLYLFTEPLLTRWPFNGLIRKKALQVTMDHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RY+TIGC+EK L M+  W EDPNG   K HLARVPDY+W+AEDG+ M  FGSQ 
Sbjct  358   YEDENSRYLTIGCVEKVLCMLACWVEDPNGVCYKKHLARVPDYVWIAEDGLKMQSFGSQQ  417

Query  1175  WDAAFATQAIIASGM-VEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSD  999
             WD  FA QA++AS + ++E G  L+K H++IKESQVK+NP GDFKSM+RH++KGSWTFSD
Sbjct  418   WDCGFAVQALLASNLSLDEIGPALKKGHYFIKESQVKDNPSGDFKSMHRHISKGSWTFSD  477

Query  998   QDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWE  819
             QDHGW VSDCTAE LKC L+L  MP +I+GEK D +RLY++V++ L LQS E+GG + WE
Sbjct  478   QDHGWQVSDCTAEGLKCCLVLSTMPPEIVGEKMDPERLYDSVNILLSLQS-ENGGLSAWE  536

Query  818   PPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAV  639
             P   Q +L++LNP+E FADIV+E E++E TGS I ALV F+  YP +R KE+   I KA 
Sbjct  537   PAGAQAWLELLNPTEFFADIVIEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFILKAS  596

Query  638   QYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEG  459
             +YLE  Q  +GSWYG WGVCF YGT+FAL GLTAAG+++ NC A+     F L  Q ++G
Sbjct  597   KYLEDTQYPNGSWYGNWGVCFTYGTWFALGGLTAAGRTFSNCAAIRKGVEFLLKSQKEDG  656

Query  458   GWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQME  279
             GWGE   SCP   ++PLEG  +NL QT+WA++GL+YT Q ERDPTPLHRAAKLLIN+Q+E
Sbjct  657   GWGESYISCPKKDFVPLEGP-SNLTQTAWALMGLIYTRQMERDPTPLHRAAKLLINSQLE  715

Query  278   DGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
              GDFPQQ+ITGV+MKNCMLHY  +RS +P+ AL+EYRK V
Sbjct  716   SGDFPQQEITGVFMKNCMLHYPMYRSIYPMWALAEYRKHV  755



>ref|XP_010417510.1| PREDICTED: amyrin synthase LUP2-like isoform X1 [Camelina sativa]
Length=764

 Score =   925 bits (2390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/757 (56%), Positives = 561/757 (74%), Gaps = 7/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LKIGEG G  PY++S+NN+ GRQ WE+DP  GTPEE+ A E AR+ F   R +    
Sbjct  1     MWRLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKTGTPEERAAVEGARRKFVDNRSR-VKG  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             C DL  RMQ +KE++ + + IPPV++ +   + +   T A+R+ V    ALQA DGHWP 
Sbjct  60    CSDLLWRMQFLKEAKFEQV-IPPVKIDDGVGITHGNATDALRRGVSFFSALQASDGHWPG  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +GPLFF PPL+  LYI+G ++ I  +EH+KE++R++Y HQNEDGGWGL+I+  S M  
Sbjct  119   EITGPLFFLPPLVFCLYITGHLEEIFDAEHRKEMLRHIYCHQNEDGGWGLHIESKSMMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ LRLLGEGP+ G D A  R R WILD GG T IPSWGKI+LS++G+Y+W G NP
Sbjct  179   TALNYICLRLLGEGPNGGRDNACKRARDWILDRGGVTYIPSWGKIWLSIIGIYDWSGTNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PE WL PS  P H  K+ CYCR  YMPMSYLY KR+ GP+T ++L LR E+H++ YE 
Sbjct  239   MPPEIWLLPSFLPIHLGKVLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPYES  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+WN+ R    KED+Y+PH  +QDL+W+AL    EPF+ RWP  K +RE A+R+A+K++ 
Sbjct  299   INWNKTRRLYAKEDMYFPHPLVQDLVWDALYLFVEPFLTRWPLNKLVRERALRRAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E + YITIGC+EK L M+  W E+PNGD  K HLAR+PDY+W+AEDGM M  FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QAI+AS + +E GD L+K H YIK+SQV+ENP GD++SMYRH++KG+WT SD+
Sbjct  419   WDTGFAVQAILASDLSDETGDVLKKGHDYIKKSQVRENPSGDYESMYRHISKGAWTLSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE  KC LLL  MP +++G+K D ++L+++V++ L  QS ++GG   WEP
Sbjct  479   DHGWQVSDCTAEAFKCCLLLSMMPAEVVGQKMDPEQLFDSVNLMLSFQS-DNGGMTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  ++++LNP+E  A++V E E++E T S++ ALV F+  YP+++ KE++ SI KAVQ
Sbjct  538   ARAYEWIELLNPTEFLANLVAEREYVECTSSVMQALVLFKQLYPDHKTKEISRSIEKAVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             +LE +Q  DGSWYG WGVCF+Y T+FAL GL  AGK+Y+N +A+     F L+ Q  +GG
Sbjct  598   FLENEQRPDGSWYGNWGVCFIYATWFALGGLATAGKTYQNSQAIRKGVEFLLTIQKDDGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYIP EG  +NLVQTSWA++GL+  GQAERDP PLHRAAKL+IN+QME+
Sbjct  658   WGESYLSCPEQRYIPSEGKISNLVQTSWAIMGLISAGQAERDPIPLHRAAKLIINSQMEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             GDFPQQ++ GV+MKNCMLHYA++R+ FPL AL+EYRK
Sbjct  718   GDFPQQELVGVFMKNCMLHYATYRNTFPLWALAEYRK  754



>gb|AFF27505.1| beta-amyrin synthase [Barbarea vulgaris]
 gb|AFF27506.1| beta-amyrin synthase [Barbarea vulgaris]
Length=762

 Score =   925 bits (2390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/757 (55%), Positives = 560/757 (74%), Gaps = 7/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LK+GEG G  PY++S+NN+ GRQ WE+DP AGT EE+ A E+AR+ F   R +    
Sbjct  1     MWRLKLGEGNGDDPYLFSSNNFVGRQTWEFDPKAGTLEERAAVEEARRSFLVNRSR-VKA  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             C DL  RMQ +KE++ + + IPPV++ + +++ YE  T ++R+ V    ALQA DGHWP 
Sbjct  60    CSDLLWRMQFLKEAKFEQV-IPPVKIEDAKDITYENATDSLRRGVSFFSALQASDGHWPG  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +GPLFF PPL+  LYI+G ++ I   EH+KE++R++Y HQNEDGGWGL+++  S M  
Sbjct  119   EIAGPLFFLPPLVFCLYITGHLEEIFDEEHRKEMLRHVYCHQNEDGGWGLHVESKSIMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNY+ LR+LGEGP+ G D A  R R+WILD GG T IPSWGKI+LS+LG+Y+W G NP
Sbjct  179   TVLNYICLRMLGEGPNGGRDNACKRARQWILDRGGVTYIPSWGKIWLSILGIYDWSGTNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PE WL PS  P H AK  CYCR  YMPMSYLY KR+ GP+T ++L LR E+H++ YE 
Sbjct  239   MPPEIWLLPSFVPIHLAKTLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPYEA  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+WN+ R    KED+Y+PH  +QDL+W+ L    EP +  WP  K +RE A+R A+K++ 
Sbjct  299   INWNKTRRLYAKEDMYFPHPLVQDLIWDTLHIFVEPLLTHWPLNKLVREKALRLAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E + YITIGC+EK L M+  W +DPNGD  K HLAR+PDY+W+AEDGM M  FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIDDPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQQ  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QAIIAS +  E GD L++ H YIK+SQ++ENP GDFKSMYRH++KG+WT SD+
Sbjct  419   WDTGFAVQAIIASDLSSETGDVLKRGHDYIKKSQIRENPSGDFKSMYRHISKGAWTLSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LLL  MP +++G K D ++LY++V++ L LQS  +GG   WEP
Sbjct  479   DHGWQVSDCTAEALKCCLLLSMMPAEVVGHKMDPEQLYDSVNLLLSLQSA-NGGVTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  + ++LNP+E  A++V E E++E T S++ ALV F+  YP+++ K+++ +I KAVQ
Sbjct  538   VRAYAWTELLNPTEFLANLVAEREYVECTSSVVQALVLFQQLYPDHKTKKISRAIEKAVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             +LE +Q+ DGSWYG WGVCF+Y T+FAL GL AAGK+Y+  +A+     F L+ Q  +GG
Sbjct  598   FLENEQKPDGSWYGNWGVCFIYATWFALGGLAAAGKTYKTSQAMRKGVEFLLTTQKDDGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYIPLEG  +NLVQT+WA++GL++ GQAERDP PLHRAAKL+IN+QME+
Sbjct  658   WGESYLSCPEQRYIPLEGNRSNLVQTAWAIMGLIHAGQAERDPIPLHRAAKLIINSQMEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             GDFPQQ+I GV+M+NC+LHYA+ R+ FPL AL+EYRK
Sbjct  718   GDFPQQEIVGVFMRNCLLHYATFRNTFPLWALAEYRK  754



>ref|NP_178017.2| lupeol synthase 2 [Arabidopsis thaliana]
 sp|Q8RWT0.1|LUP2_ARATH RecName: Full=Amyrin synthase LUP2; AltName: Full=Alpha-amyrin 
synthase; AltName: Full=Beta-amyrin synthase; AltName: Full=Lupeol 
synthase 2; Short=AtLUP2 [Arabidopsis thaliana]
 gb|AAM14080.1| putative lupeol synthase [Arabidopsis thaliana]
 gb|AAM45087.1| putative lupeol synthase [Arabidopsis thaliana]
 gb|AEE36185.1| lupeol synthase 2 [Arabidopsis thaliana]
Length=763

 Score =   925 bits (2390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/757 (56%), Positives = 562/757 (74%), Gaps = 7/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLKIGEG G  PY++S+NN+ GRQ WE+DP AGTPEE+ A E AR+ +   R +    
Sbjct  1     MWKLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTPEERAAVEDARRNYLDNRPR-VKG  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             C DL  RMQ +KE++ + + IPPV++ + E + Y+  T A+R+AV    ALQ+ DGHWPA
Sbjct  60    CSDLLWRMQFLKEAKFEQV-IPPVKIDDGEGITYKNATDALRRAVSFYSALQSSDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +G LFF PPL+   YI+G ++ I  +EH+KE++R++Y HQNEDGGWGL+I+G S M  
Sbjct  119   EITGTLFFLPPLVFCFYITGHLEKIFDAEHRKEMLRHIYCHQNEDGGWGLHIEGKSVMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNY+ LR+LGEGP+ G + A  R R+WILDHGG T IPSWGKI+LS+LG+Y+W G NP
Sbjct  179   TVLNYICLRMLGEGPNGGRNNACKRARQWILDHGGVTYIPSWGKIWLSILGIYDWSGTNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PE WL PS FP H  K  CY R  YMPMSYLY KR+ GPLT +++ LR E+H++ YE+
Sbjct  239   MPPEIWLLPSFFPIHLGKTLCYTRMVYMPMSYLYGKRFVGPLTPLIMLLRKELHLQPYEE  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+WN+AR  C KED+ YPH  +QDLLW+ L    EP +  WP KK +RE A+R A++++ 
Sbjct  299   INWNKARRLCAKEDMIYPHPLVQDLLWDTLHNFVEPILTNWPLKKLVREKALRVAMEHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E + YITIGC+EK L M+  W E+PNGD  K HLAR+PD++W+AEDG+ M  FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDHFKKHLARIPDFMWVAEDGLKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++A  + +E  D LRK H +IK+SQV+ENP GDFKSMYRH++KG+WT SD+
Sbjct  419   WDTVFAIQALLACDLSDETDDVLRKGHSFIKKSQVRENPSGDFKSMYRHISKGAWTLSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC +LL  MP +++G+K D ++LY++V++ L LQ  E GG   WEP
Sbjct  479   DHGWQVSDCTAEALKCCMLLSMMPAEVVGQKIDPEQLYDSVNLLLSLQG-EKGGLTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP++ F  ++ E E++E T ++I ALV F+  YP++R KE+  SI K VQ
Sbjct  538   VRAQEWLELLNPTDFFTCVMAEREYVECTSAVIQALVLFKQLYPDHRTKEIIKSIEKGVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             ++E +Q  DGSW+G WG+CF+Y T+FAL GL AAGK+Y++C AV     F L+ Q ++GG
Sbjct  598   FIESKQTPDGSWHGNWGICFIYATWFALSGLAAAGKTYKSCLAVRKGVDFLLAIQEEDGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYIPLEG  +NLVQT+WAM+GL++ GQAERDPTPLHRAAKL+I +Q+E+
Sbjct  658   WGESHLSCPEQRYIPLEGNRSNLVQTAWAMMGLIHAGQAERDPTPLHRAAKLIITSQLEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             GDFPQQ+I GV+M  CMLHYA++R+ FPL AL+EYRK
Sbjct  718   GDFPQQEILGVFMNTCMLHYATYRNIFPLWALAEYRK  754



>ref|XP_010429766.1| PREDICTED: amyrin synthase LUP2-like isoform X2 [Camelina sativa]
Length=761

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/757 (55%), Positives = 562/757 (74%), Gaps = 7/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGP--YIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LKIGEG G   Y++S+NN+ GRQ WE+DP AGTPEE+ A E+AR+ +   R +    
Sbjct  1     MWRLKIGEGNGEDRYLFSSNNFVGRQTWEFDPKAGTPEERAAVEEARRKYVDNRSR-VKG  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             C DL  RMQ ++E++ + + IPPV++ + E + +   T A+R+ V    ALQA DGHWP 
Sbjct  60    CSDLLWRMQFLREAKFEQV-IPPVKIHDGEAITHGNATDALRRGVSFFSALQASDGHWPG  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +GPLFF PPL+  LYI+G ++ I  +EH+KE++R++Y HQNEDGGWGL+I+  S M  
Sbjct  119   EITGPLFFLPPLVFCLYITGHLEEIFDAEHRKEMLRHIYCHQNEDGGWGLHIESKSMMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ LRLLGE P+ G D A  R R WILD GG T IPSWGKI+LS+LG+Y+W G NP
Sbjct  179   TALNYICLRLLGEDPNGGRDNACKRARDWILDRGGVTYIPSWGKIWLSILGIYDWSGTNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PE WL PS  P H  K+WC CR  YMPMSYLY KR+ GP+T ++L LR E+H++ YE 
Sbjct  239   MPPEIWLLPSFLPIHLGKVWCCCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPYES  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+WN+ R    KED+Y+PH  +QDL+W+AL    EPF+ RWP  K +R+ A+R+A+K++ 
Sbjct  299   INWNKTRRLYAKEDMYFPHPLVQDLVWDALYLFVEPFLTRWPLNKLVRDKALRRAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E + YITIGC+EK L M+  W E+PNGD  K HLAR+PDY+W+AEDGM M  FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QAI+AS + +E GD L+K H YIK+SQ++ENP GD++SMYRH++KG+WT SD+
Sbjct  419   WDTGFAVQAILASDLSDETGDVLKKGHDYIKKSQIRENPSGDYESMYRHISKGAWTLSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE  KC LLL  MP +++G+K D ++L+++V++ L LQS ++GG   WEP
Sbjct  479   DHGWQVSDCTAEAFKCCLLLSMMPAEVVGQKMDPEQLFDSVNLMLSLQS-DNGGMTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  ++++LNP+E  A++V E E++E T S++ ALV F+  YP+Y+ +E++ SI KAVQ
Sbjct  538   ACAYEWIELLNPTEFLANLVAEREYVECTSSVMQALVLFKQLYPDYKTQEISRSIEKAVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             +LE +Q  DGSWYG WGVCF+Y T+FAL GL AAGK+Y+N +A+     F L+ Q  +GG
Sbjct  598   FLENEQRPDGSWYGSWGVCFIYATWFALGGLAAAGKTYQNSQAIRKGVEFLLTIQKDDGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYIP +G  +NLVQT+WA +GL+  GQAERDP PLHRAAKL+IN+QME+
Sbjct  658   WGESYLSCPEQRYIPSDGKSSNLVQTAWATMGLISAGQAERDPIPLHRAAKLIINSQMEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             GDFPQQ+I G +MKNCMLHYA++R+ FPL AL+EYRK
Sbjct  718   GDFPQQEIVGTFMKNCMLHYATYRNTFPLWALAEYRK  754



>ref|XP_010429765.1| PREDICTED: amyrin synthase LUP2-like isoform X1 [Camelina sativa]
Length=771

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/757 (55%), Positives = 562/757 (74%), Gaps = 7/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGP--YIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LKIGEG G   Y++S+NN+ GRQ WE+DP AGTPEE+ A E+AR+ +   R +    
Sbjct  1     MWRLKIGEGNGEDRYLFSSNNFVGRQTWEFDPKAGTPEERAAVEEARRKYVDNRSR-VKG  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             C DL  RMQ ++E++ + + IPPV++ + E + +   T A+R+ V    ALQA DGHWP 
Sbjct  60    CSDLLWRMQFLREAKFEQV-IPPVKIHDGEAITHGNATDALRRGVSFFSALQASDGHWPG  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +GPLFF PPL+  LYI+G ++ I  +EH+KE++R++Y HQNEDGGWGL+I+  S M  
Sbjct  119   EITGPLFFLPPLVFCLYITGHLEEIFDAEHRKEMLRHIYCHQNEDGGWGLHIESKSMMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ LRLLGE P+ G D A  R R WILD GG T IPSWGKI+LS+LG+Y+W G NP
Sbjct  179   TALNYICLRLLGEDPNGGRDNACKRARDWILDRGGVTYIPSWGKIWLSILGIYDWSGTNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PE WL PS  P H  K+WC CR  YMPMSYLY KR+ GP+T ++L LR E+H++ YE 
Sbjct  239   MPPEIWLLPSFLPIHLGKVWCCCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPYES  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+WN+ R    KED+Y+PH  +QDL+W+AL    EPF+ RWP  K +R+ A+R+A+K++ 
Sbjct  299   INWNKTRRLYAKEDMYFPHPLVQDLVWDALYLFVEPFLTRWPLNKLVRDKALRRAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E + YITIGC+EK L M+  W E+PNGD  K HLAR+PDY+W+AEDGM M  FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QAI+AS + +E GD L+K H YIK+SQ++ENP GD++SMYRH++KG+WT SD+
Sbjct  419   WDTGFAVQAILASDLSDETGDVLKKGHDYIKKSQIRENPSGDYESMYRHISKGAWTLSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE  KC LLL  MP +++G+K D ++L+++V++ L LQS ++GG   WEP
Sbjct  479   DHGWQVSDCTAEAFKCCLLLSMMPAEVVGQKMDPEQLFDSVNLMLSLQS-DNGGMTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  ++++LNP+E  A++V E E++E T S++ ALV F+  YP+Y+ +E++ SI KAVQ
Sbjct  538   ACAYEWIELLNPTEFLANLVAEREYVECTSSVMQALVLFKQLYPDYKTQEISRSIEKAVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             +LE +Q  DGSWYG WGVCF+Y T+FAL GL AAGK+Y+N +A+     F L+ Q  +GG
Sbjct  598   FLENEQRPDGSWYGSWGVCFIYATWFALGGLAAAGKTYQNSQAIRKGVEFLLTIQKDDGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYIP +G  +NLVQT+WA +GL+  GQAERDP PLHRAAKL+IN+QME+
Sbjct  658   WGESYLSCPEQRYIPSDGKSSNLVQTAWATMGLISAGQAERDPIPLHRAAKLIINSQMEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             GDFPQQ+I G +MKNCMLHYA++R+ FPL AL+EYRK
Sbjct  718   GDFPQQEIVGTFMKNCMLHYATYRNTFPLWALAEYRK  754



>ref|XP_009779991.1| PREDICTED: beta-amyrin synthase-like [Nicotiana sylvestris]
Length=761

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/757 (58%), Positives = 552/757 (73%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKI +G  GPY+YSTNNY GRQIW +DPNAG+PEE+   E+AR+ F   R K   + 
Sbjct  1     MWKLKIAQGQDGPYLYSTNNYVGRQIWAFDPNAGSPEERAEIEEARQHFWNNRYKIKPS-  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ + E       IP V++ E EE+  E  TTA+R+AV    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLGEKNFKQ-KIPAVKVEEGEEITDEVATTALRRAVHFFSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N GPLFF PPL+I +YI+G ++++  +EH++E++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NGGPLFFLPPLVICMYITGHLNIVFPAEHRREILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEGPD G + A  R RKWILDHG  T IPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGPDGGENNACGRARKWILDHGSVTVIPSWGKTWLSILGVFEWLGTNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCY R  YMPMSYLY KR+ GP+T +VL LR E++ + Y +I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYTRMVYMPMSYLYGKRFVGPITPLVLQLREELYDQPYREI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
             +W + R  C KEDLYYPH  +QDL+W++L  CTEP + RWPF K+R  A+   +K++ YE
Sbjct  299   NWKKVRHLCAKEDLYYPHPLVQDLMWDSLYICTEPLLTRWPFNKLRNKALEVTMKHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W E+P GD  K HLAR+PDY W+AEDGM M G GSQ WD
Sbjct  359   DESSRYITIGCVEKVLCMLACWVENPKGDCFKKHLARIPDYFWVAEDGMKMQGLGSQLWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
               FA QA++AS M  E  D LRK H +IK+SQVK+NP GDF+ MYRH++KGSWTFSDQDH
Sbjct  419   TTFAIQALLASEMNHEISDTLRKGHDFIKKSQVKDNPSGDFRGMYRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE L C LL   MP +++G+  D   LY+AV+V L LQS ++GG + WEP  
Sbjct  479   GWGVSDCTAEALTCCLLFSTMPSELVGDAMDPAGLYDAVNVILSLQS-KNGGLSVWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                YL++LNP E FADIV+E E++E TGS I ALV F   YP +R KEV+  I  AV+Y 
Sbjct  538   ASEYLELLNPIEFFADIVIEHEYVECTGSSIQALVLFNKLYPGHRTKEVDNFIDNAVKYF  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSWYG WGVCF+Y ++FAL GL AAGKSY NC AV     F L  Q  +GGWG
Sbjct  598   EDVQMPDGSWYGCWGVCFIYASWFALGGLAAAGKSYSNCAAVRKGVEFLLRTQRSDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E  +SC    Y  LE   +NLVQT+WA++GL+++GQ +RDP PLHRAA+LLIN+Q+EDGD
Sbjct  658   ESYRSCLDKVYRELETDNSNLVQTAWALMGLIHSGQVDRDPRPLHRAARLLINSQLEDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ++TGV MKNCMLHYA +R+ FP+  L+EY K V
Sbjct  718   FPQQEMTGVSMKNCMLHYALYRNIFPMWGLAEYCKNV  754



>ref|XP_009379200.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=756

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/759 (58%), Positives = 564/759 (74%), Gaps = 13/759 (2%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MWKL++ +GG  PYIYSTNN+ GRQI E+DP AGT EE+   E+AR  F   R Q  P  
Sbjct  1     MWKLRVADGGSDPYIYSTNNFVGRQISEFDPEAGTTEERAEVEEARLHFYNNRYQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GDL  RMQ ++E      +IPPV++ + EE+++E +T ++R++V    ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLREKNFKQ-TIPPVKVEDREEISHEKVTASLRRSVHFLSALQATDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++  YI+G ++ I  ++H+KE++RY+Y HQN+DGGWGL+I+GHS M  
Sbjct  118   ENAGPLFFLPPLVMCTYITGHLNTIFHAKHRKEILRYIYYHQNQDGGWGLHIEGHSIMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ +R+LGE PD G D A  R RKWILDHG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TALNYICMRILGEEPDGGQDNACTRARKWILDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y++
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDK  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+       C KED+Y+PH +IQD LW+ L  CTEP + RWPF K IRE A+   +K++ 
Sbjct  298   IN-----HYCAKEDIYFPHPWIQDFLWDCLYICTEPLLTRWPFNKLIRERALEVTMKHIH  352

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  WAEDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ 
Sbjct  353   YEDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQL  412

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++A  + +E    L + H +IK+SQVK+NP GDFKSM+RH++KGSWTFSDQ
Sbjct  413   WDTGFAVQALLACNLTDEVAPTLARGHDFIKKSQVKDNPSGDFKSMHRHISKGSWTFSDQ  472

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSD TA+ LKC LLL  MP +++GEK + +RLY+AV V + LQS ++GG A WEP
Sbjct  473   DHGWQVSDSTADGLKCCLLLSMMPPEMVGEKMEPERLYDAVHVIISLQS-KNGGLAAWEP  531

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+E FADIVVE E++E T S I ALV F+  YP +R KE++  I  A Q
Sbjct  532   AGAAEWLELLNPAEFFADIVVEHEYVECTSSAIQALVLFKKLYPGHRKKEIDQFITNAAQ  591

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE    +DGSWYG WGVCF YGT+FAL GLTAAGK++ NC  +  A  F L+ Q + GG
Sbjct  592   YLENTLMADGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCAVIRKAISFLLTIQKENGG  651

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP   Y+PLEG  +NLV T+WAM+GL++ GQAERDPTPLHRAAKL+IN++ME+
Sbjct  652   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIHAGQAERDPTPLHRAAKLIINSKMEN  711

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITGV MKNCMLHYA++R+  PL AL+EYRKRV
Sbjct  712   GDFPQQEITGVIMKNCMLHYAAYRNIHPLWALAEYRKRV  750



>gb|AAC17080.1| Strong similarity to lupeol synthase gb|U49919 and cycloartenol 
synthase gb|U02555 from A. thaliana (the third gene with 
similar homology) [Arabidopsis thaliana]
Length=1565

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/759 (58%), Positives = 561/759 (74%), Gaps = 7/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLKI  G    PY++STNN+ GRQ WE+DP+AGT EE  A E+AR+ F   R +    
Sbjct  1     MWKLKIANGNKEEPYLFSTNNFLGRQTWEFDPDAGTVEELAAVEEARRKFYDDRFR-VKA  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ +KE + + + IPP ++ +   +  E  T A+RK V    ALQA DGHWPA
Sbjct  60    SSDLIWRMQFLKEKKFEQV-IPPAKVEDANNITSEIATNALRKGVNFLSALQASDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL+  LY++G +  I T +H++E++RY+Y HQNEDGGWGL+I+G+STM  
Sbjct  119   ENAGPLFFLPPLVFCLYVTGHLHEIFTQDHRREVLRYIYCHQNEDGGWGLHIEGNSTMFC  178

Query  1889  SALNYVALRLLGEGPDDGDG-AIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNY+ +R+LGEGP+ G G A  R R WILDHGGAT IPSWGK +LS+LGV++W G NP
Sbjct  179   TTLNYICMRILGEGPNGGPGNACKRARDWILDHGGATYIPSWGKTWLSILGVFDWSGSNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP++ ++L LR EI+++ Y +
Sbjct  239   MPPEFWILPSFLPIHPAKMWCYCRLVYMPMSYLYGKRFVGPISPLILQLREEIYLQPYAK  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYMR  1356
             I+WN+AR  C KED Y PH  IQD++WN L   TEPF+  WPF K+ RE A+  A+K++ 
Sbjct  299   INWNRARHLCAKEDAYCPHPQIQDVIWNCLYIFTEPFLACWPFNKLLREKALGVAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK+L M+  W EDPNG   K HL R+ DYLW+AEDGM M  FGSQ 
Sbjct  359   YEDENSRYITIGCVEKALCMLACWVEDPNGIHFKKHLLRISDYLWIAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD+ FA QA++AS +V E  D LR+ + ++K SQV+ENP GDF +MYRH++KGSWTFSD+
Sbjct  419   WDSGFALQALVASNLVNEIPDVLRRGYDFLKNSQVRENPSGDFTNMYRHISKGSWTFSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW  SDCTAE+ KC LLL  +P  I+G K D ++LYEAV + L LQS ++GG   WEP
Sbjct  479   DHGWQASDCTAESFKCCLLLSMIPPDIVGPKMDPEQLYEAVTILLSLQS-KNGGVTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP+E+FADIVVE E+ E T S I AL+ F+  YPN+R +E+N SI KAVQ
Sbjct  538   ARGQEWLELLNPTEVFADIVVEHEYNECTSSAIQALILFKQLYPNHRTEEINTSIKKAVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             Y+E  Q  DGSWYG WGVCF Y T+F L GL AAGK+Y NC A+    HF L+ Q   GG
Sbjct  598   YIESIQMLDGSWYGSWGVCFTYSTWFGLGGLAAAGKTYNNCLAMRKGVHFLLTTQKDNGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYIP EG  +NLVQTSWAM+GL++ GQAERDP+PLHRAAKLLIN+Q+E+
Sbjct  658   WGESYLSCPKKRYIPSEGERSNLVQTSWAMMGLLHAGQAERDPSPLHRAAKLLINSQLEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITG +MKNC+LHYA++R+ FP+ AL+EYR+RV
Sbjct  718   GDFPQQEITGAFMKNCLLHYAAYRNIFPVWALAEYRRRV  756


 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/793 (53%), Positives = 554/793 (70%), Gaps = 33/793 (4%)
 Frame = -3

Query  2444  FSVNIRKMWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQ  2271
             +  +I  MW+LKIGEG G  PY+++TNN+AGRQ WE+DP+ G+PEE+ +  +AR+ F   
Sbjct  772   YVAHIFVMWRLKIGEGNGDDPYLFTTNNFAGRQTWEFDPDGGSPEERHSVVEARRIFYDN  831

Query  2270  RQKGPHTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQA  2091
             R        DL  RMQ ++E + +   I PV++ + E+V +E  T+A+R+ +    ALQA
Sbjct  832   RFH-VKASSDLLWRMQFLREKKFEQ-RIAPVKVEDSEKVTFETATSALRRGIHFFSALQA  889

Query  2090  KDGHWPAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYID  1911
              DGHWPAEN+GPLFF PPL+  LYI+G +D + TSEH+KE++RY+Y HQ EDGGWGL+I+
Sbjct  890   SDGHWPAENAGPLFFLPPLVFCLYITGHLDEVFTSEHRKEILRYIYCHQKEDGGWGLHIE  949

Query  1910  GHSTMIGSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVY  1734
             GHSTM  + LNY+ +R+LGE PD G D A  R R+WIL HGG T IPSWGK +LS+LGV+
Sbjct  950   GHSTMFCTTLNYICMRILGESPDGGHDNACGRAREWILSHGGVTYIPSWGKTWLSILGVF  1009

Query  1733  EWDGCNPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEI  1554
             +W G NP+ PEFW+ PS FP HPAKMW YCR  Y+PMSYLY KR+ GP+T ++L LR E+
Sbjct  1010  DWSGSNPMPPEFWILPSFFPVHPAKMWSYCRMVYLPMSYLYGKRFVGPITSLILQLRKEL  1069

Query  1553  HVKSYEQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMR  1377
             +++ YE+I+W + R  C KED YYP   +Q+L+W++L    EPF+ RWPF K+ RE A++
Sbjct  1070  YLQPYEEINWMKVRHLCAKEDTYYPRPLVQELVWDSLYIFAEPFLARWPFNKLLREKALQ  1129

Query  1376  KAIKYMRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSM  1197
              A+K++ YE E +RYITIGC+EK L M+  W EDPNGD  K HL+R+ DYLW+AEDGM M
Sbjct  1130  LAMKHIHYEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLSRISDYLWMAEDGMKM  1189

Query  1196  HGFGSQNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKG  1017
               FGSQ WD  FA QA++AS +  E  D LR+ H +IK SQV ENP GD+KSMYRH++KG
Sbjct  1190  QSFGSQLWDTGFAMQALLASNLSSEISDVLRRGHEFIKNSQVGENPSGDYKSMYRHISKG  1249

Query  1016  SWTFSDQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQ-----  852
             +WTFSD+DHGW VSDCTA  LKC LL   +   I+G K D +RL+++V++ L LQ     
Sbjct  1250  AWTFSDRDHGWQVSDCTAHGLKCCLLFSMLAPDIVGPKQDPERLHDSVNILLSLQVSIIR  1309

Query  851   ----------------------SPESGGFATWEPPVPQPYLQVLNPSEIFADIVVEEEHI  738
                                     ++GG   WEP     +L++LNP+E+F+DIV+E E+ 
Sbjct  1310  HRIEPTSSKKHPFSGRDSFTCLQSKNGGMTAWEPAGAPKWLELLNPTEMFSDIVIEHEYS  1369

Query  737   EPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLEKQQESDGSWYGYWGVCFLYGTFF  558
             E T S I AL  F+  YP++R  E+   I KA +YLE  Q  DGSWYG WG+CF YGT+F
Sbjct  1370  ECTSSAIQALSLFKQLYPDHRTTEITAFIKKAAEYLENMQTRDGSWYGNWGICFTYGTWF  1429

Query  557   ALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGECLQSCPSMRYIPLEGTGTNLVQT  378
             AL GL AAGK++ +CEA+     F L+ Q   GGWGE   SC    YI   G  +N+VQT
Sbjct  1430  ALAGLAAAGKTFNDCEAIRKGVQFLLAAQKDNGGWGESYLSCSKKIYIAQVGEISNVVQT  1489

Query  377   SWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDFPQQDITGVYMKNCMLHYASHRSY  198
             +WA++GL+++GQAERDP PLHRAAKL+IN+Q+E GDFPQQ  TGV++KNC LHYA++R+ 
Sbjct  1490  AWALMGLIHSGQAERDPIPLHRAAKLIINSQLESGDFPQQQATGVFLKNCTLHYAAYRNI  1549

Query  197   FPLMALSEYRKRV  159
              PL AL+EYR RV
Sbjct  1550  HPLWALAEYRARV  1562



>ref|XP_006300770.1| hypothetical protein CARUB_v10019849mg [Capsella rubella]
 gb|EOA33668.1| hypothetical protein CARUB_v10019849mg [Capsella rubella]
Length=763

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/759 (56%), Positives = 563/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQ--RQKGP  2256
             MW+LKIGEG G  PY++S+NN+ GRQ WE+DP AGTPEE+   E++R+ F     R KG 
Sbjct  1     MWRLKIGEGNGENPYLFSSNNFVGRQTWEFDPKAGTPEERAVVEESRRNFVDNHSRVKG-  59

Query  2255  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2076
               C DL  RMQ + E++ + + IPPV++ + E + ++  T A+R+ V L  ALQA DGHW
Sbjct  60    --CSDLLWRMQFLGEAKFEQV-IPPVKIDDGEGITHDNATDALRRGVSLFSALQASDGHW  116

Query  2075  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  1896
             P E +GPLFF PPL+  LYI+G ++ +  +EH+KE++R++Y HQNEDGGWGL+I+ +S M
Sbjct  117   PGEITGPLFFLPPLVFCLYITGHLNKVFDAEHRKEMLRHIYCHQNEDGGWGLHIESNSMM  176

Query  1895  IGSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGC  1719
               + LNY+ LRLLGEGPD G D A  R ++WILD GGAT IPSWGKI+LS+LG+Y+W G 
Sbjct  177   FCTVLNYICLRLLGEGPDGGRDNACKRAKQWILDRGGATYIPSWGKIWLSILGIYDWSGT  236

Query  1718  NPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSY  1539
             NP+ PE WL PS FP H  K+ CYCR  YMPMSYLY KR+ GP+T ++L LR E+H++ Y
Sbjct  237   NPMPPEIWLLPSFFPIHLGKVLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPY  296

Query  1538  EQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKY  1362
             E I+WN+ R    KED+Y+PH  +QDL+W+AL    EPF+ RWP  K +RE A+R A+K+
Sbjct  297   ESINWNKTRRLYAKEDMYFPHPLVQDLVWDALYVFVEPFLTRWPLNKLVREKALRLAMKH  356

Query  1361  MRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGS  1182
             + YE E + YITIGC+EK L M+  W EDPNGD  K HLAR+PDY+W+AEDGM M  FGS
Sbjct  357   IHYEDENSHYITIGCVEKVLCMLACWIEDPNGDYFKKHLARIPDYMWIAEDGMKMQSFGS  416

Query  1181  QNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFS  1002
             Q WD  FA QAI+AS +  E G+ L+K H YIK+SQV+ENP GDFK MYRH +KG+WT S
Sbjct  417   QLWDTGFAVQAILASDLSLETGNVLKKGHDYIKKSQVRENPSGDFKGMYRHKSKGAWTLS  476

Query  1001  DQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATW  822
             D+DHGW VSDCTAE LKC LLL  MP +++G++ D ++LY++VD+ L  QS ++GG   W
Sbjct  477   DRDHGWQVSDCTAEALKCCLLLSMMPAEVVGQQMDPEQLYDSVDLLLSFQS-DNGGVTAW  535

Query  821   EPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKA  642
             EP     ++++LNP+E  A++V E E++E T S++ ALV F+  YP ++ KE++ SI KA
Sbjct  536   EPVRAYEWIELLNPTEFLANLVAEREYVECTSSVMQALVLFKQLYPGHKTKEISRSIEKA  595

Query  641   VQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQE  462
             VQ+L+ +Q  DGSWYG WGVCF+Y T+FAL GL AAGK+Y+N +A+     F L+ Q  +
Sbjct  596   VQFLDNEQRPDGSWYGNWGVCFIYATWFALGGLAAAGKTYQNSQAIRKGVEFLLTTQKDD  655

Query  461   GGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQM  282
             GGWGE   SCP  RYI   G  +NLVQT+WA++GL+  GQAERDP PLHRAAKL+IN+QM
Sbjct  656   GGWGESYLSCPEQRYISTGGKSSNLVQTAWAIMGLINAGQAERDPIPLHRAAKLIINSQM  715

Query  281   EDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             E+GDFPQQ+I GV+MKNC++HYA++R+ FPL AL+EYRK
Sbjct  716   ENGDFPQQEIVGVFMKNCLIHYATYRNTFPLWALAEYRK  754



>ref|NP_683508.1| camelliol C synthase 1 [Arabidopsis thaliana]
 sp|P0C8Y0.1|LUP3_ARATH RecName: Full=Camelliol C synthase; AltName: Full=Lupeol synthase 
3; Short=AtLUP3 [Arabidopsis thaliana]
 gb|AEE36184.1| camelliol C synthase 1 [Arabidopsis thaliana]
Length=769

 Score =   924 bits (2387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/759 (58%), Positives = 562/759 (74%), Gaps = 7/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLKI  G    PY++STNN+ GRQ WE+DP+AGT EE  A E+AR+ F   R +   +
Sbjct  1     MWKLKIANGNKEEPYLFSTNNFLGRQTWEFDPDAGTVEELAAVEEARRKFYDDRFRVKAS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ +KE + + + IPP ++ +   +  E  T A+RK V    ALQA DGHWPA
Sbjct  61    -SDLIWRMQFLKEKKFEQV-IPPAKVEDANNITSEIATNALRKGVNFLSALQASDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL+  LY++G +  I T +H++E++RY+Y HQNEDGGWGL+I+G+STM  
Sbjct  119   ENAGPLFFLPPLVFCLYVTGHLHEIFTQDHRREVLRYIYCHQNEDGGWGLHIEGNSTMFC  178

Query  1889  SALNYVALRLLGEGPDDGDG-AIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNY+ +R+LGEGP+ G G A  R R WILDHGGAT IPSWGK +LS+LGV++W G NP
Sbjct  179   TTLNYICMRILGEGPNGGPGNACKRARDWILDHGGATYIPSWGKTWLSILGVFDWSGSNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP++ ++L LR EI+++ Y +
Sbjct  239   MPPEFWILPSFLPIHPAKMWCYCRLVYMPMSYLYGKRFVGPISPLILQLREEIYLQPYAK  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYMR  1356
             I+WN+AR  C KED Y PH  IQD++WN L   TEPF+  WPF K+ RE A+  A+K++ 
Sbjct  299   INWNRARHLCAKEDAYCPHPQIQDVIWNCLYIFTEPFLACWPFNKLLREKALGVAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK+L M+  W EDPNG   K HL R+ DYLW+AEDGM M  FGSQ 
Sbjct  359   YEDENSRYITIGCVEKALCMLACWVEDPNGIHFKKHLLRISDYLWIAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD+ FA QA++AS +V E  D LR+ + ++K SQV+ENP GDF +MYRH++KGSWTFSD+
Sbjct  419   WDSGFALQALVASNLVNEIPDVLRRGYDFLKNSQVRENPSGDFTNMYRHISKGSWTFSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW  SDCTAE+ KC LLL  +P  I+G K D ++LYEAV + L LQS ++GG   WEP
Sbjct  479   DHGWQASDCTAESFKCCLLLSMIPPDIVGPKMDPEQLYEAVTILLSLQS-KNGGVTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP+E+FADIVVE E+ E T S I AL+ F+  YPN+R +E+N SI KAVQ
Sbjct  538   ARGQEWLELLNPTEVFADIVVEHEYNECTSSAIQALILFKQLYPNHRTEEINTSIKKAVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             Y+E  Q  DGSWYG WGVCF Y T+F L GL AAGK+Y NC A+    HF L+ Q   GG
Sbjct  598   YIESIQMLDGSWYGSWGVCFTYSTWFGLGGLAAAGKTYNNCLAMRKGVHFLLTTQKDNGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYIP EG  +NLVQTSWAM+GL++ GQAERDP+PLHRAAKLLIN+Q+E+
Sbjct  658   WGESYLSCPKKRYIPSEGERSNLVQTSWAMMGLLHAGQAERDPSPLHRAAKLLINSQLEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITG +MKNC+LHYA++R+ FP+ AL+EYR+RV
Sbjct  718   GDFPQQEITGAFMKNCLLHYAAYRNIFPVWALAEYRRRV  756



>ref|XP_010417512.1| PREDICTED: amyrin synthase LUP2-like isoform X3 [Camelina sativa]
Length=764

 Score =   923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/757 (56%), Positives = 559/757 (74%), Gaps = 7/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LKIGEG G  PY++S+NN+ GRQ WE+DP  GTPEE+ A E AR+ F   R +    
Sbjct  1     MWRLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKTGTPEERAAVEGARRKFVDNRSR-VKG  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             C DL  RMQ +KE++ + + IPPV++ +   + +   T A+R+ V    ALQA DGHWP 
Sbjct  60    CSDLLWRMQFLKEAKFEQV-IPPVKIDDGVGITHGNATDALRRGVSFFSALQASDGHWPG  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +GPLFF PPL+  LYI+G ++ I  +EH+KE++R++Y HQNEDGGWGL+I+  S M  
Sbjct  119   EITGPLFFLPPLVFCLYITGHLEEIFDAEHRKEMLRHIYCHQNEDGGWGLHIESKSMMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ LRLLGEGP+ G D A  R R WILD GG T IPSWGKI+LS++G+Y+W G NP
Sbjct  179   TALNYICLRLLGEGPNGGRDNACKRARDWILDRGGVTYIPSWGKIWLSIIGIYDWSGTNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PE WL PS  P H  K+ CYCR  YMPMSYLY KR+ GP+T ++L LR E+H++ YE 
Sbjct  239   MPPEIWLLPSFLPIHLGKVLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPYES  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+WN+ R    KED+Y+PH  +QDL+W+AL    EPF+ RWP  K +RE A+R+A+K++ 
Sbjct  299   INWNKTRRLYAKEDMYFPHPLVQDLVWDALYLFVEPFLTRWPLNKLVRERALRRAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E + YITIGC+EK L M+  W E+PNGD  K HLAR+PDY+W+AEDGM M  FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QAI+AS + +E GD L+K H YIK+SQV+ENP GD++SMYRH++KG+WT SD+
Sbjct  419   WDTGFAVQAILASDLSDETGDVLKKGHDYIKKSQVRENPSGDYESMYRHISKGAWTLSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE  KC LLL  MP +++G+K D ++L ++VD+ L  QS + GG   WEP
Sbjct  479   DHGWQVSDCTAEAFKCCLLLSMMPAEVVGQKMDPEQLNDSVDLMLSFQS-DKGGMTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  ++++LNP+E  A++V E E++E T S++ ALV F+  YP+++ KE++ SI KAVQ
Sbjct  538   VRAYEWIELLNPTEFLANLVAEREYVECTSSVMQALVLFKQLYPDHKTKEISRSIEKAVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             +LE +Q  DGSWYG WGVCF+Y T+FAL GL  AGK+Y+N +A+     F L+ Q  +GG
Sbjct  598   FLENEQRPDGSWYGNWGVCFIYATWFALGGLATAGKTYQNSQAIRKGVEFLLTIQKDDGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYIP EG  +NLVQTSWA++GL+  GQAERDP PLHRAAKL+IN+QME+
Sbjct  658   WGESYLSCPEQRYIPSEGKISNLVQTSWAIMGLISAGQAERDPIPLHRAAKLIINSQMEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             GDFPQQ++ GV+MKNCMLHYA++R+ FPL AL+EYRK
Sbjct  718   GDFPQQELVGVFMKNCMLHYATYRNTFPLWALAEYRK  754



>ref|XP_010048520.1| PREDICTED: LOW QUALITY PROTEIN: lupeol synthase-like [Eucalyptus 
grandis]
Length=755

 Score =   923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/756 (57%), Positives = 553/756 (73%), Gaps = 5/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI EGG P++ S NN+ GRQ WE+DP+AGTPEE+   E+ R  FT+ R +   +  
Sbjct  1     MWKLKIAEGG-PWLTSVNNHVGRQHWEFDPDAGTPEERAEVERVRDEFTRNRFRIKQS-A  58

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DL MRMQ+ KE+    +  PPV++ E E+V  EA TT +R+A+    ++QA DGHWPAEN
Sbjct  59    DLLMRMQLTKENPSGPIP-PPVKVEEGEDVTEEAATTTLRRAISFYSSIQAHDGHWPAEN  117

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GPLFF PP++ AL I+G+++ I + EHKKE+ RY+YNHQNEDGGWG +I+GHSTM GSA
Sbjct  118   AGPLFFFPPMVFALSITGAMNAIFSPEHKKEIKRYIYNHQNEDGGWGFHIEGHSTMFGSA  177

Query  1883  LNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             L+Y+ALRLLGEGPDDG DGA+ARGRKWILDHGG    PSWGK +L+VLGVYEW GCNPL 
Sbjct  178   LSYIALRLLGEGPDDGEDGAMARGRKWILDHGGLVGTPSWGKFWLAVLGVYEWAGCNPLP  237

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWL P  FP HP  M CYCR  YMPMSYLY +R+ GP+T ++L+LR E++ + Y +I+
Sbjct  238   PEFWLLPRKFPIHPGNMLCYCRLVYMPMSYLYGRRFVGPVTGLILSLRXELYTEPYNEIN  297

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+AR    KEDLYYPH  +QD+LW  L + TEP ++RWP   +RE A++ AIK++ YE 
Sbjct  298   WNRARSTVAKEDLYYPHPLVQDMLWGFLHHVTEPVLKRWPLSMMREKALKVAIKHVHYED  357

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E +RY+TIGC+EK L M+  W EDPN +  K HLAR+PDY W+AEDG+ M  FG Q WDA
Sbjct  358   ENSRYLTIGCVEKVLCMVACWVEDPNSEAYKRHLARIPDYYWIAEDGLKMQTFGCQMWDA  417

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
             AFA QAI++  + EEY   LRK H ++K SQV++NP GDFK+MYRH++KG+WTF+ QDHG
Sbjct  418   AFAIQAIMSGNLTEEYATTLRKGHDFVKASQVQDNPSGDFKAMYRHISKGAWTFAMQDHG  477

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE LK  LL  +M   ++GEK + +R Y+AV+V L LQS  +GGF  WEP   
Sbjct  478   WQVSDCTAEGLKTALLFSQMSPDLVGEKMETERFYDAVNVILSLQS-SNGGFPAWEPQRA  536

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
               +L+  NP+E F + ++E E++E T S I  LV F+  +P +R KE++  IA+A+ Y+E
Sbjct  537   YAWLEKFNPTEFFEETLIEREYVECTSSAIQGLVLFKKLHPKHRRKEIDSCIARAIDYIE  596

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
               Q  DGSWYG WG+C+ YGT+FA+ GL A GKSY NC  V  A  F LSKQ   GGWGE
Sbjct  597   HTQLPDGSWYGCWGICYTYGTWFAVEGLAACGKSYRNCTTVRKACEFLLSKQLPCGGWGE  656

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                S  +  Y  LEG   NLVQT+WA+L L+  GQAE D TP+HR  K+LIN+QM+DGDF
Sbjct  657   SYLSSQNKVYTNLEGNRPNLVQTAWALLSLIDAGQAEIDATPIHRGVKVLINSQMDDGDF  716

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PQQ+ITGV+M+NC L+Y+S R+ FP+ AL EYR+RV
Sbjct  717   PQQEITGVFMRNCTLNYSSFRNIFPIWALGEYRRRV  752



>ref|XP_009104558.1| PREDICTED: amyrin synthase LUP2-like [Brassica rapa]
Length=767

 Score =   923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/759 (57%), Positives = 558/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGF--TKQRQKGP  2256
             MWKLKIGEG G  PY+ STNN+ GRQ WE+DP AGTPEE+ A E+AR+ F   + R KG 
Sbjct  1     MWKLKIGEGNGEDPYLSSTNNFVGRQTWEFDPKAGTPEERAAVEEARRSFLVNRYRVKG-  59

Query  2255  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2076
               C DLF RMQ +KE+  + + IPPV++  +E + +E  T A+R+ V    ALQA DGHW
Sbjct  60    --CSDLFWRMQFLKEARFEQV-IPPVKIDGDEAITHENATNALRRGVSFFSALQASDGHW  116

Query  2075  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  1896
             P E +GPLFF PPL+  LYI+G ++ +   EH+KE++R++Y HQNEDGGWGL+++  S M
Sbjct  117   PGEITGPLFFLPPLVFCLYITGHLEKVFDEEHRKEMLRHVYCHQNEDGGWGLHVESKSIM  176

Query  1895  IGSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGC  1719
               +ALNY+ LR+LGEGPD G D A  R R+WILD GG T IPSWGKI+LS+LG+Y+W G 
Sbjct  177   FCTALNYICLRILGEGPDGGRDNACKRARQWILDRGGVTYIPSWGKIWLSILGIYDWSGT  236

Query  1718  NPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSY  1539
             NP+ PE WL PS  P H AK  CYCR  YMPMSYLY KR+ GP+T ++L LR+E+ ++ Y
Sbjct  237   NPMPPEIWLLPSFLPIHLAKTLCYCRMVYMPMSYLYGKRFVGPITPLILQLRDELLLQPY  296

Query  1538  EQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKY  1362
             E I+WN+ R    KED+Y+PH ++QDL+W+AL    EPF+ RWP  K +RE A R A+K+
Sbjct  297   EAINWNKTRRLYAKEDMYFPHPWVQDLVWDALNVFVEPFLTRWPLNKLVREKACRLAMKH  356

Query  1361  MRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGS  1182
             + YE E + YITIGC+EK L M+  W ++P+ D  K HLAR+PDY+W+AEDGM M  FGS
Sbjct  357   IHYEDENSHYITIGCVEKVLCMLACWIDNPHEDYFKKHLARIPDYMWVAEDGMKMQSFGS  416

Query  1181  QNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFS  1002
             Q WD  FA QAI+AS  ++E  + L+K H YIK SQV+ENP GDFKSMYRH++KG+WT S
Sbjct  417   QLWDTGFAVQAILASDFLDETSNVLKKGHDYIKLSQVRENPSGDFKSMYRHISKGAWTLS  476

Query  1001  DQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATW  822
             D+DHGW VSDCTAE LKC LLL  MP +++G++ D +++Y++V++ L  QS E GG   W
Sbjct  477   DRDHGWQVSDCTAEALKCCLLLSTMPSEVVGQQLDPEQIYDSVNLLLSFQS-EKGGVTAW  535

Query  821   EPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKA  642
             EP     +++ LNP+E  A++V E E++E T S+I ALV F   YP++R KE++ SI KA
Sbjct  536   EPVRAYEWIEFLNPTEFLANLVAEREYVECTSSVIQALVLFNQLYPDHRTKEISRSIEKA  595

Query  641   VQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQE  462
             V YLE +Q+ DGSWYG WGVCF+Y T+FAL GL AAGK+YE   A+     F L  Q  +
Sbjct  596   VHYLENEQKPDGSWYGNWGVCFIYATWFALGGLAAAGKTYEKSLAMRKGVEFLLRTQKDD  655

Query  461   GGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQM  282
             GGWGE   SCP  RYIP EG  +NLVQT+WAMLGL++ GQA RDP PLHRAAKL+IN+QM
Sbjct  656   GGWGESYLSCPEERYIPSEGKQSNLVQTAWAMLGLIHAGQAGRDPIPLHRAAKLIINSQM  715

Query  281   EDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             EDGDFPQQ+I GV+MKNC++HYA++R+ FPL AL+EYRK
Sbjct  716   EDGDFPQQEIVGVFMKNCLIHYATYRNTFPLWALAEYRK  754



>ref|XP_008365649.1| PREDICTED: beta-amyrin synthase [Malus domestica]
Length=761

 Score =   923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/759 (58%), Positives = 562/759 (74%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MWKLK  +GG  PYIYSTNN+ GRQI+E+DP AGT EE+   E+AR  F   R Q  P  
Sbjct  1     MWKLKXADGGNDPYIYSTNNFVGRQIFEFDPEAGTTEERAEVEEARLHFYNNRYQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GD   RMQ ++E      +IPP ++ + EE+ +E  T ++R++V    ALQA DGHWPA
Sbjct  59    SGDFLWRMQFLREXNFKQ-TIPPXKVEDGEEITHEKATASLRRSVHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+ PLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAXPLFFLPPLVMCVYITGHLNTVFHAEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +AL+Y+ +R+LGEGPD G D A AR RKWILDHG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TALSYICMRILGEGPDGGQDNACARARKWILDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y++
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W   R  C KED+YYPH +IQD LW++L  CTEP + RWPF K IR+ A+   +K++ 
Sbjct  298   INWKGVRHHCAKEDIYYPHPWIQDFLWDSLYICTEPLLTRWPFNKMIRKRALEVTMKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  WAEDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQ  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS + +E    L + H ++K+SQVK+NP GDFKSM+RH++KGS TFSDQ
Sbjct  418   WDTGFAIQALLASNLTDEIAPTLARGHDFVKKSQVKDNPSGDFKSMHRHISKGSXTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LLL  MP +++GEK + +RLY+AV+V + LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMMPPELVGEKMEPERLYDAVNVLISLQS-KNGGLAAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+E FADIVVE E++E T S I ALV F+  YP +R KE++  I  A Q
Sbjct  537   AGAAEWLEMLNPTEFFADIVVEHEYVECTSSAIQALVLFKKLYPGHRKKEIDQFITNAAQ  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q  DGSWYG WGV F YGT+ AL GLTAAGK++ NC  +  A +F L  Q + GG
Sbjct  597   YLENIQMEDGSWYGNWGVXFTYGTWXALGGLTAAGKTFNNCXVIRKAINFLLXIQKENGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP   Y+PLEG   NLV T+WAM+GL+Y GQAERDP PLHRAAKL+ N+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRXNLVHTAWAMMGLIYAGQAERDPAPLHRAAKLIXNSQMEN  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDF QQ+ITGV+ KNCMLHYA++R+ +PL AL+EYRK V
Sbjct  717   GDFXQQEITGVFXKNCMLHYAAYRNIYPLWALAEYRKWV  755



>gb|AAG41762.1|AF099968_1 pentacyclic triterpene synthase [synthetic construct]
Length=763

 Score =   923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/757 (56%), Positives = 563/757 (74%), Gaps = 7/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLKIGEG G  PY++S+NN+ GRQ WE+DP AGTPEE+ A E AR+ +   R +    
Sbjct  1     MWKLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTPEERAAVEDARRNYLDNRPR-VKG  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             C DL  RMQ +KE++ + + IPPV++ + E + Y+  T A+R+AV    ALQ+ DGHWPA
Sbjct  60    CSDLLWRMQFLKEAKFEQV-IPPVKIDDGEGITYKNATDALRRAVSFYSALQSSDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +G LFF PPL+   YI+G ++ I  +EH+KE++R++Y HQNEDGGWGL+I+G S M  
Sbjct  119   EITGTLFFLPPLVFCFYITGHLEKIFDAEHRKEMLRHIYCHQNEDGGWGLHIEGKSVMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNY+ LR+LGEGP+ G + A  R R+WILDHGG T IPSWGKI+LS+LG+Y+W G NP
Sbjct  179   TVLNYICLRMLGEGPNGGRNNACKRARQWILDHGGVTYIPSWGKIWLSILGIYDWSGTNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PE WL PS FP H  K  CY R  YMPMSYLY KR+ GPLT +++ LR E+H++ YE+
Sbjct  239   MPPEIWLLPSFFPIHLGKTLCYTRMVYMPMSYLYGKRFVGPLTPLIMLLRKELHLQPYEE  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+WN+AR  C KED+ YPH  +QDLLW+ L    EP +  WP KK +RE A+R A++++ 
Sbjct  299   INWNKARRLCAKEDMIYPHPLVQDLLWDTLHNFVEPILTNWPLKKLVREKALRVAMEHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E + YITIGC+EK L M+  W E+PNGD  K HLAR+PD++W+AEDG+ M  FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDHFKKHLARIPDFMWVAEDGLKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++A  + +E  D LRK H +IK+SQV+ENP GDFKSMYRH++KG+WT SD+
Sbjct  419   WDTVFAIQALLACDLSDETDDVLRKGHSFIKKSQVRENPSGDFKSMYRHISKGAWTLSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC +LL  MP +++G+K D ++ Y++V++ L LQ  E GG   WEP
Sbjct  479   DHGWQVSDCTAEALKCCMLLSMMPAEVVGQKIDPEQSYDSVNLLLSLQG-EKGGLTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
               PQ +L++LNP++ F  ++ E E++E T ++I ALV F+  YP++R KE+  SI K VQ
Sbjct  538   VRPQEWLELLNPTDFFTCVMAEREYVECTSAVIQALVLFKRLYPDHRTKEIIKSIEKGVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             ++E +Q  DGSW+G WG+CF+Y T+FAL GL AAGK+Y++C AV     F L+ Q ++GG
Sbjct  598   FIESKQTPDGSWHGNWGICFIYATWFALSGLAAAGKTYKSCLAVRKGVDFLLAIQEEDGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYIPLEG  +NLVQT+W M+GL++ GQAERDPTPLHRAAKL+I++Q+E+
Sbjct  658   WGESHLSCPGQRYIPLEGDRSNLVQTAWGMMGLIHAGQAERDPTPLHRAAKLVISSQLEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             GDFP+Q+I GV+MK CMLHYA++R+ FPL AL+EYRK
Sbjct  718   GDFPRQEILGVFMKTCMLHYATYRNIFPLWALAEYRK  754



>ref|XP_009347735.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=760

 Score =   923 bits (2385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/759 (58%), Positives = 563/759 (74%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MWKLK+ +GG  PYIYSTNN+ GRQI+E+DP AGT EE+   E+AR  F   R Q  P++
Sbjct  1     MWKLKVADGGNAPYIYSTNNFVGRQIFEFDPEAGTTEERAEVEEARLHFYNNRYQVKPNS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E      +I  V++ + EE+ YE    A+R++V    ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-TIHLVKVEDGEEITYEKAIVALRRSVHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++  YI+G ++ I  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCTYITGHLNTIFLAEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ +R+LGEGPD G D A AR RKWI DHG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TALNYICMRILGEGPDGGQDNACARARKWIHDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKM+CY R  YMPMSYLY KR+ GP+T ++L LR E++ + Y++
Sbjct  238   MPPEFWILPSFLPMHPAKMFCYSRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W   R  C K D+YYPH +IQD LW++L  CTEP + RWPF K IR+ A+   ++++ 
Sbjct  298   INWKGVRHHCAKVDIYYPHPWIQDFLWDSLYVCTEPLLTRWPFNKLIRKRALEVTMEHVH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQ  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  F  QA++AS + +E    L + H +IK+SQVK+NP GDFKSMYRH++KGSWTFSDQ
Sbjct  418   WDTGFVIQALLASNLTDEIAPTLARGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LLL  MP +I+GEK + +RLY+AV+V + L S ++GG   WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMMPPEIVGEKMEPERLYDAVNVLISLPS-KNGGLPAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++ NP+E FADIVVE E++E T S I ALV F+  YP +R +E++  I  A  
Sbjct  537   AGAAEWLEMFNPTEFFADIVVEHEYVECTSSAIQALVLFKKLYPGHRKEEIDQFITAAAL  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q +DGSWYG WGVCF YGT+FAL GLTAAGK++ NC A+  A  F L+ Q + GG
Sbjct  597   YLENVQMADGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCAAIRKAISFLLAIQKENGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP   Y+PLEG  +NLV T+WAM+GL++ GQAERDPTPLHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIHVGQAERDPTPLHRAAKLIINSQMEN  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EY +RV
Sbjct  717   GDFPQQEITGAFMKNCMLHYAAYRNIYPLWALAEYCRRV  755



>emb|CDY57947.1| BnaA07g38460D [Brassica napus]
Length=767

 Score =   923 bits (2385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/759 (57%), Positives = 559/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGF--TKQRQKGP  2256
             MWKLKIGEG G  PY+ STNN+ GRQ WE+DP AGTPEE+ A E+AR+ F   + R KG 
Sbjct  1     MWKLKIGEGNGEDPYLSSTNNFVGRQTWEFDPKAGTPEERAAVEEARRSFLVNRYRVKG-  59

Query  2255  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2076
               C DLF RMQ +KE+  + + IPPV++  +E + +E  T A+R+ V    ALQA DGHW
Sbjct  60    --CSDLFWRMQFLKEARFEQV-IPPVKIDGDEAITHENATNALRRGVSFFSALQASDGHW  116

Query  2075  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  1896
             P E +GPLFF PPL+  LYI+G ++ +   EH+KE++R++Y HQNEDGGWGL+++  S M
Sbjct  117   PGEITGPLFFLPPLVFCLYITGHLEKVFDEEHRKEMLRHVYCHQNEDGGWGLHVESKSIM  176

Query  1895  IGSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGC  1719
               +ALNY+ LR+LGEGP+ G D A  R R+WILD GG T IPSWGKI+LS+LG+Y+W G 
Sbjct  177   FCTALNYICLRILGEGPNGGRDNACKRARQWILDRGGVTYIPSWGKIWLSILGIYDWSGT  236

Query  1718  NPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSY  1539
             NP+ PE WL PS  P H AK  CYCR  YMPMSYLY KR+ GP+T ++L LR+E+ ++ Y
Sbjct  237   NPMPPEIWLLPSFLPIHLAKTLCYCRMVYMPMSYLYGKRFVGPITPLILQLRDELLLQPY  296

Query  1538  EQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKY  1362
             E I+WN+ R    KED+Y+PH ++QDL+W+AL    EPF+ RWP  K +RE A R A+K+
Sbjct  297   EAINWNKTRRLYAKEDMYFPHPWVQDLVWDALNVFVEPFLTRWPLNKLVREKACRLAMKH  356

Query  1361  MRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGS  1182
             + YE E + YITIGC+EK L M+  W ++P+GD  K HLAR+PDY+W+AEDGM M  FGS
Sbjct  357   IHYEDENSHYITIGCVEKVLCMLACWIDNPHGDYFKKHLARIPDYMWVAEDGMKMQSFGS  416

Query  1181  QNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFS  1002
             Q WD  FA QAI+AS +++E  + L+K H YIK SQV+ENP GDFKSMYRH++KG+WT S
Sbjct  417   QLWDTGFAVQAILASDLLDETSNVLKKGHDYIKLSQVRENPSGDFKSMYRHISKGAWTLS  476

Query  1001  DQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATW  822
             D+DHGW VSDCTAE LKC LLL  MP +++G++ D +++Y++V++ L  QS E GG   W
Sbjct  477   DRDHGWQVSDCTAEALKCCLLLSTMPSEVVGQQLDPEQIYDSVNLLLSFQS-EKGGVTAW  535

Query  821   EPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKA  642
             EP     +++ LNP+E  A++V E E++E T S+I ALV F   YP++R KE++ SI KA
Sbjct  536   EPVRAYEWIEFLNPTEFLANLVAEREYVECTSSVIQALVLFNQLYPDHRTKEISRSIEKA  595

Query  641   VQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQE  462
             V YLE +Q+ DGSWYG WGVCF+Y T+FAL GL AAGK+YE   A+     F L  Q  +
Sbjct  596   VHYLENEQKPDGSWYGNWGVCFIYATWFALGGLAAAGKTYEKSLAMRKGVEFLLRTQKDD  655

Query  461   GGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQM  282
             GGWGE   SCP  RYIP EG  +NLVQT+WAMLGL++ GQA  DP PLHRAAKL+IN+QM
Sbjct  656   GGWGESYLSCPEERYIPSEGKQSNLVQTAWAMLGLIHAGQAGSDPIPLHRAAKLIINSQM  715

Query  281   EDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             EDGDFPQQ+I GV+MKNC++HYA++R+ FPL AL+EYRK
Sbjct  716   EDGDFPQQEIVGVFMKNCLIHYATYRNTFPLWALAEYRK  754



>ref|XP_008365698.1| PREDICTED: beta-amyrin synthase-like [Malus domestica]
Length=760

 Score =   923 bits (2385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/759 (58%), Positives = 565/759 (74%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MWKLK+ +GG  PYI+STNN+ GRQI+E+DP AGT EE+   E+AR  F   R Q  P++
Sbjct  1     MWKLKVADGGNDPYIHSTNNFVGRQIFEFDPEAGTTEERAEVEEARLNFYNNRYQVKPNS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E      +IPPV++ + E++ YE  T A+R++V    ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-TIPPVKVEDGEKITYEKATFALRRSVHFFSALQAGDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++  YI+G ++ +  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCTYITGHLNTVFPAEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ LR+LGEGPD   D A A+ RKWILDHG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TALNYICLRILGEGPDGAQDNACAKARKWILDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y++
Sbjct  238   MPPEFWILPSFLPVHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W   R  C K D+YYPH +IQD LW++L  CTEP + RWPF K IR+ A+   ++++ 
Sbjct  298   INWKGVRHHCAKVDIYYPHPWIQDFLWDSLYVCTEPLLTRWPFNKLIRKRALEVTMEHVH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIG +EK L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ 
Sbjct  358   YEDENSRYITIGAVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQ  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++A+ + +E    L + H ++K+SQVK+NP GDFKSMYRH++KGSWTFSDQ
Sbjct  418   WDTGFAIQALLAANLTDEIAPTLARGHDFVKKSQVKDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW +SDCTAE LKC LLL  MP +I+GEK + +RLY+AV+V + LQS ++GG A WEP
Sbjct  478   DHGWQLSDCTAEGLKCCLLLSMMPPEIVGEKMEPERLYDAVNVIISLQS-KNGGLAAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  + ++ NP+E F DIVVE E++E T S I ALV F+  YP +R +E++  I  AV 
Sbjct  537   AGAPEWWEMFNPTEFFEDIVVEHEYVECTSSAIQALVLFKKLYPGHRKEEIDQFITAAVL  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q +DGSWYG WGVCF YGT+FAL GLTAAGK++ NC A+     F L+ Q + GG
Sbjct  597   YLENVQMADGSWYGEWGVCFTYGTWFALGGLTAAGKTFNNCAAMRKGISFLLAIQKENGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP   Y+PLEG  +NLV T+WAM+GL++ GQAERDPTPLHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIHAGQAERDPTPLHRAAKLIINSQMEN  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITG + KNCMLH+ ++R+ FPL AL+EY +RV
Sbjct  717   GDFPQQEITGSFKKNCMLHFPAYRNIFPLWALAEYCRRV  755



>gb|KFK42270.1| hypothetical protein AALP_AA2G234200 [Arabis alpina]
Length=759

 Score =   922 bits (2384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/759 (57%), Positives = 556/759 (73%), Gaps = 7/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLKI  G    PY++STNN+ GRQ WE+DP+AGTPEE+ A E+AR+ F   R +    
Sbjct  1     MWKLKIANGNKEEPYLFSTNNFLGRQTWEFDPDAGTPEERAAVEEARRKFYDDRFR-VKA  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ + E + + + I PV++ + +++  E  T A+R+ V    ALQA DGHWPA
Sbjct  60    SSDLIWRMQFLNEKKFEQV-IAPVKVEDGKKITSEVATNALRRGVNFLSALQASDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL+  L+++G +  I T EH +E++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVFCLFVTGHLSEIFTKEHCREILRYIYCHQNEDGGWGLHIEGHSTMFC  178

Query  1889  SALNYVALRLLGEGPDDGDG-AIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ +R+LGE P+ G G A  R + WIL HGGAT IPSWGK +LS+LGV++W G NP
Sbjct  179   TALNYICMRILGESPNGGPGNACERAKNWILGHGGATYIPSWGKTWLSILGVFDWSGSNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCY R  YMPMSYLY K++ GP++ ++L LR EI+++ YE+
Sbjct  239   MPPEFWILPSFLPIHPAKMWCYSRLVYMPMSYLYGKKFVGPISPLILQLREEIYLQPYEK  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYMR  1356
             I+WN+AR  C KED YYP   +QD++W+ L   TEP +  WPF K+ RE A+  A+K++ 
Sbjct  299   INWNRARHLCAKEDAYYPRPLVQDVIWDCLYIFTEPLLTCWPFNKLLREKALVAAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK+L M+  W EDPNG   K HL R+ DYLW+AEDGM M  FGSQ 
Sbjct  359   YEDENSRYITIGCVEKALCMLACWVEDPNGIHFKKHLLRISDYLWIAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD+ FA QA+++S +  E  D LR+ H   K SQV+ENP GDF SM+RH++KGSWTFSD+
Sbjct  419   WDSGFALQALVSSNLSNEIPDVLRRGHDLFKNSQVRENPSGDFTSMHRHMSKGSWTFSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW  SDCTAE LKC +LL  MP  I+G K D ++LYE+V + L LQS ++GG   WEP
Sbjct  479   DHGWQASDCTAEGLKCCILLSMMPPDIVGPKMDPEQLYESVTILLSLQS-KNGGVTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP+E+FADIVVE E+ E T S I ALV F+  YPN+R + +N  I KAVQ
Sbjct  538   ARGQEWLELLNPTEVFADIVVEHEYNECTSSAIQALVMFKQLYPNHRTEVINNFIKKAVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             Y+E  Q  DGSWYG WGVCF Y T+FAL GL AAGK+Y NC A+    HF L+ Q   GG
Sbjct  598   YIENIQMLDGSWYGSWGVCFTYSTWFALGGLAAAGKTYTNCLAMRKGVHFLLTTQKDNGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SC   RYIP +G  +NLVQTSWAM+GL++ GQAERDPTPLHRAAKLLIN+Q+E+
Sbjct  658   WGESYLSCSKKRYIPSDGERSNLVQTSWAMMGLLHAGQAERDPTPLHRAAKLLINSQLEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITG +MKNC+LHYA++R+ FP+ AL+EYR+RV
Sbjct  718   GDFPQQEITGAFMKNCLLHYAAYRNIFPVWALAEYRRRV  756



>ref|XP_006488602.1| PREDICTED: beta-amyrin synthase-like [Citrus sinensis]
Length=781

 Score =   922 bits (2383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/777 (57%), Positives = 563/777 (72%), Gaps = 27/777 (3%)
 Frame = -3

Query  2423  MWKLKIGEGGG---PYIYSTNNYAGRQIW----------EYDPNAGTPEEQEAFEKARKG  2283
             MWKLK+GEG G    YIYSTNNYAGRQIW          E+DP AGT EE+   E AR  
Sbjct  1     MWKLKVGEGNGEKDAYIYSTNNYAGRQIWQFDPEAGRIWEFDPEAGTDEERAQVEAARLH  60

Query  2282  FTKQRQKGPHTCGDLFMRMQMIKESEVDVLSIPPVRLR---EEEEVNYE-AITTAVRKAV  2115
             F   R     +  DL  RMQ +KE +    +IP V+++   +EEE+ YE A TTA+R+ V
Sbjct  61    FYNNRDHLKPS-ADLLWRMQFLKEKKFKQ-TIPQVKIKVDGDEEEITYETAATTALRRGV  118

Query  2114  RLNCALQAKDGHWPAENSGPLFFTPPLMIALYISGSIDMIL--TSEHKKELVRYLYNHQN  1941
             R   ALQA DGHWPAEN+GPLFF PPL++ LYI+G ++ +    SEH+KE++RY++ HQN
Sbjct  119   RFFSALQASDGHWPAENAGPLFFLPPLVMCLYITGHLNTVFPAESEHRKEILRYIHYHQN  178

Query  1940  EDGGWGLYIDGHSTMIGSALNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGK  1761
             EDGGWGL+I+GHSTM  +ALNY+ LR+LG+ P     A A  R WILD GG T IPSWGK
Sbjct  179   EDGGWGLHIEGHSTMFCTALNYICLRILGQPPHHI--ACATARNWILDRGGVTLIPSWGK  236

Query  1760  IYLSVLGVYEWDGCNPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTD  1581
             I+LS+LGV++W GCNP+ PEFW+ PS  P HP KMWCYCR  YMPMSYLY KR+ G +T 
Sbjct  237   IWLSILGVFDWSGCNPMPPEFWILPSFLPMHPGKMWCYCRMVYMPMSYLYGKRFVGAITP  296

Query  1580  VVLALRNEIH--VKSYEQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWP  1407
             +V+ LR E++   + Y +++W +AR  C KED YYPH +IQDL+WN L   TEP + RWP
Sbjct  297   LVVELRQELYPEAEPYHKVNWGKARHLCAKEDAYYPHPWIQDLIWNTLYVFTEPLLTRWP  356

Query  1406  FKK-IREMAMRKAIKYMRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPD  1230
             F K IRE A++  + ++ YE   +RYITIGC+EK L M+  W E PNGD  K HLAR+PD
Sbjct  357   FNKFIREKALQVTMDHIHYEDHNSRYITIGCVEKVLCMLACWVEHPNGDSFKKHLARIPD  416

Query  1229  YLWLAEDGMSMHGFGSQNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGD  1050
             YLW+AEDGM M  FGSQ WD  FA QA++AS +++E G  L++ H +IK SQVK+NP GD
Sbjct  417   YLWVAEDGMKMQSFGSQQWDTGFAIQALLASNLIDEIGPVLKRGHEFIKASQVKDNPSGD  476

Query  1049  FKSMYRHVTKGSWTFSDQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVD  870
             FK MYRH++KGSWTFSDQDHGW VSDCTAE LKC LLL  MP +I+GEK + +RLY++V+
Sbjct  477   FKRMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPTEIVGEKMEPERLYDSVN  536

Query  869   VCLYLQSPESGGFATWEPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCH  690
             + L LQS + GG   WEP     +L++LNP+E FADIV+E E++E T S I AL  F   
Sbjct  537   ILLSLQS-KIGGLPAWEPVGAHKWLELLNPTEFFADIVIEHEYVECTSSAIQALTMFSKL  595

Query  689   YPNYRPKEVNISIAKAVQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCE  510
             YP +R KE++  I KA+ YLE  Q +DGSWYG WGVCF YGT+FAL GL AAGK+Y N  
Sbjct  596   YPGHRKKEIDKFIGKAIGYLEDAQMADGSWYGCWGVCFTYGTWFALGGLAAAGKTYTNSP  655

Query  509   AVCNAAHFFLSKQNQEGGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERD  330
              V  A HF L+ Q Q GGWGE  +SCP  +YIPLEG  +NLVQT+W M+GL++ GQA+RD
Sbjct  656   TVRKAVHFLLNSQTQNGGWGESFRSCPQKKYIPLEGNRSNLVQTAWGMMGLLHAGQADRD  715

Query  329   PTPLHRAAKLLINAQMEDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PTPLH AAKLLIN+Q+E GDFPQ++ITGV+ KNCMLHYA++R+ +PL AL+EY +R+
Sbjct  716   PTPLHLAAKLLINSQLEHGDFPQEEITGVFNKNCMLHYAAYRNIYPLWALAEYCRRL  772



>ref|XP_010245750.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Nelumbo nucifera]
Length=736

 Score =   922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/757 (57%), Positives = 556/757 (73%), Gaps = 32/757 (4%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MW+LKI +GGGPY+YSTNNY GRQ WE++P+ GT EE+   EKAR  FTK R       G
Sbjct  1     MWRLKIAQGGGPYMYSTNNYVGRQTWEFNPDYGTSEERAEVEKARDEFTKNRH-CVKPSG  59

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             D+ +R+Q++KE+   + +IPPVR+ E+EE++YEA T A+++AV+ + ALQA DGHWPAEN
Sbjct  60    DVLLRLQLLKENNF-IQTIPPVRIGEDEEISYEAATAALKRAVQFHSALQASDGHWPAEN  118

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             SG  FF PP+++ LYI+G ++ + T E++KE++RY+YNHQNEDGGWGL+I+GHS M  + 
Sbjct  119   SGCPFFLPPMVMCLYITGDLNKVFTEEYRKEILRYIYNHQNEDGGWGLHIEGHSIMFSTV  178

Query  1883  LNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             LNY+++R+LGEGP+ G D A+ R RKWI DHGGAT IPSWGK +LS+ GVYEW+G NP+ 
Sbjct  179   LNYISMRILGEGPEGGRDRAVPRARKWIHDHGGATSIPSWGKTWLSIFGVYEWEGSNPMP  238

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWL PS FP  P K+WCYCR TYMPM YLY KR+ GP+T ++L LR EIH + Y +I 
Sbjct  239   PEFWLLPSFFPLSPEKLWCYCRMTYMPMCYLYGKRFVGPITPLILQLREEIHTQPYHKIK  298

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             W++ R  C KEDLYYPH FIQDLLW+ L   TEP + RWPF K+RE A+++ +K++ YE 
Sbjct  299   WSRTRHMCAKEDLYYPHPFIQDLLWDTLYILTEPLLTRWPFNKLRERALKQTMKHIHYED  358

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E +RYITIGC+EK L M+  W EDPNGD  KYHL R+PDY+W+AEDGM M  +GSQ WD 
Sbjct  359   ENSRYITIGCVEKPLFMLACWVEDPNGDAYKYHLERIPDYIWVAEDGMKMQSYGSQLWDT  418

Query  1166  AFATQAIIASGM-VEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
             +FA QAI+AS +  +E G CL+K H Y+K SQV+ENP GDFK M+RH++KGSWTFSDQDH
Sbjct  419   SFAIQAIMASNLSFDEIGLCLKKGHDYLKNSQVRENPSGDFKRMFRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW +SDCTAE LK  L+   MP +I+GEK + + L++AV+V L LQS ++GG A WEP  
Sbjct  479   GWQISDCTAEALKACLMFSLMPPEIVGEKMEKECLFDAVNVLLSLQS-QNGGLACWEPAR  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
              + +L++ NP+E F++IV+E E+IE T S I ALV F+  YPN+R KEV   I+K+V Y+
Sbjct  538   SENWLELFNPTEFFSNIVIEHEYIECTASAIQALVLFKKLYPNHRKKEVESFISKSVHYI  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E+ Q  +GSWYG WG+CF+Y  +FAL GL A GK+Y+NC  V     F LS Q    GWG
Sbjct  598   EQIQMPNGSWYGNWGICFIYSAWFALGGLAAVGKTYDNCPTVRKCVDFLLSTQKDSCGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP++                           AERD TPLHRAAKLLIN+QME+GD
Sbjct  658   ESYLSCPNV---------------------------AERDATPLHRAAKLLINSQMENGD  690

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQ++ITGV++KNCM+HYA++R+ FPL AL EYR RV
Sbjct  691   FPQEEITGVFLKNCMIHYAAYRNIFPLWALGEYRARV  727



>gb|KFK42272.1| hypothetical protein AALP_AA2G234400 [Arabis alpina]
Length=759

 Score =   921 bits (2381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/759 (56%), Positives = 557/759 (73%), Gaps = 7/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG--GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLKIGE     PY++STNN+AGRQ WE+DP+ G+PEEQ+A  +AR+ F + R +    
Sbjct  1     MWKLKIGERNEDDPYLFSTNNFAGRQTWEFDPHGGSPEEQQAVVEARRSFYENRFR-VKA  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ +KE + + + IPPV++   +++ +E+ T ++R+ V    ALQA DGHWPA
Sbjct  60    SSDLLWRMQFLKEKKFEQV-IPPVKVESSDKITFESATNSLRRGVHFFSALQASDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL+  LYI+G +D I T EH+KE++RY+Y HQ EDGGWG +I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVFCLYITGHLDDIFTLEHRKEILRYIYCHQKEDGGWGFHIEGHSTMFC  178

Query  1889  SALNYVALRLLGEGPDDGD-GAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ +R+LGE PD G+  A AR RKWI  HGG T IPSWGK +LS+LGV++W G NP
Sbjct  179   TALNYICMRILGESPDGGEENACARARKWIHVHGGVTCIPSWGKTWLSILGVFDWSGSNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS FP +PAKMWCYCR  Y+PMSYLY KR+ GP+T ++L LR E++++ Y +
Sbjct  239   MPPEFWILPSFFPVNPAKMWCYCRMVYLPMSYLYGKRFVGPITPLILQLRKELYLQPYGE  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYMR  1356
             I+W +    C KED YYP   +Q+L+W++L   TEPF+ RWP  K+ R+ A++ A+K++ 
Sbjct  299   INWKKIHHLCAKEDAYYPRPLVQELIWDSLYIFTEPFLTRWPLNKLLRQRALQVAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ 
Sbjct  359   YEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS +  E  D LR+ H +IK+SQV+ENP GDFKSMYRH++KG+WTFSD+
Sbjct  419   WDTGFAMQALLASNLSSEISDVLRRGHEFIKKSQVRENPSGDFKSMYRHISKGAWTFSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTA  LKC LLL  M   I+G K D +RLY++V++ L LQS + GG   WEP
Sbjct  479   DHGWQVSDCTAHGLKCCLLLSMMAPNIVGPKTDPERLYDSVNLLLTLQS-KKGGMTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+E+F+DIV+E E+ E T S I AL  F+  +P++R  E+N  I KAVQ
Sbjct  538   AGAPEWLELLNPTEMFSDIVIEHEYTECTSSAIQALSLFKQLFPDHRKAEINKFIEKAVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q  DGSWYG WG+CF+YGT+F L GL AAGK+Y +C A+     F L+ Q   GG
Sbjct  598   YLENMQTPDGSWYGNWGICFMYGTWFGLAGLAAAGKTYNDCVAIRKGVQFLLATQKDNGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SC   RYI  E   TN+VQTSWA++GL+++GQA+RDP PLHRA KL+IN+Q+E+
Sbjct  658   WGESYLSCSEKRYIAEEADITNVVQTSWALMGLIHSGQAKRDPVPLHRAVKLIINSQLEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ  TGV+MKNC LHYA++R+  PL AL+EYR RV
Sbjct  718   GDFPQQQSTGVFMKNCTLHYAAYRNIHPLWALAEYRARV  756



>ref|XP_006377610.1| putative oxidosqualene cyclase family protein [Populus trichocarpa]
 gb|ERP55407.1| putative oxidosqualene cyclase family protein [Populus trichocarpa]
Length=755

 Score =   921 bits (2381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/756 (57%), Positives = 563/756 (74%), Gaps = 7/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKL++ +G GP+++STNN+ GRQIW++ P+ GTPEE    E AR+ F   R +      
Sbjct  1     MWKLEVADGDGPWLFSTNNFVGRQIWKFKPHVGTPEEHARVEIAREQFRSNRSRCK-ASS  59

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             D+    Q+I+E+++D LSIPPVRL + EE+  E   TA+RKA+R   A QA DGHWPAE 
Sbjct  60    DVLKNFQLIQENQID-LSIPPVRLGDGEEITVEKAETALRKALRFTSATQASDGHWPAEF  118

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             SGPLF TPPL++ +Y+SGS++ +L+S+HKKE++RY+YNHQNEDGGWG +++GHSTM+G+A
Sbjct  119   SGPLFLTPPLIMVVYLSGSLNTVLSSDHKKEIIRYIYNHQNEDGGWGFHVEGHSTMMGTA  178

Query  1883  LNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             LNYVALRLLGEGP+ G DGA+   RKWILDHGG T +PSWGK+YLSVLG YEW GCNP+ 
Sbjct  179   LNYVALRLLGEGPEGGRDGALTEARKWILDHGGVTMLPSWGKLYLSVLGTYEWSGCNPVP  238

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEF LFPS  PF P K+WC+ RT Y PM+YLY K++ GP+TD++L LR+E++ + YE++D
Sbjct  239   PEFLLFPSFLPFSPGKLWCHLRTVYTPMAYLYGKKFVGPITDLILQLRDELYNQPYEEVD  298

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+AR  C KEDLY   S  ++L+++ + Y +E  +R WPF K+RE A+++A+K + YE 
Sbjct  299   WNKARHLCLKEDLYTSPSLAKNLIFDGVHYLSERVLRHWPFSKLREQALQEAMKLIHYED  358

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E TRY+T   IEKSL MM  WAEDP  D  K+HLARVPD LWLAEDGM M   GSQ WDA
Sbjct  359   ENTRYMTHASIEKSLNMMACWAEDPTSDAFKFHLARVPDVLWLAEDGMKMQSIGSQLWDA  418

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
             AFATQA+IAS +V+EYG  LR+ H ++K+SQ++ N  GDF+ M+RH++KG+WT S +DHG
Sbjct  419   AFATQAVIASKLVDEYGSTLRRAHEFLKQSQIQANASGDFRRMHRHISKGAWTLSIKDHG  478

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE L+ LLLL +MP +I+GE    +RLY A+D  L LQS ++GGF+ WEP   
Sbjct  479   WQVSDCTAEALRALLLLSQMPSEIVGETIHTERLYNAIDFLLSLQS-KNGGFSVWEPARG  537

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
             Q +L+VLNP+E F D++VE E++E T S I ALV F+  +P YR KE+  S+AKA  Y+E
Sbjct  538   QRWLEVLNPTEAFGDMMVETEYVECTASAIQALVLFKRLHPGYRSKEIEASVAKASSYIE  597

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
               Q SDGSWYG WG+C+ YGT+FAL GL + GK+  N   V  A  F LSKQ+  GGWGE
Sbjct  598   DAQMSDGSWYGNWGICYTYGTYFALKGLASVGKTCRNSTTVRKACEFLLSKQHNSGGWGE  657

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                SC +  Y  +E   +N+VQT+WAM+GL++ GQA  DP PLH+AA+LLIN+QME+G+F
Sbjct  658   SYLSCANSEYTEIE--KSNVVQTAWAMMGLIHAGQAS-DPAPLHQAARLLINSQMENGEF  714

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PQQ ITG  +K CMLHYAS ++  PL AL EYRK V
Sbjct  715   PQQQITGASLKTCMLHYASFKNILPLWALGEYRKCV  750



>gb|AAS83468.1| beta-armyrin synthase [Bupleurum kaoi]
Length=762

 Score =   921 bits (2381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/758 (56%), Positives = 556/758 (73%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG--GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LKI EG     Y+YSTNNY GRQ WE+DPN G+ EE+   ++AR  F + R K   +
Sbjct  1     MWRLKIAEGSEDDKYLYSTNNYVGRQTWEFDPNYGSREEKAQVDEARLNFWQNRYKVKPS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GD+  +MQ ++E      +IP V++ + E+++YE  +  V++A     ALQA DGHWPA
Sbjct  61    -GDVLWQMQFLREKGFKQ-TIPQVKIEDGEDISYEKASVTVKRAAHYFAALQASDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++ +YI+G ++ +  + H++E++RYLY HQNEDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVMCVYITGHLNQVFPAPHREEILRYLYCHQNEDGGWGLHIEGHSTMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +AL+Y+ +R+LGEGPD G + A +R RKWILDHG  T +PSWGK +LS+LGV+EW G NP
Sbjct  179   TALSYICMRILGEGPDGGVNNACSRARKWILDHGSVTHMPSWGKTWLSILGVFEWSGSNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+  P+T ++L LR E++ + Y+ 
Sbjct  239   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVAPMTPLILQLREELYDQPYDH  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I+W + R  C  ED+YYPH  +QDL+W +L  CTEP + RWPF KIRE A+   ++++ Y
Sbjct  299   INWPKVRHCCAPEDIYYPHPLVQDLIWGSLYICTEPLLTRWPFNKIREKALATTMEHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M   WAEDP+GD  K HLAR+PDYLW+AEDGM M  FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMPACWAEDPDGDYFKKHLARIPDYLWVAEDGMKMQSFGSQEW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D  F  QA++A+ + +E G  L++   ++K SQVK+NP GDFKSMYRH++KGSWTFSDQD
Sbjct  419   DTGFGLQALLATDLTDELGPTLKRGREFVKASQVKDNPSGDFKSMYRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LL   M  +I+G+K + +RLY++V++ L LQS ++GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLFSMMSPEIVGKKFEPERLYDSVNLLLSLQS-KNGGLAAWEPA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L++LNP+E F DIV+E E++E T S I ALV F   YP +R KE+N  I  A +Y
Sbjct  538   GAQEWLELLNPTEFFQDIVIEHEYVECTASAIQALVLFTKLYPAHRKKEINAFIVNAAKY  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q  DGSWYG WGVCF YG++FAL GL AAGK+Y NC AV     F L  Q  +GGW
Sbjct  598   LEDIQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYNNCAAVRKGVDFLLKSQLDDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP  +Y  +EG+ +NLVQT+WA +GL+++GQ ERDPTPLHRAAKL+IN+Q E G
Sbjct  658   GESYLSCPLEKYTQIEGSRSNLVQTAWATVGLIHSGQVERDPTPLHRAAKLIINSQEEKG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
              FPQQ+ITGV+MKNCMLHYA++R  +PL AL+EYRKRV
Sbjct  718   GFPQQEITGVFMKNCMLHYAAYRDLYPLWALAEYRKRV  755



>emb|CBI18406.3| unnamed protein product [Vitis vinifera]
Length=910

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/755 (57%), Positives = 555/755 (74%), Gaps = 7/755 (1%)
 Frame = -3

Query  2426  KMWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPH  2253
             KMW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   E AR+ F K R Q  P 
Sbjct  141   KMWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAARENFWKNRFQVKPS  200

Query  2252  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2073
             +  DL  RMQ ++E      +IP V++ + EE+  E  TTAVR+      ALQA DGHWP
Sbjct  201   S--DLLWRMQFLREKNFKQ-TIPQVKVGDGEEIAEETATTAVRRGAHFFSALQASDGHWP  257

Query  2072  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  1893
             AE+SGPLFF PPL++ LYI+G +D +   E++KE++RYLY HQNEDGGWGL+I+ HS M 
Sbjct  258   AEHSGPLFFLPPLVMCLYITGHLDTVFPGEYRKEILRYLYCHQNEDGGWGLHIEEHSIMF  317

Query  1892  GSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              + L+YV +R+LGEG D G D A ARGRKWIL+ GG T IP+WGKI+LS+ G+++W G N
Sbjct  318   CTTLSYVCMRILGEGRDGGRDNACARGRKWILNRGGVTSIPTWGKIWLSIFGLFDWSGSN  377

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             P+ PEF LFPS+ P +PAK+WCY R  +MPMSYLY KR+ GP+T +VL LR E+ ++ Y 
Sbjct  378   PMPPEFSLFPSHLPMNPAKIWCYSRLIFMPMSYLYGKRFVGPITPLVLELREELFLQPYN  437

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
             +I+W + R  C KEDLYYPH  IQD++W++L  CTEP + RWPF K+R+ A+   +K++ 
Sbjct  438   EINWKKVRHLCAKEDLYYPHPLIQDMMWDSLYICTEPLLTRWPFNKLRKKALEVTMKHIH  497

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDY+W+ EDG+ M  FGSQ 
Sbjct  498   YEDENSRYITIGCVEKVLCMLSCWVEDPNGDYFKKHLARIPDYIWVGEDGIKMQTFGSQE  557

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD + A QA++A  M  E G  L+K H ++KESQVK+NP GDFKSMYRH++KGSWTFSD+
Sbjct  558   WDTSLALQALLACNMTNEIGPTLKKGHEFLKESQVKDNPSGDFKSMYRHISKGSWTFSDK  617

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LL   M  +I+G K +  RL+++V++ L LQS E+GG   WEP
Sbjct  618   DHGWQVSDCTAEGLKCCLLFSMMAPEIVGMKIEPGRLFDSVNILLSLQS-ENGGIVGWEP  676

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNPSE+F D+V+E E++E T S I ALV F+  YP +R +E++  I  A +
Sbjct  677   AGASEWLELLNPSEMFEDLVIEHEYVECTASAIQALVLFKKLYPEHRTEEIDNFITNATK  736

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             Y+E QQ  DGSWYG WGVCF+Y +++AL GL AAGK+Y NC A+  A  F L  Q  +GG
Sbjct  737   YIEDQQMPDGSWYGKWGVCFIYSSWWALGGLAAAGKTYHNCLAIGRAVEFLLKSQRDDGG  796

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SC   +Y PLEG  +NLVQT WA++GL+ +GQAERDPTPLHRAAKLLIN+QMED
Sbjct  797   WGESYISCRDKKYTPLEGNKSNLVQTGWALMGLLSSGQAERDPTPLHRAAKLLINSQMED  856

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEY  171
             GDFPQQ+ITG +M NCMLH A +R+ FPL AL+EY
Sbjct  857   GDFPQQEITGAFMNNCMLHCADYRNIFPLWALAEY  891



>ref|XP_004507562.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Cicer arietinum]
Length=762

 Score =   920 bits (2379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/759 (56%), Positives = 566/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LKI +GG  PYI+STN + GRQIWEYD  AGT EE+E  ++AR  F   R Q  P  
Sbjct  1     MWRLKIADGGKDPYIFSTNEFVGRQIWEYDSEAGTKEEREQVQQARLNFYNNRFQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             C DL  R Q+++E+     +I  V++ + EE+ YE  T+A+R+      ALQ  DGHWPA
Sbjct  59    CADLLWRFQILRENNFKQ-TIDSVKIEDGEEITYEKATSALRRGTHHLAALQTTDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             + +GPLFF PPL+  +YI+G +D+I + EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   QIAGPLFFLPPLVFCVYITGHLDLIFSKEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ +R+LG+GP+ G D A AR RKWI DHGG T I SWGKI+LS+LGV++W G NP
Sbjct  178   TALNYICMRILGKGPNGGEDNACARARKWIHDHGGVTYISSWGKIWLSILGVFDWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR+ YMPMSYLY KR+ GP+T ++L LR E+H + YE+
Sbjct  238   MPPEFWMLPSFLPIHPAKMWCYCRSVYMPMSYLYGKRFVGPITPLILQLREELHTQPYEK  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W+++R  C KEDLY PH+ + DL+ ++L   TEP +  WP  K +RE A+   +K++ 
Sbjct  298   INWSKSRHLCAKEDLYSPHTLMYDLICDSLYIFTEPLLTHWPLNKLVREKALEVTMKHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW++EDGM+M  FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARIPDYLWISEDGMTMQSFGSQA  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WDA FA QA++A+ ++EE G  L K H +IK+SQV++NP GDFKSMYRH+ KGSWTFSDQ
Sbjct  418   WDAIFAVQALLATDLIEEIGSVLLKGHNFIKKSQVRDNPSGDFKSMYRHICKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW ++D TAE LKC LLL  +P +I+GEK + +RLY+++++ L  QS ++GG   WEP
Sbjct  478   DHGWQITDGTAEGLKCCLLLSMLPPEIVGEKLEPERLYDSINILLSFQS-KNGGLPAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP E   DIVVE E++E TGS I ALV F+  YP +R +E++  IA AV+
Sbjct  537   TTAPKWLELLNPLEFCEDIVVEHEYVECTGSAIQALVLFKKLYPGHRKEEIDNFIANAVR  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             ++E  Q S+GSWYG WGVCF+YGT+FAL GL AAGK+Y NC A+  A  F L+ Q ++GG
Sbjct  597   FIEDTQTSNGSWYGNWGVCFIYGTWFALGGLAAAGKTYTNCSAIRKAVQFLLTIQREDGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   S P   Y+PLEG+ +N+VQT+WA+LGL++ GQAERD TPLHRAAKLLIN+Q+E+
Sbjct  657   WGESYLSNPKKIYVPLEGSRSNVVQTAWALLGLIHVGQAERDLTPLHRAAKLLINSQLEE  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             G++PQQ+ITGV+MKNC LHY  +R  +PL AL+EYRK V
Sbjct  717   GNWPQQEITGVFMKNCFLHYPMYRDIYPLWALAEYRKCV  755



>ref|XP_002887124.1| ATLUP2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63383.1| ATLUP2 [Arabidopsis lyrata subsp. lyrata]
Length=759

 Score =   920 bits (2378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/759 (56%), Positives = 560/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGF--TKQRQKGP  2256
             MW+LKIGEG G  PY++S+NN+ GRQ WE+DP AGT EE+   E AR+ F     R KG 
Sbjct  1     MWRLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTIEERATVEVARRSFLVNHSRVKG-  59

Query  2255  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2076
               C DL  RMQ +KE++ + + IPPV++ + E + +E  T A+R+ V    ALQA DGHW
Sbjct  60    --CSDLLWRMQFLKEAKFEQV-IPPVKIDDAEGITHENATDALRRGVSFFSALQASDGHW  116

Query  2075  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  1896
             P E +GPLFF PPL+  LYI+G ++ I   EH+KE++R++Y HQNEDGGWGL+I+  S M
Sbjct  117   PGEITGPLFFLPPLVFCLYITGHLEKIFDEEHRKEMLRHVYCHQNEDGGWGLHIESKSIM  176

Query  1895  IGSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGC  1719
               + LNY+ LR+LGEGP+ G + A  R R+WILD GG T IPSWGKI+LS+LG+Y+W G 
Sbjct  177   FCTVLNYICLRMLGEGPNGGRENACKRARQWILDRGGVTYIPSWGKIWLSILGIYDWSGT  236

Query  1718  NPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSY  1539
             NP+ PE WL PS  P H AK  CYCR  YMPMSYLY KR+ GP+T ++L LR E+H++ Y
Sbjct  237   NPMPPEIWLLPSFLPIHLAKTLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELHLEPY  296

Query  1538  EQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKY  1362
             E I+WN+ R    KED+Y+PH  +QDL+W+AL    EPF+ RWP  K +RE A+R A+K+
Sbjct  297   EAINWNKTRRLYAKEDMYFPHPLVQDLIWDALYLFVEPFLTRWPLNKLVREKALRLAMKH  356

Query  1361  MRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGS  1182
             + YE E + YITIGC+EK L M+  W E+PNGD  K HLAR+PDY+W+AEDGM M  FGS
Sbjct  357   IHYEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGS  416

Query  1181  QNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFS  1002
             Q WD  FA QAI+A  +  E GD L++ H YIK+SQV+ENP GDFKSMYRH++KG+WT S
Sbjct  417   QLWDTGFAVQAILACDLSGETGDVLKRGHDYIKKSQVRENPSGDFKSMYRHISKGAWTLS  476

Query  1001  DQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATW  822
             D+DHGW VSDCTAE LKC LLL  MP +++G K D +++Y++V++ L  QS ++GG   W
Sbjct  477   DRDHGWQVSDCTAEALKCCLLLSMMPAEVVGHKIDPEQIYDSVNLLLSFQS-DNGGVTAW  535

Query  821   EPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKA  642
             EP     ++++LNP+E  A++VVE E++E T ++I ALV F+  YP+++ KE+  SI KA
Sbjct  536   EPVRAYKWIELLNPTEFLANLVVEREYVECTSAVIQALVLFKKLYPDHKTKEITRSIEKA  595

Query  641   VQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQE  462
             V +LE +Q SDGSWYG WGVCF+YGT+FAL GL AAG++Y+  +A+     F L  Q  +
Sbjct  596   VHFLENEQRSDGSWYGNWGVCFIYGTWFALGGLAAAGETYKTSQAMRKGVEFLLRTQKDD  655

Query  461   GGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQM  282
             GGWGE   SCP  RYIPLEG  +NLVQT+WA++GL++ GQAERDP  LHRAAKL+IN+QM
Sbjct  656   GGWGESYLSCPEQRYIPLEGKRSNLVQTAWALMGLIHAGQAERDPITLHRAAKLIINSQM  715

Query  281   EDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             E+GDFPQQ+I GV+M+NC++HYA++R+ FPL AL+EYRK
Sbjct  716   ENGDFPQQEIVGVFMRNCLIHYATYRNTFPLWALAEYRK  754



>ref|XP_009379199.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=761

 Score =   919 bits (2376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/758 (57%), Positives = 563/758 (74%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLK+ +GG  PYIYSTNN+ GRQI+E+DP AGT EE+   E+AR  F   R +   + 
Sbjct  1     MWKLKVADGGNDPYIYSTNNFVGRQIFEFDPEAGTTEERAEVEEARLHFYNNRHQVKPS-  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ ++E      +IPPV++ + EE+ +E  T ++R+++ L  ALQ    H PAE
Sbjct  60    GDLLWRMQFLREKNFKQ-TIPPVKIEDGEEITHEKATASLRRSIHLFSALQVSCAHGPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQN+DGGWG +I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCVYITGHLNTVFHAEHRKEILRYIYYHQNQDGGWGFHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ +R+LGEG D G D A AR RKWILDHG  T IPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGSDGGQDNACARARKWILDHGSVTHIPSWGKTWLSILGVFEWSGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y++I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDKI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W   R  C KED+YYPH +IQD LW++L  CTEP + RWP  K IR+ A+  A++++ Y
Sbjct  299   NWKGVRHYCAKEDIYYPHPWIQDFLWDSLYICTEPLLTRWPLNKLIRKRALEVAMEHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIG +EK+L MM  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ W
Sbjct  359   EDENSRYITIGSVEKALCMMACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQMW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA FA QA++AS + +E    L + H ++K+SQVK+NP GDFKSM+RH++KGSWTFSDQD
Sbjct  419   DAGFAIQALLASNLTDEIAPTLARGHDFVKKSQVKDNPSGDFKSMHRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW +SDCTAE LKC LLL  MP +++GEK + + LYEAV+V +YLQS ++GG   WE  
Sbjct  479   HGWQLSDCTAEGLKCCLLLSMMPPELVGEKMEPEWLYEAVNVLIYLQS-KNGGLGVWERA  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP+E F DIV+E E++E T + I A+V F+  YP +R KE +  I  A QY
Sbjct  538   GAAKWLEMLNPTEFFIDIVLEHEYLECTAAAIQAMVLFKKFYPGHRKKETDQFITNAAQY  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E  Q  DGSWYG WGVCF YGT+FAL GLTAAGK++ NCE +  A  F L+ QN+ GGW
Sbjct  598   VENTQMEDGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCEVIRKAVSFLLTMQNENGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP   Y+PLEG  +NLVQT+WAM+GL+Y GQAERDP PLHRAAKL+IN+Q+E+G
Sbjct  658   GESYLSCPKREYVPLEGNRSNLVQTAWAMMGLIYAGQAERDPAPLHRAAKLIINSQLENG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+I GV+  NCMLHY ++R+ FPL AL+EYRK V
Sbjct  718   DFPQQEIAGVFKMNCMLHYPTYRNIFPLWALAEYRKCV  755



>gb|ACO24697.1| beta-amyrin synthase [Gentiana straminea]
Length=755

 Score =   919 bits (2375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/758 (58%), Positives = 559/758 (74%), Gaps = 7/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGF-TKQRQKGPHT  2250
             MW+LKIGEGG  P +YSTNNY GRQIWEYD NAG  EE+E  E+AR+ F   +R   P +
Sbjct  1     MWRLKIGEGGNDPNLYSTNNYVGRQIWEYDRNAGIAEEREEVEEARRNFWNNRRHVKPSS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               D+  R+Q ++E      SIP V++ + +E+N++  TTA+R+AV L  ALQ+ DGHWPA
Sbjct  61    --DILWRLQFLREKNFKQ-SIPAVKVDDGQEINHQMATTALRRAVHLLSALQSSDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+G LFF PPL+I LYI+G ++ I  +EH  E++RYLY HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGSLFFLPPLIICLYITGHLNNIFPTEHTHEILRYLYCHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ +R+LGEGPD G + A AR RKWILDHG  T IPS GK +LS+LG+Y+W G NP
Sbjct  178   TALNYICMRILGEGPDGGKENACARARKWILDHGSVTAIPSLGKAWLSILGLYDWSGTNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PE W  PS+   HP KM CYCR  YMPMSYLY KR+   +T ++  LR E+H + Y Q
Sbjct  238   MPPEIWSLPSSLSIHPGKMGCYCRMVYMPMSYLYGKRFVCRITPLISELREELHCEPYNQ  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I W + R  C KEDLYYPH  IQDL+W+    CTEP    WP  K+R  A+   +K++ Y
Sbjct  298   IRWKRYRHVCAKEDLYYPHPLIQDLIWDFFYICTEPLFTHWPVNKLRAKALDATMKHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYIT+G +EK L M+  W EDPNGD  + HLAR+PDY+W+AEDGM M  FGSQ W
Sbjct  358   EDENSRYITVGSVEKVLCMLACWVEDPNGDYFQKHLARIPDYIWVAEDGMKMQSFGSQLW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D  FA QA++AS M EE  D LRK H +IK SQVKENP GDFKSMYRH++KGSWTFSDQD
Sbjct  418   DICFAIQALLASDMTEEITDTLRKGHDFIKNSQVKENPSGDFKSMYRHMSKGSWTFSDQD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LLL  MP +I+GE+ +++R+Y+AV++ L LQS ++GG   WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLLSTMPQEIVGERIELERIYDAVNILLSLQS-KNGGLPGWEPV  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP++ FAD+V+E EH E T S I ALV F+  YPN+  KE+   I  A  Y
Sbjct  537   RASDWLELLNPTDSFADLVIEHEHAECTASAIDALVLFKKLYPNHMTKEIESFITNASNY  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q  DGSWYG WGVCF+YGT+FAL GL A+GK+Y NC+ V  A +F L+ Q ++GGW
Sbjct  597   LEDVQMPDGSWYGNWGVCFIYGTWFALRGLAASGKTYNNCQVVRKAVNFLLTTQQKDGGW  656

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE  +SCP M+YIPLEG  +NLV T+WAM+GL+++GQA+RDPTPLH AAKLLIN+Q+E+G
Sbjct  657   GESYRSCPEMKYIPLEGNRSNLVHTAWAMMGLIHSGQAKRDPTPLHCAAKLLINSQLENG  716

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+I GV+ KN MLH+AS+RS +PL AL+EYRK+V
Sbjct  717   DFPQQEIAGVFFKNGMLHFASYRSIYPLWALAEYRKQV  754



>ref|XP_006409183.1| hypothetical protein EUTSA_v10022563mg [Eutrema salsugineum]
 gb|ESQ50636.1| hypothetical protein EUTSA_v10022563mg [Eutrema salsugineum]
Length=771

 Score =   918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/757 (55%), Positives = 559/757 (74%), Gaps = 7/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLK GEG G  PY++S+NN+ GRQIWE+DP AGTPEE+ A E+AR+ F   R +    
Sbjct  1     MWKLKTGEGNGEDPYLFSSNNFTGRQIWEFDPKAGTPEERAAVEEARRSFYDNRSR-VKA  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ +KE++ + + IPPV+  + E + Y   T A+R+ V    ALQ+ DGHWPA
Sbjct  60    SSDLLWRMQFLKEAKFEQV-IPPVKFDDGESITYVKTTNALRRGVAFFSALQSSDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +GPLFF PPL+  LYI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+  S M  
Sbjct  119   EIAGPLFFLPPLVFCLYITGHLEEVFDAEHRKEILRYIYCHQNEDGGWGLHIESKSVMFS  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ LR+LG G D G + +  R R+WIL+HGG T IPSWGK++LS+LG+Y+W G NP
Sbjct  179   TALNYICLRMLGVGLDGGRENSCKRAREWILNHGGVTYIPSWGKVWLSILGIYDWSGTNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PE WL PS  P H  K+ CY R  YMPMSYLY KR+ GP+T +++ LR E+H++ YE+
Sbjct  239   MPPEMWLLPSFLPLHLGKLLCYTRMVYMPMSYLYGKRFVGPVTPLIMQLREELHLQPYEE  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+WN+AR  C KED YYPH  +QDL+W+ L    EPF+ RWP  K +RE A+R A+ ++ 
Sbjct  299   INWNKARRLCGKEDTYYPHPLVQDLIWDTLHMFVEPFLTRWPLNKLVREKALRVAMNHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E + YITIGCIEK L M+  W E+P GD  K HL+R+ DY+W+AEDG+ M  FGSQ 
Sbjct  359   YEDENSHYITIGCIEKVLCMLACWVENPVGDHFKKHLSRLSDYMWVAEDGLKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             W+  FA QA++AS + +E  + LR+ H YIK SQV+ENP GDFK+M+RH++KG+WTFSD+
Sbjct  419   WETGFAIQALLASDLGDETYEVLRRGHTYIKRSQVRENPSGDFKTMHRHISKGAWTFSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC +LL  MP  ++G+K D + LY++V++ L LQS E+GG   WEP
Sbjct  479   DHGWQVSDCTAEALKCCMLLSMMPADLVGQKIDPEHLYDSVNLLLSLQS-ENGGLTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP++ FA+++VE E +E T ++I A V F+  YP++R KEV  SI KAVQ
Sbjct  538   ASAPEWLELLNPTDFFANVMVEGECVECTSAVIQAFVMFKQLYPDHREKEVIKSIKKAVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             ++E +Q  DGSWYG WG+CF+YGT+FAL GL A GK+Y NC ++CN   F L+ QN++GG
Sbjct  598   FIESKQMPDGSWYGNWGICFIYGTWFALSGLAAIGKTYNNCLSICNGVDFLLTIQNEDGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYIPLE  G+N+VQT+WAM+GL++ GQAERD  PLHRAAK +I +QME+
Sbjct  658   WGESYLSCPEQRYIPLERNGSNIVQTAWAMMGLIHGGQAERDFIPLHRAAKFIITSQMEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             GDFPQQ++TG +M NCMLHYA++R+ FPL AL+EYRK
Sbjct  718   GDFPQQEMTGAFMNNCMLHYATYRNTFPLWALAEYRK  754



>ref|XP_010472735.1| PREDICTED: amyrin synthase LUP2 isoform X2 [Camelina sativa]
Length=760

 Score =   918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/761 (55%), Positives = 561/761 (74%), Gaps = 10/761 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LKIGEG G  PY++S+NN+ GRQ WE+DP AGTPEE+ A E+AR+ F   R +    
Sbjct  1     MWRLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTPEERAAVEEARRKFVDNRSR-VKG  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             C DL  RMQ +KE++ + + IPPV++ + E + ++  T A+R+ V    ALQA DGHWP 
Sbjct  60    CSDLLWRMQFLKEAKFEQV-IPPVKIDDGEGITHQNATDALRRGVSFFSALQASDGHWPG  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +GPLFF PPL+  LYI+G ++ +  +EH+KE++R++Y HQNEDGGWGL+I+  S M  
Sbjct  119   EITGPLFFLPPLVFCLYITGHLEKVFDAEHRKEMLRHIYCHQNEDGGWGLHIESKSMMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ LRLLGEGPD G D A  R R WILD GG T IPSWGKI+LS+LG+Y+W G NP
Sbjct  179   TALNYICLRLLGEGPDGGRDNACKRARDWILDRGGVTYIPSWGKIWLSILGIYDWSGTNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PE WL PS  P H  K+ CYCR  YMPMSYLY KR+ GP+T ++L LR E+H++ Y+ 
Sbjct  239   MPPEIWLLPSFLPIHLGKVLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPYKS  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+WN++R    KED+Y+PH  +QDL+W+AL    EPF+ RWP  K +RE A+R+A+K++ 
Sbjct  299   INWNKSRRLYAKEDMYFPHPLVQDLVWDALYVFVEPFLTRWPLNKLVREKALRRAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E + YITIGC+EK L M+  W E+PNGD  K HLAR+PDY+W+AEDGM M  FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QAI+AS + +E G C   V    +  Q++ENP GD++SMYRH++KG+WT SD+
Sbjct  419   WDTGFAVQAILASDLSDETGGC---VFLNQRTLQIRENPSGDYESMYRHISKGAWTLSDR  475

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE  KC LLL  MP +++G+K D ++LY++V++ L  QS + GG   WEP
Sbjct  476   DHGWQVSDCTAEAFKCCLLLSMMPAEVVGQKMDPEQLYDSVNLLLSFQS-DKGGMTAWEP  534

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  ++++LNP+E  A++VVE E++E T S++ ALV F+  YP+++ KE++ SI KAVQ
Sbjct  535   VRAYEWIELLNPTEFLANLVVEREYVECTSSVMKALVLFKQLYPDHKTKEISRSIEKAVQ  594

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             +LE +Q  DGSWYG+WGVCF+Y T+F L GL AAGK+Y+N +A+     F L+ Q  +GG
Sbjct  595   FLENEQRPDGSWYGFWGVCFIYATWFGLGGLAAAGKTYQNSQAIRKGVEFLLTTQKDDGG  654

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYIP EG  +NLVQT+WA++GL+  GQAERDP PLHRAAKL+IN+QME+
Sbjct  655   WGESYLSCPEQRYIPSEGKSSNLVQTAWAIMGLINAGQAERDPIPLHRAAKLIINSQMEN  714

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVWT  153
             GDFPQQ+I GV+MKNC+ HYA++R+ FPL AL+EYRK V+ 
Sbjct  715   GDFPQQEIVGVFMKNCLTHYATYRNTFPLWALAEYRKAVFV  755



>ref|XP_002889222.1| hypothetical protein ARALYDRAFT_316793 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65481.1| hypothetical protein ARALYDRAFT_316793 [Arabidopsis lyrata subsp. 
lyrata]
Length=1556

 Score =   918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/759 (57%), Positives = 555/759 (73%), Gaps = 7/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLKI  G    PY++STNN+ GRQ WE+DP+AG  EE  A E+AR+ +   R +    
Sbjct  1     MWKLKIANGNKEEPYLFSTNNFLGRQTWEFDPDAGIAEELAAVEEARRKYFDDRFQ-VKA  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ +KE + + + IPPV++ +  ++  E  T A+R+ V    ALQA DGHWPA
Sbjct  60    SSDLIWRMQFLKEKKFEQV-IPPVKVEDANKITSEIATNALRRGVNFLSALQATDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL+  L+++G +  I T EH++E++RY+Y HQNEDGGWGL+I+G STM  
Sbjct  119   ENAGPLFFLPPLVFCLFVTGHLHEIFTQEHRREILRYIYCHQNEDGGWGLHIEGDSTMFC  178

Query  1889  SALNYVALRLLGEGPDDGDG-AIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNY+ +R+LGE P  G G A  R R WILDHGGAT IPSWGK +LS+LGV++W G NP
Sbjct  179   TTLNYICMRILGESPFGGPGNACRRARDWILDHGGATYIPSWGKTWLSILGVFDWSGSNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP++ ++L LR EI+++ Y +
Sbjct  239   MPPEFWILPSFLPIHPAKMWCYCRLVYMPMSYLYGKRFVGPISPLILQLREEIYLQPYAK  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYMR  1356
             I+WN+AR  C KED Y PH  IQD++W+ L   TEPF+  WPF K+ RE A+  A+K++ 
Sbjct  299   INWNRARHLCAKEDAYCPHPQIQDVIWDCLYIFTEPFLTCWPFNKLLREKALGVAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK+L M+  W EDPNG   K HL R+ DYLW+AEDGM M  FGSQ 
Sbjct  359   YEDENSRYITIGCVEKALCMLACWVEDPNGSHFKKHLLRISDYLWIAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD+ FA QA++AS +  E  D LR+ + ++K SQV+ENP GDF +M+RH++KGSWTFSD+
Sbjct  419   WDSGFALQALVASDLANEIPDVLRRGYDFLKNSQVRENPSGDFTNMFRHISKGSWTFSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW  SDCTAE  KC LLL  MP  I+G K D ++LYEAV + L LQS ++GG   WEP
Sbjct  479   DHGWQASDCTAEGFKCCLLLSMMPPDIVGPKMDPEQLYEAVTILLSLQS-KNGGVTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP+E+FADIVVE E+ E T S I AL+ F+  YPN+R  E+N SI KAVQ
Sbjct  538   ARGQEWLELLNPTEVFADIVVEHEYNECTSSAIQALILFKQLYPNHRTAEINTSIKKAVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             Y+E  Q  DGSWYG WGVCF Y T+F L GL AAGK+Y NC A+    HF L+ Q   GG
Sbjct  598   YIESIQMHDGSWYGSWGVCFTYSTWFGLGGLAAAGKTYNNCLAMRKGVHFLLTTQKDNGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYIP EG  +NLVQTSWAM+GL++ GQAERDP PLHRAAKLLIN+Q+E+
Sbjct  658   WGESYLSCPKKRYIPSEGDRSNLVQTSWAMMGLLHAGQAERDPAPLHRAAKLLINSQLEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITG +MKNC+LHYA++R+ FP+ AL+EYR+RV
Sbjct  718   GDFPQQEITGAFMKNCLLHYAAYRNIFPVWALAEYRRRV  756


 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/782 (54%), Positives = 550/782 (70%), Gaps = 29/782 (4%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LKIGEG G  PY+++TNN+ GRQ WE+DP+AG+PEE+ A  +AR+ F   R      
Sbjct  774   MWRLKIGEGSGDDPYLFTTNNFVGRQTWEFDPDAGSPEERYAVVEARQSFYDNRFH-VKA  832

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ +KE + + + I PV++   E+V +E  T A+R+ V    ALQA DGHWPA
Sbjct  833   SSDLLWRMQFLKEKKFEQV-IAPVKVEGSEKVTFETATNALRRGVHFFSALQASDGHWPA  891

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL+  LYI+G +D + T EH+KE++RY+Y HQ EDGGWGL+I+GHSTM  
Sbjct  892   ENAGPLFFLPPLVFCLYITGHLDEVFTLEHRKEILRYIYCHQKEDGGWGLHIEGHSTMFC  951

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ +R+LGE P  G + A  R R+WIL HGG T IPSWGK +LS+LGV++W G NP
Sbjct  952   TALNYICMRILGESPVGGHENACRRAREWILSHGGVTYIPSWGKTWLSILGVFDWSGSNP  1011

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS FP HPAKMWCYCR  Y+PMSYLY KR+ GP+T ++L LR E++++ YE+
Sbjct  1012  MPPEFWILPSFFPVHPAKMWCYCRMVYLPMSYLYGKRFVGPITSLILQLRKELYLQPYEE  1071

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W + R  C KED YYP   +Q+L+W++L    EPF+ RWPF K +R+ A++  +K++ 
Sbjct  1072  INWMKVRHLCAKEDTYYPRPLVQELIWDSLYIFAEPFLGRWPFNKFLRQKALQVTMKHIH  1131

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDPNG+  K HLAR+ DYLW+AEDGM M  FGSQ 
Sbjct  1132  YEDENSRYITIGCVEKVLCMLACWVEDPNGNYFKKHLARISDYLWVAEDGMKMQSFGSQL  1191

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS +  E  D LR+ H +IK+SQV ENP GDF+SMYRH++KG+WTFSD+
Sbjct  1192  WDTGFALQALLASNLSSEISDVLRRGHEFIKDSQVGENPSGDFRSMYRHISKGAWTFSDR  1251

Query  995   DHGWAVSDCTAETLKC--------LLLLGEMPHKIIG---EKPDVQRLYEAVDVCLYLQ-  852
             DHGW VSDCTA+ LK         L LL  +     G    K D +RLY++V++ L LQ 
Sbjct  1252  DHGWQVSDCTADGLKVIQPFKPNTLTLLPAVLDAGTGYCCPKQDPERLYDSVNILLTLQV  1311

Query  851   -----------SPESGGFATWEPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALV  705
                          ++GG + WEP     +L++LNP+E+F+DIV+E E+ E T S I AL 
Sbjct  1312  SIIGRDSFTCFQSKNGGVSAWEPAGAPEWLELLNPTELFSDIVIEHEYSECTSSAIQALS  1371

Query  704   AFRCHYPNYRPKEVNISIAKAVQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKS  525
              F+  +P++R  E+   I KAV YLE  Q  DGSWYG WG+CF YGT+FAL GLTAAGK+
Sbjct  1372  LFKQLFPHHRTTEITTFINKAVHYLESMQTPDGSWYGNWGICFTYGTWFALAGLTAAGKT  1431

Query  524   YENCEAVCNAAHFFLSKQNQEGGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTG  345
             Y +CEA+     F L  Q   GGWGE   SC    YI  EG  +N+VQT+WA++GL+++G
Sbjct  1432  YNDCEAIRKGVQFLLGAQKDNGGWGESYLSCSKKIYIAKEGEMSNVVQTAWALMGLIHSG  1491

Query  344   QAERDPTPLHRAAKLLINAQMEDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             QAERDP PLHR AKL+IN+Q+E GDFPQQ  TGV++KNC LHYAS+R+  PL AL+EYR 
Sbjct  1492  QAERDPVPLHRGAKLIINSQLESGDFPQQQATGVFLKNCTLHYASYRNIHPLWALAEYRA  1551

Query  164   RV  159
             RV
Sbjct  1552  RV  1553



>ref|XP_002271333.1| PREDICTED: beta-Amyrin Synthase 1 isoform X1 [Vitis vinifera]
 ref|XP_010655244.1| PREDICTED: beta-Amyrin Synthase 1 isoform X1 [Vitis vinifera]
 ref|XP_010655245.1| PREDICTED: beta-Amyrin Synthase 1 isoform X1 [Vitis vinifera]
 ref|XP_010655246.1| PREDICTED: beta-Amyrin Synthase 1 isoform X1 [Vitis vinifera]
Length=769

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/754 (57%), Positives = 554/754 (73%), Gaps = 7/754 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   E AR+ F K R Q  P +
Sbjct  1     MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAARENFWKNRFQVKPSS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E      +IP V++ + EE+  E  TTAVR+      ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-TIPQVKVGDGEEIAEETATTAVRRGAHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E+SGPLFF PPL++ LYI+G +D +   E++KE++RYLY HQNEDGGWGL+I+ HS M  
Sbjct  118   EHSGPLFFLPPLVMCLYITGHLDTVFPGEYRKEILRYLYCHQNEDGGWGLHIEEHSIMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + L+YV +R+LGEG D G D A ARGRKWIL+ GG T IP+WGKI+LS+ G+++W G NP
Sbjct  178   TTLSYVCMRILGEGRDGGRDNACARGRKWILNRGGVTSIPTWGKIWLSIFGLFDWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEF LFPS+ P +PAK+WCY R  +MPMSYLY KR+ GP+T +VL LR E+ ++ Y +
Sbjct  238   MPPEFSLFPSHLPMNPAKIWCYSRLIFMPMSYLYGKRFVGPITPLVLELREELFLQPYNE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I+W + R  C KEDLYYPH  IQD++W++L  CTEP + RWPF K+R+ A+   +K++ Y
Sbjct  298   INWKKVRHLCAKEDLYYPHPLIQDMMWDSLYICTEPLLTRWPFNKLRKKALEVTMKHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDY+W+ EDG+ M  FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLSCWVEDPNGDYFKKHLARIPDYIWVGEDGIKMQTFGSQEW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D + A QA++A  M  E G  L+K H ++KESQVK+NP GDFKSMYRH++KGSWTFSD+D
Sbjct  418   DTSLALQALLACNMTNEIGPTLKKGHEFLKESQVKDNPSGDFKSMYRHISKGSWTFSDKD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LL   M  +I+G K +  RL+++V++ L LQS E+GG   WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSMMAPEIVGMKIEPGRLFDSVNILLSLQS-ENGGIVGWEPA  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNPSE+F D+V+E E++E T S I ALV F+  YP +R +E++  I  A +Y
Sbjct  537   GASEWLELLNPSEMFEDLVIEHEYVECTASAIQALVLFKKLYPEHRTEEIDNFITNATKY  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E QQ  DGSWYG WGVCF+Y +++AL GL AAGK+Y NC A+  A  F L  Q  +GGW
Sbjct  597   IEDQQMPDGSWYGKWGVCFIYSSWWALGGLAAAGKTYHNCLAIGRAVEFLLKSQRDDGGW  656

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SC   +Y PLEG  +NLVQT WA++GL+ +GQAERDPTPLHRAAKLLIN+QMEDG
Sbjct  657   GESYISCRDKKYTPLEGNKSNLVQTGWALMGLLSSGQAERDPTPLHRAAKLLINSQMEDG  716

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEY  171
             DFPQQ+ITG +M NCMLH A +R+ FPL AL+EY
Sbjct  717   DFPQQEITGAFMNNCMLHCADYRNIFPLWALAEY  750



>ref|XP_011006636.1| PREDICTED: beta-amyrin synthase-like [Populus euphratica]
Length=758

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/756 (57%), Positives = 568/756 (75%), Gaps = 4/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MW+L++ +G GP+++STNN+ GRQIW++ PN GTPEE    E+AR+ F   R +      
Sbjct  1     MWELEVADGDGPWLFSTNNFVGRQIWKFKPNVGTPEEHARVERAREQFRLNRSRC-KASS  59

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             D+    Q+I+E+++D LSIP VRL + EE+  E   TA+RKA+R   A+QA DGHWPAE 
Sbjct  60    DVLKNFQLIQENQID-LSIPAVRLGDGEEITVEKAETALRKALRFTSAIQASDGHWPAEF  118

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             SGPLF TPPL++ +Y+SGS++ +L+S+HKKE++RY+YNHQNEDGGWG +++GHSTM+G+A
Sbjct  119   SGPLFLTPPLIMVVYLSGSLNTVLSSDHKKEIIRYIYNHQNEDGGWGFHVEGHSTMMGTA  178

Query  1883  LNYVALRLLGEGPDDGDGAIAR-GRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             LNYVALRLLGEGP+ G     R  RKWILDHGG T +PSWGK+YLSVLG YEW GCNP+ 
Sbjct  179   LNYVALRLLGEGPEGGGDGDLRKARKWILDHGGVTMLPSWGKLYLSVLGTYEWSGCNPVP  238

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEF LFPS  PF P K+WC+ RT Y PM+YLY K++ GP+TD++L LR+E++ + YE++D
Sbjct  239   PEFLLFPSFLPFSPGKLWCHLRTVYTPMAYLYGKKFVGPITDLILQLRDELYNQPYEEVD  298

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+AR  C +EDLY   S  ++L+++ + Y +E  +R+WPF K+RE A+++A+K + YE 
Sbjct  299   WNKARHLCLREDLYTSPSLAKNLIFDGVHYLSERVLRQWPFSKLREQALQEAMKLIHYED  358

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E TRY+T   IEKSL MM  WAEDP  D  K+HLARVPD LWLAEDGM M   GSQ WDA
Sbjct  359   ENTRYMTHASIEKSLNMMACWAEDPTSDAFKFHLARVPDVLWLAEDGMKMQSIGSQLWDA  418

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
             AFATQA+IAS +V+EYG  LR+ H ++K+SQ++ N  GDF+ M+RH++KG+WT S +DHG
Sbjct  419   AFATQAVIASKLVDEYGSTLRRAHEFLKQSQIQANASGDFRRMHRHISKGAWTLSIKDHG  478

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE L+ LLLL +MP +I+GE  D +RLY A+D  L LQS ++GGF+ WEP   
Sbjct  479   WQVSDCTAEALRALLLLSQMPTEIVGEPIDTERLYNAIDFLLSLQS-KNGGFSVWEPARG  537

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
             Q +L+VLNP+E F D++VE E++E T S I ALV F+  +P YR KE+  S+AKA  Y+E
Sbjct  538   QRWLEVLNPTEAFGDMMVETEYVECTASAIQALVLFKRLHPGYRRKEIEASVAKASSYIE  597

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
               Q SDGSWYG WG+C+ YGT+FAL GL + GK+Y N   V  A  F LSKQ+  GGWGE
Sbjct  598   DAQMSDGSWYGNWGICYSYGTYFALKGLASVGKTYRNSTTVQKACEFLLSKQHNSGGWGE  657

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                SC ++ Y  +EG  +N+VQT+WAM+GL++ GQAERDP PLH+AA+LLIN+QME+G+F
Sbjct  658   SYLSCATLEYTEIEGNKSNVVQTAWAMMGLIHAGQAERDPAPLHQAARLLINSQMENGEF  717

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PQQ ITG  +K CMLHYAS ++ FPL AL EY K V
Sbjct  718   PQQQITGASLKTCMLHYASFKNIFPLWALGEYLKCV  753



>ref|XP_006301366.1| hypothetical protein CARUB_v10021777mg [Capsella rubella]
 gb|EOA34264.1| hypothetical protein CARUB_v10021777mg [Capsella rubella]
Length=761

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/758 (55%), Positives = 561/758 (74%), Gaps = 8/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG---PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2253
             MW+LKIGEG G   PY++S+NN+ GRQ WE++P AGTPEE+ A E+AR+ F   R +   
Sbjct  1     MWRLKIGEGNGEEDPYLFSSNNFVGRQTWEFNPKAGTPEERAAVEEARRKFLDNRSR-VK  59

Query  2252  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2073
              C D   RMQ +KE++ + + IPPV++ + E V++E  T A+R+ V    ALQA DGHWP
Sbjct  60    GCSDFLWRMQFLKEAKFEQV-IPPVKIDDGEGVSHENATDALRRGVSFFSALQASDGHWP  118

Query  2072  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  1893
              E SGPLFF PPL+  LYI+G +D +  ++H+KE++RY+Y HQNEDGGWGL+I+G S M 
Sbjct  119   GEFSGPLFFLPPLVFCLYITGHLDKVFDADHRKEMLRYIYCHQNEDGGWGLHIEGKSVMF  178

Query  1892  GSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              +ALNY+ LR+LGEGPD G D A  R R+WILD GG T IPSWGK++LS+LG+Y+W G N
Sbjct  179   CTALNYICLRMLGEGPDGGQDNACKRARQWILDRGGVTYIPSWGKMWLSILGIYDWSGTN  238

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             P+ PE WL PS  P H  K  CY R  YMP+SYLY KR+ GPLT +++ LR E+H++ YE
Sbjct  239   PMPPEIWLLPSFLPLHIGKFLCYTRMVYMPVSYLYGKRFVGPLTPLIMLLRGELHLQPYE  298

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYM  1359
             +I+WN+AR    KED++YPH  +QDL+W+ L    EP + RWP  K +RE A+  A++++
Sbjct  299   KINWNKARRLYAKEDMFYPHPLVQDLIWDTLHIFVEPLLTRWPLNKLVREKALCVAMEHI  358

Query  1358  RYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQ  1179
              YE E + YITIGC+EK L M+  W E PNGD  K HLAR+PD++W+AEDG+ M  FGSQ
Sbjct  359   HYEDENSHYITIGCVEKVLCMLACWIEHPNGDHFKKHLARIPDFMWVAEDGLKMQSFGSQ  418

Query  1178  NWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSD  999
              W+  FA QAI+AS + +E  D LRK H YIK+SQV+ENP GD+KSMYRH++KG+WT SD
Sbjct  419   LWETGFAMQAILASDLCDETDDVLRKGHSYIKKSQVRENPSGDYKSMYRHISKGAWTLSD  478

Query  998   QDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWE  819
             +DHGW VSDCTAE  KC +LL  MP +++G+K D + LY++V++ L LQS  +GG   WE
Sbjct  479   RDHGWQVSDCTAEAFKCCMLLSMMPAEVVGQKLDPEYLYDSVNLLLSLQS-GNGGLTAWE  537

Query  818   PPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAV  639
             P     +L++LNP++IFAD++ E E++E T ++I ALV F+  YP++R +E+ +SI K V
Sbjct  538   PVRAHEWLELLNPTDIFADVMAEREYVECTSAVIQALVLFKKLYPDHRTEEIIMSIEKGV  597

Query  638   QYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEG  459
             Q+LE +Q  DGSWYG WG+CF+Y T+FAL GL A GK+Y++C A+     F L+ Q ++G
Sbjct  598   QFLESKQMPDGSWYGNWGICFIYATWFALSGLAAVGKTYKSCLAMRKGVDFLLTIQKEDG  657

Query  458   GWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQME  279
             GWGE   SCP  RYIPLEG+ +NLVQT+WAM+GL++ GQAERDP PLHRAAKL+I +Q+E
Sbjct  658   GWGESYLSCPEQRYIPLEGSKSNLVQTAWAMMGLIHAGQAERDPIPLHRAAKLIITSQLE  717

Query  278   DGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             +GDFPQQ+I G +M  C+LHYA++R+ FPL AL+EYRK
Sbjct  718   NGDFPQQEIVGAFMNTCLLHYATYRNTFPLWALAEYRK  755



>ref|XP_010669609.1| PREDICTED: lupeol synthase-like [Beta vulgaris subsp. vulgaris]
Length=762

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/755 (56%), Positives = 555/755 (74%), Gaps = 6/755 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI +G  P++ STNN+ GRQ WE+DP AGTPEE+   EK R+ F K R K   +  
Sbjct  1     MWKLKIAQGEDPWLVSTNNHVGRQHWEFDPVAGTPEERAEVEKVREEFKKNRLKKKQS-D  59

Query  2243  DLFMRMQMIKESEVDVLSIPP-VRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             DL MRMQ+ +E+    L++P  + L+E+E++  +A+   V++A+     +QA DGHWPAE
Sbjct  60    DLLMRMQLRREN--PSLAMPQGITLKEKEDITEKAVNMTVKRAINFFSTIQAHDGHWPAE  117

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             ++GPLFF PPL+IAL+I+G+ + IL+ +H+KE+ RY+YNHQNEDGGWGL+I+GHSTM GS
Sbjct  118   SAGPLFFLPPLVIALHITGATNTILSPQHQKEIKRYIYNHQNEDGGWGLHIEGHSTMFGS  177

Query  1886  ALNYVALRLLGEGPDDGDG-AIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              ++Y+ALRLLGEGPDDG+  A+ RGR+WILDHGGAT IPSWGK +L+VLGVYEWDGCNP+
Sbjct  178   IISYIALRLLGEGPDDGEANAVTRGRQWILDHGGATGIPSWGKFWLTVLGVYEWDGCNPM  237

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFWL P   P HP KM CYCR  YMPMSYLY KR+ GP+T ++L+LR E++++ Y +I
Sbjct  238   PPEFWLLPKISPMHPGKMLCYCRLVYMPMSYLYGKRFVGPITSLILSLRRELYIQPYNEI  297

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
             +WN AR +C KEDLYYPH  +QD++W  L + TEP + RWPF K+RE +M+ A++++ YE
Sbjct  298   NWNNARNSCAKEDLYYPHPLMQDMVWGFLHHFTEPILNRWPFSKLREKSMKIAMEHVHYE  357

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
                +RY+ IGC+EK L ++  W ED N +  K HLAR+PDY WLAEDGM M  FGSQ WD
Sbjct  358   DVASRYLCIGCVEKVLCLLACWVEDSNSEAYKRHLARIPDYFWLAEDGMKMQSFGSQMWD  417

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
             AAF  QAI ASG+++EY   L+K H ++K SQVKENP G+FK MYRH++KG+WTFS QDH
Sbjct  418   AAFGIQAIFASGLIQEYAPTLKKAHDFVKASQVKENPSGNFKEMYRHISKGAWTFSIQDH  477

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LK  LL   MP + +GEK D + LY+AV+V L LQS E+GGF  WEP  
Sbjct  478   GWQVSDCTAEGLKTALLYSSMPTEFVGEKMDAECLYDAVNVTLSLQS-ENGGFPAWEPQR  536

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +++  NP+E F D+++E E++E T S I  L  F+  YP +R KE+ + IAK + Y+
Sbjct  537   AFRWIEKFNPTEFFEDVLIEREYVECTSSAIQGLTLFKELYPGHRKKEIEMCIAKGLDYI  596

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E+ Q  DGSWYG WG+C+ YGT+F +  L A  K++ N  A+  A HF +SKQ  +GGWG
Sbjct  597   EETQNPDGSWYGCWGICYTYGTWFGVEALVACRKNFYNSLALRKACHFLISKQLPDGGWG  656

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   S P+  Y  LEG  +NLVQTSWA+L LM  G    DPTP+ R  ++LIN+QMEDGD
Sbjct  657   ENYLSSPNKVYTNLEGNKSNLVQTSWALLSLMKAGFGHVDPTPIERGIRVLINSQMEDGD  716

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             FPQQ+ITGV+MKNC L+Y+S+R+ FP+ AL EYR+
Sbjct  717   FPQQEITGVFMKNCTLNYSSYRNIFPIWALGEYRR  751



>dbj|BAA86930.1| lupeol synthase [Olea europaea]
Length=758

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/757 (55%), Positives = 555/757 (73%), Gaps = 6/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI +G GP++ +TNN+ GRQ WE+DP AGTP+E+   E+ R+ F K R +   +  
Sbjct  1     MWKLKIADGTGPWLTTTNNHIGRQHWEFDPEAGTPDERVEVERLREEFKKNRFRTKQS-A  59

Query  2243  DLFMRMQMIKESEVDVLSIPP-VRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             DL MRMQ++KE++   + IPP ++++E E +  EA+ T +R+A+     +QA DGHWPAE
Sbjct  60    DLLMRMQLVKENQR--VQIPPAIKIKETEGITEEAVITTLRRAISFYSTIQAHDGHWPAE  117

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             ++GPLFF PPL++ALY++G+I+++L+ EH+KE+ RY+YNHQNEDGGWG++I+GHSTM GS
Sbjct  118   SAGPLFFLPPLVLALYVTGAINVVLSREHQKEITRYIYNHQNEDGGWGIHIEGHSTMFGS  177

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              L+Y+ LRLLGEG +DG D A+ARGRKWILDHGGA  IPSWGK +L+VLGVYEWDGCNP+
Sbjct  178   VLSYITLRLLGEGQEDGEDKAVARGRKWILDHGGAVGIPSWGKFWLTVLGVYEWDGCNPM  237

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFWL P+  P HP KM CYCR  YMPMSYLY KR+ GP+T +VL+LR EI+ + Y  I
Sbjct  238   PPEFWLLPNFSPIHPGKMLCYCRLVYMPMSYLYGKRFVGPITGLVLSLRQEIYTEPYHGI  297

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
             +WN+AR  C KEDLYYPH   QD+LW  L +  EP + RWPF K+RE A++ A++++ YE
Sbjct  298   NWNRARNTCAKEDLYYPHPLAQDMLWGFLHHFAEPVLTRWPFSKLREKALKVAMEHVHYE  357

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
                +RY+ IGC+EK L ++  W EDPN +  K H+AR+PDY W+AEDG+ M  FG Q WD
Sbjct  358   DMNSRYLCIGCVEKVLCLIACWVEDPNSEAYKRHIARIPDYFWVAEDGLKMQSFGCQMWD  417

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
             AAFA QAI++S + EEYG  L K H ++K SQV+ENP GDF  MYRH +KG+WTFS QDH
Sbjct  418   AAFAIQAILSSNLAEEYGPTLMKAHNFVKASQVQENPSGDFNEMYRHTSKGAWTFSMQDH  477

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LK  LL  +MP +++G + +   LY+AV+V L LQS  SGGF  WEP  
Sbjct  478   GWQVSDCTAEGLKAALLFSQMPIELVGAEIETGHLYDAVNVILTLQSA-SGGFPAWEPQK  536

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +L+ LNP+E F D+++E +++E T S + AL  F+  +P +R KE+   I+KA+QY+
Sbjct  537   AYRWLEKLNPTEFFEDVLIERDYVECTSSAVQALKLFKQLHPGHRRKEIASCISKAIQYI  596

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSW G WG+CF YGT+FA+ GL A GK+Y N   +  A  F LSKQ  +GGW 
Sbjct  597   EATQNPDGSWDGSWGICFTYGTWFAVEGLVACGKNYHNSPTLRRACEFLLSKQLPDGGWS  656

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   S  +  Y  LEG  +NLVQTSWA+L L+  GQ E DP P+HR  KLL+N+QMEDGD
Sbjct  657   ESYLSSSNKVYTNLEGNRSNLVQTSWALLSLIKAGQVEIDPGPIHRGIKLLVNSQMEDGD  716

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQ++ITG +MKNC L+Y+S+R+ FP+ AL EYR+R+
Sbjct  717   FPQEEITGAFMKNCTLNYSSYRNIFPIWALGEYRRRI  753



>ref|XP_006389936.1| hypothetical protein EUTSA_v10018166mg [Eutrema salsugineum]
 gb|ESQ27222.1| hypothetical protein EUTSA_v10018166mg [Eutrema salsugineum]
Length=765

 Score =   915 bits (2364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/761 (54%), Positives = 559/761 (73%), Gaps = 7/761 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LKIGEG G  PY++S+NN+ GRQ WE+DP AGTPEE+ A E+AR+GF   R +    
Sbjct  6     MWRLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTPEERAAVEEARRGFLANRSR-VKG  64

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             C DL  RMQ +KE++ + + IPPV++   E + YE  T A+R+ V    ALQA DGHWP 
Sbjct  65    CSDLLWRMQFLKEAKFEQV-IPPVKIDGGEGITYEKATNALRRGVSFFSALQASDGHWPG  123

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +GPLFF PPL+  LYI+G ++ +  +EH++E++R++Y HQNEDGGWGL+++  S M  
Sbjct  124   EITGPLFFLPPLVFCLYITGHLEKVFDAEHRREMLRHIYCHQNEDGGWGLHVESKSVMFC  183

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ LR+LGEGP+ G + A  R R+WILD GG T IPSWGK++LS+LG+Y+W G NP
Sbjct  184   TALNYICLRMLGEGPNGGRENACKRARQWILDRGGVTYIPSWGKVWLSILGIYDWSGTNP  243

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PE W  PS  P H  K  CY R  YMPMSYLY KR+ GPLT +++ LR E+H++ YE+
Sbjct  244   MPPEIWFLPSFIPIHLGKTLCYTRMVYMPMSYLYGKRFVGPLTPLIMLLRQELHLQPYEE  303

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+WN+AR    KED++YPH  +QDL+W+ L    EPF+  WP  K +RE A+R A+ ++ 
Sbjct  304   INWNKARRLFAKEDMFYPHPLVQDLIWDTLYIFVEPFLTSWPLNKLVREKALRLAMSHIH  363

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E + YITIGC+EK L M+  W E+PNG+  K HLAR+PDY+W+AEDG+ M  FGSQ 
Sbjct  364   YEDENSHYITIGCVEKVLCMLACWIENPNGEHFKKHLARIPDYMWVAEDGLKMQSFGSQL  423

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             W+  FA QA+IAS + ++  D LRK H YIK SQV ENP GDFKSMYRH++KG+WT SD+
Sbjct  424   WETGFAIQALIASDLCDKTDDVLRKGHSYIKSSQVIENPSGDFKSMYRHISKGAWTLSDR  483

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE +KC +LL  MP +++G+K D ++LY++V++ L LQ  E+GG   WEP
Sbjct  484   DHGWQVSDCTAEAMKCCMLLSMMPAEVVGQKIDPEQLYDSVNLMLSLQG-ENGGLTAWEP  542

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L+ LNP+E FA+++ E E++E T +++ ALV F+  YP++R KE+  SI KAV+
Sbjct  543   VRAHEWLEFLNPTEFFANVMAEREYVECTSAVLQALVLFKQLYPDHRTKEIIKSIEKAVR  602

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             ++E +Q  DGSWYG WG+CF+YGT+FAL GL AAGK+Y++C A+     F L  Q + GG
Sbjct  603   FIESKQTPDGSWYGNWGICFIYGTWFALSGLAAAGKTYKSCLAMRKGVDFLLRIQKENGG  662

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYI LEG G+NLVQT+WAM+GL++ GQAERDP PLHRAAK +I +Q+E+
Sbjct  663   WGESHMSCPEQRYIQLEGNGSNLVQTAWAMMGLIHAGQAERDPIPLHRAAKFIITSQLEN  722

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVWT  153
             GDFPQQ+I GV+M  CM+HYA++R+ FP+ AL+EYRK V+ 
Sbjct  723   GDFPQQEILGVFMNTCMIHYATYRNTFPIWALAEYRKAVFV  763



>ref|XP_011009936.1| PREDICTED: beta-amyrin synthase-like isoform X3 [Populus euphratica]
Length=728

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/725 (58%), Positives = 545/725 (75%), Gaps = 4/725 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKL++ EG GP+++STN + GRQIW ++PNA TPEEQ   E AR+ F   R       G
Sbjct  1     MWKLEVAEGDGPWLFSTNKFVGRQIWRFEPNAWTPEEQAQVEMAREKFRLNRFY-TKASG  59

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             D+    Q+IKE+++D L IPPVRL   EE++ E + TA+RKAVR   A+QA DGHWPAE 
Sbjct  60    DVLKNFQLIKENQID-LRIPPVRLGNGEEISREKVETALRKAVRFTSAIQASDGHWPAEF  118

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             SGPLF  PPL++ LY+S S+D +L++EHKKE++RY+YNHQNEDGGWG +I+ HSTM+G+A
Sbjct  119   SGPLFLMPPLIMVLYLSRSLDTVLSTEHKKEIIRYIYNHQNEDGGWGFHIESHSTMLGTA  178

Query  1883  LNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             LNYVALRLLGEGP+ G DGA  + RKW+LDHGGAT IP+WGK+YLSVLG YEW GCNP+ 
Sbjct  179   LNYVALRLLGEGPEGGRDGAATKARKWVLDHGGATMIPAWGKVYLSVLGTYEWSGCNPVP  238

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEF LFPS  PF P K+WC+ RT Y PMSYLY K++ GP+TD++L LR E++++ YE+ID
Sbjct  239   PEFLLFPSFLPFSPGKVWCHLRTVYTPMSYLYGKKFVGPITDLILQLRRELYIQPYEEID  298

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+AR  C KEDLY   S  Q+LL + + Y +E  +++WPF K+RE A+++AIK++ YE 
Sbjct  299   WNKARHLCLKEDLYTSRSIAQNLLLDGVHYLSERLLKQWPFSKLREQALQEAIKHIHYED  358

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E TRY+T   IEKSL MM  WAEDP  D  K+HLARVPD LWLAEDGM     GSQ WDA
Sbjct  359   ESTRYMTHASIEKSLNMMACWAEDPTSDAFKFHLARVPDILWLAEDGMKTQSIGSQLWDA  418

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
             AFATQAIIAS +V+EYG  LRK H ++K SQ++EN  GDF+SMYRH++KG+WT S +DHG
Sbjct  419   AFATQAIIASNLVDEYGSTLRKAHEFLKLSQIQENAYGDFRSMYRHISKGAWTLSVKDHG  478

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE L+ LLLL +MP +I+GE  D +RL+ A+D  L LQS ++GGF+ WEP   
Sbjct  479   WQVSDCTAEALRALLLLSQMPAEIVGETIDTERLHNAIDFLLSLQS-KNGGFSVWEPARG  537

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
             Q +L+VLNP++ F D++VE E++E T S I  LV F+  +P YR KE+ +S+A A  Y+E
Sbjct  538   QRWLEVLNPTQAFGDVMVETEYVECTASAIQVLVLFKSLHPGYRRKEIEVSVANASSYIE  597

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
               Q SDGSWYG WG+C+ YGT+FAL GL + GK+Y N   V  A  F LSKQ+  GGWGE
Sbjct  598   DAQMSDGSWYGNWGICYTYGTYFALKGLASVGKTYRNSRTVRKACEFLLSKQHNSGGWGE  657

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                SC + +Y   EG  +N+VQT+WAM+GL+Y GQAE+DP PLH+AA+LLIN+QME+G+F
Sbjct  658   SYLSCANSKYTETEGNKSNVVQTAWAMMGLIYAGQAEKDPAPLHQAARLLINSQMENGEF  717

Query  266   PQQDI  252
             PQQD 
Sbjct  718   PQQDF  722



>ref|XP_004251564.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Solanum lycopersicum]
Length=761

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/758 (57%), Positives = 553/758 (73%), Gaps = 7/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHT  2250
             MWKLKI +G    Y+YSTNNY GRQIWE+DPNAGT EEQ   E+AR+ +   R K  P++
Sbjct  1     MWKLKIAKGQDDRYLYSTNNYIGRQIWEFDPNAGTIEEQAKIEEARQHYWNNRYKVKPNS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E       I  V++ E EE+++E  T A+R+AV    ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-RIGAVKVEEGEEISHEIATIALRRAVHFFSALQATDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+G LFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGLLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDGD-GAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +AL+Y+ +R+LGEGPD G+  A AR RKWILDHG  T IPS GKI+LS+LG +EW G NP
Sbjct  178   TALSYICMRILGEGPDGGERNACARARKWILDHGSVTAIPSSGKIWLSILGAFEWLGTNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEF++ PS  P HPAKMWCY R  YMP+SYLY KR+ GP+T ++L LR E++ + Y +
Sbjct  238   IPPEFYILPSFLPMHPAKMWCYSRIFYMPLSYLYGKRFVGPITPLILQLREELYDQPYNE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I+W + R  C KEDLYYPH  +QDL+W+ L +  EP + RWPF K+R  A+   +K++ Y
Sbjct  298   INWKRVRHLCAKEDLYYPHPLVQDLMWDTLYFFYEPLLTRWPFNKLRNKALEVTMKHLHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYIT+ C+ K L M+  W EDPNG   K HLARVPDYLW+AEDGM M   GSQ+W
Sbjct  358   EDENSRYITVQCVNKVLCMLACWVEDPNGSYFKKHLARVPDYLWVAEDGMKMQNSGSQSW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D +FA QA++AS M +E  D LRK H +IK+SQVK+NP GDF+ MYRH++KGSWTFSDQD
Sbjct  418   DTSFAIQALLASEMNDEISDTLRKGHDFIKKSQVKDNPSGDFRGMYRHISKGSWTFSDQD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             +GW  SD TAE L+C L    MP K++GE  +  RLY++V+V L LQS ++GG A WEP 
Sbjct  478   YGWQSSDTTAEALRCCLFFSTMPSKLVGEAMEPARLYDSVNVILSLQS-KNGGLAAWEPA  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 YL++LNP+EIF D+V+E E++E TGS I ALV F+  YP +R  E++  I  AV+Y
Sbjct  537   GTSKYLELLNPTEIFEDVVIEHEYVECTGSSIQALVHFKKLYPGHRTTEIDNFIDNAVKY  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E  Q  DGSWYG+WGVCF Y ++FAL GL AAGKSY N  AV     F L +Q  +GGW
Sbjct  597   IENVQRPDGSWYGFWGVCFTYASWFALGGLAAAGKSYSNSAAVRKGVDFLLQRQRSDGGW  656

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP   Y  LE   +NLVQT+WA++GL+++GQA+RDP PLHRAA+LLIN+QMEDG
Sbjct  657   GESYHSCPDKVYRELETEHSNLVQTAWALMGLIHSGQADRDPKPLHRAARLLINSQMEDG  716

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+ITG +MKNCMLHYA+ R+ FPL  L+EYRK V
Sbjct  717   DFPQQEITGAFMKNCMLHYATFRNIFPLWGLAEYRKNV  754



>ref|XP_011009935.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Populus euphratica]
Length=747

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/723 (59%), Positives = 544/723 (75%), Gaps = 4/723 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKL++ EG GP+++STN + GRQIW ++PNA TPEEQ   E AR+ F   R       G
Sbjct  1     MWKLEVAEGDGPWLFSTNKFVGRQIWRFEPNAWTPEEQAQVEMAREKFRLNRFY-TKASG  59

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             D+    Q+IKE+++D L IPPVRL   EE++ E + TA+RKAVR   A+QA DGHWPAE 
Sbjct  60    DVLKNFQLIKENQID-LRIPPVRLGNGEEISREKVETALRKAVRFTSAIQASDGHWPAEF  118

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             SGPLF  PPL++ LY+S S+D +L++EHKKE++RY+YNHQNEDGGWG +I+ HSTM+G+A
Sbjct  119   SGPLFLMPPLIMVLYLSRSLDTVLSTEHKKEIIRYIYNHQNEDGGWGFHIESHSTMLGTA  178

Query  1883  LNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             LNYVALRLLGEGP+ G DGA  + RKW+LDHGGAT IP+WGK+YLSVLG YEW GCNP+ 
Sbjct  179   LNYVALRLLGEGPEGGRDGAATKARKWVLDHGGATMIPAWGKVYLSVLGTYEWSGCNPVP  238

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEF LFPS  PF P K+WC+ RT Y PMSYLY K++ GP+TD++L LR E++++ YE+ID
Sbjct  239   PEFLLFPSFLPFSPGKVWCHLRTVYTPMSYLYGKKFVGPITDLILQLRRELYIQPYEEID  298

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+AR  C KEDLY   S  Q+LL + + Y +E  +++WPF K+RE A+++AIK++ YE 
Sbjct  299   WNKARHLCLKEDLYTSRSIAQNLLLDGVHYLSERLLKQWPFSKLREQALQEAIKHIHYED  358

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E TRY+T   IEKSL MM  WAEDP  D  K+HLARVPD LWLAEDGM     GSQ WDA
Sbjct  359   ESTRYMTHASIEKSLNMMACWAEDPTSDAFKFHLARVPDILWLAEDGMKTQSIGSQLWDA  418

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
             AFATQAIIAS +V+EYG  LRK H ++K SQ++EN  GDF+SMYRH++KG+WT S +DHG
Sbjct  419   AFATQAIIASNLVDEYGSTLRKAHEFLKLSQIQENAYGDFRSMYRHISKGAWTLSVKDHG  478

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE L+ LLLL +MP +I+GE  D +RL+ A+D  L LQS ++GGF+ WEP   
Sbjct  479   WQVSDCTAEALRALLLLSQMPAEIVGETIDTERLHNAIDFLLSLQS-KNGGFSVWEPARG  537

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
             Q +L+VLNP++ F D++VE E++E T S I  LV F+  +P YR KE+ +S+A A  Y+E
Sbjct  538   QRWLEVLNPTQAFGDVMVETEYVECTASAIQVLVLFKSLHPGYRRKEIEVSVANASSYIE  597

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
               Q SDGSWYG WG+C+ YGT+FAL GL + GK+Y N   V  A  F LSKQ+  GGWGE
Sbjct  598   DAQMSDGSWYGNWGICYTYGTYFALKGLASVGKTYRNSRTVRKACEFLLSKQHNSGGWGE  657

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                SC + +Y   EG  +N+VQT+WAM+GL+Y GQAE+DP PLH+AA+LLIN+QME+G+F
Sbjct  658   SYLSCANSKYTETEGNKSNVVQTAWAMMGLIYAGQAEKDPAPLHQAARLLINSQMENGEF  717

Query  266   PQQ  258
             PQQ
Sbjct  718   PQQ  720



>ref|XP_004309763.1| PREDICTED: beta-amyrin synthase-like [Fragaria vesca subsp. vesca]
Length=765

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/762 (57%), Positives = 562/762 (74%), Gaps = 10/762 (1%)
 Frame = -3

Query  2423  MWKLKIGEG---GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2253
             MWKLK+ EG      Y+YSTNN+ GRQ WE+DP+AGT EE+   E AR  F   R +   
Sbjct  1     MWKLKVSEGEKDSSGYLYSTNNFVGRQTWEFDPDAGTAEERAEVEAARLHFHNNRHE-VK  59

Query  2252  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2073
               GDL  RMQ ++E +    +IPPV++ + E + +E  T A+R++V    ALQA DGHWP
Sbjct  60    PSGDLLWRMQFLREKKFKQ-TIPPVKVEDGEVITHEKTTDALRRSVHFLSALQASDGHWP  118

Query  2072  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGH-STM  1896
             AEN+GPLFF PPL++ ++I+G +  + + EH+KE++RY+Y HQNEDGGWGL+I+G  STM
Sbjct  119   AENAGPLFFLPPLVMVMHITGHLKSVFSEEHRKEILRYIYYHQNEDGGWGLHIEGRKSTM  178

Query  1895  IGSALNYVALRLLGEGPDDG--DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDG  1722
               +AL+Y+ +R+LGEGPDDG  D A  R RKWILDHGG T IPSWGK +LS+LG+++W G
Sbjct  179   FSTALSYIFMRILGEGPDDGGQDNACPRARKWILDHGGVTHIPSWGKTWLSILGLFDWSG  238

Query  1721  CNPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKS  1542
              NP+ PEFW+ PS FP HPAK+WCYCR TYMPMSYLY KR+ GP+T +++ LR E+  + 
Sbjct  239   SNPMPPEFWILPSFFPMHPAKIWCYCRMTYMPMSYLYGKRFVGPITPLIIQLREELFTQP  298

Query  1541  YEQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIK  1365
             Y +I+W +AR  C KED+YYPH +IQDLLW++L   TEP + RWPF K IRE A++  + 
Sbjct  299   YGEINWKKARHLCAKEDIYYPHPWIQDLLWDSLYIFTEPLLTRWPFNKLIREKALQVTMS  358

Query  1364  YMRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFG  1185
             ++ YE E +RYIT+GC+EK L M+  W EDPNGD  K HLAR+ DYLW+AEDGM M GFG
Sbjct  359   HIHYEDENSRYITMGCVEKVLCMLACWVEDPNGDYFKKHLARIRDYLWVAEDGMKMQGFG  418

Query  1184  SQNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTF  1005
             SQ WD + A QA++AS + +E G  L + H YIKESQVKENP GDFKSMYRH++KGSWTF
Sbjct  419   SQQWDTSLAIQALLASNLTDEIGPTLARGHDYIKESQVKENPSGDFKSMYRHISKGSWTF  478

Query  1004  SDQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFAT  825
             SDQDHGW +SD TAE LKC LLL  MP +I+GEK + + LY++V++ L LQS  +GGF  
Sbjct  479   SDQDHGWQISDGTAEGLKCCLLLSMMPSEIVGEKMEPECLYDSVNLLLSLQS-MNGGFPP  537

Query  824   WEPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAK  645
             WEP     +L++LNP+E  ADI++E EH E T S+I ALV F+  +P +R +E+  SI+ 
Sbjct  538   WEPARGAEWLELLNPAEFLADIMIEHEHGECTSSVIQALVMFKKLHPEHRKEEIEDSISI  597

Query  644   AVQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQ  465
             A+ YLE  Q SDGSWY  WGVCF YGT+FAL GL AAGK++  C A+ N   F L  Q +
Sbjct  598   ALHYLENIQMSDGSWYRDWGVCFTYGTWFALSGLAAAGKTFSTCAAMRNGVSFLLKVQRE  657

Query  464   EGGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQ  285
              GGWGE   SCP   Y+ LEG  +NLVQT+WAM+GL+  GQAERDP PLHRAAK +IN+Q
Sbjct  658   NGGWGESYLSCPQETYVHLEGNRSNLVQTAWAMMGLISAGQAERDPAPLHRAAKFIINSQ  717

Query  284   MEDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             +E+GDFPQQ+ITGV+ KNCM+H+A++R+ +P+ AL+EYR RV
Sbjct  718   LENGDFPQQEITGVFKKNCMMHFAAYRNIYPMWALAEYRNRV  759



>ref|XP_007023364.1| Beta-Amyrin Synthase [Theobroma cacao]
 gb|EOY25986.1| Beta-Amyrin Synthase [Theobroma cacao]
Length=761

 Score =   913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/757 (57%), Positives = 553/757 (73%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+L IGEGG  PYIYSTNNY GRQ WE+DPNAGTPEE+   E+ R+ +   R K     
Sbjct  1     MWRLTIGEGGNNPYIYSTNNYLGRQTWEFDPNAGTPEERAEVEEVRQNYYNNR-KHVRPS  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  ++Q +KE      +IPPV++++ EE+  E  T A+R+ V L  ALQA DGHWPAE
Sbjct  60    SDLLWQIQSLKEKNFKQ-TIPPVKIKDGEEITCETATAALRRGVHLLSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             NSGP+F+ PPL +ALYI+G ID + ++EH+KE++RY+Y HQNEDGGWGL+I+GHS M  +
Sbjct  119   NSGPMFYFPPLAMALYITGHIDTVFSAEHRKEILRYIYCHQNEDGGWGLHIEGHSIMFST  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             ALNY+ +RLLGEGPD G D A  R RKWILD GG T IPSWGK +LS+LG+++W GC+P+
Sbjct  179   ALNYICMRLLGEGPDGGQDNACKRARKWILDRGGVTTIPSWGKTWLSILGLFDWSGCHPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS FP HPAKMWCYCR TY+PMSYLY K++ GP+T ++L LR E+H++ Y +I
Sbjct  239   PPEFWVLPSYFPIHPAKMWCYCRITYLPMSYLYGKKFVGPITPLILQLREELHIEPYHKI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
             +W Q R  C +EDLYYPH+ +Q LLWN+L   TEP + RWP  K+RE A++K + ++ YE
Sbjct  299   NWRQKRHLCAEEDLYYPHTVLQMLLWNSLSTFTEPLLSRWPLNKLREKALQKTMDHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIG +EK L M+  W E+P GD  K HLAR+ DYLW+ EDGM M  FGSQ WD
Sbjct  359   DECSRYITIGGVEKPLCMLACWLENPTGDYFKKHLARIADYLWVGEDGMKMQSFGSQVWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
             ++FA QA++AS +  +    L K H ++K SQVK+NP GDFK M+RH++KGSWTFSDQDH
Sbjct  419   SSFALQALLASDLTNDIRPTLMKGHDFLKHSQVKDNPPGDFKRMFRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE+LKC L   +MP + +GEK + ++ Y+AV+V + LQS ++GGF+ WEP  
Sbjct  479   GWQVSDCTAESLKCCLYFSKMPPETVGEKMEPEKFYDAVNVIISLQS-QNGGFSGWEPAT  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +++ LNP E   D V+E E+ E T S I ALV F   YP +R KE    IAKAV +L
Sbjct  538   AGLWMEWLNPVEFLDDNVIEHEYTECTASAIQALVLFTESYPGHRGKETEKCIAKAVLFL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q+ DGSWYG WG+CF YGT+FAL GL AAGK+Y NC AV     F L  Q  +GGWG
Sbjct  598   ENVQKPDGSWYGSWGICFTYGTWFALGGLAAAGKNYNNCLAVRKGLDFLLETQTDDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP   Y PLEG  +NLV T+ A++GL++ GQA+RDP PLHRAAKLLIN+Q+ DGD
Sbjct  658   ESYLSCPKEVYTPLEGNRSNLVHTAMALMGLIHGGQAKRDPNPLHRAAKLLINSQLPDGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ++ GV+M NCMLHYAS+R+ FP  AL+EYRK V
Sbjct  718   FPQQEMMGVFMSNCMLHYASYRNTFPTWALAEYRKHV  754



>gb|AAX14716.1| beta-amyrin synthase [Aster sedifolius]
Length=761

 Score =   913 bits (2359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/757 (56%), Positives = 551/757 (73%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW++ I +GG  PY++STNNY GRQIWE+DPN GTPEE    E+AR  F   R K   T 
Sbjct  1     MWRMNIAKGGNDPYLFSTNNYVGRQIWEFDPNYGTPEELAEVEQARAEFWNNRHK-VKTS  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              D+  RMQ ++E      +IP V++ + EE+  E     +R+AV L  ALQA DGHWPAE
Sbjct  60    SDVLWRMQFLREKGFKQ-TIPQVKIEDGEEITDEKAKITLRRAVNLFSALQADDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GP +F  PL++ LY++G ++ + T E++KE++RY+Y HQNEDGGWG +I+GHS M  +
Sbjct  119   NAGPQYFMQPLVMCLYVTGHLNSVFTEEYRKEILRYMYCHQNEDGGWGFHIEGHSIMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              L+Y+ +RLLGEGPD G +GA A+ RKWILDHG AT  PSWGK +LS+LG+ EW G NP+
Sbjct  179   TLSYICMRLLGEGPDGGLNGACAKARKWILDHGTATANPSWGKTWLSILGLCEWSGTNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LRNEI ++ Y +I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILELRNEIFLQPYHEI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
             +W   R    KED+YYPH  +QDL+W++L   TEP + RWPF K+RE A+R  + ++ YE
Sbjct  299   NWKSIRHVVAKEDIYYPHPLLQDLMWDSLYIFTEPLLNRWPFNKLREKALRTTMNHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIG +EK+L M+  W EDPNG   K HLARVPDYLW+ EDGM M  FGSQ WD
Sbjct  359   DENSRYITIGSVEKALCMLSCWVEDPNGICFKKHLARVPDYLWVGEDGMKMQSFGSQEWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
             A FA QA++A+ + EE G  L+K H +IK SQVK+NP GDFKSM+RH++KGSWTFSDQDH
Sbjct  419   AGFAIQALLATDLTEEIGSTLKKGHEFIKASQVKDNPSGDFKSMHRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC LL   MP +I+GE    ++L +AV+V L LQS ++GG + WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLFSNMPPEIVGEHMKPEQLKDAVNVILSLQS-KNGGLSAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +L+ LNP+E FADIV+E E++E T + + ALV F+  YP +R KE+   +  A +YL
Sbjct  538   SSDWLEYLNPTEFFADIVIEHEYVECTSASMQALVLFKKLYPGHRRKEIENFLPNACRYL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q   GSWYG WGVCF YGT+FAL GLT+ GK+YENC A+     F L  Q ++GGWG
Sbjct  598   ENIQMPGGSWYGNWGVCFTYGTWFALGGLTSIGKTYENCPAIRKGVKFLLETQLKDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E  +S P  +Y+PLEG  +NLV T+WA++GL+++ Q ERDPTPLHRAAKL+IN+Q+E+GD
Sbjct  658   ESYKSSPEKKYVPLEGGRSNLVHTAWALMGLIHSRQEERDPTPLHRAAKLIINSQLENGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ+I GV+MKNCMLHYA +R  +P+ AL++YRK V
Sbjct  718   FPQQEIAGVFMKNCMLHYALYRDIYPMWALADYRKHV  754



>ref|XP_010252186.1| PREDICTED: lupeol synthase-like [Nelumbo nucifera]
 ref|XP_010252187.1| PREDICTED: lupeol synthase-like [Nelumbo nucifera]
Length=755

 Score =   911 bits (2355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/756 (55%), Positives = 554/756 (73%), Gaps = 5/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI EGG P++ + NN+ GRQ WE+DP AGTPEE+   E+ R+ F K R +      
Sbjct  1     MWKLKIAEGG-PWLKTVNNHVGRQHWEFDPEAGTPEERAEVERVREEFRKNRFRQKQN-S  58

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DL MRMQ+ KE+  + L++PPV++++ EE+  EA+TT +R+A+    ++QA DGHWP E 
Sbjct  59    DLLMRMQLTKENP-NKLNLPPVKVKDNEEITEEAVTTTLRRAISFYSSIQAHDGHWPGEI  117

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GP+FF PPL+IALYI+G+++ +L+ EH+KE+ RYLYN QN+DGGWGL+++GHSTM  S 
Sbjct  118   AGPIFFLPPLVIALYITGALNTVLSPEHQKEIRRYLYNTQNKDGGWGLHVEGHSTMFSSV  177

Query  1883  LNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             ++Y+ALRLLGEGPDDG D  +AR RKWILDHGGA  IPSWGK +++VLGVYEW G NP  
Sbjct  178   VSYIALRLLGEGPDDGEDMGMARVRKWILDHGGAVGIPSWGKFWVTVLGVYEWAGFNPTP  237

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWL P  FP HP KM CYCR  YMPMSYLY K++ GP+T +VL+LR E++ K Y +ID
Sbjct  238   PEFWLLPKCFPIHPGKMLCYCRLVYMPMSYLYGKKFVGPITSLVLSLRQELYTKPYHEID  297

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+AR    KEDLYYPH  +QD+LW  L    EP + RWPF  +RE A++ A++++ YE 
Sbjct  298   WNKARNTVAKEDLYYPHPLVQDMLWAFLYKVGEPILTRWPFSMLREKALKVAMEHVHYED  357

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             + +RY TIGC+EK + ++  W EDPN +  K HLAR+PDYLW+AEDG+ M  FG Q WDA
Sbjct  358   KNSRYYTIGCVEKVICLLACWVEDPNSEAYKLHLARIPDYLWVAEDGIKMQSFGCQMWDA  417

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
              FA QAI++S ++EE+   LRK H ++K SQVKENP GDF  MYRH++KG WTFS  DHG
Sbjct  418   GFAIQAILSSNLIEEFSPTLRKAHDFVKSSQVKENPSGDFSKMYRHISKGGWTFSTADHG  477

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCT+E LK  LL  ++  +I+GE+ +++R+Y+AVDV L LQS  +GGF  WEP   
Sbjct  478   WQVSDCTSEGLKVCLLFSQISSEIVGEQLEIERMYDAVDVILSLQS-SNGGFPAWEPQRA  536

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
               +L++ NP+E F D ++E E++E T S+I AL  F+  +P YR KE+   I++A+ Y+E
Sbjct  537   FRWLELFNPTEFFEDTLIETEYVECTSSVIQALALFKKLHPEYRKKEIEHCISRAIDYIE  596

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
             K Q+SDGSWYG WG+CF YGT+FA+  L A GK+Y N   +  A  F LSKQ   GGWGE
Sbjct  597   KTQKSDGSWYGCWGICFTYGTWFAVEALVACGKNYYNSPHIQKACAFLLSKQLPSGGWGE  656

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                S  +  Y  +EG  +NLVQT+WAML L+  GQAE DPTPLHR  ++LIN QME+GDF
Sbjct  657   SYLSATNKVYTNIEGNRSNLVQTAWAMLSLIDAGQAEIDPTPLHRGMRVLINTQMENGDF  716

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PQQ+ITGV+M+NC L YA +R+ FP+ A+++YR++V
Sbjct  717   PQQEITGVFMRNCTLQYAQYRNIFPIWAIAQYRRKV  752



>sp|Q2XPU7.1|LUPS_RICCO RecName: Full=Lupeol synthase [Ricinus communis]
 gb|ABB76766.1| lupeol synthase [Ricinus communis]
Length=769

 Score =   910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/758 (56%), Positives = 548/758 (72%), Gaps = 7/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW++KI EGG  PYIYSTNN+ GRQIW +DPNAGTPEEQ   E+AR+ F K R Q  P++
Sbjct  1     MWRIKIAEGGNNPYIYSTNNFQGRQIWVFDPNAGTPEEQAEVEEARQNFWKNRFQVKPNS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  ++Q ++E       IP V++ + EE+  E    A+R++V L  ALQA DGHW A
Sbjct  61    --DLLWQLQFLREKNFKQ-KIPKVKVEDGEEITSEIAAAALRRSVHLFSALQASDGHWCA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN G LFF PPL+ A+YI+G ++ + + EH+KE++RY+Y HQNEDGGWG++I+GHSTM  
Sbjct  118   ENGGLLFFLPPLVFAVYITGHLNTVFSPEHRKEILRYIYCHQNEDGGWGIHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNY+ +R+LGE  D G + A  RGRKWILDHGGAT I SWGK +LS+LGVYEWDG NP
Sbjct  178   TVLNYICMRILGEARDGGIENACERGRKWILDHGGATGISSWGKTWLSILGVYEWDGTNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW FPS+FP HPAKM+CYCR TYMPMSYLY KR+ GP+T ++L +R EI+ + Y +
Sbjct  238   MPPEFWAFPSSFPLHPAKMFCYCRITYMPMSYLYGKRFVGPITPLILQIREEIYNEPYNK  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I WN  R  C KED Y+PH  IQ LLW+AL   +EP   RWPF K+RE A++  + ++ Y
Sbjct  298   IKWNSVRHLCAKEDNYFPHPTIQKLLWDALYTFSEPLFSRWPFNKLREKALKITMDHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E   +RYITIGC+EK L M+  W EDP+G+  K HLAR+ DY+W+ EDG+ M  FGSQ W
Sbjct  358   EDHNSRYITIGCVEKPLCMLACWIEDPHGEAFKKHLARIADYIWVGEDGIKMQSFGSQTW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D + A QA+IAS +  E G  L++ H + K SQ  ENP GDF+ M+RH++KG+WTFSD+D
Sbjct  418   DTSLALQALIASDLSHEIGPTLKQGHVFTKNSQATENPSGDFRKMFRHISKGAWTFSDKD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
              GW VSDCTAE+LKC LL   MP +I+GEK + +++Y++V+V L LQS ++GGF  WEP 
Sbjct  478   QGWQVSDCTAESLKCCLLFSMMPPEIVGEKMEPEKVYDSVNVILSLQS-QNGGFTAWEPA  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +++ LNP E   D+VVE E++E T S I ALV F+  YP +R KE+   I  A Q+
Sbjct  537   RAGSWMEWLNPVEFMEDLVVEHEYVECTSSAIQALVLFKKLYPRHRNKEIENCIINAAQF  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E  QE DGSWYG WG+CF YGT+FAL GL AAG++YENC A+     F L  Q  +GGW
Sbjct  597   IENIQEPDGSWYGNWGICFSYGTWFALKGLAAAGRTYENCSAIRKGVDFLLKSQRDDGGW  656

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
              E   SCP   Y+P EG  +NLVQT+WAM+GL+Y GQA+RDP PLHRAAKLLIN+Q + G
Sbjct  657   AESYLSCPKKVYVPFEGNRSNLVQTAWAMMGLIYGGQAKRDPMPLHRAAKLLINSQTDLG  716

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ++TG +M+NCMLHYA  R+ FP+ AL+EYR+ V
Sbjct  717   DFPQQELTGAFMRNCMLHYALFRNTFPIWALAEYRRHV  754



>gb|AAC17070.1| Strong similarity to lupeol synthase gb|U49919 from A. thaliana 
(second gene in a series of three with similar homologies) 
[Arabidopsis thaliana]
Length=795

 Score =   910 bits (2351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/789 (53%), Positives = 562/789 (71%), Gaps = 39/789 (5%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLKIGEG G  PY++S+NN+ GRQ WE+DP AGTPEE+ A E AR+ +   R +    
Sbjct  1     MWKLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTPEERAAVEDARRNYLDNRPR-VKG  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
             C DL  RMQ +KE++ + + IPPV++ + E + Y+  T A+R+AV    ALQ+ DGHWPA
Sbjct  60    CSDLLWRMQFLKEAKFEQV-IPPVKIDDGEGITYKNATDALRRAVSFYSALQSSDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +G LFF PPL+   YI+G ++ I  +EH+KE++R++Y HQNEDGGWGL+I+G S M  
Sbjct  119   EITGTLFFLPPLVFCFYITGHLEKIFDAEHRKEMLRHIYCHQNEDGGWGLHIEGKSVMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNY+ LR+LGEGP+ G + A  R R+WILDHGG T IPSWGKI+LS+LG+Y+W G NP
Sbjct  179   TVLNYICLRMLGEGPNGGRNNACKRARQWILDHGGVTYIPSWGKIWLSILGIYDWSGTNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PE WL PS FP H  K  CY R  YMPMSYLY KR+ GPLT +++ LR E+H++ YE+
Sbjct  239   MPPEIWLLPSFFPIHLGKTLCYTRMVYMPMSYLYGKRFVGPLTPLIMLLRKELHLQPYEE  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+WN+AR  C KED+ YPH  +QDLLW+ L    EP +  WP KK +RE A+R A++++ 
Sbjct  299   INWNKARRLCAKEDMIYPHPLVQDLLWDTLHNFVEPILTNWPLKKLVREKALRVAMEHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E + YITIGC+EK L M+  W E+PNGD  K HLAR+PD++W+AEDG+ M  FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDHFKKHLARIPDFMWVAEDGLKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++A  + +E  D LRK H +IK+SQV+ENP GDFKSMYRH++KG+WT SD+
Sbjct  419   WDTVFAIQALLACDLSDETDDVLRKGHSFIKKSQVRENPSGDFKSMYRHISKGAWTLSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC +LL  MP +++G+K D ++LY++V++ L LQ  E GG   WEP
Sbjct  479   DHGWQVSDCTAEALKCCMLLSMMPAEVVGQKIDPEQLYDSVNLLLSLQG-EKGGLTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP++ F  ++ E E++E T ++I ALV F+  YP++R KE+  SI K VQ
Sbjct  538   VRAQEWLELLNPTDFFTCVMAEREYVECTSAVIQALVLFKQLYPDHRTKEIIKSIEKGVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             ++E +Q  DGSW+G WG+CF+Y T+FAL GL AAGK+Y++C AV     F L+ Q ++GG
Sbjct  598   FIESKQTPDGSWHGNWGICFIYATWFALSGLAAAGKTYKSCLAVRKGVDFLLAIQEEDGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTG-----------------------  345
             WGE   SCP  RYIPLEG  +NLVQT+WAM+GL++ G                       
Sbjct  658   WGESHLSCPEQRYIPLEGNRSNLVQTAWAMMGLIHAGQVQIFSILDLHLFQVQRNYLETP  717

Query  344   ---------QAERDPTPLHRAAKLLINAQMEDGDFPQQDITGVYMKNCMLHYASHRSYFP  192
                      QAERDPTPLHRAAKL+I +Q+E+GDFPQQ+I GV+M  CMLHYA++R+ FP
Sbjct  718   IVSSAVSIQQAERDPTPLHRAAKLIITSQLENGDFPQQEILGVFMNTCMLHYATYRNIFP  777

Query  191   LMALSEYRK  165
             L AL+EYRK
Sbjct  778   LWALAEYRK  786



>ref|XP_007023363.1| Terpenoid cyclases family protein [Theobroma cacao]
 gb|EOY25985.1| Terpenoid cyclases family protein [Theobroma cacao]
Length=1130

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/758 (55%), Positives = 556/758 (73%), Gaps = 5/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKIGEGG  PY+YSTNNY GRQ WE+DPNAGTP+E+   E+ R+ +   R K     
Sbjct  1     MWRLKIGEGGNDPYLYSTNNYLGRQTWEFDPNAGTPKERAEVEEVRQNYYNNR-KHVQPS  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  ++Q ++E      +IP  ++ + EE+ +EA T AVR++V    ALQ+KDGHWPAE
Sbjct  60    SDLLWQIQFLREKNFKQ-TIPQPKVEDGEEITFEATTAAVRRSVHFFSALQSKDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GP+F+ PPL+++LYI+G +  I  +EH+KE++RY+Y HQNEDGGWGLYI GHSTM  +
Sbjct  119   NAGPMFYFPPLVMSLYITGHLHTIFFAEHRKEILRYIYCHQNEDGGWGLYIGGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             ALNY+ +RLLGEGPD G + A  R RKWILD GG T IPSWGK +LS+LGVYEW GC+P+
Sbjct  179   ALNYICMRLLGEGPDGGLNNACERSRKWILDRGGVTTIPSWGKTWLSILGVYEWSGCHPI  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFWL PS FP HPAKM+CYCR TYMPMSYLY +++ GP+T +++ LR E+H++ Y +I
Sbjct  239   PPEFWLLPSYFPIHPAKMFCYCRLTYMPMSYLYGRKFVGPITPLIVQLREELHIEPYNEI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
             +W++ R  C KEDL+YPH+ +Q  LW++L   TEP +  WPF K+RE A++  + ++ YE
Sbjct  299   NWSKKRHLCAKEDLHYPHTMLQIFLWDSLYIFTEPLLNCWPFNKLREKALKVTMNHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E ++YITIGC+EK L M+  W EDPNG   K HLAR+ DY+W+ EDG+ M  FGSQ WD
Sbjct  359   DESSQYITIGCVEKPLCMLACWVEDPNGVYFKKHLARIADYVWVGEDGIKMQSFGSQVWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
             A+   QA++AS + +E G  L K H ++K SQV++NP  DFK M+RH++KGSWTFSD+DH
Sbjct  419   ASLTLQALLASQLFDEIGPILMKGHNFLKNSQVRDNPPSDFKRMFRHISKGSWTFSDRDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE+LKC L    MP +++GEK ++++ Y++V+V L LQS E+GG + WEP  
Sbjct  479   GWQVSDCTAESLKCCLYFAMMPPEMVGEKMELKQFYDSVNVILSLQS-ENGGLSAWEPTG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                + + LNP E   D+V E E++E T S I ALV F+  YP ++ +E+   I+KA Q+L
Sbjct  538   GGFWWEWLNPVEFLEDLVKEYEYVECTSSSIQALVLFQKLYPEHKKREIANFISKAAQFL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E+ Q  DGSWYG WG+CF+YGT+F L GL AAGK+Y NC A+     F L  Q ++GGWG
Sbjct  598   EEIQYPDGSWYGNWGICFIYGTWFGLQGLKAAGKTYNNCLAIRKGVDFLLKTQREDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP   YIP EG  TNLVQT+ A++GL+  GQAERDPTPLHRAAKLLIN+Q+ +GD
Sbjct  658   ESYLSCPKRVYIPSEGNRTNLVQTALALMGLIIGGQAERDPTPLHRAAKLLINSQLPNGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVW  156
             FPQQ++ GV+M+NCMLHYA +R+ FPL AL+EY K  W
Sbjct  718   FPQQELAGVFMRNCMLHYALYRNVFPLWALAEYCKHFW  755



>ref|XP_009106612.1| PREDICTED: camelliol C synthase [Brassica rapa]
 emb|CDX87420.1| BnaA07g34530D [Brassica napus]
Length=768

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/759 (56%), Positives = 557/759 (73%), Gaps = 7/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLKI +G    PY++STNN+ GRQ WE+DP+AG+ EE+ A ++AR+ F   R +   +
Sbjct  1     MWKLKIAKGNKEEPYLFSTNNFLGRQTWEFDPDAGSSEERAAVDEARRFFFDNRFRVKAS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ +KE +    +IPPV++ + +++  EA + A+R+ V    +LQA DGHWPA
Sbjct  61    -SDLIWRMQFLKEKKFKQ-AIPPVKVEDAKKITSEAASKALRRGVSFLSSLQASDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL+  L+++G +  I T  H++E++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVFCLFVTGHLHEIFTKAHRREILRYIYCHQNEDGGWGLHIEGHSTMFC  178

Query  1889  SALNYVALRLLGEGPDDGDG-AIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNY+ LR+LGEGP++G G A  R R+WIL HGGAT IPSWGK +LS+LGV++W G NP
Sbjct  179   TTLNYICLRILGEGPNEGPGNACKRAREWILGHGGATYIPSWGKTWLSILGVFDWSGSNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP++ ++L LR EI+++ Y +
Sbjct  239   MPPEFWILPSCLPIHPAKMWCYCRLVYMPMSYLYGKRFVGPISPLILQLREEIYLQPYAE  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYMR  1356
             I+WN+AR  C +ED YYP   +Q+++W+ L    EPF+  WP  K+ RE A+  A+K++ 
Sbjct  299   INWNRARHLCAQEDAYYPRPLVQNVIWDCLYMFAEPFLTCWPLNKLLREKALDVAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK+L M+  W E+PNG   K HL RV DYLW+AEDGM M  FGSQ 
Sbjct  359   YEDENSRYITIGCVEKALCMLACWVENPNGVHFKKHLLRVSDYLWIAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD+ FA QA++AS +  E  D LR+ H + K SQV++NP  DF SM+RH++KGSWTFSD+
Sbjct  419   WDSGFALQALLASNLCSEIPDVLRRGHDFFKYSQVRDNPSSDFNSMHRHISKGSWTFSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW  SDCTAE LKC LLL  MP  I+G K D + LYE+V + L LQS ++GG   WEP
Sbjct  479   DHGWQASDCTAEGLKCCLLLSMMPPDIVGPKMDPEHLYESVTILLSLQS-KNGGVTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP+E FADIVVE E+ E T S I AL+ F+  YP++R +E+N SI KAVQ
Sbjct  538   ARGQEWLELLNPTEFFADIVVEHEYNECTSSTIQALILFKQLYPDHRTEEINSSIKKAVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             Y+E  Q  DGSWYG WGVCF Y T+FAL GL AAGK+Y NC A+    HF L+ Q   GG
Sbjct  598   YIENIQMLDGSWYGSWGVCFTYSTWFALGGLAAAGKTYSNCLAMRKGVHFLLTIQKDNGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SC   RYIP EG  TNLVQTSWAM+GL++ GQAERDPTPLHRAAKLLIN+Q+E+
Sbjct  658   WGESYLSCSKKRYIPSEGEKTNLVQTSWAMMGLLHAGQAERDPTPLHRAAKLLINSQLEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITG +MK C+LHYA++R+ FP+ AL+EY + V
Sbjct  718   GDFPQQEITGAFMKTCLLHYAAYRNIFPVWALAEYSRLV  756



>emb|CDX88493.1| BnaC06g39370D [Brassica napus]
Length=778

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/757 (56%), Positives = 554/757 (73%), Gaps = 7/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLKI +G    PY++STNN+ GRQ WE+DP+AGT EE+ A ++AR+      +     
Sbjct  1     MWKLKIAKGSKEEPYLFSTNNFLGRQTWEFDPDAGTSEERAAVDEARRF-FFDNRFRVKA  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ +KE +    +IP V++ + +++  E  + A+R+ V    +LQA DGHWPA
Sbjct  60    SSDLIWRMQFLKEKKFKQ-AIPSVKVEDAKKLTSETASNALRRGVSFLSSLQASDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL+  L+++G +  I T EH++E++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVFCLFVTGHLHEIFTKEHRREILRYIYCHQNEDGGWGLHIEGHSTMFC  178

Query  1889  SALNYVALRLLGEGPDDGDG-AIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNY+ LR+LGEGP++G G A  R R+WIL HGGAT IPSWGK +LS+LGV++W G NP
Sbjct  179   TTLNYICLRILGEGPNEGPGNACKRAREWILGHGGATYIPSWGKTWLSILGVFDWSGSNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP++ ++L LR EI+++ Y +
Sbjct  239   MPPEFWILPSCLPIHPAKMWCYCRLVYMPMSYLYGKRFVGPISPLILKLREEIYLQPYAE  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYMR  1356
             I+WN+AR  C KED YYP   +Q+++W+ L    EPF+  WP  K+ RE A+  A+K++ 
Sbjct  299   INWNKARHLCAKEDAYYPRPLVQNVIWDCLYMFAEPFLTCWPLNKLLREKALDVAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK+L M+  W E+PNG   K HL RV DYLW+AEDGM M  FGSQ 
Sbjct  359   YEDENSRYITIGCVEKALCMLACWVENPNGVHFKKHLLRVSDYLWIAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD+ FA QA++AS +  E  + LR+ H + K+SQV++NP  DF SM+RH++KGSWTFSD+
Sbjct  419   WDSGFALQALLASNLCSEIPEVLRRGHDFFKDSQVRDNPSSDFNSMHRHISKGSWTFSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW  SDCTAE LKC LLL  MP  I+G K D ++LYE+V + L LQS ++GG   WEP
Sbjct  479   DHGWQASDCTAEGLKCCLLLSMMPPDIVGPKMDPEQLYESVIILLSLQS-KNGGVTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP+E FADIVVE E+ E T S I AL+ F+  YP++R +E+N SI KAVQ
Sbjct  538   ARGQEWLELLNPTEFFADIVVEHEYNECTSSTIQALILFKQLYPDHRTEEINSSIKKAVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             Y+E  Q  DGSWYG WGVCF Y T+FAL GL AAGK+Y NC A+    HF L+ Q   GG
Sbjct  598   YIENIQMLDGSWYGSWGVCFTYSTWFALGGLAAAGKTYSNCLAMRKGVHFLLTIQKDNGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SC   RYIP EG  TNLVQTSWAM+GL++ GQAERDPTPLHRAAKLLIN+Q+E+
Sbjct  658   WGESYLSCSKKRYIPSEGEKTNLVQTSWAMMGLLHAGQAERDPTPLHRAAKLLINSQLEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             GDFPQQ+ITG +MK C+LHYA++R+ FP+ AL+EY +
Sbjct  718   GDFPQQEITGAFMKTCLLHYAAYRNIFPVWALAEYSR  754



>sp|B9X0J1.1|STBOS_STERE RecName: Full=Baccharis oxide synthase; Short=StrBOS [Stevia 
rebaudiana]
 dbj|BAH23676.1| baccharis oxide synthase [Stevia rebaudiana]
Length=761

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/757 (56%), Positives = 552/757 (73%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI +G   PY+YSTNN+ GRQ WE+DPN GT EE++  E+AR+ F   R +   T 
Sbjct  1     MWRLKIADGNNNPYLYSTNNFVGRQTWEFDPNYGTQEERDEVEQARQHFWNNRHQFKAT-  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GD+  RMQ I+E      +IP V++ + EE++Y+ +T  +R++V L  ALQA DGHWPAE
Sbjct  60    GDVLWRMQFIREKRFKQ-TIPQVKIEDGEEISYDKVTATLRRSVHLLAALQADDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GP+FF  PL+I LYI+G +D +   EHKKE++RYLY  QNEDGGWGL+I+G S M G+
Sbjct  119   NTGPMFFIQPLVICLYITGHLDRVFPKEHKKEILRYLYTQQNEDGGWGLHIEGQSIMFGT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              ++YV +RLLGEGPD G +GA  + RKWILDHG     PSWGKIYL++LGV+EW+GCNPL
Sbjct  179   IMSYVCMRLLGEGPDGGLNGACTKARKWILDHGSVLASPSWGKIYLTILGVHEWEGCNPL  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS FP HPAKMWCYCR  YMPMSYLY +R+ GP+T +VL LR E++ +SY  I
Sbjct  239   PPEFWILPSIFPMHPAKMWCYCRLIYMPMSYLYGRRFVGPITPLVLQLREELYSQSYNDI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
              W   R    KEDL+YPH ++QDL+W+ L   TEP + RWPF K+RE A++  I ++ YE
Sbjct  299   KWKSTRHLVVKEDLHYPHPWLQDLMWDGLYIFTEPLLTRWPFSKLREKALKTTINHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIG +EKSL M+  W EDP+G   K HLAR+PDY+W++EDG+ M  FGSQ WD
Sbjct  359   DENSRYITIGAVEKSLCMLACWDEDPDGVCFKKHLARIPDYIWVSEDGLKMQSFGSQLWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
             A+ A QA++A+ +  +    LRK H +IK SQVK+NP GDFKSMYRH+TKGSWTFSDQDH
Sbjct  419   ASLAIQALLATDLNHDIEPILRKGHDFIKASQVKDNPSGDFKSMYRHITKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW  SDCT E LKC LLL +M  +I+GEK   ++ Y+AV++ L LQ  ++GG A WEP  
Sbjct  479   GWQTSDCTTEGLKCCLLLSKMSAEIVGEKMQPEQFYDAVNLILSLQC-KNGGEAGWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +L+ LNPSE+F DIV+E + +E T + + ALV F+  YP +R +E+   +  A  YL
Sbjct  538   ESNWLEFLNPSELFEDIVLEHDSVECTATGMQALVIFKKLYPKHRREEIEKFLKDACGYL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             EK Q  DGSWYG WG+CF YGT FAL G+ A GK+YENCEA+  A +F L+ Q  +GGWG
Sbjct  598   EKVQMQDGSWYGEWGICFTYGTCFALGGMEAIGKTYENCEAIRRAVNFLLTTQRNDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E  +S P  +Y+PLEG  +NLVQT+ A++GL+ + Q ERDPTPLHRAAKLLIN+QME+GD
Sbjct  658   ESYRSSPKKKYVPLEGNRSNLVQTACALMGLIRSKQEERDPTPLHRAAKLLINSQMENGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQ++  GV+ KNC+LHY  +R+ + L AL EYRK+V
Sbjct  718   FPQEETGGVFKKNCLLHYPMYRNIYTLWALGEYRKKV  754



>ref|XP_007014712.1| Beta-Amyrin Synthase isoform 1 [Theobroma cacao]
 gb|EOY32331.1| Beta-Amyrin Synthase isoform 1 [Theobroma cacao]
Length=755

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/756 (55%), Positives = 544/756 (72%), Gaps = 5/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI E G P++ + N + GRQ WE+DPNAG+PEEQ   E+ R  F K R +   +  
Sbjct  1     MWKLKIAEEG-PWLATVNGHVGRQHWEFDPNAGSPEEQAQVERLRLEFKKNRFRVKQS-S  58

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DL MRMQ+ KE+   ++  PPV+L  EE V  EA T  +R+A+    +LQA DGHWPAE 
Sbjct  59    DLLMRMQLTKENPCGLIP-PPVKLNHEEVVTEEATTVTLRRAISFYSSLQAHDGHWPAET  117

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GPLFF PPL++ALY++G ++ IL+ EH+KE++RY+YNHQNEDGGWGL+I+GHSTM G+A
Sbjct  118   AGPLFFLPPLVMALYVTGGLNTILSPEHQKEIIRYIYNHQNEDGGWGLHIEGHSTMFGTA  177

Query  1883  LNYVALRLLGEGPDDGDG-AIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             ++Y+ LRLLGE P+DG+G A+ARGRKWILDHGG   IPSWGK +++VLGVYEW GCNPL 
Sbjct  178   ISYITLRLLGERPEDGEGMAVARGRKWILDHGGLVGIPSWGKFWVTVLGVYEWAGCNPLP  237

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWL P   P HP KM CYCR  YMPMSYLY KR+ GP+T ++  LR E++ + Y +I+
Sbjct  238   PEFWLLPKVSPIHPGKMLCYCRLVYMPMSYLYGKRFVGPITGLIRQLRQELYNQPYHEIN  297

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN AR    KEDLYYPH  +QDL W  L +  EPF+ RWPF  +R+ A++ AI+++ YE 
Sbjct  298   WNAARNTVAKEDLYYPHPLVQDLTWGFLHHVVEPFLTRWPFSMLRDKALKVAIQHVHYED  357

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E +RY+ IGC+EK L +M  W EDPN +  K HLAR+PDY W+AEDG+ M  FG Q WDA
Sbjct  358   ENSRYLCIGCVEKVLCLMACWVEDPNSEAYKRHLARLPDYYWIAEDGLKMQTFGCQMWDA  417

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
             AFA QAI++S + +EYG  LRK H ++K SQV+ENP G+F  MYRH++KGSWTFS QDHG
Sbjct  418   AFAIQAIMSSNLSDEYGPTLRKAHDFVKASQVRENPSGNFSGMYRHISKGSWTFSTQDHG  477

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE LKC LL  +M + ++GEK + QR Y+AV+V L LQS  +GGF  WEP   
Sbjct  478   WQVSDCTAEGLKCALLFSQMSNDLVGEKLETQRFYDAVNVILSLQS-NNGGFPAWEPQRA  536

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
               +L+  NP+E F D ++E E++E T S I AL  FR  +P +R  E++  +A+  +Y+E
Sbjct  537   YGWLEKFNPTEFFEDTLIEREYVECTSSAIQALALFRKLHPKHRRAEIDHCVARGARYIE  596

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
               Q  DGSWYG WG+C+ YG +FA+ GL A G++Y N  A+  A  F LSKQ   GGWGE
Sbjct  597   DTQNQDGSWYGCWGICYTYGAWFAVEGLAACGRNYHNSPALRKACEFLLSKQLANGGWGE  656

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                S  +  Y  L G   NLV T+WA+L L+  GQA+ DPTP+HR  K+LIN+QMEDGDF
Sbjct  657   SYLSSQNKVYTNLPGNRANLVHTAWALLSLIAAGQADVDPTPIHRGIKVLINSQMEDGDF  716

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PQQ+ITGV+M+NC L+Y+S R+ FP+ AL EYR+R+
Sbjct  717   PQQEITGVFMRNCTLNYSSFRNIFPIWALGEYRRRI  752



>ref|XP_011031246.1| PREDICTED: beta-amyrin synthase-like [Populus euphratica]
Length=759

 Score =   906 bits (2341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/757 (56%), Positives = 544/757 (72%), Gaps = 7/757 (1%)
 Frame = -3

Query  2423  MWKLKIGE-GGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI E G  PYI++TN+YAGRQIWEYDPNAGTPEE+E  E+AR+ FTK R K   + 
Sbjct  1     MWRLKIAEKGNSPYIFTTNDYAGRQIWEYDPNAGTPEEREQVEEARRNFTKSRSKVKPS-  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  + Q+++E      +IP VR+ E EEV YE  TTA+R++     ALQA DGHWPAE
Sbjct  60    ADLLWQYQILREKNFKQ-TIPAVRVEEGEEVTYEKTTTALRRSASFYSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             NSG LFF PP +   YI+G ++ +   E++KE+ RY+YNHQNEDGGWGL+I+ HS M  +
Sbjct  119   NSGVLFFLPPFVFCFYITGHLNTMFPPEYRKEIFRYIYNHQNEDGGWGLHIESHSNMFCT  178

Query  1886  ALNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             A +Y+ LR+LG GPD+   A ARGRKWILD GG T IPSWGK +LS+LG++EW GCNP+ 
Sbjct  179   AFSYICLRMLGVGPDEE--ACARGRKWILDRGGVTSIPSWGKTWLSILGLFEWSGCNPMP  236

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFW+ P+  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L+LR E++++ YE + 
Sbjct  237   PEFWILPTTLPVHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILSLREELYLQPYESVK  296

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRYE  1350
             W Q R  C +EDLYYPHS IQD LW++L   +EP + RWPF + IR+ A+   +K++ YE
Sbjct  297   WKQVRHLCAEEDLYYPHSLIQDFLWDSLYLMSEPLLTRWPFNQLIRKKALEVTMKHIHYE  356

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDP+G   K HLARVPD+LW+ EDGM +  FGSQ WD
Sbjct  357   DENSRYITIGCVEKVLCMLSCWVEDPDGVAFKRHLARVPDFLWVGEDGMKVQSFGSQLWD  416

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
             A F  QA+  S + EE    L K   +IK+ QV +NP GDF  MYRH++KGSWTFSDQDH
Sbjct  417   ATFGFQALHTSELGEEIKPTLAKAFDFIKKCQVVDNPAGDFVGMYRHISKGSWTFSDQDH  476

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW +SDCTAE LKC+L    +P + IGEK D Q ++EAV++ L LQ P  GG A WEP  
Sbjct  477   GWQLSDCTAEALKCVLFAQMLPTEYIGEKVDPQMIFEAVNIILSLQGPR-GGLAGWEPIR  535

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
              + +L+ LNP E   +IV+E +++E T S I   V F   YP +R KE+   IA+AV YL
Sbjct  536   GEMWLEKLNPMEFLENIVIEHDYVECTSSAIHGFVMFMKMYPGHRKKEIETFIARAVDYL  595

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSWYG WGVCF+Y T+FAL+GL AAGKSY N +A+     F L  Q+ +GGWG
Sbjct  596   EMIQMPDGSWYGNWGVCFIYSTWFALVGLAAAGKSYYNNQAMRRGVDFLLRAQSPDGGWG  655

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP+  Y PLEG  +  VQT+WAMLGL+++GQA+RDPTPLHR AKLLIN+Q EDG 
Sbjct  656   ESYLSCPNKIYTPLEGKRSTYVQTAWAMLGLIHSGQADRDPTPLHRGAKLLINSQAEDGS  715

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             +PQQ+ITGV+  NCMLHY ++++ FPL AL+EYRK V
Sbjct  716   YPQQEITGVFKNNCMLHYPTYKNVFPLWALAEYRKNV  752



>gb|KHG28038.1| Beta-amyrin synthase [Gossypium arboreum]
Length=693

 Score =   906 bits (2341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/692 (60%), Positives = 530/692 (77%), Gaps = 4/692 (1%)
 Frame = -3

Query  2228  MQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAENSGPLF  2049
             MQ +KE      SIP V++ + E++ YE  TT +R+AV    ALQA DGHWPAEN+GPLF
Sbjct  1     MQFLKEKNFKQ-SIPAVKIDDGEQITYEKATTTLRRAVHFFSALQASDGHWPAENAGPLF  59

Query  2048  FTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSALNYVA  1869
             F PPL+ ++YI+G ++ +   EH++E++RY+Y HQNEDGGWGL+I+GHSTM  +AL+Y+ 
Sbjct  60    FLPPLVFSMYITGHLNTVFPEEHRREILRYIYYHQNEDGGWGLHIEGHSTMFCTALSYIC  119

Query  1868  LRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLSPEFWL  1692
             +R+LGEGPD G D A AR RKWILDHG  T +PSWGK +LS+LGV++W GCNP+ PEFWL
Sbjct  120   MRILGEGPDGGLDNACARARKWILDHGSVTHMPSWGKTWLSILGVFDWSGCNPMPPEFWL  179

Query  1691  FPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQIDWNQAR  1512
              PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++  LR E++++ Y +I+W + R
Sbjct  180   LPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLIEQLREELYLQPYNEINWKKIR  239

Query  1511  MACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRYEAEETR  1335
               C  ED+YYPH  IQDL+W++L  CTEP + RWPF K IRE A++  +K++ YE E +R
Sbjct  240   HLCAPEDIYYPHPLIQDLMWDSLYICTEPLLTRWPFNKLIRERALQVTMKHIHYEDENSR  299

Query  1334  YITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDAAFAT  1155
             YITIGC+EK L M+  WAE+PN D  K HLAR+PDYLW+AEDGM M  FGSQ WD  FA 
Sbjct  300   YITIGCVEKVLCMLACWAEEPNSDYFKKHLARIPDYLWVAEDGMKMQSFGSQQWDTGFAI  359

Query  1154  QAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHGWAVS  975
             QA++AS + +E G  L++ H +IK+SQVK+NP GDFK M+RH++KGSWTFSDQDHGW VS
Sbjct  360   QALLASNLTDEIGPVLKRGHDFIKKSQVKDNPSGDFKQMFRHISKGSWTFSDQDHGWQVS  419

Query  974   DCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVPQPYL  795
             DCTAE LKC LL+  +P +I+GEK + Q+LY+AV+V L LQS ++GG A WEP   Q +L
Sbjct  420   DCTAEGLKCCLLMSMLPPEIVGEKMEPQQLYDAVNVILSLQS-QNGGLAAWEPAGAQEWL  478

Query  794   QVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLEKQQE  615
             ++LNP+E FADIV+E E+IE T S I ALV F+  YP +R KE++  I  AV YLE  Q 
Sbjct  479   EMLNPTEFFADIVIEHEYIECTASSIHALVMFKKLYPGHRKKEIDNFITNAVHYLEDIQM  538

Query  614   SDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGECLQS  435
              DGSWYG WGVCF YGT+FAL GL AAGK+Y NCEA+     F L+ Q + GGWGE  +S
Sbjct  539   PDGSWYGNWGVCFTYGTWFALGGLAAAGKTYTNCEAMRRGVQFLLTTQRENGGWGESYKS  598

Query  434   CPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDFPQQD  255
             CP  RY+PLE   +NLV T+WAM+GL++ GQAERDP PLHRAAKL+IN+Q+EDGDFPQQ+
Sbjct  599   CPEKRYVPLEDGRSNLVHTAWAMMGLIHAGQAERDPRPLHRAAKLIINSQLEDGDFPQQE  658

Query  254   ITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             ITGV+MKNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  659   ITGVFMKNCMLHYAAYRNIYPLWALAEYRKRV  690



>ref|XP_006409184.1| hypothetical protein EUTSA_v10022563mg [Eutrema salsugineum]
 gb|ESQ50637.1| hypothetical protein EUTSA_v10022563mg [Eutrema salsugineum]
Length=794

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/780 (54%), Positives = 559/780 (72%), Gaps = 30/780 (4%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLK GEG G  PY++S+NN+ GRQIWE+DP AGTPEE+ A E+AR+ F   R +    
Sbjct  1     MWKLKTGEGNGEDPYLFSSNNFTGRQIWEFDPKAGTPEERAAVEEARRSFYDNRSR-VKA  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ +KE++ + + IPPV+  + E + Y   T A+R+ V    ALQ+ DGHWPA
Sbjct  60    SSDLLWRMQFLKEAKFEQV-IPPVKFDDGESITYVKTTNALRRGVAFFSALQSSDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +GPLFF PPL+  LYI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+  S M  
Sbjct  119   EIAGPLFFLPPLVFCLYITGHLEEVFDAEHRKEILRYIYCHQNEDGGWGLHIESKSVMFS  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ LR+LG G D G + +  R R+WIL+HGG T IPSWGK++LS+LG+Y+W G NP
Sbjct  179   TALNYICLRMLGVGLDGGRENSCKRAREWILNHGGVTYIPSWGKVWLSILGIYDWSGTNP  238

Query  1712  LSPEFWLFPSNFPFH-----------------------PAKMWCYCRTTYMPMSYLYAKR  1602
             + PE WL PS  P H                         K+ CY R  YMPMSYLY KR
Sbjct  239   MPPEMWLLPSFLPLHLGVFCTFVFVDYCCKFFCLDAKNAGKLLCYTRMVYMPMSYLYGKR  298

Query  1601  YRGPLTDVVLALRNEIHVKSYEQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPF  1422
             + GP+T +++ LR E+H++ YE+I+WN+AR  C KED YYPH  +QDL+W+ L    EPF
Sbjct  299   FVGPVTPLIMQLREELHLQPYEEINWNKARRLCGKEDTYYPHPLVQDLIWDTLHMFVEPF  358

Query  1421  MRRWPFKK-IREMAMRKAIKYMRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHL  1245
             + RWP  K +RE A+R A+ ++ YE E + YITIGCIEK L M+  W E+P GD  K HL
Sbjct  359   LTRWPLNKLVREKALRVAMNHIHYEDENSHYITIGCIEKVLCMLACWVENPVGDHFKKHL  418

Query  1244  ARVPDYLWLAEDGMSMHGFGSQNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKE  1065
             +R+ DY+W+AEDG+ M  FGSQ W+  FA QA++AS + +E  + LR+ H YIK SQV+E
Sbjct  419   SRLSDYMWVAEDGLKMQSFGSQLWETGFAIQALLASDLGDETYEVLRRGHTYIKRSQVRE  478

Query  1064  NPKGDFKSMYRHVTKGSWTFSDQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRL  885
             NP GDFK+M+RH++KG+WTFSD+DHGW VSDCTAE LKC +LL  MP  ++G+K D + L
Sbjct  479   NPSGDFKTMHRHISKGAWTFSDRDHGWQVSDCTAEALKCCMLLSMMPADLVGQKIDPEHL  538

Query  884   YEAVDVCLYLQSPESGGFATWEPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALV  705
             Y++V++ L LQS E+GG   WEP     +L++LNP++ FA+++VE E +E T ++I A V
Sbjct  539   YDSVNLLLSLQS-ENGGLTAWEPASAPEWLELLNPTDFFANVMVEGECVECTSAVIQAFV  597

Query  704   AFRCHYPNYRPKEVNISIAKAVQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKS  525
              F+  YP++R KEV  SI KAVQ++E +Q  DGSWYG WG+CF+YGT+FAL GL A GK+
Sbjct  598   MFKQLYPDHREKEVIKSIKKAVQFIESKQMPDGSWYGNWGICFIYGTWFALSGLAAIGKT  657

Query  524   YENCEAVCNAAHFFLSKQNQEGGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTG  345
             Y NC ++CN   F L+ QN++GGWGE   SCP  RYIPLE  G+N+VQT+WAM+GL++ G
Sbjct  658   YNNCLSICNGVDFLLTIQNEDGGWGESYLSCPEQRYIPLERNGSNIVQTAWAMMGLIHGG  717

Query  344   QAERDPTPLHRAAKLLINAQMEDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             QAERD  PLHRAAK +I +QME+GDFPQQ++TG +M NCMLHYA++R+ FPL AL+EYRK
Sbjct  718   QAERDFIPLHRAAKFIITSQMENGDFPQQEMTGAFMNNCMLHYATYRNTFPLWALAEYRK  777



>gb|KFK42271.1| hypothetical protein AALP_AA2G234300 [Arabis alpina]
Length=759

 Score =   904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/759 (56%), Positives = 553/759 (73%), Gaps = 7/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LKIGEG G  PY++STNN+AGRQ WE+DP+ G+ EE+ +  +AR+ F + R +    
Sbjct  1     MWRLKIGEGNGNDPYLFSTNNFAGRQTWEFDPDGGSSEERNSVVEARRSFYENRFR-VKA  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               D+  RMQ +KE + + + IPP ++   +++ +E+ T A+R+ V    ALQA DGHWPA
Sbjct  60    SSDVLWRMQFLKEKKFEQV-IPPGKVESSDKITFESATNALRRGVHFFSALQATDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL+  LYI+G +D I TSEH+KE++RY+Y HQ EDGGWG +I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVFCLYITGHLDEIFTSEHRKEILRYIYCHQKEDGGWGFHIEGHSTMFC  178

Query  1889  SALNYVALRLLGEGPDDGD-GAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ +R+LGE PD G+  A AR RKWI  HGG T IPSWGK +LS+LGV++W G NP
Sbjct  179   TALNYICMRILGESPDGGEENACARARKWIHVHGGVTCIPSWGKTWLSILGVFDWSGSNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS FP HPAKMWC CR  Y+PMSYLY KR+ GP+T ++L LR E++++ YE+
Sbjct  239   MPPEFWILPSFFPVHPAKMWCNCRMVYLPMSYLYGKRFVGPITPLILQLRKELYLQPYEE  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYMR  1356
             I W +    C KED YYP   +Q+L+W++L   TEP + RWPF K+ R+ A+  A+K++ 
Sbjct  299   ISWKKIHHLCAKEDAYYPRPLVQELIWDSLYIFTEPLLTRWPFNKLLRQKALHVAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYIT+GC++K L M+  W EDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ 
Sbjct  359   YEDENSRYITMGCVQKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA +A++AS +  E  D LR+ H +IK SQV+ENP G+FKSMYRH++KG+WTFSD+
Sbjct  419   WDTGFAMEALLASNLSSEISDVLRRGHEFIKNSQVRENPSGNFKSMYRHISKGAWTFSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTA  LKC LL   M   I+G K D +RLY++V++ L LQS ++GG   WEP
Sbjct  479   DHGWQVSDCTAHGLKCCLLFSMMAPDIVGPKTDPERLYDSVNLLLILQS-KNGGVTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+E+FADIV+E E+ E T S I AL  F+  +P++R KE+   I KAVQ
Sbjct  538   AGAPEWLELLNPTEMFADIVIEHEYTECTSSAIQALSLFKQLFPDHRKKEITNFIKKAVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q  DGSWYG WG+CF YGT+FAL GL AAGK+Y +C A+    HF LS Q   GG
Sbjct  598   YLENMQTPDGSWYGNWGICFTYGTWFALAGLAAAGKTYNDCAAIRKGVHFLLSTQKDNGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SC   RYI  EG  +NLVQT+WA++GL++ GQAERDP PLHRAAKL+IN+Q++ 
Sbjct  658   WGESYLSCSEKRYIAEEGEKSNLVQTAWALMGLIHAGQAERDPVPLHRAAKLIINSQLDT  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ  TGV+MKNC LHYA +R   PL AL+EYR RV
Sbjct  718   GDFPQQQATGVFMKNCTLHYAQYRIIHPLWALAEYRARV  756



>gb|KFK40207.1| hypothetical protein AALP_AA3G344300 [Arabis alpina]
Length=763

 Score =   904 bits (2336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/757 (54%), Positives = 551/757 (73%), Gaps = 7/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLK GEG G  PY++S+NN+ GRQ WE+DP AGTPEE+ A E+AR+ F   R +    
Sbjct  1     MWKLKTGEGNGEDPYLFSSNNFVGRQTWEFDPEAGTPEERAAVEEARRSFMDNRSR-VKA  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ +KE++ + + IPPV++ + E + +E  T A+R+ +    ALQA DGHWP 
Sbjct  60    SSDLLWRMQFLKEAKFEQV-IPPVKISDYESITHENATNALRRGIAFFSALQASDGHWPG  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E +GPLFF PPL+  L+I+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+  S M  
Sbjct  119   EITGPLFFLPPLVFCLHITGHLEEVFDAEHRKEMLRYIYCHQNEDGGWGLHIESKSVMFS  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ LR+LG GPD G + A  R R+WIL+HGG T IPSWGKI+LS+LG+Y+W G NP
Sbjct  179   TALNYICLRILGVGPDGGRENACKRARQWILNHGGVTYIPSWGKIWLSILGIYDWSGTNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PE WL PS  P H  K  CY R  YMPMSYLY KR+ GP+T +++ LR E+H++ YE+
Sbjct  239   MPPEIWLLPSFLPIHLGKTLCYTRMVYMPMSYLYGKRFVGPITPLIMQLREELHLQPYEE  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W +AR    KED YYPH  +QDL+W+ L    EPF+  WP  K +RE A+  A+K++ 
Sbjct  299   INWKKARRLYAKEDTYYPHPLVQDLIWDTLNMFVEPFLTSWPLNKLVREKALGVAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E T YITIGCIEK L M+  W E P+GD  K HL+R+ DY+W+AEDG+ +  FGSQ 
Sbjct  359   YEDESTHYITIGCIEKVLCMLACWIEKPDGDNFKKHLSRISDYIWVAEDGLKIQCFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             W+  FA QA+I+S + +E  + LR+ H YIK+SQV+ENP GDFKSMYRH++KGSWTFSD+
Sbjct  419   WETGFAIQALISSDLCDETYEVLRRGHSYIKQSQVRENPSGDFKSMYRHISKGSWTFSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC +LL  MP  ++G+K D + LY++V + L LQS  +GG   WEP
Sbjct  479   DHGWQVSDCTAEALKCCMLLSMMPSDVVGQKIDPENLYDSVHLLLSLQSA-NGGLTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+E FA+++VE E++E T ++I ALV F+  YP++R KE+  SI KA Q
Sbjct  538   VRGHEWLELLNPTEFFANVMVEREYVECTSAVIQALVIFKQLYPDHRTKEITKSIEKAAQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             ++E +Q  DGSWYG WG+CF+YGT+FAL GL A GK+Y NC +V     F L  QN++GG
Sbjct  598   FIESKQMLDGSWYGDWGICFMYGTWFALSGLAAIGKTYNNCLSVRKGVDFLLMIQNEDGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYIPLEG  +NLVQT+WAM+GL++ GQA+RD  P+HRAA+ +I +Q+E+
Sbjct  658   WGESYLSCPEQRYIPLEGNRSNLVQTAWAMMGLIHAGQAKRDLLPIHRAARFIITSQLEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             GDFPQQ+I G +M  CMLHYA++R+ FPL AL+EYRK
Sbjct  718   GDFPQQEIVGAFMNTCMLHYATYRNTFPLWALAEYRK  754



>gb|KEH18380.1| beta-amyrin synthase [Medicago truncatula]
Length=762

 Score =   904 bits (2336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/758 (55%), Positives = 554/758 (73%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI +GG  PYI+STNN+ GRQ WE+DPNAGT EE+   EKAR+ F   R K    C
Sbjct  1     MWRLKIADGGNDPYIFSTNNFLGRQTWEFDPNAGTSEERAQVEKARQHFYNNRFK-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  R Q+++E      +I  V++ + EE+  E +TT +R+AV    ALQA DGHWP+ 
Sbjct  60    SDLLWRFQILREIFFKQ-TIASVKIEDGEEITEEKVTTTLRRAVNHISALQASDGHWPSL  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLF+ PPL+  +Y+ G +D +   E++KE++RY+Y HQNEDGGWGL+++GHS M  +
Sbjct  119   NAGPLFYFPPLVFCMYVIGHLDSVFPKEYRKEILRYIYCHQNEDGGWGLHVEGHSIMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              LNY+ +R+LGEGP+ G + A A+ RKWI DHGG T +PSWGK +LS+LG+++W   NP+
Sbjct  179   VLNYICMRILGEGPNGGKENACAKARKWIHDHGGVTYVPSWGKFWLSILGIFDWRASNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS    HPA+M CYCR  YMPMSYLY KR+ GP+T + L LR E+  + YE++
Sbjct  239   PPEFWMLPSFLLKHPARMLCYCRLVYMPMSYLYGKRFVGPITPLTLKLREELLTEPYEKV  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W + R  C KEDLYYPH  IQDL+W++L    EP +  WP  K IRE A++ A+K++ Y
Sbjct  299   NWQKVRHLCAKEDLYYPHPLIQDLIWDSLYIFMEPLLTHWPLNKLIREKALQVAMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW+AEDGM++H FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLSCWVEDPNGDAFKKHLARLPDYLWVAEDGMTLHSFGSQTW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA+   QA++A+ ++E+ G  L K H +IK SQV++NP GDF+SMYRH++KGSWTFSDQD
Sbjct  419   DASLIIQALLATNLIEDIGPTLAKGHKFIKNSQVRDNPSGDFESMYRHISKGSWTFSDQD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LLL  +  +I+GEK + +RLY++V++   LQ  + GG   WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSMLSPEIVGEKMEPERLYDSVNIMFSLQG-KKGGLPAWEPS  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP E   +IVVE E++E T S I A+V F+  YP +R +EV   IAKAV++
Sbjct  538   KALEWLELLNPIEFLEEIVVEREYVECTSSSIQAMVLFKKLYPEHRKEEVENFIAKAVKF  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE +Q SDGSWYG WG+CF YG++FAL GLTAAGK+YENC A+  A  F L+ Q ++GGW
Sbjct  598   LEDKQTSDGSWYGNWGICFTYGSWFALGGLTAAGKTYENCAAIRKAVKFLLTIQREDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SC    Y+PLEG+ +N+VQT+WA++ L++ GQAERDPTPLHRA KL+IN Q E+G
Sbjct  658   GESHLSCSKKIYVPLEGSQSNIVQTAWALMALIHAGQAERDPTPLHRAVKLIINLQQEEG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             D+PQQ++T V+MKNCMLHYA  R  FP+ AL+EYRK +
Sbjct  718   DWPQQELTAVFMKNCMLHYAMFRDIFPMWALAEYRKGI  755



>dbj|BAE53430.1| lupeol synthase [Lotus japonicus]
Length=755

 Score =   904 bits (2335),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/757 (56%), Positives = 550/757 (73%), Gaps = 7/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLK+ EGG   + S +N+ GRQ W +DPNAGTP+E E  E+ R+ FTK R     +  
Sbjct  1     MWKLKVAEGGKGLV-SVSNFIGRQHWVFDPNAGTPQEHEEIERMRQEFTKNRFSIKQS-A  58

Query  2243  DLFMRMQMIKESEVDVLSIPP-VRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             DL MRMQ+ KE+      IPP V+LR+ E+V  EA+ T +R+++    ++QA DGHWPAE
Sbjct  59    DLLMRMQLRKENPCG--PIPPAVKLRDVEKVTAEALITTIRRSITFYSSIQAHDGHWPAE  116

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             ++GPLFF  PL++ALYI+GS+D +L  +HKKE++RYLYNHQNEDGGWG +I+GHSTM GS
Sbjct  117   SAGPLFFVQPLVMALYITGSLDDVLGPQHKKEIIRYLYNHQNEDGGWGFHIEGHSTMFGS  176

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             AL+Y+ALR+LG+  +DG D A+ARGRKWILDHGG   IPSWGK +++VLGVYEW GCNPL
Sbjct  177   ALSYIALRVLGQSLEDGEDMAVARGRKWILDHGGLVAIPSWGKFWVTVLGVYEWSGCNPL  236

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFWL P  FP HP KM CYCR  YMPMSYLY K++ GP+T +V +LR E++ + Y+++
Sbjct  237   PPEFWLLPKIFPIHPGKMLCYCRLVYMPMSYLYGKKFVGPITALVRSLRKELYNEPYDRV  296

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
             DWN+AR    KEDLYYPH  IQD+LW  L +  E  +  WPF  +R+ A+  AI ++RYE
Sbjct  297   DWNKARNTVAKEDLYYPHPLIQDMLWGFLHHVGERVLNTWPFSMLRQKAIEVAINHVRYE  356

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E TRY+ IG +EK L ++  W EDPN +  K HLAR+PDY WLAEDG+ +  FG Q WD
Sbjct  357   DETTRYLCIGSVEKVLYLIARWVEDPNSEAYKLHLARIPDYFWLAEDGLKIQSFGCQMWD  416

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
             AAFA QAI++  + EEYG  L+K H ++K SQV+ENP GDFK+MYRH++KG+WTFS  DH
Sbjct  417   AAFAIQAILSGNVSEEYGPTLKKAHHFVKASQVRENPSGDFKAMYRHISKGAWTFSMHDH  476

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LK  LLL EM   ++G K + ++ Y+AV+V L LQS  +GGF  WEP  
Sbjct  477   GWQVSDCTAEGLKVALLLSEMSDDLVGAKMETEQFYDAVNVILSLQS-SNGGFPAWEPQR  535

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +L+  NP+E F + ++E E++E TGS + AL  FR  YP +R KE++  I+KA++Y+
Sbjct  536   AYQWLEKFNPTEFFEETLIEREYVECTGSAMQALALFRKLYPKHRRKEIDRCISKAIRYI  595

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSWYG WG+C+ YGT+FA+ GLTA GK+++N   +  A  F LSKQ   GGWG
Sbjct  596   ENTQNPDGSWYGCWGICYTYGTWFAVEGLTACGKNFQNSVTLRRACKFLLSKQLPNGGWG  655

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   S     Y  +EG   NLVQ+SWA+L LM  GQAE DPTP+HR  +LLIN+QM+DGD
Sbjct  656   ESYLSSQDKVYTNIEGKRANLVQSSWALLSLMRAGQAEIDPTPIHRGIRLLINSQMDDGD  715

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ+ITGV+M+NC L+Y+S+R+ FP+ AL EYR+RV
Sbjct  716   FPQQEITGVFMRNCTLNYSSYRNIFPIWALGEYRRRV  752



>sp|F8WQD0.1|SHS1_ASTTA RecName: Full=Shionone synthase; Short=AtaSHS [Aster tataricus]
 dbj|BAK52535.1| shionone synthase [Aster tataricus]
Length=761

 Score =   902 bits (2331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/757 (55%), Positives = 550/757 (73%), Gaps = 5/757 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI +GG  PY+YSTNN+ GRQ WE+DPN GTPEE++  E+AR  F   R +     
Sbjct  1     MWRLKIADGGNNPYLYSTNNFIGRQTWEFDPNYGTPEERDEVEQARLHFWNHRHE-IKPS  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GD   RMQ I+E +    +IP V++ ++EE++Y+ +T  +R++V L  AL A DGHWPAE
Sbjct  60    GDTLWRMQFIREKKFKQ-TIPQVKIEDDEEISYDKVTATMRRSVHLLEALLADDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             NSGP FF  PL++ LYI+G ++ +  +EH+KE++RY+Y+HQN+DGGWGL+++GHS M G+
Sbjct  119   NSGPSFFIQPLVMCLYITGHLNSVFPAEHRKEILRYVYSHQNKDGGWGLHMEGHSIMFGT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              L+Y+ +RLLGEGPD G +GA  R RKWILDHGGA   PSWGK++LS+LGV+EW GCNPL
Sbjct  179   TLSYICMRLLGEGPDGGLNGACTRARKWILDHGGAIANPSWGKVWLSILGVHEWVGCNPL  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFWLFPS  P  P KMW YCR  +MPMSYLY +R+ GP+T +VL LR E++ + Y  I
Sbjct  239   PPEFWLFPSFLPMSPGKMWSYCRLVFMPMSYLYGRRFVGPITPLVLQLRKELYAQPYNDI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
              W  +R  C KED+YYPH  +QDL+W++L   TEP + RWPF K+R+ A+   ++++ YE
Sbjct  299   KWKSSRHVCAKEDIYYPHPLLQDLMWDSLYILTEPLLTRWPFNKLRKKALATTMRHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIG +EK L M+  W EDPNG   K HLAR+PDY+W+AEDGM M  FGSQ WD
Sbjct  359   DENSRYITIGSVEKILCMLACWDEDPNGVCFKKHLARIPDYIWVAEDGMKMQTFGSQVWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
             A+   QA++A+ +  +    L+K H +IK SQV++NP GDFKSMYRH++KGSWTFSDQDH
Sbjct  419   ASIGIQALLATELTHDIAPILKKGHEFIKASQVRDNPSGDFKSMYRHISKGSWTFSDQDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW +SDCT   L C LLL  MP + +GEK D ++L +AV+V L LQS E+GG A WEP  
Sbjct  479   GWQLSDCTTIGLTCCLLLSTMPPETVGEKMDPEQLKDAVNVILSLQS-ENGGLAAWEPAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +L++LNP E   DIV+E E++E TG+ + ALV F+  YP +R KEV   +  A +YL
Sbjct  538   SSNWLEMLNPIEFIEDIVIEHEYVECTGTGMEALVLFKKLYPKHRTKEVESFLTNAARYL  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             +  Q  DGSWYG WG+CF YGT++AL GL A  K+YENC+++  A  F L  Q ++GGWG
Sbjct  598   DNTQMPDGSWYGEWGICFTYGTYYALGGLAAIEKTYENCQSIRKAVRFLLKTQGEDGGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E  +SC    YIPL+G  + +V T+WAMLGLM++ Q ERDP PLHRAAKLLIN+QME+GD
Sbjct  658   ESYRSCAEKIYIPLDGNRSTVVHTAWAMLGLMHSKQEERDPIPLHRAAKLLINSQMENGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQD TG + KNC+LHY  +R+ + L AL++YRK+V
Sbjct  718   FPQQDTTGAFKKNCLLHYPMYRNIYTLWALAQYRKKV  754



>ref|XP_006300769.1| hypothetical protein CARUB_v10019844mg [Capsella rubella]
 gb|EOA33667.1| hypothetical protein CARUB_v10019844mg [Capsella rubella]
Length=769

 Score =   900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/759 (57%), Positives = 559/759 (74%), Gaps = 7/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG--GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLKI  G    PY++STNN+ GRQ WE+DP+AGT EE+ A E+AR+ +   R +    
Sbjct  1     MWKLKIANGNKEDPYLFSTNNFLGRQTWEFDPDAGTEEERAAVEEARRKYFDNRFR-VRA  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  R+Q +K+   +  +IPPV++ +  ++  E  T A+R+ V    ALQA DGHWPA
Sbjct  60    SSDLIWRLQFLKDKSFEQ-TIPPVKVEDANKITSEIATDALRRGVNFLSALQASDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL+  L+++G +  ILT EH++E++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVFCLFVTGHLHEILTKEHRREILRYIYCHQNEDGGWGLHIEGHSTMFC  178

Query  1889  SALNYVALRLLGEGPDDGDG-AIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNY+ +R+LGEGP+ G G A    RKWIL HGGAT IPSWGK +LS+LGV++W G NP
Sbjct  179   TTLNYICMRILGEGPNGGPGNACTLARKWILGHGGATYIPSWGKTWLSILGVFDWSGSNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L LR EI+++ Y +
Sbjct  239   MPPEFWILPSFLPIHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREEIYLQPYAK  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYMR  1356
             I+WN+AR  C KED Y PH  IQD++W+ L   TEPF+  WPF K+ RE A+  A+K++ 
Sbjct  299   INWNRARHLCAKEDAYCPHPQIQDVIWDCLYIFTEPFLTCWPFNKLLREKALGVAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK+L M+  W EDPNG   K HL R+ DYLW+AEDGM M  FGSQ 
Sbjct  359   YEDENSRYITIGCVEKALCMLSCWVEDPNGIHFKKHLLRISDYLWVAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD+ FA QA++AS +  E  D LR+ + + K SQV+ENP GDF +MYRH++KGSWTFSD+
Sbjct  419   WDSGFALQALVASNLANEIPDVLRRGYDFFKHSQVRENPSGDFTNMYRHISKGSWTFSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW  SDCTAE LKC LLL  MP  I+G K D ++LY++V + L LQS ++GG   WEP
Sbjct  479   DHGWQASDCTAEGLKCCLLLSMMPSDIVGPKMDPEQLYDSVTILLSLQS-KNGGVTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                Q +L++LNP+E+FADIV+E E+ E T S I AL+ F+  YP +R +E+N SI KAVQ
Sbjct  538   ARGQEWLELLNPTEVFADIVIEHEYNECTSSAIQALILFKQLYPYHRTEEINTSIKKAVQ  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             Y+E  Q  DGSWYG WGVCF Y T+F L GL AAGK+Y NC A+    HF L+ Q   GG
Sbjct  598   YIESIQMLDGSWYGSWGVCFTYSTWFGLGGLAAAGKTYNNCLAMRKGVHFLLTTQKDNGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP  RYIP EG  +NLVQTSWAM+GL++ GQAERDP PLHRAAKLLIN+Q+E+
Sbjct  658   WGESYLSCPKKRYIPSEGERSNLVQTSWAMMGLLHAGQAERDPAPLHRAAKLLINSQLEN  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+ITG +MKNC+LHYA++R+ FP+ AL+EYR+RV
Sbjct  718   GDFPQQEITGAFMKNCLLHYAAYRNIFPVWALAEYRRRV  756



>emb|CAN77299.1| hypothetical protein VITISV_033299 [Vitis vinifera]
Length=755

 Score =   900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/753 (56%), Positives = 543/753 (72%), Gaps = 19/753 (3%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   + +               
Sbjct  1     MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVKPS---------------  45

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  RMQ ++E      + P V++ + EE+  E  TTAVR+      ALQA DGHWPAE
Sbjct  46    SDLLWRMQFLREKNFKQ-TJPQVKVGDGEEIAXETATTAVRRGAHFFSALQASDGHWPAE  104

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             +SGPLFF PPL++ LYI+G +D +   E++KE++RYLY HQNEDGGWGL+I+ HS M  +
Sbjct  105   HSGPLFFLPPLVMCLYITGHLDTVFPGEYRKEILRYLYCHQNEDGGWGLHIEEHSIMFCT  164

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              L+Y  +R+LGEG D G D A ARGRKWIL+ GG T IP+WGKI+LS+ G+++W G NP+
Sbjct  165   TLSYXCMRILGEGRDGGRDNACARGRKWILBRGGVTSIPTWGKIWLSIFGLFDWSGSNPM  224

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEF LFPS+ P +PAK+WCY R  +MPMSYLY KR+ GP+T +VL LR E+ ++ Y +I
Sbjct  225   PPEFSLFPSHLPMNPAKIWCYSRLIFMPMSYLYGKRFVGPITPLVLELREELFLQPYNEI  284

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
             +W + R  C KEDLYYPH  IQD++W++L  CTEP + RWPF K+R+ A+   +K++ YE
Sbjct  285   NWKKVRHLCAKEDLYYPHPLIQDMMWDSLYICTEPLLTRWPFNKLRKKALEVTMKHIHYE  344

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDY+W  EDG+ M  FGSQ WD
Sbjct  345   DENSRYITIGCVEKVLCMLSCWVEDPNGDYFKKHLARIPDYIWAGEDGIKMQTFGSQEWD  404

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
              + A QA++A  M  E G  L+K H ++KESQVK+NP GDFKSMYRH++KGSWTFSD+DH
Sbjct  405   TSLALQALLACNMTNEIGPTLKKGHEFLKESQVKDNPSGDFKSMYRHISKGSWTFSDKDH  464

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC LL   M  +I+G K +  RL+++V++ L LQS E+GG   WEP  
Sbjct  465   GWQVSDCTAEGLKCCLLFSMMAPEIVGMKIEPGRLFDSVNILLSLQS-ENGGIVGWEPAG  523

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +L++LNPSE+F D+V+E E++E T S I ALV F+  YP +R +E++  I  A +Y+
Sbjct  524   ASEWLELLNPSEMFEDLVIEHEYVECTASAIQALVLFKKLYPEHRTEEIDNFITNATKYI  583

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E QQ  DGSWYG WGVCF+Y +++AL GL AAGK+Y NC A+  A  F L  Q  +GGWG
Sbjct  584   EDQQMPDGSWYGKWGVCFIYSSWWALGGLAAAGKTYHNCLAIGRAVEFLLKSQRDDGGWG  643

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SC   +Y PLEG  +NLVQT WA++GL+ +GQAERDPTPLHRAAKLLIN+QMEDGD
Sbjct  644   ESYISCRDKKYTPLEGNKSNLVQTGWALMGLLSSGQAERDPTPLHRAAKLLINSQMEDGD  703

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEY  171
             FPQQ+ITG +M NCMLH A +R+ FPL AL+EY
Sbjct  704   FPQQEITGAFMNNCMLHCADYRNIFPLWALAEY  736



>ref|XP_010539602.1| PREDICTED: camelliol C synthase-like isoform X5 [Tarenaya hassleriana]
Length=770

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/767 (55%), Positives = 554/767 (72%), Gaps = 10/767 (1%)
 Frame = -3

Query  2444  FSVNIRKMWKLKIGEGGG---PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTK  2274
             F  N  +MW+LKIGEG     PY+YSTN++ GRQ WE+DP+AGTPEE+ A E+ R+ F +
Sbjct  5     FLSNTIRMWRLKIGEGNSKEDPYLYSTNDFVGRQTWEFDPDAGTPEERAAVEETRRSFYE  64

Query  2273  QRQKGPHTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQ  2094
              R +      DL  R+  ++E E     IPPV++ + +++  E +T A+R+ +R   ALQ
Sbjct  65    NRYR-VKASSDLLCRIYFLEEFEQ---LIPPVKVEDNDDIPPETLTNALRRGIRFFSALQ  120

Query  2093  AKDGHWPAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYI  1914
             A DGHWPAEN+GPLF  PPL+  LYI+G +D I ++EH+K+ + Y+Y HQNEDGGWGL+I
Sbjct  121   ADDGHWPAENAGPLFPLPPLVFCLYITGVLDEIFSAEHRKQALWYIYCHQNEDGGWGLHI  180

Query  1913  DGHSTMIGSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGV  1737
             +GHSTM  + LNY+ +R+LGEGPD G + A  R R+WILDHGG T IPSWGK +L++LGV
Sbjct  181   EGHSTMFCTTLNYICMRILGEGPDGGRENACTRARQWILDHGGVTYIPSWGKAWLAILGV  240

Query  1736  YEWDGCNPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNE  1557
             ++W G NP+ PEFW+ PS  P HPA M CY R  YMP+SYLY KR+  P+T ++L LR E
Sbjct  241   FDWSGSNPMPPEFWILPSFLPIHPANMMCYSRMVYMPLSYLYGKRFVAPITPLILKLRKE  300

Query  1556  IHVKSYEQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAM  1380
             +++  YE I+WN+ R  C KEDLYY H  IQDL+W+ L    EPF+ RWPF K+ RE A+
Sbjct  301   MYLHPYETINWNKVRHLCAKEDLYYLHPLIQDLIWDCLYVIVEPFLTRWPFNKLLREKAL  360

Query  1379  RKAIKYMRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMS  1200
             + A+K++ YE E +RYITIG +EK+L M+  W EDP+GD  K HLAR+PDYLW+AEDGM 
Sbjct  361   KVAMKHIHYEDENSRYITIGSVEKALCMLACWVEDPHGDYFKKHLARIPDYLWVAEDGMK  420

Query  1199  MHGFGSQNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTK  1020
             M G  SQ WD   A QA++AS + +E  + LR+ H ++K+SQV ENP GDFKSMYRH+++
Sbjct  421   MQGLASQLWDTGLAIQALLASNLSDEISNVLRRGHDFLKKSQVAENPSGDFKSMYRHISR  480

Query  1019  GSWTFSDQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPES  840
             G+WTFS++DHGW VSDCTAE LKC LLL  MP  ++G K +   LY+AV++ L LQS E+
Sbjct  481   GAWTFSERDHGWQVSDCTAEGLKCCLLLSMMPPDVVGPKLNPGPLYDAVNIILSLQS-EN  539

Query  839   GGFATWEPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVN  660
             GG   WEP     +L++ NPSE F + ++E ++ E T S I ALV FR  YP++R +E+N
Sbjct  540   GGVTPWEPARAYGWLELFNPSEFFVNNLIEYQYCECTSSAIQALVLFRQLYPDHRAEEIN  599

Query  659   ISIAKAVQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFL  480
               + KAV+Y+E  Q  DGSWYG WGVCF YGT+FAL GL  AGK+Y NC A+     F L
Sbjct  600   NFLEKAVEYIENVQMPDGSWYGSWGVCFTYGTWFALAGLAEAGKTYGNCLAMRKGVRFLL  659

Query  479   SKQNQEGGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKL  300
               Q   GGWGE   SCP  RYIP EG  +NLVQT+WA++GL++ GQAERDPTPLH A KL
Sbjct  660   ETQKDNGGWGESYLSCPKKRYIPTEGERSNLVQTAWAVMGLLHAGQAERDPTPLHPAVKL  719

Query  299   LINAQMEDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             +IN+Q+E+GDFPQQ+ITG  M++CM+HYA++R+ FPL ALS+YR+ V
Sbjct  720   IINSQLENGDFPQQEITGAVMRSCMMHYAAYRNTFPLWALSQYRRLV  766



>ref|XP_002310351.1| hypothetical protein POPTR_0007s15210g [Populus trichocarpa]
 gb|EEE90801.1| hypothetical protein POPTR_0007s15210g [Populus trichocarpa]
Length=759

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/757 (56%), Positives = 540/757 (71%), Gaps = 7/757 (1%)
 Frame = -3

Query  2423  MWKLKIGE-GGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI E G  PYI++TN YAGRQIWEYDPNAGTPEE+E  E+AR+ FTK R K     
Sbjct  1     MWRLKIAEKGNNPYIFTTNEYAGRQIWEYDPNAGTPEEREQVEEARRNFTKNRSK-VKPS  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  + Q+++E      +IP VR+ E EEV YE  TTA++++     ALQA DGHWPAE
Sbjct  60    SDLLWQYQILREKNFKQ-TIPAVRVEEGEEVTYEKTTTAMKRSASFYSALQASDGHWPAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             NSG LFF PP +   YI+G ++ +   E++KE+ RY+YNHQNEDGGWGL+I+ HS M  +
Sbjct  119   NSGVLFFLPPFVFCFYITGHLNTMFPPEYRKEIFRYIYNHQNEDGGWGLHIESHSNMFCT  178

Query  1886  ALNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
               +Y+ LR+LG GPD+   A ARGRKWILD GG T IPSWGK +LS+LG+++W GCNP+ 
Sbjct  179   TFSYICLRMLGVGPDEE--ACARGRKWILDRGGVTSIPSWGKTWLSILGLFDWSGCNPMP  236

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFW+ P+  P HPAKMWCYCR  YMPMSYLY KR+ GP+T ++L+LR E++++ YE + 
Sbjct  237   PEFWILPTALPVHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILSLREELYLQPYESVK  296

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRYE  1350
             W Q R  C +EDLYYPHS IQD LW++L   +EP + RWPF + +R+ A+   +K++ YE
Sbjct  297   WKQVRHLCAEEDLYYPHSLIQDFLWDSLYLMSEPLLTRWPFNQLVRKKALEVTMKHIHYE  356

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDP+G   K HLARVPDYLW+ EDGM +  FGSQ WD
Sbjct  357   DENSRYITIGCVEKVLCMLSCWVEDPDGVAFKRHLARVPDYLWVGEDGMKVQSFGSQLWD  416

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
             A F  QA+  S + EE    L K   +IK+SQV +NP GDF  MYRH++KGSWTFSDQDH
Sbjct  417   ATFGFQALYTSELGEEIKPTLAKAFDFIKKSQVVDNPAGDFVGMYRHISKGSWTFSDQDH  476

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW +SDCTAE LKC+L    +P + IGEK D Q ++EAV++ L LQ P  GG A WEP  
Sbjct  477   GWQLSDCTAEALKCVLFAQMLPTEYIGEKMDPQMIFEAVNIILSLQGPR-GGLAGWEPIR  535

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
              + +L+ LNP E   +IV+E +++E T S I   V F   YP +R KE+   IA+AV YL
Sbjct  536   GEMWLEKLNPMEFLENIVIEHDYVECTSSAIHGFVMFMKMYPGHRKKEIETFIARAVDYL  595

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSWYG WGVCF+Y T+FAL+GL AAGK+Y N +A+     F L  Q+ +GGWG
Sbjct  596   EMIQMPDGSWYGNWGVCFIYSTWFALVGLAAAGKTYYNNQAMRRGVDFLLRAQSPDGGWG  655

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP+  Y PLE   +  VQT WAMLGL+++GQA+RDPTPLHR AKLLIN+Q EDG 
Sbjct  656   ESYLSCPNKIYTPLEEKRSTYVQTGWAMLGLIHSGQADRDPTPLHRGAKLLINSQAEDGS  715

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             +PQQ+ITGV+  NCMLHY ++++ FPL AL+EYRK V
Sbjct  716   YPQQEITGVFKNNCMLHYPTYKNVFPLWALAEYRKNV  752



>gb|KHN00954.1| Lupeol synthase [Glycine soja]
Length=755

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/756 (56%), Positives = 544/756 (72%), Gaps = 5/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI EGG   I S N++ GRQ W +DPNAGTP+E+   E+ R  FTK R     +  
Sbjct  1     MWKLKIAEGGKGLI-SVNDFIGRQHWIFDPNAGTPQERAEVERLRHQFTKNRFSIKQS-A  58

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DL MRMQ+ KE++   +  P V++R+ E +  E + T +R+ +    ++QA DGHWPAE+
Sbjct  59    DLLMRMQLTKENQCGPIP-PAVKVRDTENITMEDLITTIRRGISFYSSIQAHDGHWPAES  117

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GPLFF  PL++ALYI+GS+D++L  EHKKE+VRYLYNHQNEDGGWG +I+GHS+M GSA
Sbjct  118   AGPLFFLQPLVMALYITGSLDVVLGPEHKKEIVRYLYNHQNEDGGWGFHIEGHSSMFGSA  177

Query  1883  LNYVALRLLGEGPDDGD-GAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             L+Y+ALR+LGEG  DG+  A+ R RKWILDHGG   IPSWGK +++VLGVYEW GCNPL 
Sbjct  178   LSYIALRILGEGSQDGEERAMDRARKWILDHGGLVAIPSWGKFWVTVLGVYEWSGCNPLP  237

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWL P   P HP KM CYCR  YMPMSYLY K++ GP+T ++ +LR E++ + Y+QI+
Sbjct  238   PEFWLLPKCSPIHPGKMLCYCRLVYMPMSYLYGKKFVGPITSLIRSLREEVYNEPYDQIN  297

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+AR    KEDLYYPH  IQD+LW  L +  E  M  WPF  +R+ A+  AI ++RYE 
Sbjct  298   WNKARNIVAKEDLYYPHPMIQDMLWGFLHHVGERVMNCWPFSMLRQKALEIAINHVRYED  357

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E +RY+ IG +EK L ++  W EDPN +  K HLAR+PDY WLAEDG+ +  FG Q WDA
Sbjct  358   ENSRYLCIGSVEKVLCLIARWVEDPNSEAYKLHLARIPDYFWLAEDGLKIQSFGCQMWDA  417

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
             AFA QAI+A  + EEYG  LRK H ++K SQV+ENP GDFK+MYRH++KGSWTFS  DHG
Sbjct  418   AFAIQAILACNVSEEYGPTLRKAHSFVKASQVRENPSGDFKAMYRHISKGSWTFSMHDHG  477

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE LK  LLL EM   ++GE+ + +RLY+AV+V L LQS  +GGF  WEP   
Sbjct  478   WQVSDCTAEGLKAALLLSEMATDLVGEEMEAERLYDAVNVILSLQS-SNGGFPAWEPQRA  536

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
               +L+  NP+E F D ++E E++E TGS +  L  FR  YP +R KE++  I+ A+ Y+E
Sbjct  537   YRWLEKFNPTEFFEDTLIEMEYVECTGSAMQGLALFRKLYPKHRRKEIDHCISNAIHYIE  596

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
               Q  DGSWYG WG+C+ YGT+FA++GLTA GK+Y N  ++  A  F LSKQ   GGWGE
Sbjct  597   NTQNPDGSWYGCWGICYTYGTWFAVVGLTACGKNYHNSPSLRKACKFLLSKQLPNGGWGE  656

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                S  +  Y  LEG   NLVQTSWA+L L+  GQAE DPTP+HR  KLLIN+QMEDGDF
Sbjct  657   SYLSSQNKVYTNLEGNRANLVQTSWALLSLIDAGQAEIDPTPIHRGIKLLINSQMEDGDF  716

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PQQ+ITGV+M+NC L+Y+S+R+ FP+ AL EYR RV
Sbjct  717   PQQEITGVFMRNCTLNYSSYRNIFPIWALGEYRCRV  752



>gb|KEH27290.1| beta-amyrin synthase [Medicago truncatula]
Length=762

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/756 (56%), Positives = 546/756 (72%), Gaps = 5/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI EGG   I S NN+ GRQ WE+DPNAGTPEE    E+ R  FTK R     +  
Sbjct  1     MWKLKIAEGGEGLI-SVNNFIGRQHWEFDPNAGTPEEHAEIERLRIQFTKNRFSIKQS-S  58

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DLFMRMQ+ KE++   +  P V+LREE+ +  EA+ T +++A+    ++QA DGHWPAE+
Sbjct  59    DLFMRMQLKKENQCSPIP-PAVKLREEDIITGEALITTIKRAISFYSSIQAHDGHWPAES  117

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GPLFF  PL++ALYI+GS+D +L  +HKKE+VRYLYNHQNEDGGWG +I+GHSTM GSA
Sbjct  118   AGPLFFVQPLVMALYITGSLDEVLGPQHKKEIVRYLYNHQNEDGGWGFHIEGHSTMFGSA  177

Query  1883  LNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             L+Y+ALRLLGEGP+DG D A+ R R WILDHGG   IPSWGK +++VLGVYEW GCNPL 
Sbjct  178   LSYIALRLLGEGPEDGEDKAMERCRNWILDHGGLVAIPSWGKFWVTVLGVYEWRGCNPLP  237

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFW  P   P HP KM CYCR  YMPMSYLY K++ GP+TD++ +LR E++ + Y+QI+
Sbjct  238   PEFWFLPKFTPIHPGKMLCYCRLVYMPMSYLYGKKFVGPITDLIKSLREELYNQPYDQIN  297

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+AR    KEDLYYPH  IQD+LW  L +  EPF+  WPF K+R+ A+  AI ++ YE 
Sbjct  298   WNKARNTIAKEDLYYPHPMIQDMLWGFLYHVGEPFLNCWPFTKLRQKALEIAINHVGYED  357

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E +RY+ IG +EK L ++  W EDPN +  K HLAR+PDY WLAEDG+ +  FG Q WDA
Sbjct  358   ENSRYLCIGSVEKVLCLIARWVEDPNSEAYKLHLARIPDYFWLAEDGLKIQSFGCQMWDA  417

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
             AFA QAI+A  + EEYG  L K H ++K SQV ENP G+FK+MYRH+ KGSWTFS  D G
Sbjct  418   AFAIQAILACNVSEEYGPTLWKAHDFLKASQVVENPSGEFKAMYRHICKGSWTFSMHDQG  477

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE LK  LLL +MP  ++GEK + +RLY+AV+V L LQS  +GGF  WEP   
Sbjct  478   WQVSDCTAEGLKAALLLSKMPSDLVGEKLESERLYDAVNVILSLQS-SNGGFPAWEPQNA  536

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
               +L+  NP+E F D ++E E+ E TGS + AL  F   +P +R KE++  ++KA+ Y+E
Sbjct  537   YSWLEKFNPTEFFEDTLIEREYAECTGSAMQALYLFTKLHPTHRAKEIHHCLSKAINYIE  596

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
               Q  DGSWYG WG+C+ YGT+FA+ GLTA GK+Y N  ++  A  F LSKQ  +GGWGE
Sbjct  597   NTQNPDGSWYGCWGICYTYGTWFAVEGLTACGKNYHNSPSLRKACQFLLSKQLPDGGWGE  656

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                S  +  Y  LE    NLVQTSWA+L L+  GQA+ DPTP+HR  KL+IN+QMEDGDF
Sbjct  657   SYLSSQNKVYTNLEDNRANLVQTSWALLSLISAGQADIDPTPIHRGMKLIINSQMEDGDF  716

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PQQ+ITGV+M+NC L+Y+S+R+ FP+ AL EYR +V
Sbjct  717   PQQEITGVFMRNCTLNYSSYRNIFPIWALGEYRHQV  752



>ref|XP_006606308.1| PREDICTED: lupeol synthase-like isoform X1 [Glycine max]
 ref|XP_006606309.1| PREDICTED: lupeol synthase-like isoform X2 [Glycine max]
Length=755

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/756 (56%), Positives = 544/756 (72%), Gaps = 5/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI EGG   I S N++ GRQ W +DPNAGTP+E+   E+ R  FTK R     +  
Sbjct  1     MWKLKIAEGGKGLI-SVNDFIGRQHWIFDPNAGTPQERAEVERLRHQFTKNRFSIKQS-A  58

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DL MRMQ+ KE++   +  P V++R+ E +  E + T +R+ +    ++QA DGHWPAE+
Sbjct  59    DLLMRMQLTKENQCGPIP-PAVKVRDTENITMEDMITTIRRGISFYSSIQAHDGHWPAES  117

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GPLFF  PL++ALYI+GS+D++L  EHKKE+VRYLYNHQNEDGGWG +I+GHS+M GSA
Sbjct  118   AGPLFFLQPLVMALYITGSLDVVLGPEHKKEIVRYLYNHQNEDGGWGFHIEGHSSMFGSA  177

Query  1883  LNYVALRLLGEGPDDGD-GAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             L+Y+ALR+LGEG  DG+  A+ R RKWILDHGG   IPSWGK +++VLGVYEW GCNPL 
Sbjct  178   LSYIALRILGEGSQDGEERAMDRARKWILDHGGLVAIPSWGKFWVTVLGVYEWSGCNPLP  237

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWL P   P HP KM CYCR  YMPMSYLY K++ GP+T ++ +LR E++ + Y+QI+
Sbjct  238   PEFWLLPKCSPIHPGKMLCYCRLVYMPMSYLYGKKFVGPITSLIRSLREEVYNEPYDQIN  297

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+AR    KEDLYYPH  IQD+LW  L +  E  M  WPF  +R+ A+  AI ++RYE 
Sbjct  298   WNKARNIVAKEDLYYPHPMIQDMLWGFLHHVGERVMNCWPFSMLRQKALEIAINHVRYED  357

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E +RY+ IG +EK L ++  W EDPN +  K HLAR+PDY WLAEDG+ +  FG Q WDA
Sbjct  358   ENSRYLCIGSVEKVLCLIARWVEDPNSEAYKLHLARIPDYFWLAEDGLKIQSFGCQMWDA  417

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
             AFA QAI+A  + EEYG  LRK H ++K SQV+ENP GDFK+MYRH++KGSWTFS  DHG
Sbjct  418   AFAIQAILACNVSEEYGPTLRKAHSFVKASQVRENPSGDFKAMYRHISKGSWTFSMHDHG  477

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE LK  LLL EM   ++GE+ + +RLY+AV+V L LQS  +GGF  WEP   
Sbjct  478   WQVSDCTAEGLKAALLLSEMATDLVGEEMEAERLYDAVNVILSLQS-SNGGFPAWEPQRA  536

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
               +L+  NP+E F D ++E E++E TGS +  L  FR  YP +R KE++  I+ A+ Y+E
Sbjct  537   YRWLEKFNPTEFFEDTLIEMEYVECTGSAMQGLALFRKLYPKHRRKEIDHCISNAIHYIE  596

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
               Q  DGSWYG WG+C+ YGT+FA++GLTA GK+Y N  ++  A  F LSKQ   GGWGE
Sbjct  597   NTQNPDGSWYGCWGICYTYGTWFAVVGLTACGKNYHNSPSLRKACKFLLSKQLPNGGWGE  656

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                S  +  Y  LEG   NLVQTSWA+L L+  GQAE DPTP+HR  KLLIN+QMEDGDF
Sbjct  657   SYLSSQNKVYTNLEGNRANLVQTSWALLSLIDAGQAEIDPTPIHRGIKLLINSQMEDGDF  716

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PQQ+ITGV+M+NC L+Y+S+R+ FP+ AL EYR RV
Sbjct  717   PQQEITGVFMRNCTLNYSSYRNIFPIWALGEYRCRV  752



>dbj|BAF35580.1| multifunctional triterpene synthase [Kandelia candel]
Length=761

 Score =   898 bits (2320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/755 (55%), Positives = 554/755 (73%), Gaps = 5/755 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI EGG  PYIYSTNN+ GRQ WE++P AGTPEE+   E+AR+ F + R +    C
Sbjct  1     MWRLKIAEGGDNPYIYSTNNFLGRQTWEFEPEAGTPEERAQVEEARQNFWRDRFR-IKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  R Q ++E +   + IP  ++++ EE+  +  TTA+R++V L  ALQA DGHW AE
Sbjct  60    SDLLWRFQFLREKKFKQI-IPQGKVQDGEEITRDIATTALRRSVHLLSALQASDGHWCAE  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             NSGP+F+ PP++ ALYI+G +  + ++EH KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NSGPMFYVPPMVFALYITGHLTTVFSAEHCKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              LNY+ +R+LGEG D G D A  R RKWILDHG AT I SWGK +L++LGVYEWDGCNP+
Sbjct  179   VLNYICMRILGEGRDGGKDNACERARKWILDHGSATAISSWGKTWLAILGVYEWDGCNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+FP+ FP HPAKM CYCR TY+ MSYLY K++ GP+T ++L LR EI+ + Y++I
Sbjct  239   PPEFWVFPTFFPIHPAKMLCYCRLTYIAMSYLYGKKFVGPITPLILQLREEIYNEPYDEI  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
             +W++ R  C KED +YPH+  Q +LW+A+   +EP ++RWP+ K+R+ A++  I ++ YE
Sbjct  299   NWSRMRHLCAKEDNHYPHTLTQIILWDAIYLLSEPLLKRWPWSKLRKKALKITIDHIHYE  358

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIGC+EK L M+  W EDPNGD  K HLAR+ DY+WLAEDGM +  FGSQ WD
Sbjct  359   DENSRYITIGCVEKPLNMLACWHEDPNGDAFKKHLARISDYVWLAEDGMKIQSFGSQAWD  418

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
              +F  QA+IAS ++ E    L K H +IK+SQV ENP GDF+ M+RH++KGSWTFSD+DH
Sbjct  419   TSFVLQALIASNLLSETAPTLEKGHNFIKDSQVTENPSGDFRRMFRHISKGSWTFSDKDH  478

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE+LKC LL   MP +++G K + QR+Y+AV+V + LQS ++GG + WE   
Sbjct  479   GWQVSDCTAESLKCCLLFSMMPPELVGRKMEPQRVYDAVNVIISLQS-KNGGCSAWEQAG  537

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
                +++ LNP E   D+V+E E+IE T S + ALV F+  YP +R KE+   I  AV+++
Sbjct  538   AGSWMEWLNPVEFLEDLVIEHEYIECTSSSVQALVLFKKLYPEHRRKEIENFIVNAVRFI  597

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E+ Q+ DGSWYG WG+CFL+GT+F L GL  AGK+Y NC AV     F L  Q ++ GWG
Sbjct  598   EEIQKPDGSWYGNWGICFLFGTWFGLKGLATAGKTYYNCTAVRKGVEFLLRTQREDSGWG  657

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP   Y+PLEG  +NL+ T+ AM+GL+ +GQAERDPTPLHRA KLLIN+Q E GD
Sbjct  658   ESYLSCPKKVYVPLEGNQSNLIHTALAMMGLILSGQAERDPTPLHRALKLLINSQTELGD  717

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             FPQQ+I+G +M+NCMLHY+++R  FP+ AL+EY K
Sbjct  718   FPQQEISGCFMRNCMLHYSAYRDIFPMWALAEYCK  752



>dbj|BAE43643.1| putative oxidosqulene cyclase [Euphorbia tirucalli]
Length=766

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/759 (55%), Positives = 549/759 (72%), Gaps = 8/759 (1%)
 Frame = -3

Query  2423  MWKLKIGE-GGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LKI E G  P IYSTNN+ GRQIWEYD NAGTP++    E AR  F   R    P +
Sbjct  1     MWRLKIAEQGNNPNIYSTNNFLGRQIWEYDANAGTPQDIAEVEDARLRFWNNRFHIKPSS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  + Q ++E +     IP VR++E+EEV YEA T A+R+ V L  ALQAKDGHWPA
Sbjct  61    --DLLWQFQFLREKKFKQ-RIPAVRIKEDEEVTYEAATAALRRGVHLFSALQAKDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GP+FF PP++  LYI+  +D +L+ EH  E++RY+Y HQNEDGGWGL+I+GHS M  
Sbjct  118   ENAGPMFFVPPMVFCLYITSQLDNVLSKEHIIEILRYIYCHQNEDGGWGLHIEGHSMMFS  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNY+ +R+LGEGP+ G + A  R RKWILDHG AT I SWGK +LS+LGVYEW+G +P
Sbjct  178   TVLNYICMRILGEGPNGGLENACERARKWILDHGSATAISSWGKTWLSILGVYEWEGSHP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW  P+ FP HPAKM+CYCR TYMPMSYLY K++ GPLT ++L LR EI+ + Y  
Sbjct  238   MPPEFWFLPTMFPIHPAKMFCYCRMTYMPMSYLYGKKFVGPLTPLILQLRQEIYNQPYHT  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I+W   R  C KED YYP ++IQ L+W++L   TEP +RRWPF K+RE A++K + ++ Y
Sbjct  298   INWKSIRHLCAKEDNYYPRTWIQKLMWDSLYIFTEPILRRWPFNKLREKALKKTMDHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYI IG +EK L M+  W  DPNGD  K HLAR+ DY+W+ EDG+ +  FGSQ W
Sbjct  358   EDENSRYIVIGSVEKPLNMLACWVGDPNGDAFKKHLARIVDYIWVGEDGLKVQSFGSQVW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA+F  QA+IAS + +E G  L   H ++K SQV ENP GD KSM+RH++KG+WTFSD+D
Sbjct  418   DASFGLQALIASNLSDEIGPILNHGHNFLKNSQVTENPYGDHKSMFRHISKGAWTFSDKD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE+LKC LL   MP +I+GEK +  +LY+AV++ L LQS E+GG + WEP 
Sbjct  478   HGWQVSDCTAESLKCCLLFSLMPSEIVGEKLEAGKLYDAVNILLSLQS-ENGGLSGWEPA  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                P+L+ LNP E   D+VVE E++E T S I AL  F+  YP +R KE+   IAKAV++
Sbjct  537   RGSPWLEWLNPVEFLEDLVVEHEYVECTSSSIQALTLFKKLYPGHRTKEIENFIAKAVKF  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E+ Q+ DGSWYG WG+CF+YGT+F L GL AAG SYENC A+     F L+ Q  +GGW
Sbjct  597   IEEIQKPDGSWYGNWGICFIYGTWFGLGGLAAAGNSYENCIAIRRGVEFLLNSQRVDGGW  656

Query  452   GECLQSCPSMRYIPLEGTG-TNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
              E   SCP+  Y+ ++G G +NLVQT++A+LGL++ GQA+ DPTPLHR  K LIN+Q + 
Sbjct  657   AESYLSCPNKVYVGVDGDGRSNLVQTAFAVLGLIHGGQAKTDPTPLHRGVKFLINSQTQL  716

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ++TG +M+NCMLHYA +R+ FPL AL+EYR+ V
Sbjct  717   GDFPQQELTGAFMRNCMLHYALYRNIFPLWALAEYRRNV  755



>ref|NP_178016.2| beta-amyrin synthase [Arabidopsis thaliana]
 sp|B6EXY6.2|LUP4_ARATH RecName: Full=Beta-amyrin synthase; Short=AtBAS; AltName: Full=Lupeol 
synthase 4; Short=AtLUP4 [Arabidopsis thaliana]
 gb|AEE36183.1| beta-amyrin synthase [Arabidopsis thaliana]
Length=759

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/759 (55%), Positives = 552/759 (73%), Gaps = 7/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LKIGEG G  PY+++TNN+AGRQ WE+DP+ G+PEE+ +  +AR+ F   R      
Sbjct  1     MWRLKIGEGNGDDPYLFTTNNFAGRQTWEFDPDGGSPEERHSVVEARRIFYDNRFH-VKA  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E + +   I PV++ + E+V +E  T+A+R+ +    ALQA DGHWPA
Sbjct  60    SSDLLWRMQFLREKKFEQ-RIAPVKVEDSEKVTFETATSALRRGIHFFSALQASDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL+  LYI+G +D + TSEH+KE++RY+Y HQ EDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVFCLYITGHLDEVFTSEHRKEILRYIYCHQKEDGGWGLHIEGHSTMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNY+ +R+LGE PD G D A  R R+WIL HGG T IPSWGK +LS+LGV++W G NP
Sbjct  179   TTLNYICMRILGESPDGGHDNACGRAREWILSHGGVTYIPSWGKTWLSILGVFDWSGSNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS FP HPAKMW YCR  Y+PMSYLY KR+ GP+T ++L LR E++++ YE+
Sbjct  239   MPPEFWILPSFFPVHPAKMWSYCRMVYLPMSYLYGKRFVGPITSLILQLRKELYLQPYEE  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYMR  1356
             I+W + R  C KED YYP   +Q+L+W++L    EPF+ RWPF K+ RE A++ A+K++ 
Sbjct  299   INWMKVRHLCAKEDTYYPRPLVQELVWDSLYIFAEPFLARWPFNKLLREKALQLAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDPNGD  K HL+R+ DYLW+AEDGM M  FGSQ 
Sbjct  359   YEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLSRISDYLWMAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS +  E  D LR+ H +IK SQV ENP GD+KSMYRH++KG+WTFSD+
Sbjct  419   WDTGFAMQALLASNLSSEISDVLRRGHEFIKNSQVGENPSGDYKSMYRHISKGAWTFSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTA  LKC LL   +   I+G K D +RL+++V++ L LQS ++GG   WEP
Sbjct  479   DHGWQVSDCTAHGLKCCLLFSMLAPDIVGPKQDPERLHDSVNILLSLQS-KNGGMTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+E+F+DIV+E E+ E T S I AL  F+  YP++R  E+   I KA +
Sbjct  538   AGAPKWLELLNPTEMFSDIVIEHEYSECTSSAIQALSLFKQLYPDHRTTEITAFIKKAAE  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q  DGSWYG WG+CF YGT+FAL GL AAGK++ +CEA+     F L+ Q   GG
Sbjct  598   YLENMQTRDGSWYGNWGICFTYGTWFALAGLAAAGKTFNDCEAIRKGVQFLLAAQKDNGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SC    YI   G  +N+VQT+WA++GL+++GQAERDP PLHRAAKL+IN+Q+E 
Sbjct  658   WGESYLSCSKKIYIAQVGEISNVVQTAWALMGLIHSGQAERDPIPLHRAAKLIINSQLES  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ  TGV++KNC LHYA++R+  PL AL+EYR RV
Sbjct  718   GDFPQQQATGVFLKNCTLHYAAYRNIHPLWALAEYRARV  756



>ref|XP_006389937.1| hypothetical protein EUTSA_v10018165mg [Eutrema salsugineum]
 gb|ESQ27223.1| hypothetical protein EUTSA_v10018165mg [Eutrema salsugineum]
Length=765

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/761 (58%), Positives = 557/761 (73%), Gaps = 9/761 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLKI  G    PY++STNN+ GRQ WE+DP+AGT EE+ A E+AR+ F   R +    
Sbjct  1     MWKLKIANGNKEEPYLFSTNNFLGRQTWEFDPDAGTAEERAAVEEARRNFFDDRFR-VKA  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPP--VRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2076
               DL  RMQ +KE + +  SIPP  V++ + +++  EA T A+R+ V    ALQA DGHW
Sbjct  60    SSDLIWRMQFLKEKKFEE-SIPPAPVKVEDAKKITSEAATNALRRGVNFLSALQASDGHW  118

Query  2075  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  1896
             PAEN+GPLFF PPL+  L+++G +  I T EH +E +RY+Y HQNEDGGWGL+I+GHSTM
Sbjct  119   PAENAGPLFFLPPLVFCLFVTGHLQEIFTKEHLRETLRYIYCHQNEDGGWGLHIEGHSTM  178

Query  1895  IGSALNYVALRLLGEGPDDGDG-AIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGC  1719
               + LNY+ +RLLGEGP+ G G A  R RKWIL HGGAT IPSWGK +LS+LGV++W G 
Sbjct  179   FCTTLNYICVRLLGEGPNGGPGNACERARKWILSHGGATYIPSWGKTWLSILGVFDWSGS  238

Query  1718  NPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSY  1539
             NP+ PEFW+ PS  P HPAKMWCYCR  YMPMSYLY KR+ GP + ++L LR EI+++ Y
Sbjct  239   NPMPPEFWILPSFLPIHPAKMWCYCRLVYMPMSYLYGKRFVGPTSPLILQLREEIYLQPY  298

Query  1538  EQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKY  1362
              +I+WN+AR  C KED YYP   +QD++W+ L   +EPF+  WPF K+ RE A+   +K+
Sbjct  299   AEINWNRARHLCAKEDAYYPRPLVQDVIWDCLYIFSEPFLTCWPFNKLLREKALGVTMKH  358

Query  1361  MRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGS  1182
             + YE E +RYITIGC+EK+L M+  W EDPNG   K HL R+ DYLW+AEDGM M  FGS
Sbjct  359   IHYEDENSRYITIGCVEKALCMLACWVEDPNGIYFKKHLLRISDYLWIAEDGMKMQSFGS  418

Query  1181  QNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFS  1002
             Q WD+ FA QA++AS +  E  D LR+ + ++K SQV+ENP  DF SM+RH++KGSWTFS
Sbjct  419   QLWDSGFALQALVASNLSNEIPDVLRRGYEFLKNSQVRENPSSDFTSMHRHISKGSWTFS  478

Query  1001  DQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATW  822
             D+DHGW  SDCTAE LKC LLL  MP  IIG K D ++LYE+V + L LQS ++GG   W
Sbjct  479   DRDHGWQASDCTAEGLKCCLLLSMMPPDIIGPKMDPEQLYESVTILLSLQS-KNGGVTAW  537

Query  821   EPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKA  642
             EP   Q +L++LNP+E FADIVVE E+ E T S I ALV F+  YP +R +E+N SI KA
Sbjct  538   EPARGQEWLELLNPTEFFADIVVEHEYNECTSSTIQALVLFKQLYPKHRTEEINSSIKKA  597

Query  641   VQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQE  462
             VQY+E  Q  DGSWYG WGVCF Y T+F L GL AAGK+Y NC A+    HF L+ Q   
Sbjct  598   VQYIENIQMIDGSWYGSWGVCFTYSTWFGLGGLAAAGKTYNNCLAMRKGVHFLLTTQKDN  657

Query  461   GGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQM  282
             GGWGE   SC   RYIP EG  +NLVQTSWAM+GL++ GQAERDPTPLHRAAKLLIN+Q+
Sbjct  658   GGWGESYLSCSRKRYIPSEGERSNLVQTSWAMMGLLHAGQAERDPTPLHRAAKLLINSQL  717

Query  281   EDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             E+GDFPQQ+ITG +MKNC+LHYA++R+ FP+ AL+EYR+RV
Sbjct  718   ENGDFPQQEITGAFMKNCLLHYAAYRNIFPVWALAEYRRRV  758



>emb|CDX87419.1| BnaA07g34540D [Brassica napus]
Length=765

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/759 (56%), Positives = 563/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGF--TKQRQKGP  2256
             MWKLKIGEG G  PY++S+NN+ GRQ WE+DP AGT EE+ A E+AR+ F   + R KG 
Sbjct  1     MWKLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTAEERAAVEEARRHFLINRSRVKG-  59

Query  2255  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2076
               C DL  RMQ +KE+  +  +IPPV++   E + +E  T A+R+ V    ALQA DGHW
Sbjct  60    --CSDLVWRMQFLKEARFEQ-AIPPVKIDGNESITHEKSTDALRRGVSFFSALQASDGHW  116

Query  2075  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  1896
             P E +GPLFF PPL+  LYI+G ++ +   EH+KE++R++Y HQNEDGGWGL+I+G S M
Sbjct  117   PGEITGPLFFLPPLVFCLYITGHLEKVFDEEHRKEMLRHVYCHQNEDGGWGLHIEGRSIM  176

Query  1895  IGSALNYVALRLLGEGPDDGDG-AIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGC  1719
               +ALNY+ LR+LGEGP+ G   A  R RKWILD GG T IPSWGKI+LS+LG+Y+W G 
Sbjct  177   FCTALNYICLRILGEGPNGGGENACKRARKWILDRGGVTYIPSWGKIWLSILGLYDWSGT  236

Query  1718  NPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSY  1539
             NP+ PE WL PS  P H AK  CYCR  YMPMSYLY KR+ GP+T ++L LR+E+H++ Y
Sbjct  237   NPMPPEIWLLPSFLPIHLAKTLCYCRMVYMPMSYLYGKRFVGPVTPLILQLRDELHLQPY  296

Query  1538  EQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKY  1362
             E+I+WN+ R    KED+Y+PH  IQDL+W+AL    EP + RWP  K +RE A+R A+K+
Sbjct  297   EEINWNKTRRLYAKEDMYFPHPLIQDLVWDALYILVEPVLTRWPLNKLVREKALRLAMKH  356

Query  1361  MRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGS  1182
             + YE E + YITIGC+EK L M+  W E+PNGD  K HLAR+PDY+W+AEDGM M  FGS
Sbjct  357   IHYEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGS  416

Query  1181  QNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFS  1002
             Q WD  FA QAI+AS + +E G+ L+K H YIK+SQV+ENP GDFKSMYRH++KG+WT S
Sbjct  417   QLWDTGFAVQAILASELFDETGNVLKKGHDYIKKSQVRENPSGDFKSMYRHISKGAWTLS  476

Query  1001  DQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATW  822
             D+DHGW VSDCTAE LKC LLL  MP +++G+  D +++Y++V++ L  QS E+GG   W
Sbjct  477   DRDHGWQVSDCTAEALKCCLLLSMMPAEVVGQGIDPEQIYDSVNLLLSFQS-ENGGMTAW  535

Query  821   EPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKA  642
             EP     +++ LNP+E  A++V E E++E T S+I AL+ F+  YP++R KE++ SI KA
Sbjct  536   EPVRAYEWIEFLNPTEFLANLVAEREYVECTSSVIQALILFKQLYPDHRTKEISRSIEKA  595

Query  641   VQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQE  462
             VQ++E +Q  DGSWYG WGVCF+YGT+FAL+GL AAGK+Y+   A+     F L  Q  +
Sbjct  596   VQFIENEQTPDGSWYGNWGVCFIYGTWFALVGLAAAGKTYKTSPAMRKGVEFLLRTQKDD  655

Query  461   GGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQM  282
             GGWGE   SCP   YIP EG  +NLVQT+WA++GL++ GQAERDP PLHRAAKL+IN+QM
Sbjct  656   GGWGESYLSCPKKIYIPSEGKRSNLVQTAWAIIGLIHAGQAERDPIPLHRAAKLIINSQM  715

Query  281   EDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             E+GDFPQQ+I GV+M+NC++HYA++R+ FPL AL+EYRK
Sbjct  716   ENGDFPQQEIVGVFMRNCLIHYATYRNTFPLWALAEYRK  754



>emb|CAN65909.1| hypothetical protein VITISV_001242 [Vitis vinifera]
Length=729

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/758 (55%), Positives = 539/758 (71%), Gaps = 35/758 (5%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   E AR+ F K R Q  P  
Sbjct  1     MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAARENFWKNRYQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GDL  RMQ ++E      +IP V++ + EE+ YE  T AVR+      ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLREKNFKQ-TIPQVKVGDGEEITYETATAAVRRGAHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPL+F PPL++ LYI+G +D +   E++KE++RYLY HQNEDGGWG +I+GHSTM  
Sbjct  118   ENAGPLYFLPPLVMCLYITGHLDTVFPGEYRKEILRYLYCHQNEDGGWGFHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + L+Y+ +R+LGEGPD G + A ARGRKWILD GG T IPSWGK +LS+ G+++W G NP
Sbjct  178   TTLSYICMRILGEGPDGGRENACARGRKWILDRGGVTSIPSWGKTWLSIFGLFDWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFWLFPS  P HPAKMWCYCR  YMPMSYLY KR+ GP+T +VL LR E+ ++ Y +
Sbjct  238   MPPEFWLFPSRLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITTLVLELREELFLQPYNE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I+W + R  C KEDLYYPH  IQDL+W+ L  CTEP + RWPF K+R+ A+   +K++ Y
Sbjct  298   INWRKVRHLCAKEDLYYPHPLIQDLMWDGLYICTEPLLTRWPFNKLRQKALEVTMKHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDY+W+ EDG+ M  FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLSCWVEDPNGDYFKKHLARIPDYIWVGEDGIKMQSFGSQEW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D  FA QA++A  M +E G  L+K H ++KESQVK+NP GDFKSMYRH++KGSWTFSDQD
Sbjct  418   DTGFALQAVLACNMTDEIGPTLKKGHEFVKESQVKDNPSGDFKSMYRHISKGSWTFSDQD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LL   MP +I+G K + +RL+++V++ L LQS ++GG A WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSMMPPEIVGVKMEPERLFDSVNILLSLQS-KNGGLAAWEPA  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP+E FADIV+E E++E T S I ALV F+  YP +R KE++  I  A +Y
Sbjct  537   GASEWLELLNPTEFFADIVIEHEYVECTASAIQALVLFKKLYPGHRKKEIDNFITYAAKY  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E  Q  DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+  A  F L+ Q  +GGW
Sbjct  597   IEDIQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYHNCHAIRRAVEFLLNSQRDDGGW  656

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP  +Y PLEG  +NLV T WA++GL+ +GQ                       
Sbjct  657   GESYVSCPDKKYTPLEGNRSNLVHTGWALMGLISSGQ-----------------------  693

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
                  +ITGV+MKNCMLHYA++R+ +PL AL+EYR+RV
Sbjct  694   -----EITGVFMKNCMLHYAAYRNIYPLWALAEYRRRV  726



>ref|XP_010429761.1| PREDICTED: beta-amyrin synthase [Camelina sativa]
Length=759

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/759 (55%), Positives = 553/759 (73%), Gaps = 7/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LKIGEG G  PY+++TNN+ GRQ WE+DP+ G+PEE+ A  +AR+ F + R      
Sbjct  1     MWRLKIGEGNGDDPYLFTTNNFVGRQTWEFDPDGGSPEERNAVVEARRSFYENRFH-VKA  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ +KE + + + IPPV++   E++  E  T A+R+ VR   ALQA DGHWPA
Sbjct  60    SSDLLWRMQFLKEKKFEQV-IPPVKVEGSEKITLETATNALRRGVRFLSALQASDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL+  LYI+G +D + TSEH++E++RY+Y HQ EDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVFCLYITGHLDEVFTSEHRREILRYIYCHQKEDGGWGLHIEGHSTMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +ALNY+ +R+LGE PD G + A  R R+WIL HGG T IPSWGK +LS+LGV++W G  P
Sbjct  179   TALNYICMRILGESPDGGHENACRRAREWILFHGGVTYIPSWGKTWLSILGVFDWSGSTP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS FP +P KMWCYCR  Y+PMSYLY KR+ GP+T ++L LR E++++ YE+
Sbjct  239   MPPEFWILPSFFPVNPGKMWCYCRMVYLPMSYLYGKRFVGPITPLILQLRKELYLQPYEE  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYMR  1356
             I+W +      KED YYP   +Q+L+W++L    EPF+ RWPF K+ R+ +++ A+K+M 
Sbjct  299   INWKKVCHLSAKEDTYYPRPLVQELIWDSLSIFVEPFLARWPFNKLLRQKSLQVAMKHMH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDP+G   K HLAR+PDYLW+AEDGM M  FGSQ 
Sbjct  359   YEDENSRYITIGCVEKVLCMLACWVEDPDGVYFKKHLARIPDYLWVAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS +  E  D L + H +IK SQV+ENP GDFKSMYRH++KG+WTFSD+
Sbjct  419   WDTGFAMQALLASNLSSEISDVLMRGHEFIKNSQVRENPSGDFKSMYRHISKGAWTFSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTA+ LKC LL   +   I+G K D +RLY++V++ L LQS ++GG + WE 
Sbjct  479   DHGWQVSDCTADGLKCCLLFSMLAPDIVGPKQDPERLYDSVNILLTLQS-KNGGVSAWEA  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++ NP+E+F+DIVVE E+ E T S I AL  F+  +P++R  E+   I+KAV 
Sbjct  538   AGAPKWLELFNPTELFSDIVVEHEYCECTSSAIQALSLFKQLFPDHRTTEITTFISKAVH  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q  DGSWYG WG+CF YGT+FAL GL AAGK+Y +C A+    HF L+ Q   GG
Sbjct  598   YLENMQTPDGSWYGNWGICFTYGTWFALAGLAAAGKTYNDCVAMRKGVHFLLATQKVNGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SC + RYI  EG  +N+VQT+WA++GL++ GQAERDP PLHRAAKL+IN+Q+E 
Sbjct  658   WGESYLSCSTKRYIEQEGDISNVVQTAWALMGLIHAGQAERDPLPLHRAAKLIINSQLES  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ  TGV++KNC LHYA++R+  PL AL+EYR RV
Sbjct  718   GDFPQQQATGVFLKNCTLHYAAYRNIHPLWALAEYRARV  756



>ref|XP_010313621.1| PREDICTED: delta-amyrin synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010313622.1| PREDICTED: delta-amyrin synthase isoform X1 [Solanum lycopersicum]
Length=768

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/725 (57%), Positives = 534/725 (74%), Gaps = 7/725 (1%)
 Frame = -3

Query  2423  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHT  2250
             MWKLKI +G    Y+YSTNNY GRQIWE+DPNAGT EEQ   E+AR+ +   R K  P++
Sbjct  1     MWKLKIAKGQDDRYLYSTNNYIGRQIWEFDPNAGTIEEQAKIEEARQHYWNNRYKVKPNS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E       I  V++ E EE+++E  T A+R+AV    ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-RIRAVKVEEGEEISHEIATVALRRAVHFFSALQATDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             E++GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ESAGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +A++Y+ +R+LGEGP+ G + A AR RKWILDHG    IPSWGK +LS+LG +EW G NP
Sbjct  178   TAMSYICMRILGEGPEGGVNNACARARKWILDHGSVIAIPSWGKTWLSILGAFEWIGTNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKMWCYCRT YMPMSYLY KR+ GP+T ++L LR E++ ++Y++
Sbjct  238   MPPEFWILPSFLPVHPAKMWCYCRTVYMPMSYLYGKRFVGPITPLILKLREELYDQTYDE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I+W + R  C KEDLYYPH F+QDL+W++L  CTEP + RWPF K+R  A+   +K++ Y
Sbjct  298   INWKKVRHVCAKEDLYYPHPFVQDLMWDSLYICTEPLLTRWPFNKLRNKALEVTMKHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYIT+GC+EK L M+  W EDPNGD  K HLAR+PD+LW+AEDGM M G GSQ+W
Sbjct  358   EDENSRYITMGCVEKVLSMLACWVEDPNGDHFKKHLARIPDFLWVAEDGMKMQGCGSQSW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA+ A QA++AS M +E  D L+  H +IK+SQVK+NP GDFK MYRH++KGSW F+DQD
Sbjct  418   DASLAIQALLASEMNDEISDTLKNGHDFIKQSQVKDNPSGDFKVMYRHISKGSWAFADQD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
              GW VSDCTAE LKC LL   MP +I+GE  D  RLY++V+V L LQS ++GG + WEP 
Sbjct  478   LGWQVSDCTAEALKCCLLFSTMPPEIVGEAMDPVRLYDSVNVILSLQS-KNGGLSAWEPA  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 YL++LNP+E F DIV+E EH+E T S I ALV F+  YP +R  EV+  I   V+Y
Sbjct  537   GAPEYLELLNPTEFFEDIVIEHEHVECTSSAIQALVRFKKLYPGHRTTEVDNFINNGVKY  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E  QE DGSWYG WGVCF+Y ++FAL GL A G SY NC AV  +  F L  Q  +GGW
Sbjct  597   IEDVQEPDGSWYGNWGVCFIYASWFALGGLAAVGLSYSNCAAVRKSVEFLLRTQRSDGGW  656

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE  +SCP   Y  LE   +NLVQT+WA++GL+++GQ ERDP PLHRAAKLLIN+QMEDG
Sbjct  657   GESYRSCPDKVYRELETEHSNLVQTAWALMGLIHSGQVERDPRPLHRAAKLLINSQMEDG  716

Query  272   DFPQQ  258
             DFPQQ
Sbjct  717   DFPQQ  721



>emb|CDY35103.1| BnaA06g11130D [Brassica napus]
Length=788

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/761 (54%), Positives = 550/761 (72%), Gaps = 8/761 (1%)
 Frame = -3

Query  2426  KMWKLKIGEGGG---PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGP  2256
             KMW+L IGEG G   PY+ STNN+AGRQIWE+DPNAGT EE  A E+AR+ F   R +  
Sbjct  31    KMWRLNIGEGRGEDNPYLISTNNFAGRQIWEFDPNAGTSEELFAVEEARRTFYNCRHR-V  89

Query  2255  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2076
               CGDL  RMQ +KE + + + IPPV++ + + +  E  T A+R++V    ALQ+ DGHW
Sbjct  90    KACGDLLWRMQFLKEKKFEQV-IPPVKVDDAQRITKEEATNALRRSVHYFSALQSSDGHW  148

Query  2075  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  1896
             PAE +GPLF+ P ++   YI+G +D + T EH+KE++RY+Y HQNEDGGWGL+I+G S M
Sbjct  149   PAEITGPLFYVPVMVFCFYITGHLDEMFTKEHRKEMLRYIYCHQNEDGGWGLHIEGKSGM  208

Query  1895  IGSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGC  1719
               +ALNY+ LR+LGEGPD G   A  R R+WILDHGG T IPSWGK +LS+LG+Y+W G 
Sbjct  209   FCTALNYICLRILGEGPDGGPRNACKRARQWILDHGGVTYIPSWGKSWLSILGIYDWSGT  268

Query  1718  NPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSY  1539
             NP+ PE WL PS  P H  K  C+CR  Y+  SY Y KR+ GP+T ++L LR E++V+ Y
Sbjct  269   NPMPPEIWLLPSWLPIHLGKTTCFCRLVYLVTSYFYGKRFVGPITPLILQLREELYVQPY  328

Query  1538  EQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKY  1362
             E+IDWN+AR +  KED+YYPH  IQD +W++L    EP + RWP  K +RE A++  + Y
Sbjct  329   EEIDWNKARRSYAKEDMYYPHPSIQDFVWDSLHVFGEPLLTRWPLNKLVREKALKVVVDY  388

Query  1361  MRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGS  1182
             + YE E +RYI IGC  K++ ++  W EDPNG+  K HLARVPDY W+AEDGM +  FGS
Sbjct  389   IHYEDENSRYINIGCAGKAMCVLASWVEDPNGEYFKKHLARVPDYFWIAEDGMKVQSFGS  448

Query  1181  QNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFS  1002
             Q WD + A QA++AS M  E    L+K H +IK SQ++ENP GDFK M RH++KG WTFS
Sbjct  449   QLWDTSLAIQALLASNMSNETAHVLKKGHDFIKRSQIRENPSGDFKKMNRHISKGGWTFS  508

Query  1001  DQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATW  822
             D+D GW VSDC+AE  KC LLL +MP  ++G + D ++LY++V++ L  QS E+GG   W
Sbjct  509   DRDQGWNVSDCSAEAFKCCLLLSKMPPDVVGPRMDPEQLYDSVNLLLSYQS-ENGGMTAW  567

Query  821   EPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKA  642
             EP     +L++ NP+E+ AD+V+E E++E T S+I AL+ F+  YP++R +E++ +I KA
Sbjct  568   EPARGYGWLELFNPTEMLADLVIEREYVECTSSVIQALIMFKKLYPDHRTREIDRTIEKA  627

Query  641   VQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQE  462
             VQ++E  QE+DGSWYG WGVC+ Y T+FAL GL A GK+YENC A+     F L KQN  
Sbjct  628   VQFIENTQEADGSWYGSWGVCYTYATWFALEGLVAVGKTYENCLAIREGVAFLLKKQNSS  687

Query  461   GGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQM  282
             GGWGE   SC   RYI LEG  +NLVQT+WA++GL+ TGQAERDP PLHRAAKL+IN+Q+
Sbjct  688   GGWGESYLSCSEKRYIELEGGRSNLVQTAWALMGLIQTGQAERDPVPLHRAAKLIINSQL  747

Query  281   EDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             E+GD+PQQ++TGV+MKNC L+Y ++R+ FP+ AL+EYRK +
Sbjct  748   ENGDYPQQEMTGVFMKNCFLNYVTYRNIFPIWALAEYRKVI  788



>ref|XP_010472731.1| PREDICTED: camelliol C synthase-like isoform X1 [Camelina sativa]
Length=768

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/760 (56%), Positives = 557/760 (73%), Gaps = 10/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLKI  G    P++ STNN+ GRQ WE+DP+AGT +E+ A E+AR+ +          
Sbjct  1     MWKLKIASGNTEEPFLSSTNNFLGRQTWEFDPDAGTEDERAAVEEARRKYXXXXXXXXXX  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREE-EEVNYEAITTAVRKAVRLNCALQAKDGHWP  2073
                   R+Q +KE   +  +IPPV+  E+  ++  E  T A+R+ V    ALQA DGHWP
Sbjct  61    ---XIWRLQFLKEKSFEQ-AIPPVKKVEDANKITSEIATNALRRGVNFLSALQASDGHWP  116

Query  2072  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  1893
             AEN+GPLFF PPL+  L+++G +  ILT+EH++E++RY+Y HQNEDGGWGL+I+GHSTM 
Sbjct  117   AENAGPLFFLPPLVFCLFVTGHLHEILTTEHRREILRYIYCHQNEDGGWGLHIEGHSTMF  176

Query  1892  GSALNYVALRLLGEGPDDGDG-AIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              + LNY+ +R+LGEGP+ G G A  R RKWIL HGGAT IPSWGK +LS+LGV++W G N
Sbjct  177   CTTLNYICMRILGEGPNGGPGNACTRARKWILGHGGATYIPSWGKTWLSILGVFDWSGSN  236

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             P+ PEFW+ PS  P HP+KMWCYCR  YMPMSYLY KR+ GP++ ++L LR EI+++ Y 
Sbjct  237   PMPPEFWILPSCLPIHPSKMWCYCRLVYMPMSYLYGKRFVGPISPLILQLREEIYLQPYA  296

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYM  1359
             +I+WN+AR  C KED Y PH  IQD++W+ L   TEPF+  WPF K+ RE ++  A+K++
Sbjct  297   KINWNRARHLCAKEDAYCPHPQIQDVIWDCLYIFTEPFLTCWPFNKLLREKSLGVAMKHI  356

Query  1358  RYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQ  1179
              YE E +RYITIGC+EK+L M+  W EDPNG   K HL R+ DYLW+AEDGM M  FGSQ
Sbjct  357   HYEDENSRYITIGCVEKALCMLACWVEDPNGIHFKKHLLRISDYLWIAEDGMKMQSFGSQ  416

Query  1178  NWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSD  999
              WD+ FA QA++AS + +E  D LR+ + ++K SQV+ENP G++ +MYRH++KGSWTFSD
Sbjct  417   LWDSGFALQALVASNLADEIPDVLRRGYDFLKISQVRENPSGEYTNMYRHISKGSWTFSD  476

Query  998   QDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWE  819
             +DHGW  SDCTAE LKC LLL  MP  I+G K D ++LYE+V + L LQS ++GG   WE
Sbjct  477   RDHGWQASDCTAEGLKCCLLLSMMPPDIVGPKMDPEQLYESVAILLSLQS-KNGGVTAWE  535

Query  818   PPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAV  639
             P   Q +L++LNP+E+FAD+V+E E+ E T S I AL+ F+  YP +R +E+N  I KAV
Sbjct  536   PARGQEWLELLNPTEVFADVVIEHEYNECTSSAIQALILFKQLYPYHRTEEINTFIKKAV  595

Query  638   QYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEG  459
             QY+E  Q  DGSWYG WGVCF Y T+F L GL AAGK+Y NC A+    HF L+ Q   G
Sbjct  596   QYIESIQMLDGSWYGSWGVCFTYSTWFGLGGLAAAGKTYNNCLAMRKGVHFLLTTQKDNG  655

Query  458   GWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQME  279
             GWGE   SCP  RYIP E   +NLVQTSWAM+GL++ GQAERDPTPLHRAAKLLIN+Q+E
Sbjct  656   GWGESYLSCPKKRYIPSEEERSNLVQTSWAMMGLLHAGQAERDPTPLHRAAKLLINSQLE  715

Query  278   DGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             +GDFPQQ+ITG +MKNC+LHYA++R+ FP+ AL+EYR+RV
Sbjct  716   NGDFPQQEITGAFMKNCLLHYAAYRNIFPVWALAEYRRRV  755



>ref|XP_009106614.1| PREDICTED: amyrin synthase LUP2 [Brassica rapa]
Length=765

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/759 (56%), Positives = 563/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGF--TKQRQKGP  2256
             MWKLKIGEG G  PY++S+NN+ GRQ WE+DP AGT EE+ A E+AR+ F   + R KG 
Sbjct  1     MWKLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTAEERAAVEEARRHFLINRSRVKG-  59

Query  2255  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2076
               C DL  RMQ +KE+  +  +IPPV++   E + +E  T A+R+ V    ALQA DGHW
Sbjct  60    --CSDLVWRMQFLKEARFEQ-AIPPVKIDGNESITHEKSTDALRRGVSFFSALQASDGHW  116

Query  2075  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  1896
             P E +GPLFF PPL+  LYI+G ++ +   EH+KE++R++Y HQNEDGGWGL+I+G S M
Sbjct  117   PGEITGPLFFLPPLVFCLYITGHLEKVFDEEHRKEMLRHVYCHQNEDGGWGLHIEGRSIM  176

Query  1895  IGSALNYVALRLLGEGPDDGDG-AIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGC  1719
               +ALNY+ LR+LGEGP+ G   A  R R+WILD GG T IPSWGKI+LS+LG+Y+W G 
Sbjct  177   FCTALNYICLRILGEGPNGGGENACKRARQWILDRGGVTYIPSWGKIWLSILGLYDWSGT  236

Query  1718  NPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSY  1539
             NP+ PE WL PS  P H AK  CYCR  YMPMSYLY KR+ GP+T ++L LR+E+H++ Y
Sbjct  237   NPMPPEIWLLPSFLPIHLAKTLCYCRMVYMPMSYLYGKRFVGPVTPLILQLRDELHLQPY  296

Query  1538  EQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKY  1362
             E+I+WN+ R    KED+Y+PH  IQDL+W+AL    EP + RWP  K +RE A+R A+K+
Sbjct  297   EEINWNKTRRLYAKEDMYFPHPLIQDLVWDALYILVEPVLTRWPLNKLVREKALRLAMKH  356

Query  1361  MRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGS  1182
             + YE E + YITIGC+EK L M+  W E+PNGD  K HLAR+PDY+W+AEDGM M  FGS
Sbjct  357   IHYEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGS  416

Query  1181  QNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFS  1002
             Q WD  FA QAI+AS + +E G+ L+K H YIK+SQV+ENP GDFKSMYRH++KG+WT S
Sbjct  417   QLWDTGFAVQAILASELFDETGNVLKKGHDYIKKSQVRENPSGDFKSMYRHISKGAWTLS  476

Query  1001  DQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATW  822
             D+DHGW VSDCTAE LKC LLL  MP +++G+  D +++Y++V++ L  QS E+GG   W
Sbjct  477   DRDHGWQVSDCTAEALKCCLLLSMMPAEVVGQGIDPEQIYDSVNLLLSFQS-ENGGMTAW  535

Query  821   EPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKA  642
             EP     +++ LNP+E  A++V E E++E T S+I AL+ F+  YP++R KE++ SI KA
Sbjct  536   EPVRAYEWIEFLNPTEFLANLVAEREYVECTSSVIQALILFKQLYPDHRTKEISRSIEKA  595

Query  641   VQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQE  462
             VQ++E +Q  DGSWYG WGVCF+YGT+FAL+GL AAGK+Y+   A+     F L  Q  +
Sbjct  596   VQFIENEQTPDGSWYGNWGVCFIYGTWFALVGLAAAGKTYKTSPAMRKGVEFLLRTQKDD  655

Query  461   GGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQM  282
             GGWGE   SCP   YIP EG  +NLVQT+WA++GL++ GQAERDP PLHRAAKL+IN+QM
Sbjct  656   GGWGESYLSCPEKIYIPSEGKRSNLVQTAWAVMGLIHAGQAERDPIPLHRAAKLIINSQM  715

Query  281   EDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             E+GDFPQQ+I GV+M+NC++HYA++R+ FPL AL+EYRK
Sbjct  716   ENGDFPQQEIVGVFMRNCLIHYATYRNTFPLWALAEYRK  754



>ref|XP_003530475.1| PREDICTED: lupeol synthase isoform 1 [Glycine max]
Length=763

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/758 (56%), Positives = 546/758 (72%), Gaps = 5/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI EGG   I S NN+ GRQ WE+DPNAGTP+E+   E+ R+ + K R     + G
Sbjct  1     MWKLKIAEGGDGLI-SVNNFIGRQHWEFDPNAGTPQERAQVERVREEYKKNRFCIKQS-G  58

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DL MRMQ+ KE+    + +  V +++ E V  EA+ T +RKA+    ++QA DGHWPAE+
Sbjct  59    DLLMRMQLTKENTCGPI-LARVNVKDTENVTEEALITTMRKAINFYSSIQAHDGHWPAES  117

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GPLFF  PL++ALYI+GS++ +L  EH+KE++RYLYNHQNEDGGWGL+I+ HSTM GSA
Sbjct  118   AGPLFFLQPLVMALYITGSLNDVLGPEHQKEIIRYLYNHQNEDGGWGLHIESHSTMFGSA  177

Query  1883  LNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             L+Y+ALR+LGEGP+DG D A+ARGRKWILDHGG   IPSWGK +++VLGVYEW GCNPL 
Sbjct  178   LSYIALRILGEGPEDGEDRAMARGRKWILDHGGLEAIPSWGKFWVTVLGVYEWSGCNPLP  237

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PE WL P   P HP KM CYCR  YMPMSYL+ KR+ GP+T ++++LR E++ + Y+QID
Sbjct  238   PEIWLLPKYAPIHPGKMLCYCRLVYMPMSYLFGKRFVGPITGLIISLREEMYNQPYDQID  297

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN AR    KEDLYYPH  IQD+LW +L +  EP +  WPF  +RE A+  AI ++RYE 
Sbjct  298   WNNARSTVAKEDLYYPHPLIQDMLWASLHHVAEPLLNCWPFSMLREKALEVAIDHIRYED  357

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E + Y+ IG +EK L ++  W EDPN +  K HLAR+PDY WLAEDG+ +   GSQ WDA
Sbjct  358   ENSGYLCIGSVEKVLCLIARWVEDPNSEAYKLHLARIPDYFWLAEDGLKIQSLGSQLWDA  417

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
               A QAII+  + EEYG  LRK H ++K SQV ENP G+FK+M+RH++KG+WTFS QD G
Sbjct  418   TLAIQAIISCDLSEEYGPTLRKAHHFVKASQVLENPSGNFKAMHRHISKGAWTFSMQDQG  477

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE LK  LLL +M   +IGEK + +R Y+AVDV L LQS  +GGF  WEP   
Sbjct  478   WQVSDCTAEGLKAALLLSQMSPDLIGEKMEDERFYDAVDVILSLQSG-NGGFPAWEPQRA  536

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
               +L+  NP+EIF D ++E E++E T S +  L  FR  YP +R KEV++ I+KA++Y+E
Sbjct  537   YRWLEKFNPTEIFKDTLIEMEYVECTSSALQGLALFRKLYPKHRRKEVDLCISKAIRYIE  596

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
             K Q  DGSW+G WG+C+ YGT F++ GLT  GK+Y N  A+  A  F LSKQ   GGWGE
Sbjct  597   KTQNPDGSWFGCWGICYTYGTLFSVKGLTDCGKNYRNSPALRKACKFLLSKQLPNGGWGE  656

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                S  +  Y  L+G   NLVQTSWA++ L+  GQ E DPTP+ R  +LLIN+QMEDGDF
Sbjct  657   SYLSSQNKVYTNLKGNRANLVQTSWALMSLIDAGQVEIDPTPVERGIRLLINSQMEDGDF  716

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRVWT  153
             PQQ+ITGV+M+NC L+Y+S+R+ F + AL EYR+RV+T
Sbjct  717   PQQEITGVFMRNCTLNYSSYRNIFLIWALGEYRRRVFT  754



>ref|XP_009364429.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=761

 Score =   891 bits (2302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/754 (54%), Positives = 555/754 (74%), Gaps = 7/754 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LKIGEG   PY++STNN+ GRQ WE+DP+AGT +E+   E+AR+ + K R Q  P  
Sbjct  1     MWRLKIGEGADDPYLFSTNNFLGRQTWEFDPHAGTLQERAEVEEARQNYRKNRFQVKPSR  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  +MQ +KE      +IP V+++E EE+ +E  T A+++AV    ALQ+  GHWPA
Sbjct  61    --DLLWKMQFLKEKNFKQ-TIPAVKIKEGEEMTHETATAAMKRAVHFISALQSSHGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             ENSGPLF+  PL++ LYI+G ++++ + EH+KE+ RY+YNHQN+DGGWGL+I+  S M  
Sbjct  118   ENSGPLFYLLPLVMCLYITGHLNVVFSMEHRKEIKRYIYNHQNKDGGWGLHIESPSNMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +A NYV+LRLLGEGPD G D A+A GRKWI DHGG T IPSWGK +LSVLGVY+W GC P
Sbjct  178   TAYNYVSLRLLGEGPDGGEDNAMASGRKWIFDHGGVTNIPSWGKTWLSVLGVYDWSGCKP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PE+W+ PS  P HPAK+ C+CR TYMP+SYLY K++ GP+T ++L LR E+H++ Y +
Sbjct  238   VPPEYWMLPSFLPIHPAKLLCFCRVTYMPLSYLYGKKFVGPITPLILQLRQELHIQPYHK  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I W++AR  C +ED++YP+ +IQDL+W+ +   TEP +  WPF K+RE A++K+IK++ Y
Sbjct  298   IKWSEARHLCAQEDMHYPNPWIQDLVWDCMYMFTEPLLTHWPFNKLREKALQKSIKHVHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RY+TI C+ K+L M+  W EDP GD  + HLAR+PDYLW++EDGM +   GSQ+W
Sbjct  358   EDESSRYMTIACVTKALVMLACWIEDPEGDSFRKHLARIPDYLWVSEDGMKIQSVGSQSW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D AF  QA++AS ++ E G  L K H +IK+SQV++NP GDFK M+R ++KGSWTF DQD
Sbjct  418   DVAFVIQALLASNLIAEIGPTLMKGHDFIKKSQVRDNPPGDFKKMFRRISKGSWTFVDQD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             +GW+VSDCT+E + C LL   MP +I+G+K +  RLY+ V++ L +QS ++GG + WEP 
Sbjct  478   NGWSVSDCTSENMTCCLLFSMMPSEIVGDKIEDDRLYDGVNLILSMQS-KNGGVSAWEPA  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP E   D+V+E E+IE T S I  LV F+  +P YR KE+   I  AVQ+
Sbjct  537   GSPSWLELLNPVEFLDDMVIEHEYIECTSSAIQTLVLFKKLHPEYRKKEIEKFIVSAVQF  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E  Q  DGSWYG WGVCF YGT+FAL GL AAGK+Y NC A+ N  +F L+ Q  +GGW
Sbjct  597   VEDAQNPDGSWYGSWGVCFTYGTWFALKGLAAAGKTYYNCPAMRNGVNFLLATQGDDGGW  656

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SC   + IPLEG  ++LVQT+WA++GL++  QAERDPTPLHRAAKLLIN+QMEDG
Sbjct  657   GESYLSCQRKKIIPLEGRRSHLVQTAWALMGLIHAQQAERDPTPLHRAAKLLINSQMEDG  716

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEY  171
              FPQQ++TG + K  MLHY+++ + FPLMAL+EY
Sbjct  717   GFPQQEMTGTFFKGGMLHYSAYCNTFPLMALAEY  750



>sp|Q9LRH7.1|ABAMS_PEA RecName: Full=Mixed-amyrin synthase [Pisum sativum]
 dbj|BAA97559.1| mixed-amyrin synthase [Pisum sativum]
Length=764

 Score =   891 bits (2302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/758 (54%), Positives = 551/758 (73%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPY-IYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKIG+GG    I+STNN+ GRQ WE+DP+AGT +E+   E AR+ F   R +    C
Sbjct  1     MWKLKIGDGGKDRNIFSTNNFVGRQTWEFDPDAGTSQEKAQVEAARQHFYDNRFE-VKAC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  R Q++KE      +I  V++++EEE++ E +   +R+AV     LQ+ DGHWPA 
Sbjct  60    SDLLWRFQILKEKNFKQ-TIESVKIKDEEEISEENVAITLRRAVHHLSTLQSNDGHWPAL  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLF+ PPL+  +Y++G +D I   E++KE++RY+Y HQNEDGGWGL+++GHS M  +
Sbjct  119   NAGPLFYFPPLVFCMYVTGHLDSIFPYEYRKEILRYIYCHQNEDGGWGLHVEGHSIMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              LNY+ +R+LGEGP+ G + A AR RKWI DHG  T + SWGKI+LSVLG+++W   NP+
Sbjct  179   VLNYICMRILGEGPNGGKEDACARARKWIHDHGSVTHVSSWGKIWLSVLGIFDWCASNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS    HPAKM CYCR  YMPMSYLY KR+ GP+T ++L LR E+  + YE++
Sbjct  239   PPEFWMLPSFLLKHPAKMLCYCRLVYMPMSYLYGKRFVGPITPLILMLREELLTQPYEKV  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYMRY  1353
             +W + R  C KEDLYYPH  IQDL+W++L    EP +  WPF K+ RE A++  +K++ Y
Sbjct  299   NWKKTRHLCAKEDLYYPHPLIQDLIWDSLYIFVEPLLTHWPFNKLLREKALQTVMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L ++  W EDPNGD  K HLAR+PDYLW++EDGM++H FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCILACWVEDPNGDAFKKHLARLPDYLWVSEDGMTLHSFGSQTW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA+   QA++A+ ++E+ G  L K H +IK+SQV++NP GDFKSMYRH++KGSWTFSD+D
Sbjct  419   DASLIIQALLATNLIEDVGPILTKAHEFIKKSQVRDNPSGDFKSMYRHISKGSWTFSDKD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE+LKC LLL  +P +I+GEK + + LY++V++ L LQ  + GG   WEP 
Sbjct  479   HGWQVSDCTAESLKCCLLLSMLPPEIVGEKMEPEMLYDSVNILLSLQG-KKGGLPAWEPS  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++ NP E   +IVVE E++E T S I ALV F+  YP +R KEV   IA AV++
Sbjct  538   EAVEWLELFNPIEFLEEIVVEREYVECTSSAIQALVLFKKLYPEHRKKEVENFIANAVRF  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE +Q SDGSWYG WG+CF YG++FAL GL AAGK+Y+NC A+     F L+ Q ++GGW
Sbjct  598   LEYKQTSDGSWYGNWGICFTYGSWFALNGLVAAGKTYDNCAAIRKGVEFLLTTQREDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   S     Y+PLE + +N+VQTSWA++GL++ GQ ERDPTPLHRA KL+IN Q E+G
Sbjct  658   GESHLSSSKKIYVPLERSQSNIVQTSWAIMGLIHAGQMERDPTPLHRAVKLIINFQQEEG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             D+PQQ++TGV+MKNCML YA +R  FP  AL+EYR+R+
Sbjct  718   DWPQQELTGVFMKNCMLQYAMYRDIFPTWALAEYRRRI  755



>ref|XP_007153005.1| hypothetical protein PHAVU_004G178500g [Phaseolus vulgaris]
 gb|ESW24999.1| hypothetical protein PHAVU_004G178500g [Phaseolus vulgaris]
Length=764

 Score =   891 bits (2302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/756 (56%), Positives = 544/756 (72%), Gaps = 5/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKIGEGG   I S NN  GRQ W +DPNAG+ EE+E  E+ R  FT  R     +  
Sbjct  1     MWKLKIGEGGKGVI-SVNNNVGRQHWVFDPNAGSVEEREEVERLRHQFTLNRFSIKQSA-  58

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DLF+RMQ+ KE+E  V+    V++R+ E V  EA+ T +R+AV    ++Q  DGHWPAE+
Sbjct  59    DLFLRMQLRKENECGVIP-AAVKVRDGENVTTEAVITTIRRAVSFYSSIQGSDGHWPAES  117

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GPLFF  PL++ALYI+GS+D +L  EHKKE++RYLYNHQNEDGGWG +I+GHSTM GSA
Sbjct  118   AGPLFFLQPLVMALYITGSLDAVLGPEHKKEIIRYLYNHQNEDGGWGFHIEGHSTMFGSA  177

Query  1883  LNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             L+Y+ALR+LGEG +DG + A+ RGRKWILDHGG   IPSWGK +++VLGVYEW GCNPL 
Sbjct  178   LSYIALRILGEGVEDGMEQAMYRGRKWILDHGGLVGIPSWGKFWVTVLGVYEWSGCNPLP  237

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWL P  FP HP KM  YCR  YMPMSYLY KR+ GP+T ++ +LR E++ + YE I+
Sbjct  238   PEFWLLPKAFPIHPGKMLSYCRLVYMPMSYLYGKRFVGPITALIRSLREELYNEPYEAIN  297

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+AR    KEDLYYPH  IQD+LW  L +  E  +  WPF  +RE A+  AI+++RYE 
Sbjct  298   WNKARNTVAKEDLYYPHPVIQDMLWGFLHHVGERLVNWWPFSMVREKALEIAIEHVRYED  357

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E +RY+ IG +EK L ++  W EDPN +  K HLAR+PDY WLAEDG+ +  FGSQ WDA
Sbjct  358   ENSRYLCIGSVEKVLCLIARWVEDPNSEAYKLHLARIPDYFWLAEDGLKIQSFGSQMWDA  417

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
             AFA QAI++  + EEY   LRK H ++K SQV ENP GDFK+MYRH++KGSWTFS  D G
Sbjct  418   AFAIQAILSCDVSEEYWPTLRKAHEFVKASQVAENPSGDFKAMYRHISKGSWTFSMHDQG  477

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCT E LK  LLL EMP  ++GEK D QR ++AV+V L LQS  +GGF  WEP   
Sbjct  478   WQVSDCTGEGLKAALLLSEMPADLVGEKMDTQRFFDAVNVILSLQS-SNGGFPAWEPQRA  536

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
               +L+  NP+E F D ++E E++E TGS +  L  FR  YP +R KE++  I+KA+ +LE
Sbjct  537   YRWLEKFNPTEFFEDTLIEMEYVECTGSAVQGLALFRKLYPKHRRKEIDSCISKAIHFLE  596

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
              +Q  DGSWYG WG+C+ YGT+F + GL A+G++Y N  ++  A  F LSKQ   GGWGE
Sbjct  597   NKQNPDGSWYGCWGICYTYGTWFGVEGLRASGRNYHNSPSLRKACQFLLSKQLPNGGWGE  656

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                S  +  Y  LEG   NLVQTSWA+L L+  GQAE DPTP+HR  KLLIN+QMEDGDF
Sbjct  657   SYLSSQNKVYTNLEGNRANLVQTSWALLSLIRAGQAEIDPTPIHRGIKLLINSQMEDGDF  716

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PQQ+ITGV+M+NC L+Y+S+R+ FP+ AL EYR++V
Sbjct  717   PQQEITGVFMRNCTLNYSSYRNIFPIWALGEYRRQV  752



>ref|XP_002305339.1| putative oxidosqualene cyclase family protein [Populus trichocarpa]
 gb|EEE85850.1| putative oxidosqualene cyclase family protein [Populus trichocarpa]
Length=728

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/723 (58%), Positives = 542/723 (75%), Gaps = 4/723 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MW+L++ EG GP+++STN + GRQIW ++PN  TPEEQ   E AR+ F   R        
Sbjct  1     MWRLEVAEGDGPWLFSTNKFVGRQIWRFEPNVWTPEEQAQVEMAREKFRLNRFY-TKASS  59

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             D+    Q+IKE+++D L IPPVRL   EE++ E + TA+RKAVR   A+QA DGHWPAE 
Sbjct  60    DVLKNFQLIKENQID-LRIPPVRLGNGEEISREKVETALRKAVRFTSAIQASDGHWPAEF  118

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             SGPLF  PPL++ LY+S S+D +L+SEHKKE++RY+YNHQNEDGGWG +I+ HSTM+G+A
Sbjct  119   SGPLFLMPPLIMVLYLSRSLDTVLSSEHKKEIIRYIYNHQNEDGGWGFHIESHSTMLGTA  178

Query  1883  LNYVALRLLGEGPDDGDG-AIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             LNYVALRLLGEGP+ G   A+ + RKW+LDHGGAT IP+WGK+YLSVLG YEW GCNP+ 
Sbjct  179   LNYVALRLLGEGPEGGGDGAVTKARKWVLDHGGATMIPAWGKVYLSVLGTYEWSGCNPVP  238

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEF LFPS  PF P K+WC+ RT Y PMSYLY K++ GP+TD++L LR E++++ YE+ID
Sbjct  239   PEFLLFPSFLPFSPGKVWCHLRTVYTPMSYLYGKKFVGPITDLILQLRGELYIQPYEEID  298

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+AR  C KEDLY   S  Q+LL + + Y +E  +++WPF K+RE A+++AIK++ YE 
Sbjct  299   WNKARHLCLKEDLYTSRSIAQNLLLDGVHYLSERLLKQWPFSKLREQALQEAIKHIHYED  358

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E TRY+T   IEKSL MM  WAEDP  D  K+HLARVPD LWLAEDGM     GSQ WDA
Sbjct  359   ESTRYMTHASIEKSLNMMACWAEDPTSDAFKFHLARVPDILWLAEDGMKTQSIGSQLWDA  418

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
             AFATQAIIAS +V+EYG  LRK H ++K SQ++EN  GDF+SMYRH++KG+WT S +DHG
Sbjct  419   AFATQAIIASNLVDEYGSTLRKAHEFLKLSQIQENAYGDFRSMYRHISKGAWTLSVKDHG  478

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE L+ LLLL +MP +I+GE  D +RL+ A+D  L LQS ++GGF+ WEP   
Sbjct  479   WQVSDCTAEALRALLLLSQMPAEIVGETIDTERLHNAIDFLLSLQS-KNGGFSVWEPARG  537

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
             Q +L+VLNP++ F D++VE E++E T S I  LV F+  +P YR KE+ +S+A A  Y+E
Sbjct  538   QRWLEVLNPTQAFGDVMVETEYVECTASAIQVLVLFQRLHPGYRSKEIEVSVANASSYIE  597

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
               Q SDGSWYG WG+C+ YGT+FAL GL + GK+Y N   V  A  F LSKQ+  GGWGE
Sbjct  598   DAQMSDGSWYGNWGICYTYGTYFALKGLASVGKTYRNSRTVRKACEFLLSKQHNSGGWGE  657

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                SC + +Y  +EG  +N+VQT+WAM+GL+Y GQAE+DP PLH+AA+LLIN+QME+G+F
Sbjct  658   SYLSCANSKYTEIEGNKSNVVQTAWAMMGLIYAGQAEKDPAPLHQAARLLINSQMENGEF  717

Query  266   PQQ  258
             PQQ
Sbjct  718   PQQ  720



>dbj|BAG82628.1| beta-amyrin synthase [Arabidopsis thaliana]
Length=759

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/759 (55%), Positives = 550/759 (72%), Gaps = 7/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LKIGEG G  PY+++TNN+AGRQ WE+DP+ G+PEE+ +  +AR+ F   R      
Sbjct  1     MWRLKIGEGNGDDPYLFTTNNFAGRQTWEFDPDGGSPEERHSVVEARRIFYDNRFH-VKA  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E + +   I PV++ + E+V +E  T+A+R+ +    ALQA DGHWPA
Sbjct  60    SSDLLWRMQFLREKKFEQ-RIAPVKVEDSEKVTFETATSALRRGIHFFSALQASDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL+  LYI+G +D + TSEH+KE++RY+Y HQ EDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVFCLYITGHLDEVFTSEHRKEILRYIYCHQKEDGGWGLHIEGHSTMFC  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNY+ +R+LGE PD G D A  R R+WIL HGG T IPSWGK +LS+LGV++W G NP
Sbjct  179   TTLNYICMRILGESPDGGHDNACGRAREWILSHGGVTYIPSWGKTWLSILGVFDWSGSNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS FP HPAKMW YCR  Y+PMSYLY KR+ GP+T ++L LR E++++ YE+
Sbjct  239   MPPEFWILPSFFPVHPAKMWSYCRMVYLPMSYLYGKRFVGPITSLILQLRKELYLQPYEE  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKI-REMAMRKAIKYMR  1356
             I+W + R  C KED YYP   +Q+L+W++L    E F+ RWPF K+ RE A++ A+K++ 
Sbjct  299   INWMKVRHLCAKEDTYYPRPLVQELVWDSLYIFAELFLARWPFNKLLREKALQLAMKHIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  W EDPNGD  K HL+R+ DYLW+AEDGM M  FGSQ 
Sbjct  359   YEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLSRISDYLWMAEDGMKMQSFGSQL  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS +  E  D LR+ H +IK SQV ENP GD+KSMYRH++KG+WTFSD+
Sbjct  419   WDTGFAMQALLASNLSSEISDVLRRGHEFIKNSQVGENPSGDYKSMYRHISKGAWTFSDR  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTA  LKC LL   +   I+G K D +RL+++V++ L LQS ++GG   WEP
Sbjct  479   DHGWQVSDCTAHGLKCCLLFSMLAPDIVGPKQDPERLHDSVNILLSLQS-KNGGMTAWEP  537

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  + ++LNP+E+F+DIV+E E+ E T S I AL  F+  YP++R  E+   I KA +
Sbjct  538   AGAPKWSELLNPTEMFSDIVIEHEYSECTSSAIQALSLFKQLYPDHRTTEITAFIKKAAE  597

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q  DGSWYG WG+CF YGT+FAL GL AAGK++ +CEA+     F L+ Q   GG
Sbjct  598   YLENMQTRDGSWYGNWGICFTYGTWFALAGLAAAGKTFNDCEAIRKGVQFLLAAQKDNGG  657

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SC    YI   G  +N+VQT+WA++GL+++GQAERDP PLHRAAKL+IN+Q+E 
Sbjct  658   WGESYLSCSKKIYIAQVGEISNVVQTAWALMGLIHSGQAERDPIPLHRAAKLIINSQLES  717

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ  TGV++KNC LHYA++R+  PL AL+EYR RV
Sbjct  718   GDFPQQQATGVFLKNCTLHYAAYRNIHPLWALAEYRARV  756



>ref|XP_009337925.1| PREDICTED: beta-amyrin synthase-like, partial [Pyrus x bretschneideri]
Length=722

 Score =   890 bits (2300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/726 (58%), Positives = 543/726 (75%), Gaps = 8/726 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MWKLK+ +GG  PYIYSTNN+ GRQI+E+DP AGT EE+   E+AR  F   R Q  P  
Sbjct  1     MWKLKVADGGNDPYIYSTNNFVGRQIFEFDPEAGTTEERAEVEEARLHFYNNRYQVKP--  58

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GDL  RMQ ++E      ++P +++ + EE+ +E  TT++R++VR   ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLREKNFKQTNLP-IKVEDGEEITHEKATTSLRRSVRFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GPLFF PPL++ +YI+  ++ I  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCVYITEHLNTIFHAEHRKEILRYIYCHQNQDGGWGLHIEGHSTMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +AL+Y+ +R+LGEGPD G D A AR RKWILDHG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TALSYICMRILGEGPDGGQDNACARARKWILDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HPAKM CYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y++
Sbjct  238   MPPEFWILPSFLPMHPAKMLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W   R  C KED+YYPH +IQD LW++L  CTEP + RWPF K IR+ A+   ++++ 
Sbjct  298   INWKGVRHHCAKEDIYYPHPWIQDFLWDSLYICTEPLLTRWPFNKLIRKRALEVTMEHIH  357

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE E +RYITIGC+EK L M+  WAEDPNGD  K HLAR+PDYLW+AEDGM M  FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQ  417

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD  FA QA++AS + +E    L + H ++K+SQVK+NP GDFKSM+RH++KGSWTFSDQ
Sbjct  418   WDTGFAIQALLASDLTDEIAPTLARGHDFVKKSQVKDNPSGDFKSMHRHISKGSWTFSDQ  477

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC LLL  MP +++GEK + +RLY+AV+V + LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMMPPELVGEKMEPERLYDAVNVLISLQS-KNGGLAAWEP  536

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L++LNP+E FAD +VE E++E T S I ALV F+  YP +R KE++  I  A Q
Sbjct  537   AGAAEWLEMLNPTEFFADTIVEHEYVECTSSAIQALVLFKKLYPGHRKKEMDQFITNAAQ  596

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             YLE  Q  DGSWYG WGVCF YGT+FAL GLTAAGK++ NC A+  A +F L+ Q + GG
Sbjct  597   YLENIQMEDGSWYGSWGVCFTYGTWFALGGLTAAGKTFNNCAAIRKAINFLLAIQKENGG  656

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SCP   Y+PLEG  +NLV T+WAM+GL++ GQA+RDPTPLHRAAKL+IN QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIHAGQAKRDPTPLHRAAKLIINTQMEN  716

Query  275   GDFPQQ  258
             GDFPQQ
Sbjct  717   GDFPQQ  722



>emb|CDX88494.1| BnaC06g39380D [Brassica napus]
Length=776

 Score =   889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/762 (56%), Positives = 563/762 (74%), Gaps = 11/762 (1%)
 Frame = -3

Query  2432  IRKMWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGF--TKQRQ  2265
             I  MWKLKI EG G  PY++S+NN+ GRQ WE+DP AGT EE+ A E+AR+ F   + R 
Sbjct  9     IVVMWKLKIAEGNGEDPYLFSSNNFVGRQTWEFDPKAGTAEERAAVEEARRHFLINRSRV  68

Query  2264  KGPHTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKD  2085
             KG   C D+  RMQ +KE+  +  +IPPV++   E + +E  T A+R+ V    ALQA D
Sbjct  69    KG---CSDIVWRMQFLKEARFEQ-AIPPVKIDGNESITHEKATDALRRGVSFFSALQASD  124

Query  2084  GHWPAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGH  1905
             GHWP E +GPLFF PPL+  LYI+G ++ +   EH+KE++R++Y HQNEDGGWGL+I+G 
Sbjct  125   GHWPGEITGPLFFLPPLVFCLYITGHLEKVFDEEHRKEMLRHVYCHQNEDGGWGLHIEGR  184

Query  1904  STMIGSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEW  1728
             S M  +ALNY+ LR+LGEGP+ G + A  R R+WILD GG T IPSWGKI+LS+LG+Y+W
Sbjct  185   SIMFCTALNYICLRILGEGPNGGRENACKRARQWILDRGGVTYIPSWGKIWLSILGLYDW  244

Query  1727  DGCNPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHV  1548
              G NP+ PE WL PS  P H AK  CY R  YMPMSYLY KR+ GP+T ++L LR+E+H+
Sbjct  245   SGTNPMPPEIWLLPSFLPIHLAKTLCYTRMVYMPMSYLYGKRFVGPITPLILQLRDELHL  304

Query  1547  KSYEQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKA  1371
             + YE+I+WN+ R    KED+Y+ H   QDL+W+AL    EPF+ RWP  K +RE A+R A
Sbjct  305   QPYEEINWNKTRRLYAKEDMYFHHPLAQDLVWDALYVVVEPFLTRWPLNKLVREKALRLA  364

Query  1370  IKYMRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHG  1191
             +K++ YE E + YITIGC+EK L M+  W EDPNGD  K HLAR+PDY+W+AEDG+ M  
Sbjct  365   MKHIHYEDENSHYITIGCVEKVLFMLACWIEDPNGDYFKKHLARIPDYMWVAEDGLKMQS  424

Query  1190  FGSQNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSW  1011
             FGSQ WD  FA QAI++S + +E G+ L K H YIK+SQV+ENP GDFKSMYRH +KG+W
Sbjct  425   FGSQLWDTGFAVQAILSSNLFDETGNVLNKGHDYIKKSQVRENPSGDFKSMYRHNSKGAW  484

Query  1010  TFSDQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGF  831
             T SD+DHGW VSDCTAE LKC LLL  MP +++G+K D +++Y++V++ L  QS E+GG 
Sbjct  485   TLSDRDHGWQVSDCTAEALKCCLLLSTMPAEVVGQKMDPEQIYDSVNLLLSFQS-ENGGV  543

Query  830   ATWEPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISI  651
               WEP     ++++LNP+E  ++++ E E++E T S+I ALV F+  YP+Y+ KE++ SI
Sbjct  544   TAWEPVRAYEWIELLNPTEFLSNLMAEREYVECTSSVIQALVLFKQLYPDYKTKEISRSI  603

Query  650   AKAVQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQ  471
              KAVQ++E +Q  DGSWYG WGVCF+YGT+FAL GL AAGK+Y+   A+     F L  Q
Sbjct  604   EKAVQFIENEQTQDGSWYGNWGVCFIYGTWFALAGLAAAGKTYKTSLAMRKGVEFLLRTQ  663

Query  470   NQEGGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLIN  291
               +GGWGE   SCP  RYIP EG  +NLVQT+WA++GL++ GQAERDPTPLHRAAK++IN
Sbjct  664   KDDGGWGESYLSCPEQRYIPSEGKISNLVQTAWAVMGLVHAGQAERDPTPLHRAAKIIIN  723

Query  290   AQMEDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             +QME+GDFPQQ+I GV+M+NC++HYA++R+ FPL AL+EYRK
Sbjct  724   SQMENGDFPQQEIVGVFMRNCLIHYATYRNTFPLWALAEYRK  765



>ref|XP_009786280.1| PREDICTED: lupeol synthase [Nicotiana sylvestris]
Length=755

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/754 (55%), Positives = 540/754 (72%), Gaps = 5/754 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKIGEG GP++ +TNNY GRQ WE+D  AGTPEE+   EK R+ F K R     +  
Sbjct  1     MWKLKIGEGEGPWLTTTNNYIGRQYWEFDSEAGTPEERTLVEKMRQHFKKNRFTQTQS-A  59

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DL MRMQ+ KE+    +    V+L E E +  EA+   +++++     +QA DGHWPAE+
Sbjct  60    DLLMRMQLRKENPCGPIP-AAVKLEETENITEEAVKATLKRSISYYSTIQANDGHWPAES  118

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GPLFF PPL++ALY++G ++ +L+  H+ E+ RY YNHQNEDGGWG +I+GHSTM G+ 
Sbjct  119   AGPLFFLPPLVMALYVTGDMNAVLSPAHQMEIKRYTYNHQNEDGGWGFHIEGHSTMFGTV  178

Query  1883  LNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLSP  1704
              NY+ALRLLGE  D  D A+A GRKWILDHGGA   PSWGK +L+VLGVYEWDGCNP+ P
Sbjct  179   FNYIALRLLGE--DGEDKALAIGRKWILDHGGAVATPSWGKFWLAVLGVYEWDGCNPMPP  236

Query  1703  EFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQIDW  1524
             EFWL P+ FP HP KM CY R  YMPMSYLY KR+ G +T +V  +R+EIH + Y +IDW
Sbjct  237   EFWLLPTLFPIHPGKMLCYGRLVYMPMSYLYGKRFVGTITSLVQFIRDEIHNQPYHEIDW  296

Query  1523  NQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEAE  1344
             N+AR  C KEDLYYPH  IQD LW  L +  EP ++RWPF K+RE A+  A++++ YE E
Sbjct  297   NKARNTCAKEDLYYPHPLIQDTLWGFLHHFAEPVLKRWPFTKLREKALNLAMEHIHYEDE  356

Query  1343  ETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDAA  1164
              +RYI IGC+EK L ++  W EDPN +  K HLAR+PDY W++EDG+    FG Q WDA 
Sbjct  357   NSRYICIGCVEKVLCLIVCWVEDPNSEAYKRHLARLPDYYWISEDGLKFQSFGCQTWDAV  416

Query  1163  FATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHGW  984
             F+ QAI++S +  E+G  L+K + ++K SQVKENP GD + MYRH++KG+WTFS QDHGW
Sbjct  417   FSIQAILSSDLAAEFGPILKKANDFLKASQVKENPSGDLRKMYRHISKGAWTFSMQDHGW  476

Query  983   AVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVPQ  804
              VSDCT+E LKC LL  +MP ++IG+K + +RL +AV+V L LQS E+GGF  WEP    
Sbjct  477   QVSDCTSEGLKCALLFSQMPTELIGKKFETERLCDAVNVTLSLQS-ENGGFPAWEPQRAY  535

Query  803   PYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLEK  624
              +L+  NP+E F D ++E E++E T S I AL  ++  +P +R KE+  +I+K +QY+E 
Sbjct  536   RWLEKFNPTEFFEDTIIEREYVECTSSAIQALTLYKKWHPRHRRKEIEAAISKGLQYIES  595

Query  623   QQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGEC  444
              Q SDGSW G WG+C+ YGT+FA+ GL A G++Y  C A+  A  F LSKQ  +GGWGE 
Sbjct  596   TQNSDGSWTGCWGICYTYGTWFAVDGLIACGRTYPTCHALQKACKFLLSKQLPDGGWGES  655

Query  443   LQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDFP  264
               S  +  Y  ++G  +NLVQTSWA+L L+  GQAE DPTP+HR  +LLIN+QMEDGD+P
Sbjct  656   YLSNSNKVYTNIKGDQSNLVQTSWALLSLINAGQAEIDPTPIHRGIRLLINSQMEDGDYP  715

Query  263   QQDITGVYMKNCMLHYASHRSYFPLMALSEYRKR  162
             QQ ITG +MKNC L+Y+S+R+ FP+ AL EYRKR
Sbjct  716   QQGITGAFMKNCTLNYSSYRNIFPIWALGEYRKR  749



>ref|XP_009149097.1| PREDICTED: amyrin synthase LUP2-like [Brassica rapa]
Length=757

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/760 (54%), Positives = 549/760 (72%), Gaps = 8/760 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG---PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2253
             MW+L IGEG G   PY+ STNN+AGRQIWE+DPNAGT EE  A E+AR+ F   R +   
Sbjct  1     MWRLNIGEGRGEDNPYLISTNNFAGRQIWEFDPNAGTSEELFAVEEARRTFYNCRHR-VK  59

Query  2252  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2073
              CGDL  RMQ +KE + + + +PPV++ + + +  E  T A+R++V    ALQ+ DGHWP
Sbjct  60    ACGDLLWRMQFLKEKKFEQV-MPPVKVDDAQRITKEEATNALRRSVHYFSALQSSDGHWP  118

Query  2072  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  1893
             AE +GPLF+ P ++   YI+G +D + T EH+KE++RY+Y HQNEDGGWGL+I+G S M 
Sbjct  119   AEITGPLFYVPVMVFCFYITGHLDEMFTKEHRKEMLRYIYCHQNEDGGWGLHIEGKSGMF  178

Query  1892  GSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              +ALNY+ LR++GEGPD G   A  R R+WILDHGG T IPSWGK +LS+LG+Y+W G N
Sbjct  179   CTALNYICLRIVGEGPDGGPRNACKRARQWILDHGGVTYIPSWGKSWLSILGIYDWSGTN  238

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
             P+ PE WL PS  P H  K  C+CR  Y+  SY Y KR+ GP+T ++L LR E++V+ YE
Sbjct  239   PMPPEIWLLPSWLPIHLGKTTCFCRLVYLVTSYFYGKRFVGPITPLILQLREELYVQPYE  298

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYM  1359
             +IDWN+AR +  KED+YYPH  IQD +W++L    EP + RWP  K +RE A++  + Y+
Sbjct  299   EIDWNKARRSYAKEDMYYPHPSIQDFVWDSLHVFGEPLLTRWPLNKLVREKALKVVVDYI  358

Query  1358  RYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQ  1179
              YE E +RYI IGC  K++ ++  W EDPNG+  K HLARVPDY W+AEDGM +  FGSQ
Sbjct  359   HYEDENSRYINIGCAGKAMCVLASWVEDPNGEYFKKHLARVPDYFWIAEDGMKVQSFGSQ  418

Query  1178  NWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSD  999
              WD + A QA++AS M  E    L+K H +IK SQ++ENP GDFK M RH++KG WTFSD
Sbjct  419   LWDTSLAIQALLASNMSNETAHVLKKGHDFIKRSQIRENPSGDFKKMNRHISKGGWTFSD  478

Query  998   QDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWE  819
             +D GW VSDC+AE  KC LLL +MP  ++G + D ++LY++V++ L  QS E+GG   WE
Sbjct  479   RDQGWNVSDCSAEAFKCCLLLSKMPPDVVGPRMDPEQLYDSVNLLLSYQS-ENGGMTAWE  537

Query  818   PPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAV  639
             P     +L++ NP+E+ AD+V+E E++E T S+I AL+ F+  YP++R +E++ +I KAV
Sbjct  538   PARGYGWLELFNPTEMLADLVIEREYVECTSSVIQALIMFKKLYPDHRTREIDRTIEKAV  597

Query  638   QYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEG  459
             Q++E  QE+DGSWYG WGVC+ Y T+FAL GL A GK+YENC A+     F L KQN  G
Sbjct  598   QFIENTQEADGSWYGSWGVCYTYATWFALEGLVAVGKTYENCLAIREGVAFLLKKQNSSG  657

Query  458   GWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQME  279
             GWGE   SC   RYI LEG  +NLVQT+WA++GL+ TGQAERDP PLHRAAKL+IN+Q+E
Sbjct  658   GWGESYLSCSEKRYIELEGGRSNLVQTAWALMGLIQTGQAERDPVPLHRAAKLIINSQLE  717

Query  278   DGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             +GD+PQQ++TGV+MKNC L+Y ++R+ FP+ AL+EYRK +
Sbjct  718   NGDYPQQEMTGVFMKNCFLNYVTYRNIFPIWALAEYRKVI  757



>ref|XP_002887763.1| ATLUP2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64022.1| ATLUP2 [Arabidopsis lyrata subsp. lyrata]
Length=763

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/765 (54%), Positives = 546/765 (71%), Gaps = 23/765 (3%)
 Frame = -3

Query  2423  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MWKLKIGEG G  PY++S+NN+ GRQ WE+DP AGTPEE+ A E+AR+ F   R +    
Sbjct  1     MWKLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTPEERAAVEEARRKFLDNRSR-VKG  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQ--------  2094
             C DL  RMQ+I E            +R  +    +          R  CA +        
Sbjct  60    CSDLLWRMQVIFERG---------EIRASDPAGEDRRRRRHNLRKRDECATESSFFLLGF  110

Query  2093  AKDGHWPAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYI  1914
             A DGHWPAE +G LFF PPL+  LYI+G ++ I  +EH+ E++R++Y HQNEDGGWGL++
Sbjct  111   ASDGHWPAEIAGTLFFLPPLVFCLYITGHLEKIFDAEHRSEMLRHIYCHQNEDGGWGLHV  170

Query  1913  DGHSTMIGSALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGV  1737
             +G+S M  +ALNY+ LR+LGEGP+ G D +  R R+WILDHGG T IPSWGK +LS+LG+
Sbjct  171   EGNSVMFCTALNYICLRMLGEGPNGGRDNSCKRARQWILDHGGVTYIPSWGKFWLSILGI  230

Query  1736  YEWDGCNPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNE  1557
             Y+W G NP+ PE WL PS  P H  K  CY R  YMPMSYLY KR+ GPLT +++ LR E
Sbjct  231   YDWSGTNPMPPEIWLLPSFIPIHLGKTLCYTRMVYMPMSYLYGKRFVGPLTPLIMLLRKE  290

Query  1556  IHVKSYEQIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAM  1380
             +H++ YE+I+WN+AR  C KED+ YPH  +QDLLW+ L    EPF+  WP KK +RE A+
Sbjct  291   LHLQPYEEINWNKARRLCAKEDMIYPHPLVQDLLWDTLHNFVEPFLTSWPLKKLVREKAL  350

Query  1379  RKAIKYMRYEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMS  1200
             R A++++ YE E + YITIGC+EK L M+  W E+PNGD  K HLAR+PD++W+AEDG+ 
Sbjct  351   RVAMEHIHYEDENSHYITIGCVEKVLCMLACWIENPNGDHFKKHLARIPDFMWVAEDGLK  410

Query  1199  MHGFGSQNWDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTK  1020
             M  FGSQ WD  FA QA++A  + +E  D LRK H +IK SQV+ENP GDFKSMYRH++K
Sbjct  411   MQSFGSQLWDTGFAIQALLACDLSDETDDVLRKGHNFIKNSQVRENPSGDFKSMYRHISK  470

Query  1019  GSWTFSDQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPES  840
             G+WT SD+DHGW VSDCTAE LKC +LL  MP +++G++ D ++LY++V++ L LQ  E 
Sbjct  471   GAWTLSDRDHGWQVSDCTAEALKCCMLLSLMPAEVVGQRIDPEQLYDSVNLLLSLQG-EK  529

Query  839   GGFATWEPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVN  660
             GG   WEP   Q +L++LNP++ F  ++ E E++E T ++I ALV F+  YP++R KE+ 
Sbjct  530   GGLTAWEPVRAQEWLELLNPTDFFTSVMAEREYVECTSAVIQALVLFKQLYPDHRTKEII  589

Query  659   ISIAKAVQYLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFL  480
              SI K VQ++E +Q  DGSWYG WG+CF+Y T+FAL GL AAGK+Y++C A+     F L
Sbjct  590   KSIEKGVQFIESKQTPDGSWYGNWGICFIYATWFALSGLAAAGKTYKSCLAMRKGVDFLL  649

Query  479   SKQNQEGGWGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKL  300
             + Q ++GGWGE   SCP  RYIPLEG  +NLVQT+WAM+GL++ GQAERDPTPLHRAAKL
Sbjct  650   TIQEEDGGWGESHLSCPEQRYIPLEGNRSNLVQTAWAMMGLIHAGQAERDPTPLHRAAKL  709

Query  299   LINAQMEDGDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRK  165
             +I +Q+E+GDFPQQ+I GV+M  CMLHYA++R+ FPL AL+EYRK
Sbjct  710   IITSQLENGDFPQQEILGVFMNTCMLHYATYRNTFPLWALAEYRK  754



>ref|XP_002264289.1| PREDICTED: cycloartenol Synthase [Vitis vinifera]
 emb|CBI24077.3| unnamed protein product [Vitis vinifera]
Length=760

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/756 (54%), Positives = 550/756 (73%), Gaps = 4/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI EGG P++ +TNN+ GRQ+WE+DP+ G+ E++E  E+AR+ F+K R +  H+  
Sbjct  1     MWKLKIAEGGSPWLRTTNNHVGRQVWEFDPDLGSAEQREEIERARETFSKHRFEKKHS-A  59

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DL MR+Q +KE+   V+ +P V++++ E+V  +A+T  +R+A+  +  LQA DGHWP + 
Sbjct  60    DLIMRIQFLKENAGTVV-LPQVKVKDTEDVTEDAVTNTLRRAINFHSTLQAHDGHWPGDY  118

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
              GP+F  P L+I L I+G+++ +L+ EH++E+ RYLYNHQN+DGGWGL+I+G STM G+ 
Sbjct  119   GGPMFLLPGLIITLSITGALNAVLSKEHRQEMCRYLYNHQNKDGGWGLHIEGPSTMFGTV  178

Query  1883  LNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLSP  1704
             LNYV LRLLGEG +D DGA+ +GR WIL+HGGAT I SWGK++LSVLGV+EW G NPL P
Sbjct  179   LNYVTLRLLGEGANDADGAMEKGRDWILNHGGATAITSWGKMWLSVLGVFEWSGNNPLPP  238

Query  1703  EFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQIDW  1524
             E WL P   P HP +MWC+CR  Y+PMSYLY KR+ GPLT  VL+LR E++   Y +IDW
Sbjct  239   EIWLLPYILPVHPGRMWCHCRMVYLPMSYLYGKRFVGPLTPTVLSLRKELYTVPYHEIDW  298

Query  1523  NQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEAE  1344
             NQAR  C KEDLYYPH  +QD+LW +L    EP +  WP KK+RE A+R  ++++ YE E
Sbjct  299   NQARNLCAKEDLYYPHPLVQDILWTSLDKVVEPILMHWPGKKLREKALRTVLEHVHYEDE  358

Query  1343  ETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGF-GSQNWDA  1167
              TRYI IG + K L M+C W EDPN +  K HL R+ D+LWLAEDGM M G+ GSQ WD 
Sbjct  359   NTRYICIGPVNKVLNMLCCWVEDPNSEAFKLHLPRIFDFLWLAEDGMKMQGYNGSQLWDT  418

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
             AF  QAII++ +VEEYG  LRK H Y+K+SQV E+  G+    YRH++KG+W FS  DHG
Sbjct  419   AFCVQAIISTDLVEEYGPTLRKAHAYLKKSQVLEDCPGNLDYWYRHISKGAWPFSTGDHG  478

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W +SDCTAE LK +LLL ++P +I+GE  D ++LY+AV+V L LQ+ + GGFAT+E    
Sbjct  479   WPISDCTAEGLKAILLLSKIPSEIVGEPLDAKQLYDAVNVILSLQNGD-GGFATYELTRS  537

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
               +L+++NP+E F DIV++  ++E T + + AL +F   YP +R +E+   I KA  ++E
Sbjct  538   YAWLELINPAETFGDIVIDYPYVECTSAALQALTSFNKFYPGHRREEIEHCIKKATMFIE  597

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
             K Q SDGSWYG WGVCF Y  +F + GL AAGK+Y NC ++C A  F LSKQ   GGWGE
Sbjct  598   KIQASDGSWYGSWGVCFTYAIWFGIKGLVAAGKNYNNCSSICKACDFLLSKQLASGGWGE  657

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                SC +  Y  L+G  +++V T+WAML L+  GQAERDPTPLHRAA++LIN+QME+GDF
Sbjct  658   SYLSCQNKVYSNLDGNRSHVVNTAWAMLALIDAGQAERDPTPLHRAARVLINSQMENGDF  717

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PQ++I GV+ +NCM+ YA++R+ FP+ AL EYR RV
Sbjct  718   PQEEIMGVFNRNCMITYAAYRNIFPIWALGEYRCRV  753



>sp|Q8W3Z2.1|LUPS_BETPL RecName: Full=Lupeol synthase [Betula platyphylla]
 dbj|BAB83087.1| lupeol synthase [Betula platyphylla]
Length=755

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/756 (54%), Positives = 545/756 (72%), Gaps = 5/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI EGG P + S N++ GRQ WE+DP+AGTP+E+   EK R+ FTK R +   +  
Sbjct  1     MWKLKIAEGG-PGLVSGNDFIGRQHWEFDPDAGTPQERAEVEKVREEFTKNRFQMKQS-A  58

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DL MRMQ+ KE+    +  PPV+++E E +  EA+ T +R+++    ++QA DGHWP E+
Sbjct  59    DLLMRMQLRKENPCQPIP-PPVKVKETEVITEEAVITTLRRSLSFYSSIQAHDGHWPGES  117

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GPLFF  P ++ALYI+G ++ I +  H+KE++RYLYNHQNEDGGWG +I+GHSTM GSA
Sbjct  118   AGPLFFLQPFVMALYITGDLNTIFSPAHQKEIIRYLYNHQNEDGGWGFHIEGHSTMFGSA  177

Query  1883  LNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             L+Y+ALR+LGEG +DG DGA+A+ RKWILDHGG   IPSWGK +++VLG+YEW GCNPL 
Sbjct  178   LSYIALRILGEGLEDGEDGAMAKSRKWILDHGGLVAIPSWGKFWVTVLGLYEWSGCNPLP  237

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFW  P  FP HP KM CYCR  YMPMSYLY KR+ GP+T ++ +LR E++ + Y QI+
Sbjct  238   PEFWFLPDIFPIHPGKMLCYCRLVYMPMSYLYGKRFVGPITGLIQSLRQELYNEPYHQIN  297

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+AR    KEDLYYPH  IQDLLW  L +  EP + RWPF  +RE A++ AI ++ YE 
Sbjct  298   WNKARSTVAKEDLYYPHPLIQDLLWGFLHHVAEPVLTRWPFSMLREKALKAAIGHVHYED  357

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E ++Y+ IG +EK L ++  WAEDPNG+  K HL R+PD  W+AEDG+ +  FG Q WDA
Sbjct  358   ENSKYLCIGSVEKVLCLIACWAEDPNGEAYKLHLGRIPDNYWVAEDGLKIQSFGCQMWDA  417

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
              FA QAI++  + EEY   LRK H ++K SQV ENP GDFK+MYRH+ KG+WTFS QDHG
Sbjct  418   GFAIQAILSCNLNEEYWPTLRKAHEFVKASQVPENPSGDFKAMYRHINKGAWTFSMQDHG  477

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE LK  +L  +MP  ++GEK + +RLY+AV+V L LQS  +GGF  WEP   
Sbjct  478   WQVSDCTAEGLKVAILFSQMPPDLVGEKIEKERLYDAVNVILSLQS-SNGGFPAWEPQRA  536

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
               +L+  NP+E F D ++E E++E T   +  L  FR  YP +R  E++ SI + +QY+E
Sbjct  537   YGWLEKFNPTEFFEDTLIEREYVECTSPAVHGLALFRKFYPRHRGTEIDSSIYRGIQYIE  596

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
               QE DGSWYG+WG+C+ YGT+FA+  L A G++Y+NC A+  +  F LSKQ   GGWGE
Sbjct  597   DVQEPDGSWYGHWGICYTYGTWFAVGALAACGRNYKNCPALRKSCEFLLSKQLPNGGWGE  656

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                S  +  +  +EG   NLVQT+WA+L L+   QAE DPTP+HR  ++LIN+QMEDGDF
Sbjct  657   SYLSSQNKVWTNIEGNRANLVQTAWALLSLIDARQAEIDPTPIHRGVRVLINSQMEDGDF  716

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PQQ+ITGV+M+NC L+Y+S+R+ FP+ AL EYR+RV
Sbjct  717   PQQEITGVFMRNCTLNYSSYRNIFPIWALGEYRRRV  752



>ref|NP_001236591.1| beta-amyrin synthase [Glycine max]
 gb|AAM23264.1| beta-amyrin synthase [Glycine max]
Length=739

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/758 (55%), Positives = 546/758 (72%), Gaps = 29/758 (4%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKI +GG  PYI+STNN+ GRQ WE+DP AG+PEE+   E AR+ F   R K    C
Sbjct  1     MWRLKIADGGNDPYIFSTNNFVGRQTWEFDPEAGSPEERAQVEAARQHFYHNRFK-VKPC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  R Q+++E+     +IP V + + EE+ Y+ +T+AVR+      ALQ  DGHWPA+
Sbjct  60    ADLLWRFQVLRENNFKQ-TIPRVTIEDGEEITYQKVTSAVRRGAHHLAALQTSDGHWPAQ  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
              +GPLFF PPL+  +YI+G+++ +   EH+KE++RY Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFLPPLVFCMYITGNLESVFPEEHRKEILRYTYYHQNEDGGWGLHIEGHSTMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
             ALNY+ +R+LGEGP+ G D A AR RKWI DHGG T IPSWGK +LS+LGV++W G NP+
Sbjct  179   ALNYICMRMLGEGPNGGHDNACARARKWIRDHGGVTHIPSWGKTWLSILGVFDWCGSNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HP                       GP+T ++L LR E+  + YE++
Sbjct  239   PPEFWILPSFLPMHP-----------------------GPITPLILQLREELFTQPYEKV  275

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W +AR  C KEDLYYPH  IQDL+W++L   TEP + RWPF K IRE A++  +K++ Y
Sbjct  276   NWKKARHQCAKEDLYYPHPLIQDLIWDSLYIFTEPLLTRWPFNKLIREKALQVTMKHIHY  335

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLARVPDYLW++EDGM+M  FGSQ W
Sbjct  336   EDETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMTMQSFGSQEW  395

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA FA QA++A+ ++EE G    K H +IK+SQVK+NP GDFKSM+RH++KGSWTFSDQD
Sbjct  396   DAGFAVQALLATNIIEEIGPTFAKGHDFIKKSQVKDNPFGDFKSMHRHISKGSWTFSDQD  455

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LLL  +P +I+GEK + +RLY++V+V L LQS + GG A WEP 
Sbjct  456   HGWQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQS-KKGGLAAWEPA  514

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               Q +L+  NP+E FADIVVE E++E  GS I ALV F+  YP  R KE+   I  AV+ 
Sbjct  515   GAQEWLEYSNPTEFFADIVVEHEYVECPGSAIQALVLFKKLYPGLRRKEIENFITNAVRS  574

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE  Q +DGSWYG WGVCF YG++FAL GL AAGK+Y  C A+  A  F L+ Q ++GGW
Sbjct  575   LEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTYTKCAAIRKAVKFLLTTQREDGGW  634

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   S P   Y+PLEG+ +N+V T+WA++GL++ GQA+RDP PLHRAAKLLIN+Q+E+G
Sbjct  635   GESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQADRDPMPLHRAAKLLINSQLEEG  694

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             D+PQQ+ITGV+MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  695   DWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  732



>ref|XP_008223938.1| PREDICTED: cycloartenol synthase 2 [Prunus mume]
Length=757

 Score =   887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/756 (55%), Positives = 544/756 (72%), Gaps = 4/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI EGG P++ + NN+ GRQ+WE+DP  GTPEE    EKAR+ F   R    H+  
Sbjct  1     MWKLKIAEGGSPWLRTLNNHVGRQVWEFDPKLGTPEELLEIEKAREHFHNNRFVKKHS-S  59

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DLFMRMQ+ KE+    + +P +++++ E+V  E +T  +R+A+  + +LQA DGHWP + 
Sbjct  60    DLFMRMQLSKENPGHAV-LPQIKVKDTEDVTGETVTNILRRAINFHSSLQAHDGHWPGDY  118

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
              GP+F  P L+I L I+G+++ +L+ EHKKE+ RYLYNHQN+DGGWGL+I+G STM GS 
Sbjct  119   GGPMFLLPGLVITLSITGALNAVLSDEHKKEICRYLYNHQNKDGGWGLHIEGPSTMFGSV  178

Query  1883  LNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLSP  1704
             L YV LRLLGEG  DG GA+  GRKWILDHGGAT I SWGK++LSVLG +EW G NPL P
Sbjct  179   LTYVTLRLLGEGAKDGQGAMESGRKWILDHGGATAITSWGKMWLSVLGAFEWSGNNPLPP  238

Query  1703  EFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQIDW  1524
             E WL P   P HP +MWC+CR  Y+PMSYLY KR+ GP+T  VL+LR E+    Y +IDW
Sbjct  239   EIWLLPYMLPIHPGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFNAPYHEIDW  298

Query  1523  NQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEAE  1344
             N AR  C KEDLYYPH F+QD+LW++L    EP + RWP KK+RE A++ AI+++ YE E
Sbjct  299   NVARNQCAKEDLYYPHPFVQDILWSSLHMAVEPILMRWPGKKLREKALKTAIEHIHYEDE  358

Query  1343  ETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGF-GSQNWDA  1167
              TRYI IG + K L M+C W EDPN +  K HL R+ DYLW+AEDGM M G+ GSQ WD 
Sbjct  359   NTRYICIGPVNKVLNMLCCWVEDPNSEAFKLHLPRIYDYLWIAEDGMKMQGYNGSQLWDT  418

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
             AFA QAII++ +VEE+G  LRK H +IK+SQV EN  GD    YRH++KG+W FS  DHG
Sbjct  419   AFAVQAIISTNLVEEFGSTLRKGHKFIKDSQVLENCPGDLDFWYRHISKGAWPFSTADHG  478

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W +SDCTAE LK +L L ++P +I+GE  D +RL+++V+V L LQ+ + GGFAT+E    
Sbjct  479   WPISDCTAEGLKAVLSLSKIPSEIVGEPLDAKRLFDSVNVVLSLQNSD-GGFATYELTRS  537

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
               +L+++NP+E F DIV++  ++E T + I AL +F+  YP +R +E+   I +AV+++E
Sbjct  538   YRWLELINPAETFGDIVIDYPYVECTSAAIQALASFKKLYPGHRSEEIERCIKRAVEFIE  597

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
             K QESDGSWYG WGVCF YGT+F + GL AAG++Y N  ++  A  F LSKQ   GGW E
Sbjct  598   KIQESDGSWYGSWGVCFTYGTWFGVKGLVAAGRNYNNSSSIRKACDFLLSKQLASGGWAE  657

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                SC +  Y  LEG  +++V T WAML L+  GQAERDPTPLHRAA+ LIN+QME+GDF
Sbjct  658   SYLSCQNKVYTNLEGDRSHVVNTGWAMLALIDAGQAERDPTPLHRAARRLINSQMENGDF  717

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PQ++I GV+ +NCM+ YA++R+ FP+ AL EYR RV
Sbjct  718   PQEEIMGVFNRNCMITYAAYRNIFPIWALGEYRCRV  753



>emb|CBI18408.3| unnamed protein product [Vitis vinifera]
Length=814

 Score =   887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/759 (56%), Positives = 549/759 (72%), Gaps = 7/759 (1%)
 Frame = -3

Query  2426  KMWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPH  2253
             KMW+LK+ +GG  PYIY+TNN+ GRQIWE+DP+ GT EE+   E AR+ F K R Q  P 
Sbjct  57    KMWRLKVADGGNDPYIYTTNNFVGRQIWEFDPDYGTTEERAEVEAARENFWKNRFQVKPS  116

Query  2252  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2073
             +  DL  RMQ ++E      +IP V++   EE+ YE  TTAVR+A     ALQA DGHWP
Sbjct  117   S--DLLCRMQFLREKNFKQ-TIPQVKVGHGEEITYETTTTAVRRAAHFFSALQASDGHWP  173

Query  2072  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  1893
             AENSGPLF  PPL++ LYI+G +D +   E++KE++R+++ HQNEDGGWG +++GHSTM 
Sbjct  174   AENSGPLFLLPPLVMCLYITGHLDTVFPGEYRKEILRFIFCHQNEDGGWGFHVEGHSTMY  233

Query  1892  GSALNYVALRLLGEGPDDGDG-AIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCN  1716
              +  NY+ +R+LG GPDDG G A  RGRKWILD GGAT IP+WGK +LSVLG+YEW GCN
Sbjct  234   CTVYNYICMRILGVGPDDGQGNACPRGRKWILDRGGATSIPTWGKAWLSVLGLYEWAGCN  293

Query  1715  PLSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYE  1536
              + PEFW+ PS FP HPAK+WCY R  YMP+SYLY KR+ GP+T +VL LR E+ ++ Y 
Sbjct  294   SMPPEFWMLPSFFPIHPAKLWCYTRMVYMPLSYLYGKRFVGPITPLVLQLREELFLQPYN  353

Query  1535  QIDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMR  1356
             +I+W + R  C +EDLYYPHS IQDL+ + +   TEPF+ RWPF K+RE A+   +K++ 
Sbjct  354   EINWKKVRHHCAQEDLYYPHSLIQDLMRDGVDLFTEPFLTRWPFNKLREKALETTMKHIH  413

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE   + YIT+ C+EK L M   W EDP GD  K HLAR+PDY+W+AEDG+ M   GSQ 
Sbjct  414   YEDRNSGYITLACVEKVLCMFACWVEDPYGDSFKKHLARLPDYIWIAEDGIKMQAVGSQL  473

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD++ A QA+IA  + +E G  L K H +IK+SQV++NP GDF+ MYRH++KGSWTFS +
Sbjct  474   WDSSLAIQALIACKLTDEIGPTLMKGHDFIKKSQVRDNPSGDFRGMYRHISKGSWTFSVR  533

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             D  W VSDCTAE  KC LLL  MP +I+GEK + + LY++V+  L LQS ++GG + WEP
Sbjct  534   DQHWQVSDCTAEGFKCCLLLSVMPPEIVGEKIEPEWLYDSVNFMLSLQS-KNGGLSAWEP  592

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                  +L+ LNP+E+F D+ +E E++E T S I ALV F+  YP +R +E+ I I  AVQ
Sbjct  593   AGTSKWLESLNPTEMFEDVFIEHEYVENTASAIDALVLFKKLYPGHRKQEIEIFIKNAVQ  652

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             Y+E+ Q  DGSWYG WGVCF YGT+FAL GL AAGK+Y NC AV  AA F L  Q  +GG
Sbjct  653   YIEEIQMPDGSWYGNWGVCFTYGTWFALRGLAAAGKTYHNCLAVRKAADFLLKLQLDDGG  712

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE   SC   +Y PLEG  +NL+QT W ++GL+++GQAERDPTPLHRAAKLLIN+QMED
Sbjct  713   WGESYLSCSDKKYTPLEGNRSNLIQTGWTLMGLLHSGQAERDPTPLHRAAKLLINSQMED  772

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+I G  +K CM+HY + R+ +PL A++EYR+ V
Sbjct  773   GDFPQQEIVGASLKTCMIHYPTCRNIYPLWAIAEYRQLV  811



>ref|XP_006450022.1| hypothetical protein CICLE_v10013952mg [Citrus clementina]
 gb|ESR63262.1| hypothetical protein CICLE_v10013952mg [Citrus clementina]
Length=761

 Score =   887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/759 (53%), Positives = 543/759 (72%), Gaps = 6/759 (1%)
 Frame = -3

Query  2423  MWKLKI--GEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LKI  G+   PY+++TNN+ GRQIWE+DPNAG+PEE    E+AR+ F K R      
Sbjct  1     MWRLKIAVGDKNSPYMFTTNNFVGRQIWEFDPNAGSPEELAEVEEARQSFYKNRHN-VKP  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GDL  R+Q ++E       IP V++++ E + YE  TTA+++A     A+QA DGHWPA
Sbjct  60    AGDLLWRLQFLREKNFKP-RIPQVKVKDGEAITYETATTAMKRAAHYFSAIQASDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GP++F PP +  LYI+G ++ + T EH++E++RYLYNHQ+EDGGWG++++  S+M G
Sbjct  119   ENAGPMYFLPPFVFCLYITGHLNTVFTVEHRREILRYLYNHQHEDGGWGVHVEAPSSMFG  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +  +Y+ +RLLG GP+DG + A AR RKWI DHGG T IPSWGK +LS+LG++EW G NP
Sbjct  179   TVFSYLCMRLLGLGPNDGENNACARARKWIRDHGGVTYIPSWGKNWLSILGIFEWSGTNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HP+KMWCYCR  YMP+SYLY KR+ GP+T ++  LR E+H + Y +
Sbjct  239   MPPEFWILPSFVPLHPSKMWCYCRLVYMPVSYLYGKRFVGPITPLIQQLREELHTQPYNE  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W + R  C KEDLYYPH F+Q+LLW+ L   +EP + RWP  K IR+ A+++ +K++ 
Sbjct  299   INWRKVRHLCSKEDLYYPHPFVQELLWDTLYLASEPLLTRWPLNKLIRQKALKETMKFIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE   +RYITIGC+EK L M+  W EDPNG   K HL R+ DY+WL EDGM +  FGSQ 
Sbjct  359   YEDHNSRYITIGCVEKPLCMLACWVEDPNGIAFKKHLNRIADYIWLGEDGMKVQTFGSQT  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD A   QA++A  + +E    L K H Y+K++Q+++NP GD+K  +RH +KG+WTFSDQ
Sbjct  419   WDTALGLQALMACNIADEVESVLGKGHDYLKKAQIRDNPVGDYKGNFRHFSKGAWTFSDQ  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC+L L  MP +I+GEK + +RLY+AV+  L LQ  ++GG A WE 
Sbjct  479   DHGWQVSDCTAEGLKCVLQLSLMPPEIVGEKMEPERLYDAVNFLLSLQDEKTGGLAVWER  538

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                   L+ LNP E   D++VE  ++E T S I A + F+  YP++R KE+   I KAV 
Sbjct  539   AGASLLLEWLNPVEFLEDLIVEHTYVECTASAIEAFMLFKKLYPHHRKKEIENFIVKAVH  598

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             Y+E +Q +DGSWYG WG+CF+YGT FAL GL  AGK+Y NC A+  A  F L+ Q+ +GG
Sbjct  599   YIEDEQTADGSWYGNWGICFIYGTCFALGGLQVAGKTYNNCLAIRRAVDFLLNAQSDDGG  658

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE  +SCP+  Y PLEG  + +V T+ A+L L+  GQA+RDPTP+HR  KLLIN+Q+E+
Sbjct  659   WGESYKSCPNKIYTPLEGKRSTVVHTALAVLSLISAGQADRDPTPIHRGVKLLINSQLEN  718

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+I GV+M+NCMLHYA +R+ FPL AL+EYRKRV
Sbjct  719   GDFPQQEIMGVFMRNCMLHYAEYRNIFPLRALAEYRKRV  757



>ref|XP_010532332.1| PREDICTED: camelliol C synthase-like [Tarenaya hassleriana]
Length=740

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/729 (57%), Positives = 543/729 (74%), Gaps = 5/729 (1%)
 Frame = -3

Query  2339  DPNAGTPEEQEAFEKARKGFTKQRQKGPHTCGDLFMRMQMIKESEVDVLSIPPVRLREEE  2160
             D +AG+PEE  A E+ R+ F + R +      DL  RMQ +KE + + L IPPV++ + E
Sbjct  10    DADAGSPEELSAVEECRRSFYENRSR-VKASSDLLWRMQFLKEKKFEQL-IPPVKVGDAE  67

Query  2159  EVNYEAITTAVRKAVRLNCALQAKDGHWPAENSGPLFFTPPLMIALYISGSIDMILTSEH  1980
             ++ +E +T A+R+ VRL  ALQ+ DGHWPAEN+GPLFF PPL+  LYI+G +D + T+EH
Sbjct  68    KITHETLTNALRRGVRLLSALQSDDGHWPAENAGPLFFLPPLVFCLYITGYLDEVFTAEH  127

Query  1979  KKELVRYLYNHQNEDGGWGLYIDGHSTMIGSALNYVALRLLGEGPDDG-DGAIARGRKWI  1803
             +KE +RY+Y HQNEDGGWGL+I+GHSTM  +ALNY+ +R+LGEG D G + A  R R+WI
Sbjct  128   RKEALRYIYCHQNEDGGWGLHIEGHSTMFCTALNYICMRILGEGLDGGRENACRRARQWI  187

Query  1802  LDHGGATQIPSWGKIYLSVLGVYEWDGCNPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPM  1623
             L HGG T IPSWGK +LS+LGV++W G NP+ PEFW+ PS  P HPAKM CYCR  YMP+
Sbjct  188   LGHGGVTYIPSWGKAWLSILGVFDWAGSNPMPPEFWILPSFLPIHPAKMLCYCRMVYMPL  247

Query  1622  SYLYAKRYRGPLTDVVLALRNEIHVKSYEQIDWNQARMACCKEDLYYPHSFIQDLLWNAL  1443
             SYLY KR+   +T ++L LR E++++ YE I+WN+AR  C KEDLYYPH  IQDL+W+ L
Sbjct  248   SYLYGKRFAAQITPLILQLREELYLQPYETINWNKARHLCAKEDLYYPHPLIQDLIWDCL  307

Query  1442  QYCTEPFMRRWPFKKI-REMAMRKAIKYMRYEAEETRYITIGCIEKSLQMMCWWAEDPNG  1266
                 EPF+ RWPF K+ RE A++ A++++ YE E +RYITIGC+EK+L M+  W EDPNG
Sbjct  308   HTLMEPFLARWPFNKLLREKALKVAMEHIHYEDENSRYITIGCVEKALCMLACWVEDPNG  367

Query  1265  DELKYHLARVPDYLWLAEDGMSMHGFGSQNWDAAFATQAIIASGMVEEYGDCLRKVHFYI  1086
             D  K HLARV DYLW+AEDGM M  FGSQ WD  FA QA++AS +  E  D L++ H +I
Sbjct  368   DYFKKHLARVLDYLWVAEDGMKMQSFGSQLWDTGFAIQALLASNLSSEISDVLKRGHNFI  427

Query  1085  KESQVKENPKGDFKSMYRHVTKGSWTFSDQDHGWAVSDCTAETLKCLLLLGEMPHKIIGE  906
             K SQV ENP  DFKSMYRH++KG+WTFSD+DHGW VSDCTA+ LKC L+L  MP  ++G 
Sbjct  428   KMSQVIENPSDDFKSMYRHISKGAWTFSDRDHGWQVSDCTADGLKCCLMLSTMPPNMVGP  487

Query  905   KPDVQRLYEAVDVCLYLQSPESGGFATWEPPVPQPYLQVLNPSEIFADIVVEEEHIEPTG  726
             K D +RLY++V++ L LQS ++GG   WEP     +L++ NP+E FAD ++E ++ E T 
Sbjct  488   KMDPERLYDSVNIILSLQS-KNGGVTAWEPARAYGWLELFNPTEFFADTLIEYQYAECTS  546

Query  725   SIISALVAFRCHYPNYRPKEVNISIAKAVQYLEKQQESDGSWYGYWGVCFLYGTFFALLG  546
             S I ALV FR  YP++R KE+N  I KAV+Y+++ Q  DGSWYG WGVCF YGT+FAL G
Sbjct  547   SAIQALVLFRKLYPDHRAKEINTFIEKAVEYIKRIQMPDGSWYGSWGVCFTYGTWFALAG  606

Query  545   LTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGECLQSCPSMRYIPLEGTGTNLVQTSWAM  366
             L AAGK+Y+NC       HF L+ Q   GGWGE   SCP  RY+ L+G  +NLVQTSWAM
Sbjct  607   LAAAGKTYDNCLVTRKGVHFLLTTQKDNGGWGESYLSCPEKRYVQLDGERSNLVQTSWAM  666

Query  365   LGLMYTGQAERDPTPLHRAAKLLINAQMEDGDFPQQDITGVYMKNCMLHYASHRSYFPLM  186
             +GL+++GQAERDP PLHRAAKL+IN+Q+E GDFPQQ+ITG +MKNCMLHY+++R+ FPL 
Sbjct  667   MGLLHSGQAERDPEPLHRAAKLIINSQLESGDFPQQEITGAFMKNCMLHYSAYRNTFPLW  726

Query  185   ALSEYRKRV  159
             AL+EYR+RV
Sbjct  727   ALAEYRRRV  735



>gb|AIK19225.1| triterpene synthase [Eugenia uniflora]
Length=758

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/758 (54%), Positives = 557/758 (73%), Gaps = 10/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKIG+G   PY++S NN+ GRQ WE+DP AGTPEE+   E AR+ F   R K     
Sbjct  1     MWKLKIGDGANDPYLFSLNNFVGRQTWEFDPEAGTPEERAEVEAARQNFYNNRFK-VRPS  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DL  R Q+++E      + PPV++ + EE+ YE  T AVR++V    ALQ+  GHWPAE
Sbjct  60    SDLLWRFQLLREKNFKQ-TTPPVKIEDGEEITYEKATAAVRRSVSFWSALQSSHGHWPAE  118

Query  2066  NSGPL-FFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             N+GP+ F+ PPL+++LY++G ++ +  +EH++E++RY+Y HQN+DGGWGL+I+GHSTMIG
Sbjct  119   NAGPIAFYFPPLVMSLYVTGYLNTVFHAEHRREILRYIYYHQNQDGGWGLHIEGHSTMIG  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNYV +RLLGEGPD G D A  RGRKWILDHG AT+  SWGK +L++ G+YEW GC+P
Sbjct  179   TVLNYVCMRLLGEGPDGGLDNACERGRKWILDHGSATKTASWGKTWLAITGLYEWVGCHP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW FPS     PA+M+CYCR TYMPMSYLY K++ GP+T ++  +R EI+ + Y+Q
Sbjct  239   MPPEFWDFPSFMS--PAQMFCYCRLTYMPMSYLYGKKFVGPITPLIKQIREEIYNEPYDQ  296

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I W + R  C  ED +YPH+ +Q L+W+ L + TEP + RWPFKKIR++A+RK ++++ Y
Sbjct  297   ISWWKIRHLCAAEDAHYPHTKLQTLMWDTLYFGTEPLLNRWPFKKIRDIAIRKTMEHIHY  356

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNG+  K HL+RVPDY+W+ EDG+ M  FGSQ W
Sbjct  357   EDENSRYITIGCVEKPLMMLACWVEDPNGEAFKKHLSRVPDYVWVGEDGIKMQSFGSQVW  416

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D   + QA++AS +++E G  L+K H ++KESQ+  NP GD K MYRH++KG+W FSD+D
Sbjct  417   DCGLSLQALLASDLIDEVGPALKKGHEFLKESQIDRNPSGDLKKMYRHISKGAWAFSDKD  476

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE++KCLLL   MP +I+G+  + ++LY+AV+V L LQ+ ++GG + WEP 
Sbjct  477   HGWQVSDCTAESMKCLLLFAMMPPEIVGQTMEPEKLYDAVNVILSLQN-KNGGMSAWEPS  535

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP E   D+V+E E++E T S I AL+ FR  +P +R KE++  I  A Q+
Sbjct  536   GAGSWLELLNPVEFLEDLVIEYEYVECTSSSIQALLLFRKLHPGHRKKEIDRFIVNATQF  595

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +   Q+ DGSWYG WG+CF+YGT+FAL+GL A GK+YENCEAV     F L+ QN++GGW
Sbjct  596   ILDIQKPDGSWYGNWGICFIYGTWFALVGLEAVGKTYENCEAVRRGVEFLLNAQNEDGGW  655

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP+  Y PL    TNL+ TS A++GL++ GQAERDPTP+HR AK+LIN Q++DG
Sbjct  656   GESYLSCPAKVYKPL--GHTNLIHTSLAIMGLIHAGQAERDPTPIHRGAKILINGQLDDG  713

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQ+++ GV+M+NCMLHY+++R+ FP  AL EYR  V
Sbjct  714   DFPQEELMGVFMRNCMLHYSAYRNIFPTWALGEYRHFV  751



>ref|XP_010095206.1| Lupeol synthase [Morus notabilis]
 gb|EXB58667.1| Lupeol synthase [Morus notabilis]
Length=788

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/788 (52%), Positives = 549/788 (70%), Gaps = 36/788 (5%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI EGG  Y+ S NN+ GRQ WE+DP+AGT EE+   ++ R+ F   R     +  
Sbjct  1     MWKLKIAEGGA-YVRSVNNHVGRQHWEFDPDAGTLEERAHVQRLRQHFKNNRFLHKQS-A  58

Query  2243  DLFMRMQMIKESEVDVLSI--------------------------PPVRLREEEEVNYEA  2142
             DL MR+Q I+E   + L +                          PPV++ E E++  +A
Sbjct  59    DLLMRLQTIREILHNELRVGMTILPISTRTHEYPLRKENPCGSIPPPVKVNETEDITEDA  118

Query  2141  ITTAVRKAVRLNCALQAKDGHWPAENSGPLFFTPP------LMIALYISGSIDMILTSEH  1980
             +   +R+A+    ++QA DGHWPAE++GPLFF PP      L+I+LY++G+++ +L  EH
Sbjct  119   VANTLRRALSFYSSIQAHDGHWPAESAGPLFFLPPLTAIKALVISLYVTGAVNAVLGPEH  178

Query  1979  KKELVRYLYNHQNEDGGWGLYIDGHSTMIGSALNYVALRLLGEGPDDG-DGAIARGRKWI  1803
             +KE++RY+YNHQNEDGGWGL+I+GHSTM GSAL+Y+ALRLLG+G DDG D A+ + RKWI
Sbjct  179   RKEIIRYIYNHQNEDGGWGLHIEGHSTMFGSALSYIALRLLGQGLDDGDDNAMEKARKWI  238

Query  1802  LDHGGATQIPSWGKIYLSVLGVYEWDGCNPLSPEFWLFPSNFPFHPAKMWCYCRTTYMPM  1623
             LDHGG   IPSWGK +++VLGVYEW GCNPL PEFWL P+  P HP KM CYCR  YMPM
Sbjct  239   LDHGGVVAIPSWGKFWITVLGVYEWSGCNPLPPEFWLLPTISPIHPGKMLCYCRLVYMPM  298

Query  1622  SYLYAKRYRGPLTDVVLALRNEIHVKSYEQIDWNQARMACCKEDLYYPHSFIQDLLWNAL  1443
             SYLY KR+ GP+T +V +LR E++ + Y+ ++WN+AR    KEDLYYPH  +QD+LW  L
Sbjct  299   SYLYGKRFVGPITKLVKSLRQELYNQPYDHVNWNKARNTVAKEDLYYPHPVVQDMLWGFL  358

Query  1442  QYCTEPFMRRWPFKKIREMAMRKAIKYMRYEAEETRYITIGCIEKSLQMMCWWAEDPNGD  1263
              +  EP +R WPF  +R+ A++ AI+++ YE E +RY+ IGC+EK L ++  W EDPN +
Sbjct  359   HHVAEPILRHWPFSMLRDKALKAAIQHVHYEDENSRYLCIGCVEKVLCLIACWVEDPNSE  418

Query  1262  ELKYHLARVPDYLWLAEDGMSMHGFGSQNWDAAFATQAIIASGMVEEYGDCLRKVHFYIK  1083
               K HLAR+PDYLWLAEDG+    FGSQ WDAAFA QAII+  + EEYG  LR+ H ++K
Sbjct  419   AYKLHLARIPDYLWLAEDGLKFQSFGSQMWDAAFAVQAIISCNLNEEYGPTLRRAHEFVK  478

Query  1082  ESQVKENPKGDFKSMYRHVTKGSWTFSDQDHGWAVSDCTAETLKCLLLLGEMPHKIIGEK  903
              SQV+ENP GDF  MYRH++KG+WTFS QDHGW VSDCTAE LK  LL  +MP +I+GEK
Sbjct  479   ASQVRENPSGDFSKMYRHISKGAWTFSIQDHGWQVSDCTAEGLKAALLFSQMPTEIVGEK  538

Query  902   PDVQRLYEAVDVCLYLQSPESGGFATWEPPVPQPYLQVLNPSEIFADIVVEEEHIEPTGS  723
              + +R Y+AV+V L LQS ++GGF  WEP     +L+  NP+E F D ++E E++E T S
Sbjct  539   METERFYDAVNVILSLQS-KNGGFPAWEPQRAFRWLEKFNPTEFFEDTLIEREYVECTSS  597

Query  722   IISALVAFRCHYPNYRPKEVNISIAKAVQYLEKQQESDGSWYGYWGVCFLYGTFFALLGL  543
              I  L  FR  YP +R KE++  I+K + Y++  Q  DGSW G WG+C+ YGT+FA+  L
Sbjct  598   AIQGLAMFRKLYPKHRRKEIDSCISKGLGYIQDTQNLDGSWTGCWGICYTYGTWFAVEAL  657

Query  542   TAAGKSYENCEAVCNAAHFFLSKQNQEGGWGECLQSCPSMRYIPLEGTGTNLVQTSWAML  363
              A GKSY NC ++  A  F LSKQ   GGWGE   S  +  Y  LEG   NLVQT+WA+L
Sbjct  658   AACGKSYNNCVSLQKACQFLLSKQLPNGGWGESYLSSQNKVYTNLEGHRANLVQTAWALL  717

Query  362   GLMYTGQAERDPTPLHRAAKLLINAQMEDGDFPQQDITGVYMKNCMLHYASHRSYFPLMA  183
              L+  GQA+ +PTP+HR  ++LIN QMEDGDFPQ++ITGV+MKNC L+Y+S+R+ FP+ A
Sbjct  718   SLIKAGQADINPTPIHRGIRVLINMQMEDGDFPQKEITGVFMKNCTLNYSSYRNIFPIWA  777

Query  182   LSEYRKRV  159
             L EYR+R+
Sbjct  778   LGEYRRRL  785



>ref|XP_006468116.1| PREDICTED: beta-amyrin synthase-like [Citrus sinensis]
Length=761

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/759 (53%), Positives = 542/759 (71%), Gaps = 6/759 (1%)
 Frame = -3

Query  2423  MWKLKIGEG--GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2250
             MW+LK+ EG    PY+++TNN+ GRQIWE+DP AG+PEE    E+AR+ F K R      
Sbjct  1     MWRLKVAEGDKNSPYMFTTNNFVGRQIWEFDPKAGSPEELAEVEEARQKFYKNRHN-VKP  59

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
              GDL  R+Q ++E       IP V++++ + + YE  TTA+++A     A+QA DGHWPA
Sbjct  60    AGDLLWRLQFLREKNFKQ-RIPQVKVKDGDAITYETATTAMKRAAHYFSAIQASDGHWPA  118

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GP++F PP +  LYI+G ++ + T EH++E++RYLYNHQ+EDGGWG++++  S+M G
Sbjct  119   ENAGPMYFLPPFVFCLYITGHLNTVFTVEHRREILRYLYNHQHEDGGWGVHVEAPSSMFG  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +  +Y+ +RLLG GP+DG + A AR RKWI DHGG T IPSWGK +LS+LG++EW G NP
Sbjct  179   TVFSYLCMRLLGLGPNDGENNACARARKWIRDHGGVTYIPSWGKNWLSILGIFEWSGTNP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS  P HP+KMWCYCR  YMP+SYLY KR+ GP+T ++  LR E+H + Y +
Sbjct  239   MPPEFWILPSFVPLHPSKMWCYCRLVYMPVSYLYGKRFVGPITPLIQQLREELHTQPYNE  298

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMR  1356
             I+W + R  C KEDLYYPH F+Q+LLW+ L   +EP + RWP  K IR+ A+++ +K++ 
Sbjct  299   INWRKVRHLCAKEDLYYPHPFVQELLWDTLYLASEPLLTRWPLNKLIRQKALKETMKFIH  358

Query  1355  YEAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQN  1176
             YE   +RYITIGC+EK L M+  W EDPNG   K HL R+ DY+WL EDGM +  FGSQ 
Sbjct  359   YEDHNSRYITIGCVEKPLCMLACWVEDPNGIAFKKHLNRIADYIWLGEDGMKVQTFGSQT  418

Query  1175  WDAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQ  996
             WD A   QA++A  + +E    L K H Y+K++Q+++NP GD+K  +RH +KG+WTFSDQ
Sbjct  419   WDTALGLQALMACNIADEVESVLGKGHDYLKKAQIRDNPVGDYKGNFRHFSKGAWTFSDQ  478

Query  995   DHGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEP  816
             DHGW VSDCTAE LKC+L L  MP +I+GEK + +RLY+AV+  L LQ  ++GG A WE 
Sbjct  479   DHGWQVSDCTAEGLKCVLQLSLMPPEIVGEKMEPERLYDAVNFLLSLQDEKTGGLAVWER  538

Query  815   PVPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQ  636
                   L+ LNP E   D++VE  ++E T S I A   F+  YP++R KE+   I KAVQ
Sbjct  539   AGASLLLEWLNPVEFLEDLIVEHTYVECTASAIEAFTLFKKLYPHHRKKEIENFIVKAVQ  598

Query  635   YLEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGG  456
             Y+E +Q +DGSWYG WG+CF+YGT FAL GL  AGK+Y NC A+  A  F L+ Q+ +GG
Sbjct  599   YIEDEQTADGSWYGNWGICFIYGTCFALGGLQVAGKTYNNCLAIRRAVDFLLNAQSDDGG  658

Query  455   WGECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMED  276
             WGE  +SCP+  Y PLEG  + +V T+ A+L L+  GQA+RDPTP+HR  KLLIN+Q+E+
Sbjct  659   WGESYKSCPNKIYTPLEGKRSTVVHTALAVLSLISAGQADRDPTPIHRGVKLLINSQLEN  718

Query  275   GDFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             GDFPQQ+I GV+M+NCMLHYA +R+ FPL AL+EYRKRV
Sbjct  719   GDFPQQEIMGVFMRNCMLHYAEYRNIFPLRALAEYRKRV  757



>ref|XP_010655249.1| PREDICTED: beta-amyrin synthase [Vitis vinifera]
 ref|XP_010655250.1| PREDICTED: beta-amyrin synthase [Vitis vinifera]
 ref|XP_010655251.1| PREDICTED: beta-amyrin synthase [Vitis vinifera]
Length=757

 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/758 (56%), Positives = 548/758 (72%), Gaps = 7/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LK+ +GG  PYIY+TNN+ GRQIWE+DP+ GT EE+   E AR+ F K R Q  P +
Sbjct  1     MWRLKVADGGNDPYIYTTNNFVGRQIWEFDPDYGTTEERAEVEAARENFWKNRFQVKPSS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  RMQ ++E      +IP V++   EE+ YE  TTAVR+A     ALQA DGHWPA
Sbjct  61    --DLLCRMQFLREKNFKQ-TIPQVKVGHGEEITYETTTTAVRRAAHFFSALQASDGHWPA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             ENSGPLF  PPL++ LYI+G +D +   E++KE++R+++ HQNEDGGWG +++GHSTM  
Sbjct  118   ENSGPLFLLPPLVMCLYITGHLDTVFPGEYRKEILRFIFCHQNEDGGWGFHVEGHSTMYC  177

Query  1889  SALNYVALRLLGEGPDDGDG-AIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             +  NY+ +R+LG GPDDG G A  RGRKWILD GGAT IP+WGK +LSVLG+YEW GCN 
Sbjct  178   TVYNYICMRILGVGPDDGQGNACPRGRKWILDRGGATSIPTWGKAWLSVLGLYEWAGCNS  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ PS FP HPAK+WCY R  YMP+SYLY KR+ GP+T +VL LR E+ ++ Y +
Sbjct  238   MPPEFWMLPSFFPIHPAKLWCYTRMVYMPLSYLYGKRFVGPITPLVLQLREELFLQPYNE  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I+W + R  C +EDLYYPHS IQDL+ + +   TEPF+ RWPF K+RE A+   +K++ Y
Sbjct  298   INWKKVRHHCAQEDLYYPHSLIQDLMRDGVDLFTEPFLTRWPFNKLREKALETTMKHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E   + YIT+ C+EK L M   W EDP GD  K HLAR+PDY+W+AEDG+ M   GSQ W
Sbjct  358   EDRNSGYITLACVEKVLCMFACWVEDPYGDSFKKHLARLPDYIWIAEDGIKMQAVGSQLW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D++ A QA+IA  + +E G  L K H +IK+SQV++NP GDF+ MYRH++KGSWTFS +D
Sbjct  418   DSSLAIQALIACKLTDEIGPTLMKGHDFIKKSQVRDNPSGDFRGMYRHISKGSWTFSVRD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
               W VSDCTAE  KC LLL  MP +I+GEK + + LY++V+  L LQS ++GG + WEP 
Sbjct  478   QHWQVSDCTAEGFKCCLLLSVMPPEIVGEKIEPEWLYDSVNFMLSLQS-KNGGLSAWEPA  536

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L+ LNP+E+F D+ +E E++E T S I ALV F+  YP +R +E+ I I  AVQY
Sbjct  537   GTSKWLESLNPTEMFEDVFIEHEYVENTASAIDALVLFKKLYPGHRKQEIEIFIKNAVQY  596

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E+ Q  DGSWYG WGVCF YGT+FAL GL AAGK+Y NC AV  AA F L  Q  +GGW
Sbjct  597   IEEIQMPDGSWYGNWGVCFTYGTWFALRGLAAAGKTYHNCLAVRKAADFLLKLQLDDGGW  656

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SC   +Y PLEG  +NL+QT W ++GL+++GQAERDPTPLHRAAKLLIN+QMEDG
Sbjct  657   GESYLSCSDKKYTPLEGNRSNLIQTGWTLMGLLHSGQAERDPTPLHRAAKLLINSQMEDG  716

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+I G  +K CM+HY + R+ +PL A++EYR+ V
Sbjct  717   DFPQQEIVGASLKTCMIHYPTCRNIYPLWAIAEYRQLV  754



>ref|XP_004510379.1| PREDICTED: mixed-amyrin synthase-like [Cicer arietinum]
Length=762

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/758 (53%), Positives = 551/758 (73%), Gaps = 6/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MW+LKIG+GG  P I+S NN+ GRQ WE+DPNAGTP++    E AR+ F   R K    C
Sbjct  1     MWRLKIGDGGKDPNIFSLNNFVGRQTWEFDPNAGTPQDIAQVEHARQHFYDNRFKFK-AC  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  R Q+++E+     +I  V++++ E++  E + + +R+AV    ALQ+ DGHWPA 
Sbjct  60    GDLLCRFQILRENNFKQ-TIADVKIKDGEKITEEKVRSTLRRAVHHLSALQSSDGHWPAI  118

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             N+GPLF+ PPL+  LY++G +D +L+ E++KE++RY+Y HQNEDGGWGL+I+GHS M  +
Sbjct  119   NTGPLFYIPPLVFCLYVTGHLDSVLSEEYRKEILRYIYCHQNEDGGWGLHIEGHSVMFCT  178

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              LNY+ +R+LGEGP+ G + A ARGR+WI DHGG T +PSWGK +LS+LG+++W   NP+
Sbjct  179   VLNYICMRILGEGPNGGRENACARGRQWIYDHGGVTHVPSWGKFWLSILGIFDWGASNPM  238

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS    HP +M  YCR  YMPMSYLY KR+ G +T ++L LR E+  +SYE++
Sbjct  239   PPEFWMLPSFLLKHPVRMLSYCRLVYMPMSYLYGKRFVGSITQLILKLREELLPQSYEKV  298

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKK-IREMAMRKAIKYMRY  1353
             +W + R  C KEDLYYPH  IQDL+W++L    EP +  WP  K +RE A++ A+K++ Y
Sbjct  299   NWQKVRHQCAKEDLYYPHPLIQDLIWDSLYILMEPLLTHWPCNKLVREKALQIAMKHIHY  358

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNGD  K HLAR+PDYLW++EDGM++H FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARIPDYLWVSEDGMTLHSFGSQTW  418

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             DA+   QA++A+ ++ + G  L K H +IK SQV+ENP GDF+SMYRH++KGSWTFSD+D
Sbjct  419   DASLIIQALLATNLIGDIGPILAKGHAFIKNSQVRENPLGDFRSMYRHISKGSWTFSDRD  478

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE LKC LLL  +P +I+GEK + +RLY++V++ L LQ  + GG   WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSMLPSEIVGEKMEPERLYDSVNILLSLQG-KKGGLPAWEPS  537

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L++LNP E   +IVVE E+IE T S + ALV F+  YP +R +E++  IAKAVQ+
Sbjct  538   EALKWLELLNPIEFLEEIVVEGEYIECTSSSVQALVMFKKLYPEHRKEEIDKFIAKAVQF  597

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +E +Q  DGSWYG WG+CF YGT+FAL  L A G +Y N  A+    +F L+ Q  +GGW
Sbjct  598   IENKQTYDGSWYGNWGICFTYGTWFALTALVAVGNTYYNSAAIRKGVNFLLTTQRNDGGW  657

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   S     Y+PLEG+ +N+VQTSWA++GL++ GQ ERD TPLH AAKL+IN Q+++G
Sbjct  658   GESYLSSSKKIYVPLEGSQSNIVQTSWALMGLIHAGQMERDSTPLHLAAKLIINFQLQEG  717

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             D+PQQ++TGV+MKNCMLHYA +R  FP+ AL+EY + +
Sbjct  718   DWPQQELTGVFMKNCMLHYAMYRDIFPMWALAEYHRHI  755



>emb|CAN60556.1| hypothetical protein VITISV_020304 [Vitis vinifera]
Length=758

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/756 (55%), Positives = 546/756 (72%), Gaps = 4/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI EG GP++ + NN+ GRQ WE+DP+AG+P+E+   E+ R+ F K R +   +  
Sbjct  1     MWKLKIAEGKGPWLMTVNNHIGRQHWEFDPDAGSPQERAEVERVREEFKKNRFQFKQS-A  59

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DL MRMQ+ KE+    +    V+++E E+   EA+TT +R+A+     +QA DGHWPAE+
Sbjct  60    DLLMRMQLTKENGCGPIP-AAVKVKETEDATKEAVTTTLRRAISFYSTIQAHDGHWPAES  118

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GPLFF PPL+IALYI G+++ +L+ +H+KE++RY+YNHQNEDGGWG++I GHST+ GSA
Sbjct  119   AGPLFFLPPLVIALYIIGAVNAVLSLQHQKEIIRYIYNHQNEDGGWGIHIAGHSTIFGSA  178

Query  1883  LNYVALRLLGEGPDDGDG-AIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
              +Y+ALRLLGEGP+ G+  A+ARGRKWILDHGGA  IPSWGK +L+VLGVYEW GCNPL 
Sbjct  179   FSYIALRLLGEGPEGGEDGAMARGRKWILDHGGAVGIPSWGKFWLTVLGVYEWSGCNPLP  238

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWL P   P HP KM CYCR  YMPMSYLY KR+ G +T +V +LR E++++ Y +I+
Sbjct  239   PEFWLLPKISPIHPGKMLCYCRLVYMPMSYLYGKRFVGRITGLVQSLREELYIEPYREIN  298

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+AR +C KEDLYYPH   QD+LW  L +  EP + RWPF  +RE A++ A+K++ YE 
Sbjct  299   WNKARNSCAKEDLYYPHPLAQDMLWGFLHHVAEPILXRWPFSIMREKALKVALKHIHYED  358

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E +RY  IGC+EK L ++  W EDPN +  K HLAR+PDYLW+AEDGM M  FG Q WDA
Sbjct  359   ENSRYYCIGCVEKVLCLLACWVEDPNSEAYKRHLARIPDYLWMAEDGMKMQSFGCQMWDA  418

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
             AFA QAII+S +  EYG  LRK H ++K SQV++NP G+F  MYRH  KG+WTFS QDHG
Sbjct  419   AFAIQAIISSDLAHEYGXTLRKAHDFVKASQVRQNPSGNFTEMYRHTCKGAWTFSTQDHG  478

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCT E LK  LL  +M   ++GEK + +R Y+AV+V L LQS  +GGF  WEP   
Sbjct  479   WQVSDCTGEGLKVALLFSQMSPDLVGEKMEKERFYDAVNVILSLQS-SNGGFPAWEPQRA  537

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
               +L+  NP+E F D+++E E++E T S I  L+ F   +P +R KE+   I++A+ Y+E
Sbjct  538   FRWLEKFNPTEFFEDVLIEREYVECTSSAIQGLILFIKLHPEHRRKEIESCISRAIHYIE  597

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
               Q  DGSWYG WG+C+ YGT+F + GL A GK+Y+N  A+  A  F LSKQ  +GGWGE
Sbjct  598   DTQNPDGSWYGCWGICYTYGTWFGVEGLVACGKTYQNSPALRKACEFLLSKQLPDGGWGE  657

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                S     Y  LEG  +NLV  SWA+L L+  GQAE DPTP+HR  ++LIN+QMEDGDF
Sbjct  658   SYLSSTDKVYTNLEGNRSNLVNXSWALLALIEGGQAEIDPTPIHRGMRVLINSQMEDGDF  717

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PQQ+ITGV+MKNC L+Y+S+R+ FP+ AL EY +RV
Sbjct  718   PQQEITGVFMKNCTLNYSSYRNIFPIWALGEYSRRV  753



>gb|AIK21791.1| beta-amyrin synthase, partial [Panax notoginseng]
Length=709

 Score =   885 bits (2286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/697 (59%), Positives = 523/697 (75%), Gaps = 3/697 (0%)
 Frame = -3

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
             GDL  RMQ ++E      +IP V++ ++E V YEA TT +R+AV    ALQA DGHWPAE
Sbjct  8     GDLLWRMQFLREKNFKQ-TIPQVKVGDDEVVTYEAATTTLRRAVHFFSALQASDGHWPAE  66

Query  2066  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  1887
             NSG LFF PPL++ LYI+G +D +  +EH+KE++RY+Y HQNEDG WG +I+G+STM  +
Sbjct  67    NSGALFFLPPLVMCLYITGHLDTVFPAEHRKEILRYIYCHQNEDGSWGFHIEGNSTMYCT  126

Query  1886  ALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPL  1710
              L+Y+ +R+LGEGP  G + A ARGRKWILDHG  T IPSWGK +LS+LG+YEW G NP 
Sbjct  127   TLSYICMRMLGEGPGGGVNDACARGRKWILDHGSVTAIPSWGKTWLSILGLYEWTGSNPT  186

Query  1709  SPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQI  1530
              PEFW+ PS  P HPAK+WCYCR  YMPMSYLY KR+ GP+T ++L LR E++ + Y +I
Sbjct  187   PPEFWIIPSFLPMHPAKIWCYCRMAYMPMSYLYGKRFVGPITPLILQLREELYAQPYNEI  246

Query  1529  DWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYE  1350
             +W + R  C KED+YYPH  IQDLLW++L   TEPF+ RWPF K+RE A++  +K++ YE
Sbjct  247   NWRKIRHVCAKEDIYYPHPKIQDLLWDSLYVLTEPFLTRWPFNKLREKALQTTMKHIHYE  306

Query  1349  AEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWD  1170
              E +RYITIG +EK L M+  W +DPNGD  K HLAR+PDY+W+ EDGM M  FGSQ WD
Sbjct  307   DENSRYITIGNVEKVLCMLACWVDDPNGDYFKKHLARIPDYIWVGEDGMKMQSFGSQQWD  366

Query  1169  AAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDH  990
                + QA++AS +  E G  L K H +IK+SQVK+NP GDFKSMYRH++KGSWTFSDQD 
Sbjct  367   TGMSIQALLASDLTHELGPTLMKGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQDQ  426

Query  989   GWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPV  810
             GW VSDCTAE LKC L+   MP +I+G++ + +RLY++V+V L LQS ++GG + WEP  
Sbjct  427   GWQVSDCTAEGLKCCLIFSRMPEEIVGKRMEPERLYDSVNVLLSLQS-KNGGLSAWEPAG  485

Query  809   PQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYL  630
              Q +L++ NPSE FADIV+E E++E T S I ALV F+  YP +R KE++  I  A++YL
Sbjct  486   AQEWLELFNPSECFADIVIEHEYVECTSSAIQALVLFKKLYPVHRKKEIDNFIMNAIRYL  545

Query  629   EKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWG  450
             E  Q  DGSWYG WGVCF YGT+FAL+GL AAGK+Y NC AV     F L  Q  +GGWG
Sbjct  546   EDLQLPDGSWYGNWGVCFTYGTWFALVGLAAAGKTYYNCAAVRKGVDFLLKSQMDDGGWG  605

Query  449   ECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGD  270
             E   SCP   YIPLEG  +NLV T WA++GL+++GQA+RDPTPLHRAAKLLIN+QMEDGD
Sbjct  606   ESYLSCPKKVYIPLEGNRSNLVNTGWALMGLIHSGQAKRDPTPLHRAAKLLINSQMEDGD  665

Query  269   FPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             FPQQ+I+GV++KNCMLHYA++R+ +PL AL+EY KRV
Sbjct  666   FPQQEISGVFLKNCMLHYAAYRNIYPLWALAEYCKRV  702



>ref|XP_002304910.2| putative oxidosqualene cyclase family protein [Populus trichocarpa]
 gb|EEE85421.2| putative oxidosqualene cyclase family protein [Populus trichocarpa]
Length=760

 Score =   885 bits (2286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/756 (54%), Positives = 540/756 (71%), Gaps = 4/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKL++ EG  P++ STN++ GRQ+WE+DP+ GTPEE    EKAR+ F++ R +      
Sbjct  1     MWKLEVAEGHDPWLLSTNDFVGRQVWEFDPDLGTPEEHAEVEKARENFSQNRFQ-VKASS  59

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             D+   +Q+IKE+ +D LSIP VRL + EE+  E   T +RKAVR   ALQA+DGHWP E 
Sbjct  60    DVLKNLQLIKENGID-LSIPSVRLGDREEITCEKAETTLRKAVRFTSALQARDGHWPFEF  118

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             S  LF  P L+IALYI+G+++ IL+ EHK+E+VRY+YNHQNEDGGWG +I+ HS M+ +A
Sbjct  119   SALLFEQPFLVIALYITGTLNTILSPEHKREMVRYIYNHQNEDGGWGFHIESHSMMLCTA  178

Query  1883  LNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
             LNYV+LRLLGE P+ G DG +A+ RKWILDHGG T I  WGK +LS +G+YEW GCNP+ 
Sbjct  179   LNYVSLRLLGEEPEGGKDGVVAKARKWILDHGGVTMISIWGKYFLSFIGLYEWSGCNPVP  238

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PE  L PS  PF    +WCY RT Y+P++YLY K++  P+TD+V+ LR E++++ Y ++D
Sbjct  239   PECLLLPSFLPFSTGNLWCYFRTIYIPLAYLYGKKFVAPITDLVILLREELYIQPYGEVD  298

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             W +AR++C K+DLY PHS ++++L + L Y  EP    WPF K+RE A+ KA++ +RYE 
Sbjct  299   WTKARISCLKKDLYKPHSLVENVLSSVLYYFAEPLSTHWPFSKLREKALAKAMRLIRYED  358

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E T Y+T   +EKSL M+  WAEDPN D LK HLA VPDYLW+AEDGM +   GSQ WD+
Sbjct  359   EHTGYLTHASVEKSLNMIANWAEDPNQDSLKRHLATVPDYLWVAEDGMKVQNMGSQLWDS  418

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
              FATQAIIAS + +EYG  LRK   +IK SQ++ENP GDF+S Y  + KG+WT + +D G
Sbjct  419   VFATQAIIASNLTDEYGSTLRKAFNFIKLSQIRENPPGDFQSTYHQICKGAWTLTVKDQG  478

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCTAE LK LLLL +MP  I+ +  +V++LYEAVD  L LQS E+GGF+ WEP   
Sbjct  479   WQVSDCTAEALKTLLLLSQMPADIVRDTIEVEQLYEAVDFLLTLQS-ENGGFSAWEPATS  537

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
               ++++ NP+E F  ++VE E+++ T S+  AL  F   +P YR KE+  S+ KA  Y+E
Sbjct  538   PQWMEMFNPTETFGGVMVETEYVDCTASVTQALALFSHLHPEYRGKEIETSVVKATHYIE  597

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
               Q +DGSWYG WG+C+ Y  +  L+ L A GK++ N E VC    F LSKQ + GGWGE
Sbjct  598   NAQMADGSWYGNWGICYTYAAYIVLVALAAVGKTHRNSEVVCKGCDFLLSKQLKSGGWGE  657

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                SC +  Y PL+G  +NLVQT+W M+GL+  GQAERD TPLH+AA+LLIN+Q+E G+F
Sbjct  658   SYLSCRNSEYTPLDGNRSNLVQTAWTMVGLIRAGQAERDATPLHQAARLLINSQLESGEF  717

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PQQ+ITG  +K  MLHYAS+R+ FPL AL EYRK V
Sbjct  718   PQQEITGASVKTSMLHYASYRNIFPLWALGEYRKHV  753



>ref|XP_007225240.1| hypothetical protein PRUPE_ppa001844mg [Prunus persica]
 gb|EMJ26439.1| hypothetical protein PRUPE_ppa001844mg [Prunus persica]
Length=757

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/756 (54%), Positives = 543/756 (72%), Gaps = 4/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI EGG P++ + NN+ GRQ+WE+DP  GTPEE    EKAR+ F   R    H+  
Sbjct  1     MWKLKIAEGGSPWLRTLNNHVGRQVWEFDPKLGTPEELLEIEKAREHFRNNRFVKKHS-S  59

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DLFMRMQ+ KE+    + +P +++++ E+V  E +T  +R+A+  + +LQA DGHWP + 
Sbjct  60    DLFMRMQLSKENPGHAV-LPQIKVKDTEDVTGETVTNTLRRAINFHSSLQAHDGHWPGDY  118

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
              GP+F  P L+I L I+G+++ +L+ EHK+E+ RYLYNHQN+DGGWGL+I+G STM GS 
Sbjct  119   GGPMFLLPGLVITLSITGALNAVLSDEHKREICRYLYNHQNKDGGWGLHIEGPSTMFGSV  178

Query  1883  LNYVALRLLGEGPDDGDGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLSP  1704
             L YV LRLLGEG  DG GA+  GRKWILDHGGAT I SWGK++LSVLG +EW G NPL P
Sbjct  179   LTYVTLRLLGEGAKDGQGAMESGRKWILDHGGATAITSWGKMWLSVLGAFEWSGNNPLPP  238

Query  1703  EFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQIDW  1524
             E WL P   P HP +MWC+CR  Y+PMSYLY KR+ GP+T  VL+LR E+    Y +IDW
Sbjct  239   EIWLLPYMLPIHPGRMWCHCRMVYLPMSYLYGKRFVGPITPTVLSLRKELFNVPYHEIDW  298

Query  1523  NQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEAE  1344
             N AR  C KEDLYYPH  +QD+LW++L    EP + RWP KK+RE A++ AI+++ YE E
Sbjct  299   NVARNQCAKEDLYYPHPLVQDILWSSLHMAVEPILMRWPGKKLREKALKTAIEHIHYEDE  358

Query  1343  ETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGF-GSQNWDA  1167
              TRYI IG + K L M+C W EDPN +  K HL R+ DYLW+AEDGM M G+ GSQ WD 
Sbjct  359   NTRYICIGPVNKVLNMLCCWVEDPNSEAFKLHLPRIYDYLWIAEDGMKMQGYNGSQLWDT  418

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
             AFA QAII++ +VEE+G  LRK H +IK+SQV EN  GD    YRH++KG+W FS  DHG
Sbjct  419   AFAVQAIISTNLVEEFGSTLRKGHKFIKDSQVLENCPGDLDFWYRHISKGAWPFSTGDHG  478

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W +SDCTAE LK +L L ++P +I+GE  D +RLY++V+V L LQ+ + GGFAT+E    
Sbjct  479   WPISDCTAEGLKAVLSLSKIPSEIVGEPIDAKRLYDSVNVVLSLQNSD-GGFATYELTRS  537

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
               +L+++NP+E F DIV++  ++E T + I AL +F+  YP +R +E+   I +AV+++E
Sbjct  538   YRWLELINPAETFGDIVIDYPYVECTSAAIQALASFKKLYPGHRSEEIEHCIKRAVEFIE  597

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
             K QESDGSWYG WGVCF YGT+F + GL AAG++Y N  ++  A  F LSKQ   GGW E
Sbjct  598   KIQESDGSWYGSWGVCFTYGTWFGVKGLVAAGRNYNNSSSIRKACDFLLSKQLASGGWAE  657

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                SC +  Y  LEG  +++V T WAML L+  GQAERDPTPLHRAA+ LIN+QME+GDF
Sbjct  658   SYLSCQNKVYTNLEGDRSHVVNTGWAMLALIDAGQAERDPTPLHRAARRLINSQMENGDF  717

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PQ++I GV+ +NCM+ YA++R+ FP+ AL EYR RV
Sbjct  718   PQEEIMGVFNRNCMITYAAYRNIFPIWALGEYRCRV  753



>ref|XP_010054047.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW89780.1| hypothetical protein EUGRSUZ_A02035 [Eucalyptus grandis]
Length=758

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/758 (54%), Positives = 558/758 (74%), Gaps = 10/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2247
             MWKLKIGEG   PY++S NN+ GRQIWE+DP AGTPEE+   E AR+ F   R K     
Sbjct  1     MWKLKIGEGANDPYLFSLNNFVGRQIWEFDPEAGTPEERAEVEAARQNFYNNRFK-VRPS  59

Query  2246  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2067
              DLF R Q ++E      +IPPV++ + E++ YE  T AV++ V    ALQ+  GHWPAE
Sbjct  60    SDLFWRFQFLREKNFKQ-TIPPVKIEDGEDITYEKATAAVKRCVSFWSALQSSHGHWPAE  118

Query  2066  NSGPL-FFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             N+GP+ F+ PPL+++LY++G ++ +  +EH++E++RY+Y HQNEDGGWGL+I+GHSTMIG
Sbjct  119   NAGPIAFYFPPLVMSLYVTGHLNNVFHAEHRREILRYIYYHQNEDGGWGLHIEGHSTMIG  178

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNYV +RLLGEGPD G D A  RGRKWILDHG AT+  SWGK +L+++G YEW G +P
Sbjct  179   TVLNYVCMRLLGEGPDGGLDNACERGRKWILDHGSATKTASWGKTWLAIIGCYEWTGTHP  238

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW FPS     PA+M+CYCR TYMPMSYLY K++ GP+T ++  +R EI+ + Y+Q
Sbjct  239   MPPEFWDFPSFMS--PAQMFCYCRLTYMPMSYLYGKKFVGPITPLIKQIREEIYYEPYDQ  296

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I W + R +C +ED +YPH+ +Q L+W+ L + TEP + RWPFKKIR++A++K ++++ Y
Sbjct  297   ISWWRVRHSCAEEDAHYPHTRLQTLMWDTLYFGTEPLLNRWPFKKIRDIAIKKTMEHIHY  356

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGC+EK L M+  W EDPNG+  K HL+RV DY+W+ EDG+ M  FGSQ W
Sbjct  357   EDENSRYITIGCVEKPLMMLACWVEDPNGEAFKKHLSRVADYVWVGEDGIKMQSFGSQIW  416

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D   + QA++AS +++E G  L+K H ++KESQ+  NP GD K MYRH++KG+W FSD+D
Sbjct  417   DCGLSLQALLASDLIDEIGPVLKKGHEFLKESQIDRNPSGDLKKMYRHISKGAWAFSDKD  476

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
             HGW VSDCTAE++KC L+   MP +I+G++ + ++LY+AV+V L LQS ++GG + WEP 
Sbjct  477   HGWQVSDCTAESMKCCLVFAMMPPEIVGQQMEPEKLYDAVNVILSLQS-KNGGLSAWEPS  535

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
                 +L+ LNP E   D+V+E E++E T S I AL+ FR  YP +R KE++  I  A Q+
Sbjct  536   GAGSWLEWLNPVEFLEDLVIEYEYVECTSSSIQALLLFRKLYPGHRKKEIDKFIVNATQF  595

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             +   Q+ DGSWYG WG+CF+YGT+FAL  L A GK++ENCEAV     F L+ QN++GGW
Sbjct  596   ILDIQKPDGSWYGNWGICFIYGTWFALTALEAVGKTHENCEAVRRGVDFLLNAQNEDGGW  655

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP+  Y PL    TNL+ TS A++GL++ GQ ERDPTP+HR AK+LINAQ++DG
Sbjct  656   GESYLSCPTRIYKPL--GHTNLIHTSLAIMGLIHAGQVERDPTPIHRGAKILINAQLDDG  713

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQ+++ GV+M+NCMLHY+++R+ FP+ ALSEYRK V
Sbjct  714   DFPQEELMGVFMRNCMLHYSAYRNIFPIWALSEYRKFV  751



>gb|KCW83375.1| hypothetical protein EUGRSUZ_B00308 [Eucalyptus grandis]
Length=706

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/695 (59%), Positives = 516/695 (74%), Gaps = 8/695 (1%)
 Frame = -3

Query  2240  LFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAENS  2061
             LF+R Q  K++      IPPVR+ + EE+ Y+  +TA+R+ V    ALQA DGHWPAE +
Sbjct  12    LFLREQQFKQA------IPPVRVEDGEEITYDKASTALRRTVHFFSALQASDGHWPAEIA  65

Query  2060  GPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSAL  1881
             GPL+F PPL++ +YI+G ++ +  +EH+KE++RYLYNHQNEDGGWG +I+GHSTM  +AL
Sbjct  66    GPLYFLPPLVMCVYITGHLNTVFPAEHRKEILRYLYNHQNEDGGWGFHIEGHSTMFCTAL  125

Query  1880  NYVALRLLGEGPDDGD-GAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLSP  1704
             +Y+ +R+LGEGPD G   A  R RKWILD GG T IPSWGK +LS+ G+++W G NP+ P
Sbjct  126   SYICMRILGEGPDGGQYNACTRARKWILDRGGVTYIPSWGKTWLSIFGLFDWSGSNPMPP  185

Query  1703  EFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQIDW  1524
             EFW+ PS  P HPAKMWCYCRT YMPMSYLY KR+ GP+T  V  LR E+H + Y+ I W
Sbjct  186   EFWILPSFLPMHPAKMWCYCRTVYMPMSYLYGKRFVGPITPFVQQLRKELHTQPYDMICW  245

Query  1523  NQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEAE  1344
              + R  C KEDLYYPH  +QDL+W++L    EP +  WPF ++RE A++  +K++ YE E
Sbjct  246   RKVRHLCAKEDLYYPHPLVQDLIWDSLYIFIEPLLNHWPFNRLREKALQVTMKHIHYEDE  305

Query  1343  ETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDAA  1164
              +RYITIGC+EK L M+  W EDP+ D  K HLAR+PDYLW+AEDGM M  FGSQ WD  
Sbjct  306   NSRYITIGCVEKVLCMLACWVEDPDSDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWDTG  365

Query  1163  FATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHGW  984
             FA QA++AS M EE G  L + H +IK+SQVK+NP GDFKSM+RH+TKGSWTFSDQDHGW
Sbjct  366   FAIQALLASNMTEEIGPVLARGHDFIKKSQVKDNPSGDFKSMHRHITKGSWTFSDQDHGW  425

Query  983   AVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVPQ  804
              VSDCTAE LKC LL   MP +I+GEK   +RLY+AV++ L LQS ++GG   WEP    
Sbjct  426   QVSDCTAEGLKCCLLFSMMPPEIVGEKMKPERLYDAVNILLSLQS-KNGGLPAWEPAGAP  484

Query  803   PYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLEK  624
              +L++LNP+E F DIV+E E++E T S I ALV FR  YP +R KE+   I+ +V+YLE 
Sbjct  485   AWLELLNPTEFFEDIVIEHEYVECTSSAIQALVLFRKLYPEHREKEIEDFISNSVEYLEN  544

Query  623   QQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGEC  444
              Q  DGSWYG WGVCF YG++FAL GL AAGK+Y NC A+     F L  Q Q+GGWGE 
Sbjct  545   VQLPDGSWYGCWGVCFTYGSWFALGGLAAAGKTYSNCAAMRKGVAFLLRTQLQDGGWGES  604

Query  443   LQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDFP  264
               SCP   Y+PLEG  +NLVQT+WAM+GL+  GQAERDPTPLHRAAKLLIN+QMEDGD+P
Sbjct  605   YLSCPKKEYVPLEGNRSNLVQTAWAMMGLIQAGQAERDPTPLHRAAKLLINSQMEDGDYP  664

Query  263   QQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             QQ++TGV+ KNCMLHY ++R+ +PL AL+EYR RV
Sbjct  665   QQELTGVFNKNCMLHYPNYRNTYPLWALAEYRTRV  699



>ref|XP_002530442.1| Cycloartenol synthase, putative [Ricinus communis]
 gb|EEF31912.1| Cycloartenol synthase, putative [Ricinus communis]
Length=757

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/758 (54%), Positives = 551/758 (73%), Gaps = 11/758 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2250
             MW+LKI EGG  P+IYSTNN+ GRQIWE+DP+AG PEE+   E+AR+ F   R Q  P +
Sbjct  1     MWRLKIAEGGNDPHIYSTNNFLGRQIWEFDPDAGAPEERAQVEEARQHFWNNRFQVKPSS  60

Query  2249  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2070
               DL  + Q++KE      +I  V++ + +E+  E    A+R++V L  ALQA DGHW A
Sbjct  61    --DLLWQFQILKEKNFKQ-TITKVKIEDGKEITSEDARNALRRSVHLMSALQASDGHWCA  117

Query  2069  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  1890
             EN+GP+F+ PPL+ +LYI+  ++++ ++EH+KE++RY+Y HQNEDGGWGL+I+GHS+M  
Sbjct  118   ENAGPMFYLPPLVFSLYITNHLNIVFSAEHRKEILRYIYCHQNEDGGWGLHIEGHSSMFC  177

Query  1889  SALNYVALRLLGEGPDDG-DGAIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNP  1713
             + LNY+ +R+LGEGP+ G D A  RGRKWILDHG AT I SWGK +LS+LG+YEW+GCNP
Sbjct  178   TVLNYICMRILGEGPNGGKDNACERGRKWILDHGSATAISSWGKTWLSILGLYEWEGCNP  237

Query  1712  LSPEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQ  1533
             + PEFW+ P+ FP HPAKM+CYCR TYMPMSYLY KR+ GP+T ++L LR EI+ +SY +
Sbjct  238   MPPEFWVCPTIFPMHPAKMFCYCRLTYMPMSYLYGKRFVGPITPLILQLREEIYNESYNK  297

Query  1532  IDWNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRY  1353
             I W   R  C KED YYPH+ +Q L+W+AL   +EP   RWPF K+R+ A++  + ++ Y
Sbjct  298   IKWKTLRHLCAKEDNYYPHTLVQILMWDALYMFSEPLFTRWPFNKLRKKALKLTMDHIHY  357

Query  1352  EAEETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNW  1173
             E E +RYITIGCIEKSL M+  W EDPNG+  K HLARVPDY+W+ EDG+ M  FGSQ W
Sbjct  358   EDENSRYITIGCIEKSLCMLACWDEDPNGEAFKKHLARVPDYIWVGEDGIKMQSFGSQLW  417

Query  1172  DAAFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQD  993
             D +FA QA+IAS + +E G  L++ H +IK SQV ENP GDFKSM+RH++KGSWTFSD+D
Sbjct  418   DTSFALQALIASNLSDEIGPTLKEGHNFIKNSQVTENPTGDFKSMFRHISKGSWTFSDKD  477

Query  992   HGWAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPP  813
              GW VSDCTAE LKC LL   MP  I+GEK + ++L++AV++ L     + GG + WEP 
Sbjct  478   QGWQVSDCTAEGLKCCLLFSMMPSNIVGEKMEPEKLFDAVNIIL-----KHGGSSAWEPV  532

Query  812   VPQPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQY  633
               + +L+ LNP E    +++E E++E T + I ALV F+  YP +R K++   I  A + 
Sbjct  533   EARLWLEWLNPVEFLEGLIIEYEYVECTSASIQALVLFKELYPGHRTKDIENFIQNATRS  592

Query  632   LEKQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGW  453
             LE +Q+ DGSWYG WG+CF+Y T+ AL GL  AGK+YENC A+     F L  Q  +GGW
Sbjct  593   LEDEQKPDGSWYGKWGICFIYATWLALKGLAVAGKTYENCLAIRRGVDFLLKLQTNDGGW  652

Query  452   GECLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDG  273
             GE   SCP   Y+PLE   +NLV T+ AM+GL++ GQA+RDPTPL+RAAKLLIN+Q E G
Sbjct  653   GESYLSCPKKVYVPLEDNRSNLVHTAMAMMGLIHGGQAKRDPTPLYRAAKLLINSQTELG  712

Query  272   DFPQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             DFPQQ+  GV+M+NCMLHYA++R+ FPL AL+EY + V
Sbjct  713   DFPQQEQIGVFMRNCMLHYAAYRNIFPLWALAEYCQHV  750



>ref|XP_002269060.2| PREDICTED: lupeol synthase isoform X1 [Vitis vinifera]
Length=757

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/756 (55%), Positives = 547/756 (72%), Gaps = 4/756 (1%)
 Frame = -3

Query  2423  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2244
             MWKLKI EG GP++ + NN+ GRQ WE+DP+AG+ +E+   E+ R+ F K R +   +  
Sbjct  4     MWKLKIAEGKGPWLMTVNNHIGRQHWEFDPDAGSSQERAEVERVREEFKKNRFQFKQS-A  62

Query  2243  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2064
             DL MRMQ+ KE+    +    V+++E E+   EA+TT +R+A+     +QA DGHWPAE+
Sbjct  63    DLLMRMQLTKENGCGPIP-AAVKVKETEDATKEAVTTTLRRAISFYSTIQAHDGHWPAES  121

Query  2063  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  1884
             +GPLFF PPL++ALYI G+++ +L+ +H+KE++RY+YNHQNEDGGWG++I GHST+ GSA
Sbjct  122   AGPLFFLPPLVLALYIIGAVNAVLSLQHQKEIIRYIYNHQNEDGGWGIHIAGHSTIFGSA  181

Query  1883  LNYVALRLLGEGPDDGDG-AIARGRKWILDHGGATQIPSWGKIYLSVLGVYEWDGCNPLS  1707
              +Y+ALRLLGEGP+ G+  A+ARGRKWILDHGGA  IPSWGK +L+VLGVYEW GCNPL 
Sbjct  182   FSYIALRLLGEGPEGGEDGAMARGRKWILDHGGAVGIPSWGKFWLTVLGVYEWSGCNPLP  241

Query  1706  PEFWLFPSNFPFHPAKMWCYCRTTYMPMSYLYAKRYRGPLTDVVLALRNEIHVKSYEQID  1527
             PEFWL P   P HP KM CYCR  YMPMSYLY KR+ G +T +V +LR E++++ Y +I+
Sbjct  242   PEFWLLPKISPIHPGKMLCYCRLVYMPMSYLYGKRFVGRITGLVQSLREELYIEPYREIN  301

Query  1526  WNQARMACCKEDLYYPHSFIQDLLWNALQYCTEPFMRRWPFKKIREMAMRKAIKYMRYEA  1347
             WN+AR +C KEDLYYPH   QD+LW  L +  EP + RWPF  +RE A++ A+K++ YE 
Sbjct  302   WNKARNSCAKEDLYYPHPLAQDMLWGFLHHVAEPILTRWPFSIMREKALKVALKHIHYED  361

Query  1346  EETRYITIGCIEKSLQMMCWWAEDPNGDELKYHLARVPDYLWLAEDGMSMHGFGSQNWDA  1167
             E +RY  IGC+EK L ++  W EDPN +  K HLAR+PDYLW+AEDGM M  FG Q WDA
Sbjct  362   ENSRYYCIGCVEKVLCLLACWVEDPNSEAYKRHLARIPDYLWMAEDGMKMQSFGCQMWDA  421

Query  1166  AFATQAIIASGMVEEYGDCLRKVHFYIKESQVKENPKGDFKSMYRHVTKGSWTFSDQDHG  987
             AFA QAII+S +  EYG  LRK H ++K SQV++NP G+F  MYRH  KG+WTFS QDHG
Sbjct  422   AFAIQAIISSDLAHEYGPTLRKAHDFVKASQVRQNPTGNFTEMYRHTCKGAWTFSTQDHG  481

Query  986   WAVSDCTAETLKCLLLLGEMPHKIIGEKPDVQRLYEAVDVCLYLQSPESGGFATWEPPVP  807
             W VSDCT E LK  LL  +M   ++GEK + +R Y+AV+V L LQS  +GGF  WEP   
Sbjct  482   WQVSDCTGEGLKVALLFSQMSPDLVGEKMEKERFYDAVNVILSLQS-SNGGFPAWEPQRA  540

Query  806   QPYLQVLNPSEIFADIVVEEEHIEPTGSIISALVAFRCHYPNYRPKEVNISIAKAVQYLE  627
               +L+  NP+E F D+++E E++E T S I  L+ F   +P +R KE+   I++A+ Y+E
Sbjct  541   FRWLEKFNPTEFFEDVLIEREYVECTSSAIQGLILFIKLHPEHRRKEIESCISRAIHYIE  600

Query  626   KQQESDGSWYGYWGVCFLYGTFFALLGLTAAGKSYENCEAVCNAAHFFLSKQNQEGGWGE  447
               Q  DGSWYG WG+C+ YGT+F + GL A GK+Y+N  A+  A  F LSKQ  +GGWGE
Sbjct  601   DTQNPDGSWYGCWGICYTYGTWFGVEGLVACGKTYQNSPALRKACEFLLSKQLPDGGWGE  660

Query  446   CLQSCPSMRYIPLEGTGTNLVQTSWAMLGLMYTGQAERDPTPLHRAAKLLINAQMEDGDF  267
                S  +  Y  LEG  +NLV TSWA+L L+  GQAE DPTP+HR  ++LIN+QMEDGDF
Sbjct  661   SYLSSTNKVYTNLEGNRSNLVNTSWALLALIEGGQAEIDPTPIHRGMRVLINSQMEDGDF  720

Query  266   PQQDITGVYMKNCMLHYASHRSYFPLMALSEYRKRV  159
             PQQ+ITGV+MKNC L+Y+S+R+ FP+ AL EY +RV
Sbjct  721   PQQEITGVFMKNCTLNYSSYRNIFPIWALGEYSRRV  756



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7806491486032