BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25000_g1_i1 len=2657 path=[1:0-351 353:352-413 415:414-459
12266:460-494 12301:495-503 12310:504-509 5733:510-519 12328:520-559
10603:560-639 641:640-665 667:666-1206 1208:1207-1241 1243:1242-1244
1246:1245-1478 1480:1479-1661 1663:1662-1687 1689:1688-1882
1884:1883-1923 1925:1924-1931 12539:1932-1950 1952:1951-2010
2012:2011-2011 2013:2012-2066 2068:2067-2084 2086:2085-2656]

Length=2657
                                                                      Score     E

ref|XP_011096562.1|  PREDICTED: dammarenediol II synthase-like         1260   0.0     
emb|CDP12624.1|  unnamed protein product                               1250   0.0     
gb|AEX99665.1|  amyrin synthase                                        1247   0.0     
gb|AFJ19235.1|  mixed amyrin synthase                                  1246   0.0     
gb|EYU33367.1|  hypothetical protein MIMGU_mgv1a001775mg               1239   0.0     
dbj|BAF63702.1|  mixed amyrin synthase                                 1227   0.0     Olea europaea
emb|CDP10664.1|  unnamed protein product                               1219   0.0     
gb|AIS39793.1|  mixed amyrin synthase 1                                1206   0.0     
gb|EYU34015.1|  hypothetical protein MIMGU_mgv1a021513mg               1175   0.0     
gb|AHF22084.1|  OSC2                                                   1168   0.0     
gb|ADM86392.1|  putative beta-amyrin synthase                          1158   0.0     
gb|AAS01523.1|  putative beta-amyrin synthase                          1149   0.0     Centella asiatica [Asiatic pennywort]
gb|AGI15962.1|  dammarenediol synthase                                 1142   0.0     
gb|ACZ71036.1|  dammarenediol synthase protein                         1141   0.0     Panax ginseng [Chinese ginseng]
gb|AGK62449.1|  dammarenediol-II synthase                              1140   0.0     
gb|AED99864.1|  DS synthase                                            1140   0.0     
dbj|BAD15332.1|  beta-amyrin synthase                                  1140   0.0     Panax ginseng [Chinese ginseng]
gb|AEO27862.1|  dammarenediol synthase                                 1138   0.0     
gb|AIK21788.1|  dammarenediol-II synthase                              1138   0.0     
gb|AGS79229.1|  dammarenediol-II synthase                              1138   0.0     
gb|AGS16975.1|  dammarenediol synthase II                              1136   0.0     
sp|Q08IT1.1|DADIS_PANGI  RecName: Full=Dammarenediol II synthase       1135   0.0     Panax ginseng [Chinese ginseng]
gb|AED99865.1|  DS synthase                                            1135   0.0     
gb|AGI19258.1|  dammarenediol synthase                                 1134   0.0     
gb|ADX01169.1|  putative beta-amyrin synthase                           986   0.0     
ref|XP_010245756.1|  PREDICTED: beta-amyrin synthase-like               975   0.0     
ref|XP_002269395.2|  PREDICTED: beta-amyrin synthase isoform X1         972   0.0     Vitis vinifera
ref|XP_010655672.1|  PREDICTED: beta-amyrin synthase isoform X2         970   0.0     
ref|XP_002270051.2|  PREDICTED: beta-amyrin synthase                    966   0.0     Vitis vinifera
gb|AHF49822.1|  bAS                                                     958   0.0     
emb|CDP08999.1|  unnamed protein product                                955   0.0     
ref|XP_010245746.1|  PREDICTED: beta-amyrin synthase-like isoform X1    952   0.0     
ref|XP_010245749.1|  PREDICTED: beta-amyrin synthase-like isoform X1    950   0.0     
sp|E2IUA9.1|LUPS_KALDA  RecName: Full=Lupeol synthase; Short=KdLUS      947   0.0     
emb|CBI18407.3|  unnamed protein product                                946   0.0     
gb|EYU38890.1|  hypothetical protein MIMGU_mgv1a001796mg                946   0.0     
ref|XP_010063692.1|  PREDICTED: beta-amyrin synthase                    944   0.0     
ref|XP_011093795.1|  PREDICTED: beta-amyrin synthase                    944   0.0     
gb|ABY90140.2|  beta-amyrin synthase                                    942   0.0     Bupleurum chinense
ref|XP_010531942.1|  PREDICTED: beta-amyrin synthase-like               942   0.0     
gb|ADK12003.1|  beta-amyrin synthase                                    942   0.0     
ref|XP_002270934.1|  PREDICTED: beta-amyrin synthase                    941   0.0     Vitis vinifera
dbj|BAE53429.1|  beta-amyrin synthase                                   941   0.0     Lotus japonicus
ref|XP_009779988.1|  PREDICTED: beta-amyrin synthase                    940   0.0     
gb|AHX97777.1|  beta-amyrin synthase                                    940   0.0     
sp|O82140.1|BAMS1_PANGI  RecName: Full=Beta-Amyrin Synthase 1           940   0.0     Panax ginseng [Chinese ginseng]
sp|E2IUA6.1|TARS_KALDA  RecName: Full=Taraxerol synthase; Short=K...    940   0.0     
gb|ACH88048.1|  beta-amyrin synthase                                    938   0.0     Nigella sativa [black-caraway]
dbj|BAE43642.1|  beta-amyrin synthase                                   937   0.0     Euphorbia tirucalli
ref|XP_007023608.1|  Beta-Amyrin Synthase                               936   0.0     
sp|Q8W3Z1.1|BAMS_BETPL  RecName: Full=Beta-amyrin synthase              935   0.0     Betula platyphylla [Asian white birch]
ref|NP_001234604.1|  beta-amyrin synthase                               935   0.0     
ref|XP_011009932.1|  PREDICTED: beta-amyrin synthase-like isoform X1    934   0.0     
ref|XP_009612988.1|  PREDICTED: beta-amyrin synthase                    934   0.0     
ref|XP_009344015.1|  PREDICTED: beta-amyrin synthase                    934   0.0     
ref|XP_010313624.1|  PREDICTED: beta-amyrin synthase isoform X1         934   0.0     
ref|XP_010063691.1|  PREDICTED: beta-amyrin synthase-like               931   0.0     
gb|AIK19223.1|  triterpene synthase                                     931   0.0     
sp|E2IUA7.1|GLUTS_KALDA  RecName: Full=Glutinol synthase; Short=K...    931   0.0     
gb|AAO33580.1|AF478455_1  multifunctional beta-amyrin synthase          931   0.0     Lotus japonicus
ref|XP_010027664.1|  PREDICTED: beta-amyrin synthase-like isoform X1    930   0.0     
ref|XP_007214978.1|  hypothetical protein PRUPE_ppa001812mg             930   0.0     
ref|XP_008228023.1|  PREDICTED: beta-amyrin synthase                    929   0.0     
gb|AGG09939.1|  beta-amyrin synthase                                    929   0.0     
ref|XP_011085901.1|  PREDICTED: beta-amyrin synthase-like               929   0.0     
sp|Q9MB42.1|BAMS_GLYGL  RecName: Full=Beta-amyrin synthase              929   0.0     Glycyrrhiza glabra
gb|AAO33579.1|AF478454_1  putative beta-amyrin synthase                 928   0.0     Lotus japonicus
sp|O82146.1|BAMS2_PANGI  RecName: Full=Beta-Amyrin Synthase 2           928   0.0     Panax ginseng [Chinese ginseng]
ref|XP_007214977.1|  hypothetical protein PRUPE_ppa001810mg             928   0.0     
ref|XP_006582958.1|  PREDICTED: beta-amyrin synthase isoform X1         926   0.0     
ref|XP_003531781.1|  PREDICTED: beta-amyrin synthase-like isoform 1     926   0.0     
ref|XP_010027785.1|  PREDICTED: beta-amyrin synthase-like               925   0.0     
ref|XP_010065062.1|  PREDICTED: beta-amyrin synthase-like               925   0.0     
ref|XP_006425178.1|  hypothetical protein CICLE_v10027855mg             925   0.0     
ref|XP_004305792.1|  PREDICTED: beta-amyrin synthase-like               925   0.0     
ref|XP_009369010.1|  PREDICTED: beta-amyrin synthase-like               925   0.0     
emb|CDP15852.1|  unnamed protein product                                925   0.0     
ref|XP_003604121.1|  Beta-amyrin synthase                               924   0.0     
gb|ADE88148.1|  beta-amyrin synthase                                    924   0.0     
ref|XP_009344148.1|  PREDICTED: beta-amyrin synthase-like               924   0.0     
ref|XP_004488915.1|  PREDICTED: beta-amyrin synthase-like               924   0.0     
gb|AIE17466.1|  oxidosqualene cyclase                                   923   0.0     
sp|E2IUA8.1|FRIES_KALDA  RecName: Full=Friedelin synthase; Short=...    923   0.0     
sp|A8CDT2.1|BAS_BRUGY  RecName: Full=Beta-amyrin synthase; Short=...    923   0.0     Bruguiera gymnorhiza [Burma mangrove]
ref|XP_006488698.1|  PREDICTED: beta-amyrin synthase-like               922   0.0     
ref|XP_007214979.1|  hypothetical protein PRUPE_ppa001817mg             922   0.0     
gb|KHN39383.1|  Beta-amyrin synthase                                    922   0.0     
ref|XP_008380418.1|  PREDICTED: beta-amyrin synthase                    922   0.0     
emb|CBI30890.3|  unnamed protein product                                922   0.0     
gb|AAO33578.1|AF478453_1  beta-amyrin synthase                          922   0.0     Medicago truncatula
ref|XP_006364890.1|  PREDICTED: beta-amyrin synthase-like               922   0.0     
gb|AFM82492.1|  lupeol synthase                                         922   0.0     
gb|AIS39794.1|  mixed amyrin synthase 2                                 921   0.0     
gb|KHN38108.1|  Beta-amyrin synthase                                    920   0.0     
gb|AHI17180.1|  beta-amyrin synthase                                    920   0.0     
gb|AIE17465.1|  oxidosqualene cyclase                                   919   0.0     
gb|ACV21067.1|  beta-amyrin synthase                                    919   0.0     
ref|XP_004305793.1|  PREDICTED: beta-amyrin synthase-like               919   0.0     
sp|A8C980.1|GERS_RHISY  RecName: Full=Germanicol synthase; Short=...    919   0.0     Rhizophora stylosa
gb|ACA13386.1|  beta-amyrin synthase                                    918   0.0     Artemisia annua [sweet Annie]
ref|XP_010245752.1|  PREDICTED: taraxerol synthase-like                 918   0.0     
gb|KEH28511.1|  beta-amyrin synthase                                    918   0.0     
ref|XP_009344016.1|  PREDICTED: beta-amyrin synthase-like               917   0.0     
gb|ACM89978.1|  putative beta amyrin synthase                           917   0.0     Malus domestica [apple tree]
emb|CBI18393.3|  unnamed protein product                                917   0.0     
ref|XP_010472733.1|  PREDICTED: amyrin synthase LUP2 isoform X1         917   0.0     
ref|XP_002265019.2|  PREDICTED: beta-amyrin synthase-like               917   0.0     Vitis vinifera
ref|XP_010531951.1|  PREDICTED: camelliol C synthase-like isoform X1    916   0.0     
gb|ACB87531.1|  beta-amyrin synthase                                    916   0.0     Artemisia annua [sweet Annie]
ref|XP_010063690.1|  PREDICTED: beta-amyrin synthase-like               914   0.0     
ref|XP_008365698.1|  PREDICTED: beta-amyrin synthase-like               914   0.0     
gb|EPS65499.1|  beta-amyrin synthase                                    914   0.0     
ref|XP_010027674.1|  PREDICTED: beta-amyrin synthase-like isoform X2    914   0.0     
ref|XP_006488602.1|  PREDICTED: beta-amyrin synthase-like               914   0.0     
gb|KEH17471.1|  beta-amyrin synthase                                    913   0.0     
ref|XP_002513298.1|  Cycloartenol synthase, putative                    913   0.0     Ricinus communis
sp|Q9LRH8.1|BAMS_PEA  RecName: Full=Beta-amyrin synthase                913   0.0     Pisum sativum [garden pea]
ref|XP_010655243.1|  PREDICTED: beta-Amyrin Synthase 1                  913   0.0     
ref|XP_010537755.1|  PREDICTED: camelliol C synthase-like isoform X1    912   0.0     
ref|XP_008362478.1|  PREDICTED: beta-amyrin synthase                    912   0.0     
gb|ADM89633.1|  beta-amyrin synthase                                    912   0.0     
sp|Q2XPU7.1|LUPS_RICCO  RecName: Full=Lupeol synthase                   912   0.0     Ricinus communis
ref|XP_006364889.1|  PREDICTED: delta-amyrin synthase-like              912   0.0     
ref|XP_007135871.1|  hypothetical protein PHAVU_010G165100g             912   0.0     
emb|CBI18406.3|  unnamed protein product                                912   0.0     
ref|XP_006374734.1|  hypothetical protein POPTR_0014s00350g             912   0.0     
ref|XP_010429766.1|  PREDICTED: amyrin synthase LUP2-like isoform X2    911   0.0     
ref|XP_009379199.1|  PREDICTED: beta-amyrin synthase-like               911   0.0     
gb|AFF27505.1|  beta-amyrin synthase                                    911   0.0     
ref|XP_010429765.1|  PREDICTED: amyrin synthase LUP2-like isoform X1    910   0.0     
ref|XP_010417511.1|  PREDICTED: amyrin synthase LUP2-like isoform X2    910   0.0     
ref|XP_010052732.1|  PREDICTED: beta-amyrin synthase-like isoform X1    910   0.0     
ref|XP_002269328.2|  PREDICTED: beta-Amyrin Synthase 1-like             909   0.0     Vitis vinifera
ref|XP_002271333.1|  PREDICTED: beta-Amyrin Synthase 1 isoform X1       909   0.0     Vitis vinifera
ref|XP_011031247.1|  PREDICTED: beta-amyrin synthase                    908   0.0     
ref|XP_009347735.1|  PREDICTED: beta-amyrin synthase-like               908   0.0     
ref|XP_010063688.1|  PREDICTED: beta-amyrin synthase-like               908   0.0     
dbj|BAA86930.1|  lupeol synthase                                        908   0.0     Olea europaea
ref|XP_010669609.1|  PREDICTED: lupeol synthase-like                    907   0.0     
ref|XP_009379200.1|  PREDICTED: beta-amyrin synthase-like               907   0.0     
emb|CBI18382.3|  unnamed protein product                                907   0.0     
ref|NP_001234597.1|  delta-amyrin synthase                              907   0.0     
gb|ABL07607.1|  beta-amyrin synthase                                    907   0.0     Polygala tenuifolia [Chinese senega-root]
gb|AAC17080.1|  Strong similarity to lupeol synthase gb|U49919 an...    906   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|NP_683508.1|  camelliol C synthase 1                                906   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_011006636.1|  PREDICTED: beta-amyrin synthase-like               905   0.0     
ref|XP_010417510.1|  PREDICTED: amyrin synthase LUP2-like isoform X1    905   0.0     
gb|AIU41743.1|  beta-amyrin synthase                                    905   0.0     
sp|F8WQD0.1|SHS1_ASTTA  RecName: Full=Shionone synthase; Short=At...    905   0.0     
ref|XP_010429762.1|  PREDICTED: amyrin synthase LUP2-like               905   0.0     
ref|XP_010417512.1|  PREDICTED: amyrin synthase LUP2-like isoform X3    905   0.0     
gb|KFK42270.1|  hypothetical protein AALP_AA2G234200                    905   0.0     
gb|AGA17940.1|  beta-amyrin synthase                                    905   0.0     
ref|XP_010245750.1|  PREDICTED: beta-amyrin synthase-like isoform X2    904   0.0     
gb|AAS83468.1|  beta-armyrin synthase                                   904   0.0     Bupleurum kaoi
ref|XP_009591746.1|  PREDICTED: beta-amyrin synthase-like               903   0.0     
gb|ABK76265.1|  beta-amyrin synthase                                    903   0.0     Vaccaria hispanica [bladder-soapwort]
ref|XP_008365649.1|  PREDICTED: beta-amyrin synthase                    902   0.0     
ref|XP_003521100.1|  PREDICTED: beta-amyrin synthase-like isoformX1     902   0.0     
ref|XP_006351975.1|  PREDICTED: beta-amyrin synthase-like               902   0.0     
ref|NP_178017.2|  lupeol synthase 2                                     902   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KFK42272.1|  hypothetical protein AALP_AA2G234400                    902   0.0     
ref|XP_010696136.1|  PREDICTED: beta-amyrin synthase-like               900   0.0     
ref|XP_009104558.1|  PREDICTED: amyrin synthase LUP2-like               900   0.0     
ref|XP_002310349.1|  beta-Amyrin synthase family protein                900   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006300770.1|  hypothetical protein CARUB_v10019849mg             900   0.0     
emb|CDY57947.1|  BnaA07g38460D                                          899   0.0     
ref|XP_010048520.1|  PREDICTED: LOW QUALITY PROTEIN: lupeol synth...    898   0.0     
gb|AAX14716.1|  beta-amyrin synthase                                    898   0.0     Aster sedifolius
gb|AAG41762.1|AF099968_1  pentacyclic triterpene synthase               898   0.0     
ref|XP_002887124.1|  ATLUP2                                             898   0.0     
ref|XP_010252186.1|  PREDICTED: lupeol synthase-like                    897   0.0     
ref|XP_006377610.1|  putative oxidosqualene cyclase family protein      896   0.0     
ref|XP_010531947.1|  PREDICTED: camelliol C synthase-like isoform X1    896   0.0     
ref|XP_010472735.1|  PREDICTED: amyrin synthase LUP2 isoform X2         896   0.0     
ref|XP_007023363.1|  Terpenoid cyclases family protein                  896   0.0     
ref|XP_007023364.1|  Beta-Amyrin Synthase                               895   0.0     
dbj|BAE53430.1|  lupeol synthase                                        895   0.0     Lotus japonicus
ref|XP_003521102.1|  PREDICTED: beta-amyrin synthase-like isoform X1    895   0.0     
gb|ACO24697.1|  beta-amyrin synthase                                    895   0.0     Gentiana straminea
ref|XP_002889222.1|  hypothetical protein ARALYDRAFT_316793             894   0.0     
sp|B9X0J1.1|STBOS_STERE  RecName: Full=Baccharis oxide synthase; ...    894   0.0     Stevia rebaudiana
ref|XP_004507562.1|  PREDICTED: beta-amyrin synthase-like isoform X1    894   0.0     
ref|XP_011031246.1|  PREDICTED: beta-amyrin synthase-like               893   0.0     
ref|XP_011009936.1|  PREDICTED: beta-amyrin synthase-like isoform X3    892   0.0     
ref|XP_006301366.1|  hypothetical protein CARUB_v10021777mg             892   0.0     
ref|XP_006409183.1|  hypothetical protein EUTSA_v10022563mg             892   0.0     
ref|NP_178016.2|  beta-amyrin synthase                                  891   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_011009935.1|  PREDICTED: beta-amyrin synthase-like isoform X2    891   0.0     
emb|CAN77299.1|  hypothetical protein VITISV_033299                     890   0.0     Vitis vinifera
ref|XP_009779991.1|  PREDICTED: beta-amyrin synthase-like               890   0.0     
gb|KFK42271.1|  hypothetical protein AALP_AA2G234300                    890   0.0     
gb|AAC17070.1|  Strong similarity to lupeol synthase gb|U49919 fr...    888   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_007014712.1|  Beta-Amyrin Synthase isoform 1                     888   0.0     
ref|XP_009106614.1|  PREDICTED: amyrin synthase LUP2                    888   0.0     
emb|CDX87419.1|  BnaA07g34540D                                          887   0.0     
dbj|BAE43643.1|  putative oxidosqulene cyclase                          887   0.0     Euphorbia tirucalli
gb|KHN00954.1|  Lupeol synthase                                         886   0.0     
ref|XP_004251564.1|  PREDICTED: beta-amyrin synthase-like isoform X1    886   0.0     
gb|KFK40207.1|  hypothetical protein AALP_AA3G344300                    886   0.0     
ref|XP_006606308.1|  PREDICTED: lupeol synthase-like isoform X1         886   0.0     
ref|XP_003530475.1|  PREDICTED: lupeol synthase isoform 1               886   0.0     
emb|CDP08328.1|  unnamed protein product                                885   0.0     
dbj|BAG82628.1|  beta-amyrin synthase                                   885   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006389936.1|  hypothetical protein EUTSA_v10018166mg             885   0.0     
dbj|BAF35580.1|  multifunctional triterpene synthase                    884   0.0     Kandelia candel
ref|XP_002310351.1|  hypothetical protein POPTR_0007s15210g             883   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010429761.1|  PREDICTED: beta-amyrin synthase                    882   0.0     
ref|XP_004309763.1|  PREDICTED: beta-amyrin synthase-like               882   0.0     
ref|XP_006389937.1|  hypothetical protein EUTSA_v10018165mg             882   0.0     
ref|XP_002305339.1|  putative oxidosqualene cyclase family protein      881   0.0     Populus trichocarpa [western balsam poplar]
gb|KHG28038.1|  Beta-amyrin synthase                                    880   0.0     
ref|XP_009786280.1|  PREDICTED: lupeol synthase                         880   0.0     
emb|CAN60556.1|  hypothetical protein VITISV_020304                     879   0.0     Vitis vinifera
ref|XP_002269060.2|  PREDICTED: lupeol synthase isoform X1              879   0.0     Vitis vinifera
ref|XP_009106612.1|  PREDICTED: camelliol C synthase                    879   0.0     
gb|KEH27290.1|  beta-amyrin synthase                                    879   0.0     
ref|XP_006409184.1|  hypothetical protein EUTSA_v10022563mg             879   0.0     
ref|XP_007153005.1|  hypothetical protein PHAVU_004G178500g             879   0.0     
ref|XP_006300769.1|  hypothetical protein CARUB_v10019844mg             879   0.0     
ref|XP_011037652.1|  PREDICTED: beta-amyrin synthase-like               878   0.0     
ref|XP_010656689.1|  PREDICTED: lupeol synthase isoform X2              878   0.0     
emb|CBI24038.3|  unnamed protein product                                878   0.0     
ref|XP_010472731.1|  PREDICTED: camelliol C synthase-like isoform X1    877   0.0     
ref|XP_010539602.1|  PREDICTED: camelliol C synthase-like isoform X5    877   0.0     
ref|XP_006468107.1|  PREDICTED: beta-amyrin synthase-like               877   0.0     
emb|CDX88493.1|  BnaC06g39370D                                          876   0.0     
ref|XP_006450022.1|  hypothetical protein CICLE_v10013952mg             876   0.0     
sp|A8CDT3.1|LUPS_BRUGY  RecName: Full=Lupeol synthase; Short=BgLUS      876   0.0     Bruguiera gymnorhiza [Burma mangrove]
ref|XP_011034490.1|  PREDICTED: lupeol synthase-like isoform X1         876   0.0     
gb|KEH18380.1|  beta-amyrin synthase                                    875   0.0     
ref|XP_006468116.1|  PREDICTED: beta-amyrin synthase-like               875   0.0     
ref|XP_006353758.1|  PREDICTED: lupeol synthase-like                    875   0.0     
ref|XP_006374737.1|  hypothetical protein POPTR_0014s00370g             875   0.0     
ref|XP_004243674.1|  PREDICTED: lupeol synthase isoform X1              875   0.0     
dbj|BAA86932.1|  lupeol synthase                                        874   0.0     Taraxacum officinale [dandelion]
emb|CAN65909.1|  hypothetical protein VITISV_001242                     873   0.0     Vitis vinifera
ref|XP_006436395.1|  hypothetical protein CICLE_v10030771mg             873   0.0     
sp|Q8W3Z2.1|LUPS_BETPL  RecName: Full=Lupeol synthase                   872   0.0     Betula platyphylla [Asian white birch]
ref|XP_009337925.1|  PREDICTED: beta-amyrin synthase-like               872   0.0     
ref|XP_006374736.1|  hypothetical protein POPTR_0014s00370g             872   0.0     
gb|KDP37006.1|  hypothetical protein JCGZ_06062                         870   0.0     
ref|XP_010655247.1|  PREDICTED: beta-Amyrin Synthase 1 isoform X2       870   0.0     
ref|XP_002304910.2|  putative oxidosqualene cyclase family protein      869   0.0     Populus trichocarpa [western balsam poplar]
emb|CDY35103.1|  BnaA06g11130D                                          869   0.0     
ref|XP_010313621.1|  PREDICTED: delta-amyrin synthase isoform X1        867   0.0     
sp|Q948R6.1|IMFS_LUFAE  RecName: Full=Isomultiflorenol synthase; ...    867   0.0     Luffa aegyptiaca [dishcloth gourd]
ref|XP_010656690.1|  PREDICTED: lupeol synthase isoform X3              866   0.0     
ref|XP_009149097.1|  PREDICTED: amyrin synthase LUP2-like               866   0.0     
sp|Q9LRH7.1|ABAMS_PEA  RecName: Full=Mixed-amyrin synthase              866   0.0     Pisum sativum [garden pea]
emb|CDX88494.1|  BnaC06g39380D                                          865   0.0     
ref|XP_010669612.1|  PREDICTED: lupeol synthase-like                    865   0.0     
ref|XP_006468103.1|  PREDICTED: beta-amyrin synthase-like               864   0.0     
ref|NP_001236591.1|  beta-amyrin synthase                               864   0.0     
ref|XP_010532332.1|  PREDICTED: camelliol C synthase-like               862   0.0     
gb|AIK19225.1|  triterpene synthase                                     862   0.0     
gb|AIK19224.1|  triterpene synthase                                     862   0.0     
sp|Q9SXV6.1|CAS1_GLYGL  RecName: Full=Cycloartenol synthase             862   0.0     Glycyrrhiza glabra
ref|XP_010417513.1|  PREDICTED: amyrin synthase LUP2-like isoform X4    862   0.0     
ref|XP_008223938.1|  PREDICTED: cycloartenol synthase 2                 862   0.0     
ref|XP_002530442.1|  Cycloartenol synthase, putative                    862   0.0     Ricinus communis
ref|XP_002887763.1|  ATLUP2                                             862   0.0     
gb|AIK21791.1|  beta-amyrin synthase                                    861   0.0     
ref|XP_010054047.1|  PREDICTED: beta-amyrin synthase-like               861   0.0     
gb|KCW83375.1|  hypothetical protein EUGRSUZ_B00308                     861   0.0     
ref|XP_006371457.1|  hypothetical protein POPTR_0019s10800g             861   0.0     
ref|XP_002264289.1|  PREDICTED: cycloartenol Synthase                   861   0.0     Vitis vinifera
ref|XP_007225240.1|  hypothetical protein PRUPE_ppa001844mg             860   0.0     
gb|AGC82084.1|  beta amyrn synthase                                     860   0.0     
dbj|BAL41371.1|  lupeol synthase                                        860   0.0     
ref|XP_010655249.1|  PREDICTED: beta-amyrin synthase                    860   0.0     
ref|XP_004510379.1|  PREDICTED: mixed-amyrin synthase-like              860   0.0     
ref|XP_010095206.1|  Lupeol synthase                                    861   0.0     
gb|KCW70932.1|  hypothetical protein EUGRSUZ_F04049                     858   0.0     
emb|CBI18408.3|  unnamed protein product                                860   0.0     
ref|XP_007019802.1|  Cycloartenol synthase 1 isoform 1                  858   0.0     
gb|KDP27754.1|  hypothetical protein JCGZ_19783                         858   0.0     
gb|AHY94897.1|  cycloartenol synthase                                   858   0.0     
emb|CAM91422.1|  cycloartenol synthase                                  857   0.0     Dioscorea zingiberensis
ref|XP_009364429.1|  PREDICTED: beta-amyrin synthase-like               857   0.0     
ref|XP_010244585.1|  PREDICTED: cycloartenol synthase 2 isoform X1      856   0.0     
sp|Q764T8.1|LUPS_GLYGL  RecName: Full=Lupeol synthase; Short=GgLUS1     856   0.0     
dbj|BAB83253.1|  cycloartenol synthase                                  856   0.0     
ref|XP_002299271.2|  hypothetical protein POPTR_0001s14610g             855   0.0     
ref|XP_010541955.1|  PREDICTED: cycloartenol synthase                   855   0.0     
emb|CBD47302.1|  cycloartenol synthase                                  855   0.0     
ref|XP_009409584.1|  PREDICTED: cycloartenol synthase-like              855   0.0     
dbj|BAE53431.1|  cycloartenol synthase                                  854   0.0     
gb|KDP25033.1|  hypothetical protein JCGZ_22568                         854   0.0     
gb|AGG09938.1|  beta-amyrin synthase                                    851   0.0     
ref|XP_010531952.1|  PREDICTED: camelliol C synthase-like isoform X2    851   0.0     
ref|XP_007019803.1|  Cycloartenol synthase 1 isoform 2                  852   0.0     
gb|EYU25764.1|  hypothetical protein MIMGU_mgv1a024154mg                852   0.0     
gb|KHN16704.1|  Lupeol synthase                                         850   0.0     
ref|XP_009345284.1|  PREDICTED: cycloartenol synthase 2-like            851   0.0     
gb|KEH25838.1|  beta-amyrin synthase                                    851   0.0     
ref|XP_004156484.1|  PREDICTED: LOW QUALITY PROTEIN: isomultiflor...    851   0.0     
ref|NP_176868.1|  Terpenoid cyclases family protein                     851   0.0     
gb|KCW80789.1|  hypothetical protein EUGRSUZ_C02165                     849   0.0     
ref|XP_010271332.1|  PREDICTED: cycloartenol Synthase isoform X2        850   0.0     
ref|XP_002527337.1|  Cycloartenol synthase, putative                    849   0.0     
ref|XP_009370034.1|  PREDICTED: cycloartenol synthase 2                 850   0.0     
gb|KHG28306.1|  Beta-amyrin synthase                                    849   0.0     
sp|Q8W3Z3.1|CAS2_BETPL  RecName: Full=Cycloartenol synthase 2           849   0.0     
ref|XP_006306840.1|  hypothetical protein CARUB_v10008384mg             849   0.0     
gb|AFS49705.1|  cycloartenol synthase                                   848   0.0     
ref|XP_010065064.1|  PREDICTED: beta-amyrin synthase-like               846   0.0     
ref|XP_006468104.1|  PREDICTED: beta-amyrin synthase-like isoform X1    848   0.0     
ref|XP_006362808.1|  PREDICTED: cycloartenol Synthase-like isofor...    848   0.0     
ref|XP_011094034.1|  PREDICTED: cycloartenol Synthase                   848   0.0     
ref|XP_004156436.1|  PREDICTED: isomultiflorenol synthase-like is...    847   0.0     
ref|XP_004299756.1|  PREDICTED: cycloartenol synthase-like              847   0.0     
gb|AAD05032.1|  lupeol synthase                                         847   0.0     
ref|XP_010271331.1|  PREDICTED: cycloartenol Synthase isoform X1        847   0.0     
ref|XP_010655670.1|  PREDICTED: beta-amyrin synthase                    845   0.0     
ref|XP_008228019.1|  PREDICTED: beta-amyrin synthase-like               847   0.0     
ref|XP_008462187.1|  PREDICTED: isomultiflorenol synthase               846   0.0     
ref|XP_009620777.1|  PREDICTED: cycloartenol Synthase-like isofor...    846   0.0     
gb|AIY33888.1|  cycloartenol synthase                                   846   0.0     
ref|NP_178018.1|  lupeol synthase 1                                     845   0.0     
gb|ABY60426.1|  cycloartenol synthase                                   845   0.0     
gb|AIU41742.1|  cycloartenol synthase                                   845   0.0     
ref|XP_009362029.1|  PREDICTED: cycloartenol synthase 2-like            844   0.0     
ref|XP_007147811.1|  hypothetical protein PHAVU_006G156900g             844   0.0     
gb|AIW81530.1|  cycloartenol synthase protein                           844   0.0     
ref|XP_002887764.1|  hypothetical protein ARALYDRAFT_477065             844   0.0     
ref|XP_004139371.1|  PREDICTED: isomultiflorenol synthase-like          844   0.0     
ref|XP_010537757.1|  PREDICTED: camelliol C synthase-like isoform X3    842   0.0     
ref|XP_010537756.1|  PREDICTED: camelliol C synthase-like isoform X2    842   0.0     
ref|XP_007147805.1|  hypothetical protein PHAVU_006G156500g             843   0.0     
ref|XP_006850984.1|  hypothetical protein AMTR_s00025p00210690          842   0.0     
ref|XP_007160210.1|  hypothetical protein PHAVU_002G302200g             842   0.0     
gb|AAB94341.1|  2,3-oxidosqualene-triterpenoid cyclase                  842   0.0     
gb|AGF87141.1|  cycloartenol synthase                                   842   0.0     
sp|Q2XPU6.1|CAS1_RICCO  RecName: Full=Cycloartenol synthase; Shor...    842   0.0     
ref|XP_002513299.1|  Cycloartenol synthase, putative                    842   0.0     
ref|XP_010531948.1|  PREDICTED: camelliol C synthase-like isoform X2    840   0.0     
ref|XP_006372242.1|  cycloartenol synthase family protein               841   0.0     
sp|O82139.1|CAS1_PANGI  RecName: Full=Cycloartenol Synthase             841   0.0     
gb|KEH22226.1|  beta-amyrin synthase                                    838   0.0     
ref|XP_010413093.1|  PREDICTED: cycloartenol synthase                   840   0.0     
ref|NP_001233784.1|  cycloartenol synthase                              840   0.0     
ref|XP_010488811.1|  PREDICTED: cycloartenol synthase-like              840   0.0     
gb|KFK39919.1|  hypothetical protein AALP_AA3G306200                    840   0.0     
ref|XP_008391430.1|  PREDICTED: cycloartenol synthase 2 isoform X1      840   0.0     
gb|AAS01524.1|  cycloartenol synthase                                   840   0.0     
ref|XP_007153003.1|  hypothetical protein PHAVU_004G178300g             839   0.0     
gb|AGK62447.1|  cycloartenol synthase                                   839   0.0     
gb|ADG60271.1|  cycloartenol synthase                                   839   0.0     
ref|XP_009136183.1|  PREDICTED: cycloartenol synthase                   839   0.0     
ref|XP_006296684.1|  hypothetical protein CARUB_v10013036mg             838   0.0     
ref|XP_008455462.1|  PREDICTED: LOW QUALITY PROTEIN: isomultiflor...    838   0.0     
dbj|BAA23533.1|  cycloartenol synthase                                  838   0.0     
gb|AAC04931.1|  cycloartenol synthase                                   837   0.0     
gb|AGA17939.1|  lupeol synthase                                         837   0.0     
ref|XP_002883756.1|  cycloartenol synthase                              837   0.0     
ref|XP_010467143.1|  PREDICTED: cycloartenol synthase-like              837   0.0     
gb|KHN32929.1|  Cycloartenol synthase                                   836   0.0     
gb|AET01563.2|  beta-amyrin synthase                                    836   0.0     
ref|XP_003516849.1|  PREDICTED: cycloartenol synthase                   836   0.0     
ref|XP_004513124.1|  PREDICTED: cycloartenol synthase-like              835   0.0     
ref|NP_178722.1|  cycloartenol synthase                                 835   0.0     
ref|XP_008240807.1|  PREDICTED: lupeol synthase-like                    835   0.0     
gb|AFC67276.1|  cycloartenol synthase                                   834   0.0     
ref|XP_002308131.2|  cycloartenol synthase family protein               834   0.0     
gb|AEO27878.1|  cycloartenol synthases                                  833   0.0     
ref|XP_009102615.1|  PREDICTED: cycloartenol synthase-like              833   0.0     
ref|XP_007147800.1|  hypothetical protein PHAVU_006G156000g             833   0.0     
gb|AAG44096.1|AF216755_1  cycloartenol synthase                         832   0.0     
emb|CDX93093.1|  BnaA03g38150D                                          833   0.0     
ref|XP_004513125.1|  PREDICTED: lupeol synthase-like                    832   0.0     
emb|CDY50938.1|  BnaC03g74380D                                          832   0.0     
ref|XP_006368912.1|  hypothetical protein POPTR_0001s14610g             832   0.0     
ref|XP_004141834.1|  PREDICTED: isomultiflorenol synthase-like          831   0.0     
ref|XP_006646871.1|  PREDICTED: cycloartenol synthase-like              831   0.0     
ref|XP_006396089.1|  hypothetical protein EUTSA_v10002412mg             831   0.0     
ref|XP_010677527.1|  PREDICTED: cycloartenol synthase 2                 830   0.0     
gb|AGC82085.1|  cycloartenol synthase protein                           830   0.0     
gb|KEH25840.1|  beta-amyrin synthase                                    830   0.0     
gb|KDP37007.1|  hypothetical protein JCGZ_06063                         828   0.0     
ref|XP_006474339.1|  PREDICTED: cycloartenol synthase 2-like isof...    830   0.0     
ref|XP_007214975.1|  hypothetical protein PRUPE_ppa001797mg             830   0.0     
ref|XP_008348400.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    830   0.0     
ref|XP_008353809.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amyrin ...    827   0.0     
gb|ADC84219.1|  putative 2,3 oxidosqualene cyclase                      829   0.0     
ref|XP_004308480.1|  PREDICTED: lupeol synthase-like                    829   0.0     
ref|XP_011034491.1|  PREDICTED: lupeol synthase-like isoform X2         827   0.0     
ref|XP_006453168.1|  hypothetical protein CICLE_v10007532mg             828   0.0     
dbj|BAF73929.1|  cycloartenol synthase                                  828   0.0     
gb|EYU25760.1|  hypothetical protein MIMGU_mgv1a001797mg                827   0.0     
ref|XP_010927164.1|  PREDICTED: cycloartenol Synthase-like isofor...    829   0.0     
ref|XP_002888561.1|  hypothetical protein ARALYDRAFT_475791             827   0.0     
gb|AAT38889.1|  cycloartenol synthase                                   827   0.0     
ref|XP_010927167.1|  PREDICTED: cycloartenol synthase-like              827   0.0     
ref|NP_001045848.1|  Os02g0139700                                       827   0.0     
gb|KFK33872.1|  hypothetical protein AALP_AA5G071200                    825   0.0     
ref|XP_011017592.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    826   0.0     
emb|CDP12480.1|  unnamed protein product                                826   0.0     
sp|E2IUB0.1|CASS_KALDA  RecName: Full=Cycloartenol synthase; Shor...    826   0.0     
ref|XP_002453283.1|  hypothetical protein SORBIDRAFT_04g003200          825   0.0     
ref|XP_010323971.1|  PREDICTED: lupeol synthase isoform X2              823   0.0     
gb|AEM42981.1|  cycloartenol synthase                                   825   0.0     
ref|XP_010534788.1|  PREDICTED: seco-amyrin synthase-like               825   0.0     
emb|CAC84559.1|  cycloartenol synthase                                  825   0.0     
gb|AAT38888.1|  cycloartenol synthase                                   825   0.0     
ref|XP_003610947.1|  Cycloartenol synthase                              823   0.0     
dbj|BAF73930.1|  cycloartenol synthase                                  823   0.0     
ref|XP_010906067.1|  PREDICTED: cycloartenol synthase-like              823   0.0     
ref|XP_006340479.1|  PREDICTED: cycloartenol Synthase-like              823   0.0     
ref|XP_006484812.1|  PREDICTED: cycloartenol synthase 2-like            823   0.0     
ref|XP_008228021.1|  PREDICTED: cycloartenol synthase                   822   0.0     
gb|AAT38891.1|  cycloartenol synthase                                   822   0.0     
ref|XP_007147801.1|  hypothetical protein PHAVU_006G156100g             822   0.0     
gb|KHG27893.1|  Cycloartenol synthase                                   822   0.0     
gb|AAF03375.1|AF169966_1  putative cycloartenol synthase                822   0.0     
gb|AAS83469.1|  cycloartenol synthase                                   822   0.0     
dbj|BAB83254.1|  multifunctional triterpene synthase                    822   0.0     
emb|CDX77512.1|  BnaA07g06500D                                          822   0.0     
ref|XP_004303791.1|  PREDICTED: beta-amyrin synthase-like               821   0.0     
ref|XP_011019951.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    821   0.0     
emb|CDP14235.1|  unnamed protein product                                818   0.0     
gb|AAT38892.1|  cycloartenol synthase                                   820   0.0     
gb|AAT38887.1|  cycloartenol synthase                                   820   0.0     
gb|AAT38890.1|  cycloartenol synthase                                   820   0.0     
ref|XP_009764017.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...    820   0.0     
gb|KHG12373.1|  Cycloartenol synthase 2                                 819   0.0     
ref|NP_001168640.1|  hypothetical protein                               819   0.0     
dbj|BAA84603.1|  oxidosqualene cyclase                                  819   0.0     
gb|AFW80117.1|  hypothetical protein ZEAMMB73_095189                    819   0.0     
ref|XP_008655662.1|  PREDICTED: cycloartenol synthase-like isofor...    819   0.0     
ref|XP_007214976.1|  hypothetical protein PRUPE_ppa001806mg             819   0.0     
ref|XP_008655663.1|  PREDICTED: cycloartenol synthase-like isofor...    819   0.0     
gb|AAC98864.1|  pentacyclic triterpene synthase                         815   0.0     
ref|XP_006403308.1|  hypothetical protein EUTSA_v10003155mg             818   0.0     
ref|XP_004303790.1|  PREDICTED: cycloartenol synthase-like              817   0.0     
emb|CAN65908.1|  hypothetical protein VITISV_001241                     816   0.0     
ref|XP_007134028.1|  hypothetical protein PHAVU_010G013200g             816   0.0     
sp|A8C981.1|TARS_RHISY  RecName: Full=Taraxerol synthase; Short=RsM2    815   0.0     
ref|XP_010068963.1|  PREDICTED: cycloartenol Synthase-like              813   0.0     
ref|XP_010098882.1|  hypothetical protein L484_012176                   813   0.0     
ref|XP_008679954.1|  PREDICTED: cycloartenol synthase isoform X1        812   0.0     
ref|XP_007023625.1|  Cycloartenol synthase 1                            811   0.0     
ref|XP_010067808.1|  PREDICTED: cycloartenol synthase 2-like isof...    811   0.0     
ref|XP_004975971.1|  PREDICTED: cycloartenol synthase-like              810   0.0     
ref|XP_008228020.1|  PREDICTED: beta-amyrin synthase-like               810   0.0     
sp|Q8W3Z4.1|CAS1_BETPL  RecName: Full=Cycloartenol synthase             810   0.0     
ref|XP_004289557.1|  PREDICTED: beta-amyrin synthase-like               810   0.0     
ref|XP_010539599.1|  PREDICTED: camelliol C synthase-like isoform X2    808   0.0     
ref|XP_003627091.1|  Beta-amyrin synthase                               807   0.0     
ref|XP_009379198.1|  PREDICTED: cycloartenol synthase-like              809   0.0     
ref|XP_003574426.1|  PREDICTED: cycloartenol synthase                   808   0.0     
gb|AET01567.2|  beta-amyrin synthase                                    807   0.0     
ref|XP_007214981.1|  hypothetical protein PRUPE_ppa001830mg             808   0.0     
ref|XP_002262960.1|  PREDICTED: cycloartenol Synthase-like              808   0.0     
ref|XP_004141754.1|  PREDICTED: cycloartenol synthase-like              808   0.0     
ref|XP_008462186.1|  PREDICTED: cycloartenol synthase                   808   0.0     
ref|XP_004159000.1|  PREDICTED: cycloartenol synthase-like              808   0.0     
dbj|BAF93208.1|  cycloartenol synthase                                  807   0.0     
ref|XP_004951930.1|  PREDICTED: cycloartenol synthase-like              805   0.0     
ref|XP_006436398.1|  hypothetical protein CICLE_v10033377mg             803   0.0     
gb|KHN33083.1|  Beta-amyrin synthase                                    804   0.0     
gb|AEM42982.1|  cucurbitadienol synthase                                805   0.0     
ref|XP_010067807.1|  PREDICTED: cycloartenol synthase 2-like isof...    805   0.0     
ref|XP_010927163.1|  PREDICTED: cycloartenol synthase-like isofor...    806   0.0     
ref|XP_010545605.1|  PREDICTED: seco-amyrin synthase-like               804   0.0     
ref|XP_007025071.1|  Beta-Amyrin Synthase, putative                     803   0.0     
gb|KEH33351.1|  beta-amyrin synthase                                    800   0.0     
ref|XP_004305790.1|  PREDICTED: beta-amyrin synthase-like               802   0.0     
ref|XP_011009937.1|  PREDICTED: beta-amyrin synthase-like isoform X4    797   0.0     
sp|Q9SLP9.1|CAS1_LUFAE  RecName: Full=Cycloartenol synthase; Shor...    801   0.0     
sp|Q6BE25.1|CAS1_CUCPE  RecName: Full=Cycloartenol synthase             801   0.0     
ref|XP_010539597.1|  PREDICTED: camelliol C synthase-like isoform X1    799   0.0     
ref|XP_010533174.1|  PREDICTED: seco-amyrin synthase-like               801   0.0     
ref|XP_002269849.1|  PREDICTED: cycloartenol synthase                   800   0.0     
gb|ABX75046.1|  cycloartenol synthase 1                                 800   0.0     
emb|CDX85104.1|  BnaC07g08020D                                          800   0.0     
ref|XP_011031251.1|  PREDICTED: cycloartenol synthase-like              799   0.0     
emb|CDP12483.1|  unnamed protein product                                799   0.0     
ref|XP_008465722.1|  PREDICTED: beta-amyrin synthase-like isoform X1    798   0.0     
ref|XP_003632939.1|  PREDICTED: cycloartenol synthase-like              797   0.0     
ref|XP_007224874.1|  hypothetical protein PRUPE_ppa022710mg             798   0.0     
ref|XP_010495860.1|  PREDICTED: tirucalladienol synthase-like           797   0.0     
ref|XP_004140567.1|  PREDICTED: cucurbitadienol synthase-like           797   0.0     
ref|XP_002310905.1|  hypothetical protein POPTR_0007s15200g             796   0.0     
ref|XP_009346737.1|  PREDICTED: cycloartenol synthase-like              796   0.0     
ref|XP_003604122.1|  Beta-amyrin synthase                               792   0.0     
ref|XP_002527812.1|  Cycloartenol synthase, putative                    795   0.0     
ref|XP_004299757.1|  PREDICTED: cycloartenol synthase-like              796   0.0     
emb|CAN82129.1|  hypothetical protein VITISV_040666                     792   0.0     
dbj|BAI48072.1|  cycloartenol synthase                                  795   0.0     
ref|XP_004156437.1|  PREDICTED: isomultiflorenol synthase-like is...    793   0.0     
ref|XP_010655242.1|  PREDICTED: cycloartenol synthase-like              794   0.0     
ref|XP_009379194.1|  PREDICTED: beta-amyrin synthase                    793   0.0     
ref|XP_002863840.1|  predicted protein                                  793   0.0     
ref|XP_010502925.1|  PREDICTED: tirucalladienol synthase-like           793   0.0     
ref|XP_008368666.1|  PREDICTED: beta-amyrin synthase-like               792   0.0     
ref|XP_009334975.1|  PREDICTED: beta-amyrin synthase-like               792   0.0     
ref|XP_011019952.1|  PREDICTED: cycloartenol synthase 2-like            792   0.0     
gb|AFP95334.2|  mixed amyrin synthase                                   791   0.0     
ref|NP_001280946.1|  beta-amyrin synthase                               791   0.0     



>ref|XP_011096562.1| PREDICTED: dammarenediol II synthase-like [Sesamum indicum]
 ref|XP_011096564.1| PREDICTED: dammarenediol II synthase-like [Sesamum indicum]
Length=761

 Score =  1260 bits (3260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/758 (77%), Positives = 662/758 (87%), Gaps = 3/758 (0%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI EG GPY+YSTNN+ GRQIWEYDPN GTPEE++AF+KAR+ F + R+KG H+C 
Sbjct  1     MWKLKIAEGHGPYLYSTNNFVGRQIWEYDPNGGTPEERQAFQKAREEFNENRKKGFHSCA  60

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             DLFMRMQ+ +ES +D+LSIPPVR+ E+EEV YEA T AV+KA+RLN A+QA DGHWPAEN
Sbjct  61    DLFMRMQLKRESGIDLLSIPPVRVGEKEEVTYEAATIAVKKALRLNRAVQASDGHWPAEN  120

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +GP+FFTPPL+IALYISG+I+ ILTSEHKKE+VRY+YNHQNEDGGWG YI+GHSTMIGSA
Sbjct  121   AGPMFFTPPLLIALYISGAINTILTSEHKKEMVRYIYNHQNEDGGWGFYIEGHSTMIGSA  180

Query  2046  LNYVALRLLGEEADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPP  1876
             L+YVALR+LGE  DD   A+AR R WIL HGGAT IPSWGK YLSVLGVYEWDGCNP+PP
Sbjct  181   LSYVALRILGEGPDDGNGAVARARKWILDHGGATGIPSWGKTYLSVLGVYEWDGCNPLPP  240

Query  1875  EFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDW  1696
             EFWLFPS  P+HPAKMW YCRTTYMPMSYLY ++YHGPLT+LVLSIR EIHVKPYDQIDW
Sbjct  241   EFWLFPSVLPYHPAKMWCYCRTTYMPMSYLYGRKYHGPLTDLVLSIRQEIHVKPYDQIDW  300

Query  1695  NNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGAE  1516
             N  R  CCK+D YYPHTFIQD+LW+ L YCTEP MRRWP NKIR+ AM K I +MRYGAE
Sbjct  301   NKARHDCCKDDLYYPHTFIQDLLWDTLNYCTEPFMRRWPLNKIRQKAMDKAIKYMRYGAE  360

Query  1515  ESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDAT  1336
             ESRYITIG +EKSLQMMCWWA DPNCDE K+HLARVPD+LWLAEDGM MQ+FGSQ WD+T
Sbjct  361   ESRYITIGCVEKSLQMMCWWAHDPNCDEFKHHLARVPDYLWLAEDGMKMQSFGSQIWDST  420

Query  1335  FATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGW  1156
              ATQA+I+SGMV+EYGDCLKKAHFY+K+SQIKENPKGD  +MYRHF+KGAW FSDQD GW
Sbjct  421   LATQAVIASGMVDEYGDCLKKAHFYVKESQIKENPKGDHTAMYRHFTKGAWTFSDQDQGW  480

Query  1155  VVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQ  976
             VVSDCTAEA+KCLLLL QM  EIAGEK DV+ LYEAV++ LYLQSP SGGFA+WEPPIPQ
Sbjct  481   VVSDCTAEALKCLLLLSQMPTEIAGEKADVERLYEAVNVLLYLQSPLSGGFAIWEPPIPQ  540

Query  975   PYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLET  796
             PYL++LNPSELFADIVV+ EHVE T SIV AL AFK  +P +R KE+ +S+AKA ++LE 
Sbjct  541   PYLQVLNPSELFADIVVEQEHVECTASIVQALLAFKRLHPGHREKEIEISVAKALQFLEE  600

Query  795   QQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGEC  616
             +Q  DGSWYGYWGICFLYGT F L GL AAG++YENSEA+RK  +FFLS QN+EGGWGE 
Sbjct  601   KQWPDGSWYGYWGICFLYGTFFVLGGLAAAGKTYENSEAVRKGVNFFLSTQNEEGGWGES  660

Query  615   LESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFP  436
             LESCP+MKY P EGNR+N+VQTSWAMLGL+ + QAERDPTPLHRAAKLLINAQM+DGDFP
Sbjct  661   LESCPSMKYTPLEGNRTNLVQTSWAMLGLLQSGQAERDPTPLHRAAKLLINAQMDDGDFP  720

Query  435   QQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             QQ+ITG YMKNCMLHYA +R+ FPL AL EYRKRVW S
Sbjct  721   QQEITGVYMKNCMLHYAQYRNIFPLWALGEYRKRVWPS  758



>emb|CDP12624.1| unnamed protein product [Coffea canephora]
Length=761

 Score =  1250 bits (3235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/758 (75%), Positives = 658/758 (87%), Gaps = 3/758 (0%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI EG GPY+YSTNN+AGRQIWEYD NAGTPEE+EAFEKAR+ FTK R+KG H CG
Sbjct  1     MWKLKIAEGHGPYLYSTNNFAGRQIWEYDSNAGTPEEREAFEKAREEFTKNRKKGVHPCG  60

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             DLFMRMQ+IKES +D+LSIPP+RL E EE  YE  T AV+KA+RLN A+QA DGHWPAEN
Sbjct  61    DLFMRMQLIKESGIDLLSIPPIRLGENEEATYENTTIAVKKALRLNRAIQASDGHWPAEN  120

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +GP+FFTPPL+IALYISG+I+ ILT EHKKE++RY+YNHQN+DGGWG YI+GHSTMIGSA
Sbjct  121   AGPMFFTPPLLIALYISGAINTILTKEHKKEMIRYIYNHQNDDGGWGFYIEGHSTMIGSA  180

Query  2046  LNYVALRLLGEEADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPP  1876
             L+YVALR+LGE  DD   A+AR R WIL HGGAT IPSWGK YLSVLGVY+WDGCNP+PP
Sbjct  181   LSYVALRILGEGPDDGNGAVARARKWILDHGGATGIPSWGKTYLSVLGVYDWDGCNPVPP  240

Query  1875  EFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDW  1696
             EFWLFP  FP+HPAKMW YCRTTYMPMSYLY K+YHGPLT+LV+S+R EIHVKPYDQIDW
Sbjct  241   EFWLFPEFFPYHPAKMWCYCRTTYMPMSYLYGKKYHGPLTDLVMSLRQEIHVKPYDQIDW  300

Query  1695  NNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGAE  1516
             N  R  CC ED YYPH+ IQD+LW+ L YCTEPIMRRWP NKIRE AM K I +MRYGAE
Sbjct  301   NKARHDCCTEDLYYPHSRIQDLLWDTLNYCTEPIMRRWPLNKIRERAMDKAIKYMRYGAE  360

Query  1515  ESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDAT  1336
             ESRYITIG +EKSLQMMCWWA DPNCDE KYHLARVPD+LWLAEDGM MQ+FGSQ WD  
Sbjct  361   ESRYITIGCVEKSLQMMCWWAHDPNCDEFKYHLARVPDYLWLAEDGMKMQSFGSQVWDCA  420

Query  1335  FATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGW  1156
              ATQA++++GMV+EYGDCLKKAHF++K+SQ+KENPKGDFKSMYRHF+KG+W FSDQD GW
Sbjct  421   LATQAVMATGMVDEYGDCLKKAHFHIKESQVKENPKGDFKSMYRHFTKGSWTFSDQDQGW  480

Query  1155  VVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQ  976
             VVSDCTAE++KCLL+L QM  EI+G+K DV+ LY+AV++ LYLQSPESGGF++WEPP+PQ
Sbjct  481   VVSDCTAESLKCLLMLSQMPTEISGKKADVERLYDAVNVLLYLQSPESGGFSIWEPPVPQ  540

Query  975   PYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLET  796
             PYL++LNPSELFADIVV+ EHVE T SI+ AL  FK  +P +R KE+ +++AKA  +LE 
Sbjct  541   PYLQVLNPSELFADIVVEQEHVENTASIIQALLLFKRLHPGHREKEIEIAVAKAVSFLEG  600

Query  795   QQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGEC  616
             +Q  DGSWYGYWGICFLYGT F L GL  AG++Y NSEA+RKA  F+LS QN+EGGWGE 
Sbjct  601   KQWPDGSWYGYWGICFLYGTMFVLAGLVVAGKTYSNSEAVRKAVQFYLSTQNEEGGWGES  660

Query  615   LESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFP  436
             LESCP+MKY P EGNR+N+VQT+WAMLGLM+  QAERDPTPLH+AAKLL+NAQM+DGDFP
Sbjct  661   LESCPSMKYTPLEGNRTNLVQTAWAMLGLMHGGQAERDPTPLHKAAKLLMNAQMDDGDFP  720

Query  435   QQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             QQ+ITG YMKNCMLHYA +R+ FPL ALSEYRKRVW S
Sbjct  721   QQEITGVYMKNCMLHYAQYRNIFPLWALSEYRKRVWPS  758



>gb|AEX99665.1| amyrin synthase [Catharanthus roseus]
Length=762

 Score =  1247 bits (3227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/757 (76%), Positives = 661/757 (87%), Gaps = 4/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT-C  2410
             MWKLKI EG GPY+YSTNN+ GRQIWEYDPNAGTP+E+EAFEKAR+ F   R+KG H  C
Sbjct  1     MWKLKIAEGKGPYLYSTNNFVGRQIWEYDPNAGTPQEREAFEKAREQFRNNRKKGVHNPC  60

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DLFMRMQ+IKE+ +D++SIPPVR+ E+EE+ +E  T AV+KA+RLN A+QA DGHWPAE
Sbjct  61    ADLFMRMQLIKENGIDLMSIPPVRVEEKEELTFEKTTIAVKKALRLNRAIQATDGHWPAE  120

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GP+FFTPPL+IALYISG+I+ ILTSEHKKELVRY+YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGPMFFTPPLLIALYISGAINTILTSEHKKELVRYIYNHQNEDGGWGFYIEGHSTMIGS  180

Query  2049  ALNYVALRLLGEEADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             AL+YVALRLLGE  DD   A+ RGR WIL HGGAT IPSWGK YLSVLGVY+WDGCNP+P
Sbjct  181   ALSYVALRLLGEGPDDGDGAVGRGRQWILDHGGATGIPSWGKTYLSVLGVYDWDGCNPLP  240

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEFWLFPS FP+HPAKMW YCRTTYMPMSYLY K+YHGPLT+LV+ +R EIHVKPYDQID
Sbjct  241   PEFWLFPSFFPYHPAKMWCYCRTTYMPMSYLYGKKYHGPLTHLVMQLRQEIHVKPYDQID  300

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             WN  R  CCK+D YYPH+FIQD+LW+ L Y +EP+MRRWP NKIRE AMRK I +MRYGA
Sbjct  301   WNKARHDCCKDDLYYPHSFIQDLLWDTLNYFSEPVMRRWPCNKIREKAMRKCIKYMRYGA  360

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             EESRYITIG +EKSLQMMCW A DPNCDE KYHLARVPD+LWLAEDGM MQ+FGSQ WD 
Sbjct  361   EESRYITIGCVEKSLQMMCWCAHDPNCDEFKYHLARVPDYLWLAEDGMKMQSFGSQLWDC  420

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
             T ATQA+I++GMVEEYGD +KKAHFY+K+SQ+KENPK DFK+MYRHF+KG+W FSDQD G
Sbjct  421   TLATQAIIATGMVEEYGDTIKKAHFYIKESQVKENPKEDFKAMYRHFTKGSWTFSDQDQG  480

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             WVVSDCTAEA+KCLL+  QM  ++AGEK DV+ LY+AV++ LYLQSPESGGFA+WEPP+P
Sbjct  481   WVVSDCTAEALKCLLVCSQMPQDLAGEKADVERLYDAVNVLLYLQSPESGGFAIWEPPVP  540

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
             QPYL++LNPSELFADIVV+ EHVE T SIV AL  FK  +P +R KE+ +S++KA  +LE
Sbjct  541   QPYLQVLNPSELFADIVVEQEHVENTASIVQALVLFKRLHPGHREKEIEVSVSKAVRFLE  600

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
              +Q  DGSWYGYWGICFLYGT F L GLTAAG++Y+NSEAIRKA  F+LS QN+EGGWGE
Sbjct  601   GRQWPDGSWYGYWGICFLYGTMFVLGGLTAAGKTYKNSEAIRKAVKFYLSTQNEEGGWGE  660

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
             CLESCP+MKYIP EGNR+N+VQTSWAMLGLMY  QAERDPTPLH+AAKLLINAQM+DGDF
Sbjct  661   CLESCPSMKYIPLEGNRTNLVQTSWAMLGLMYGGQAERDPTPLHKAAKLLINAQMDDGDF  720

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVW  328
             PQQ+ITG YMKNCMLHYA +R+ FPL AL+EYRKRVW
Sbjct  721   PQQEITGVYMKNCMLHYAEYRNIFPLWALAEYRKRVW  757



>gb|AFJ19235.1| mixed amyrin synthase [Catharanthus roseus]
Length=762

 Score =  1246 bits (3223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/757 (75%), Positives = 661/757 (87%), Gaps = 4/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT-C  2410
             MWKLKI +G GPY+YSTNN+ GRQIWEYDPNAGTP+E+EAFEKAR+ F   R+KG H  C
Sbjct  1     MWKLKIAKGKGPYLYSTNNFVGRQIWEYDPNAGTPQEREAFEKAREQFRNNRKKGVHNPC  60

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DLFMRMQ+IKE+ +D++SIPPVR+ E+EE+ +E  T AV+KA+RLN A+QA DGHWPAE
Sbjct  61    ADLFMRMQLIKENGIDLMSIPPVRVEEKEELTFEKTTIAVKKALRLNRAIQATDGHWPAE  120

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GP+FFTPPL+IALYISG+I+ ILTSEHKKELVRY+YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGPMFFTPPLLIALYISGAINTILTSEHKKELVRYIYNHQNEDGGWGFYIEGHSTMIGS  180

Query  2049  ALNYVALRLLGEEADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             AL+YVALRLLGE  DD   A+ RGR WIL HGGAT IPSWGK YLSVLGVY+WDGCNP+P
Sbjct  181   ALSYVALRLLGEGPDDGDGAVGRGRQWILDHGGATGIPSWGKTYLSVLGVYDWDGCNPLP  240

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEFWLFPS FP+HPAKMW YCRTTYMPMSYLY K+YHGPLT+LV+ +R EIHVKPYDQID
Sbjct  241   PEFWLFPSFFPYHPAKMWCYCRTTYMPMSYLYGKKYHGPLTHLVMQLRQEIHVKPYDQID  300

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             WN  R  CCK+D YYPH+FIQD+LW+ L Y +EP+MRRWP NKIRE AMRK I +MRYGA
Sbjct  301   WNKARHDCCKDDLYYPHSFIQDLLWDTLNYFSEPVMRRWPCNKIREKAMRKCIKYMRYGA  360

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             EESRYITIG +EKSLQMMCW A DPNCDE KYHLARVPD+LWLAEDGM MQ+FGSQ WD 
Sbjct  361   EESRYITIGCVEKSLQMMCWCAHDPNCDEFKYHLARVPDYLWLAEDGMKMQSFGSQLWDC  420

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
             T ATQA+I++GMVEEYGD +KKAHFY+K+SQ+KENPK DFK+MYRHF+KG+W FSDQD G
Sbjct  421   TLATQAIIATGMVEEYGDTIKKAHFYIKESQVKENPKEDFKAMYRHFTKGSWTFSDQDQG  480

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             WVVSDCTAEA+KCLL+  QM  ++AGEK DV+ LY+AV++ LYLQSPESGGFA+WEPP+P
Sbjct  481   WVVSDCTAEALKCLLVCSQMPQDLAGEKADVERLYDAVNVLLYLQSPESGGFAIWEPPVP  540

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
             QPYL++LNPSELFADIVV+ EHVE T SIV AL  FK  +P +R KE+ +S++KA  +LE
Sbjct  541   QPYLQVLNPSELFADIVVEQEHVENTASIVQALVLFKRLHPGHREKEIEVSVSKAVRFLE  600

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
              +Q  DGSWYGYWGICFLYGT F L GLTAAG++Y+NSEAIRKA  F+LS QN+EGGWGE
Sbjct  601   GRQWPDGSWYGYWGICFLYGTMFVLGGLTAAGKTYKNSEAIRKAVKFYLSTQNEEGGWGE  660

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
             CLESCP+MKYIP EGNR+N+VQTSWAMLGLMY  QAERDPTPLH+AAKLLINAQM+DGDF
Sbjct  661   CLESCPSMKYIPLEGNRTNLVQTSWAMLGLMYGGQAERDPTPLHKAAKLLINAQMDDGDF  720

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVW  328
             PQQ+ITG YMKNCMLHYA +R+ FPL AL+EYRKRVW
Sbjct  721   PQQEITGVYMKNCMLHYAEYRNIFPLWALAEYRKRVW  757



>gb|EYU33367.1| hypothetical protein MIMGU_mgv1a001775mg [Erythranthe guttata]
Length=761

 Score =  1239 bits (3206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/758 (75%), Positives = 653/758 (86%), Gaps = 3/758 (0%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI EG GPY+YSTNN+ GRQ WEYDPNAGTPE++E+F+KAR  F + R+KG H+CG
Sbjct  1     MWKLKIAEGNGPYLYSTNNFVGRQTWEYDPNAGTPEDRESFQKARDIFDQNRKKGFHSCG  60

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             DLFMRMQ+ KES +D+ SIPPVRL E+EE+ YE  T AV+KA+RLN A+QA DGHWPAEN
Sbjct  61    DLFMRMQLKKESGIDLESIPPVRLEEKEEITYETATIAVKKALRLNRAVQASDGHWPAEN  120

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +GP+FFTPPL+IALYISG+I+  LTSEHKKE++RY+YNHQNEDGGWG YI+GHSTMIGSA
Sbjct  121   AGPMFFTPPLLIALYISGAINTTLTSEHKKEMIRYIYNHQNEDGGWGFYIEGHSTMIGSA  180

Query  2046  LNYVALRLLGEEADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPP  1876
             L+YVALR+LGE ADD   AIAR R WIL HGGAT IPSWGK YLSVLGVYEW+GCNP+PP
Sbjct  181   LSYVALRILGEGADDGNGAIARARKWILDHGGATGIPSWGKTYLSVLGVYEWEGCNPLPP  240

Query  1875  EFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDW  1696
             EFWLFPS  P+HPAKMW YCRTTYMPMSYLY ++YHGP+T+LVLS+RNEIHVK YDQIDW
Sbjct  241   EFWLFPSILPYHPAKMWCYCRTTYMPMSYLYGRKYHGPITDLVLSLRNEIHVKSYDQIDW  300

Query  1695  NNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGAE  1516
             N  R  CCKED YYPHTF+QD+LW+ L YCTEP+M+RWP NKIR+ A+ K I +MRYGAE
Sbjct  301   NKARHHCCKEDVYYPHTFVQDLLWDTLNYCTEPVMKRWPLNKIRQRALDKTIKYMRYGAE  360

Query  1515  ESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDAT  1336
             ESRYITIG +EKSLQMMCWWA D NCDE KYHLARVPD+LWLAEDGM MQ+FGSQ WD+T
Sbjct  361   ESRYITIGCVEKSLQMMCWWAHDQNCDEFKYHLARVPDYLWLAEDGMKMQSFGSQIWDST  420

Query  1335  FATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGW  1156
              ATQA+IS+GMVEEYGDCL+KAHFY+K+SQIKENPKGDF+ MYRHF+KGAW FSDQD GW
Sbjct  421   LATQAVISTGMVEEYGDCLQKAHFYIKESQIKENPKGDFRGMYRHFTKGAWTFSDQDQGW  480

Query  1155  VVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQ  976
             VVSDCTAEA+KCLLLL QM  EI+GEK  V+ LY+AV++ LYLQSP SGGFA+WEP IPQ
Sbjct  481   VVSDCTAEALKCLLLLSQMPAEISGEKPPVERLYDAVNVLLYLQSPLSGGFAIWEPAIPQ  540

Query  975   PYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLET  796
             PYL++LNPSELFADIVV+ EHVE T SIV AL +FK  +P +R KE+  S+A+   +LE 
Sbjct  541   PYLQVLNPSELFADIVVEQEHVECTASIVQALISFKRMHPGHREKEIENSVARGVSFLEE  600

Query  795   QQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGEC  616
             +Q  DGSWYGYWGICFLYGT F L GL AAG++YEN EA+RKA +FFLS QN+EGGWGE 
Sbjct  601   KQWPDGSWYGYWGICFLYGTFFTLGGLAAAGKTYENCEAVRKAVNFFLSSQNEEGGWGES  660

Query  615   LESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFP  436
             LESCP+MKY P EGNR+N+VQTSWAMLGLMY  QAERDP PLH+AAKLLIN QM DGDFP
Sbjct  661   LESCPSMKYTPLEGNRTNLVQTSWAMLGLMYGGQAERDPMPLHKAAKLLINEQMIDGDFP  720

Query  435   QQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             QQ+ITG YMKNCMLHYA +R+ FPL AL EYRKRVW S
Sbjct  721   QQEITGVYMKNCMLHYAQYRNIFPLWALGEYRKRVWPS  758



>dbj|BAF63702.1| mixed amyrin synthase [Olea europaea]
Length=762

 Score =  1227 bits (3175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/759 (75%), Positives = 661/759 (87%), Gaps = 4/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2410
             MWKLKI EG GPY+YSTNN+AGRQIWEYDPN GTPEE+EA++KAR+ F + R+ KG H C
Sbjct  1     MWKLKIAEGHGPYLYSTNNFAGRQIWEYDPNGGTPEEREAYDKAREEFQRNRKLKGVHPC  60

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDLFMR+Q+IKES +D++SIPPVRL E+EEV YE  TTAV+KA+ LN A+QA DGHWPAE
Sbjct  61    GDLFMRIQLIKESGIDLMSIPPVRLGEKEEVTYETATTAVKKALLLNRAVQASDGHWPAE  120

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GP+FFTPPL+I LYISG+I+ ILTSEH+KE+VRY+YNHQN+DGGWG YI+GHSTMIGS
Sbjct  121   NAGPMFFTPPLIIVLYISGAINTILTSEHRKEMVRYIYNHQNDDGGWGFYIEGHSTMIGS  180

Query  2049  ALNYVALRLLGEEADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             AL+Y+ALRLLGE  DD   +IAR R WIL HGGAT IPSWGK YLSVLGVY+WDGCNP+P
Sbjct  181   ALSYIALRLLGEGPDDGNGSIARARKWILDHGGATGIPSWGKTYLSVLGVYDWDGCNPLP  240

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEFWLFPS  P+HPAKMW YCRTTYMPMSYLY ++YHGPLT+LVLS+RNEIH+KPY++ID
Sbjct  241   PEFWLFPSFLPYHPAKMWCYCRTTYMPMSYLYGRKYHGPLTDLVLSLRNEIHIKPYNEID  300

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             WN  R  CCKED YYPH+ IQD+LW+ L YC EP+MRRWP NKIR+ A+ K I +MRYGA
Sbjct  301   WNKARHDCCKEDLYYPHSSIQDLLWDTLNYCAEPVMRRWPLNKIRQRALNKTIKYMRYGA  360

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             EESRYITIG +EKSLQMMCWWA DPN DE K+HLARVPD+LWLAEDGM MQ+FGSQ WD+
Sbjct  361   EESRYITIGCVEKSLQMMCWWAHDPNGDEFKHHLARVPDYLWLAEDGMKMQSFGSQIWDS  420

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
             T ATQA+I++GMVEEYGDCLKKAHFY+K+SQIKENP GDFKSMYRHF+KGAW FSDQD G
Sbjct  421   TLATQAVIATGMVEEYGDCLKKAHFYVKESQIKENPAGDFKSMYRHFTKGAWTFSDQDQG  480

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             WVVSDCTAEA+KCLLLL Q+  E AGEK DV+ LYEAV++ LYLQSPESGGFA+WEPP+P
Sbjct  481   WVVSDCTAEALKCLLLLSQLPTETAGEKADVERLYEAVNVLLYLQSPESGGFAIWEPPVP  540

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
             QPYL+MLNPSE+FADIVV+ EHVE + SI+ AL AFK  YP +R KE+ +S+AKA  +LE
Sbjct  541   QPYLQMLNPSEIFADIVVETEHVECSASIIQALLAFKRLYPGHREKEIEISVAKAISFLE  600

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
              +Q  DGSWYGYWGICFLYGT F L GL+AAG++YENSEA+RK  +F LS QN+EGGWGE
Sbjct  601   GRQWPDGSWYGYWGICFLYGTFFVLGGLSAAGKTYENSEAVRKGVNFLLSTQNEEGGWGE  660

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
             CLESCP+MKY P EGNR+N+VQTSWAMLGLMY  QAERDPT LH+AAKLLI+AQM+DGDF
Sbjct  661   CLESCPSMKYTPLEGNRTNLVQTSWAMLGLMYGGQAERDPTSLHKAAKLLIDAQMDDGDF  720

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             PQQ+ITG YMKNCMLHYA +R+ FPL AL EYRKRVW S
Sbjct  721   PQQEITGVYMKNCMLHYAQYRNIFPLWALGEYRKRVWSS  759



>emb|CDP10664.1| unnamed protein product [Coffea canephora]
Length=761

 Score =  1219 bits (3154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/758 (74%), Positives = 649/758 (86%), Gaps = 3/758 (0%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MW+LKI EG GPY+YSTNN+ GRQIWE+DPN GTPEE+EAFEKAR+ F   R+KG H C 
Sbjct  1     MWRLKIAEGNGPYLYSTNNFVGRQIWEWDPNDGTPEEREAFEKAREDFRNNRKKGVHPCA  60

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             DLFMRMQ+ KE+    L IPPVRL E EEV YE  TTAVRKAVRLN A+QAKDGHWPAEN
Sbjct  61    DLFMRMQLKKENSHIDLGIPPVRLGENEEVTYETATTAVRKAVRLNRAIQAKDGHWPAEN  120

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +GP+FFTPPL+IALYISG+I+  LTSEHKKELVRY+YNHQNEDGGWG YI+GHSTM+GSA
Sbjct  121   AGPMFFTPPLLIALYISGAINTHLTSEHKKELVRYIYNHQNEDGGWGFYIEGHSTMMGSA  180

Query  2046  LNYVALRLLGEEADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPP  1876
             L+YVALR+LGE  DD   A+AR R WIL +GGAT IPSWGK YLSVLGVY+WDGCNP+PP
Sbjct  181   LSYVALRILGEGPDDGDGAVARARKWILDNGGATGIPSWGKTYLSVLGVYDWDGCNPLPP  240

Query  1875  EFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDW  1696
             EFWLFP  FP+HPAKMW YCRTTYMPMSYLY ++YHGPLT+LVLS+R EIHVKPYDQI+W
Sbjct  241   EFWLFPEFFPYHPAKMWCYCRTTYMPMSYLYGRQYHGPLTDLVLSLRREIHVKPYDQINW  300

Query  1695  NNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGAE  1516
             N  R  CCKED YYPH+FIQD+LW+ L YCTEP MRRWP NKIR+ AM K I +MRYGAE
Sbjct  301   NKARHDCCKEDLYYPHSFIQDLLWDTLNYCTEPFMRRWPCNKIRQRAMAKSIEYMRYGAE  360

Query  1515  ESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDAT  1336
              SRYITIG +EKSLQMMC+WA DPN D+ KYHLARVPD+LWLAEDGM MQ+FGSQ WD  
Sbjct  361   VSRYITIGCVEKSLQMMCFWAHDPNGDDFKYHLARVPDYLWLAEDGMKMQSFGSQIWDCA  420

Query  1335  FATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGW  1156
              A QA+++SGMV+EYGD LKKAHF+LK++Q K NPKGDFK MYRHF+KG+W FSDQD GW
Sbjct  421   LACQAILASGMVDEYGDSLKKAHFHLKEAQCKTNPKGDFKKMYRHFTKGSWTFSDQDQGW  480

Query  1155  VVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQ  976
             VVSDCTAEA+KCLLL  QM  EIAGEK DV+ LY+AV++CLYLQSPE+GGF++WEPP+PQ
Sbjct  481   VVSDCTAEALKCLLLFSQMPQEIAGEKADVERLYDAVNVCLYLQSPETGGFSIWEPPVPQ  540

Query  975   PYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLET  796
             PYL+ LNPSE+FADIVV+ EHVE + SI+ AL  FK  +P +R KE+ ++++KA  +LE 
Sbjct  541   PYLQQLNPSEMFADIVVEQEHVENSVSIIQALLLFKRLHPGHREKEIEIAVSKAVHFLEG  600

Query  795   QQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGEC  616
             +Q  DGSWYGYWGICFLYGT F L G TAAG++YENSE++RKA +F+LS QN+EGGWGEC
Sbjct  601   KQWPDGSWYGYWGICFLYGTMFVLAGFTAAGKTYENSESVRKAVNFYLSTQNEEGGWGEC  660

Query  615   LESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFP  436
             LESCP+MKYIP EGNR+N+VQTSWAMLGLM+  QAERDPTPLH+ AKLLINAQM+DGDFP
Sbjct  661   LESCPSMKYIPLEGNRTNLVQTSWAMLGLMFGGQAERDPTPLHKGAKLLINAQMDDGDFP  720

Query  435   QQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             QQ+ITG YMKNCMLHYA +R+ FPL AL+EYRKRVW S
Sbjct  721   QQEITGVYMKNCMLHYAEYRNIFPLWALAEYRKRVWPS  758



>gb|AIS39793.1| mixed amyrin synthase 1 [Ilex asprella var. asprella]
Length=762

 Score =  1206 bits (3121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/756 (73%), Positives = 646/756 (85%), Gaps = 3/756 (0%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI EG GPY+YSTNN+ GRQIWEY+P AGTPEE+E  EKAR+ F K R++G H CG
Sbjct  1     MWKLKIAEGKGPYLYSTNNFVGRQIWEYEPEAGTPEEREEVEKARETFRKNRKQGIHPCG  60

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             DL MRMQM KES +DVLSIPPVRL E+EEV YEA+TT+VRKAVRL  ALQAKDGHWPAEN
Sbjct  61    DLLMRMQMKKESGIDVLSIPPVRLGEKEEVTYEAVTTSVRKAVRLLRALQAKDGHWPAEN  120

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +G  FF+PPLMI+LYISG+I+ +LT  HKKEL+R+LYNHQN+DGGWG YI+GHSTMIGSA
Sbjct  121   AGVNFFSPPLMISLYISGAINTVLTPHHKKELIRWLYNHQNDDGGWGFYIEGHSTMIGSA  180

Query  2046  LNYVALRLLGEEADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPP  1876
             L+YV LR+LGE  DD   AIARGR WIL HGGAT IPSWGK YL+VLGVYEWDGCNP+ P
Sbjct  181   LSYVMLRILGEGPDDGDGAIARGRKWILDHGGATGIPSWGKTYLAVLGVYEWDGCNPLTP  240

Query  1875  EFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDW  1696
             EFWLFPS  P+HPAKMW YCRTTYMPMSYLY ++YHGPLT++VL +R EIH +PY +I+W
Sbjct  241   EFWLFPSILPYHPAKMWCYCRTTYMPMSYLYGRKYHGPLTDVVLQLRQEIHPQPYHEINW  300

Query  1695  NNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGAE  1516
             N  R  CCKED YY HTFIQD+LW+ L Y TEP+M+ WPF K+RE A+RK I +MRYG+ 
Sbjct  301   NKARHDCCKEDLYYHHTFIQDLLWDTLNYVTEPLMKFWPFRKLRERALRKAIKYMRYGST  360

Query  1515  ESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDAT  1336
             ESRYITIG +EKSLQMMCWWAEDPNC+E KYHLARVPD+LWLAEDGMTMQ+FGSQ WDAT
Sbjct  361   ESRYITIGCVEKSLQMMCWWAEDPNCEEFKYHLARVPDYLWLAEDGMTMQSFGSQLWDAT  420

Query  1335  FATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGW  1156
              ATQA+++S M EEYGD LKKAHFY+K+SQ KE+P GD  +MYRHF+KG+W FSDQD GW
Sbjct  421   LATQAILASNMEEEYGDSLKKAHFYIKESQCKESPAGDHMAMYRHFTKGSWTFSDQDQGW  480

Query  1155  VVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQ  976
             VVSDCTAEA+KCLL+L QM  E+AGEK DVQ LY+AV++ LYLQSPESGGFA+WEPPIP 
Sbjct  481   VVSDCTAEALKCLLVLSQMPQEMAGEKADVQRLYDAVNVLLYLQSPESGGFAIWEPPIPL  540

Query  975   PYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLET  796
             P L++LNPSE+FADIVV+ EH+E T  I+ AL AFK  +P +R KE+ +S+AKAA++LE 
Sbjct  541   PALQVLNPSEVFADIVVEKEHLENTACIIQALLAFKRLHPGHREKEIEISVAKAAQFLED  600

Query  795   QQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGEC  616
             +Q  DGSWYGYWGICFLYGTCF L GL A G++Y+N  A+RKA HF+LS QN+EGGWGE 
Sbjct  601   KQYPDGSWYGYWGICFLYGTCFVLGGLLAVGKTYDNCPAVRKAVHFYLSTQNEEGGWGES  660

Query  615   LESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFP  436
             LE+CP+MKYIP EGNR+N+VQT+WAM+GLMY  QAERDPTPLHRAAKLLINAQM+DGDFP
Sbjct  661   LEACPSMKYIPLEGNRTNIVQTAWAMMGLMYAGQAERDPTPLHRAAKLLINAQMDDGDFP  720

Query  435   QQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVW  328
             QQ+I G YMKNCMLHYA +RSYFPL AL EYR+R+W
Sbjct  721   QQEILGVYMKNCMLHYAEYRSYFPLWALGEYRRRLW  756



>gb|EYU34015.1| hypothetical protein MIMGU_mgv1a021513mg [Erythranthe guttata]
Length=727

 Score =  1175 bits (3039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/722 (75%), Positives = 620/722 (86%), Gaps = 3/722 (0%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI EG GPY+YSTNN+ GRQ WEYDPNAGTPE++E+F+KAR  F + R KG H+CG
Sbjct  1     MWKLKIAEGNGPYLYSTNNFVGRQTWEYDPNAGTPEDRESFQKARDQFDQNRIKGFHSCG  60

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             DLFMRMQ+ KES +D+ SIP VRL E+EE+ YE  T AV+KA+RLN A+QA DGHWPAEN
Sbjct  61    DLFMRMQLKKESGIDLESIPAVRLEEKEEITYETATIAVKKALRLNRAVQASDGHWPAEN  120

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +GP+ FTPPL+IALYISG+I+  LTSEHKKE++RY+YNHQNEDGGWGLYI+GHSTMIGSA
Sbjct  121   AGPMLFTPPLLIALYISGAINTTLTSEHKKEMIRYMYNHQNEDGGWGLYIEGHSTMIGSA  180

Query  2046  LNYVALRLLGEEADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPP  1876
             L+YVALR+LGE ADD   AIAR R WIL HGGAT IPSWGK YLSVLGVYEW+GCNP+PP
Sbjct  181   LSYVALRILGEGADDGNGAIARARKWILDHGGATGIPSWGKAYLSVLGVYEWEGCNPLPP  240

Query  1875  EFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDW  1696
             EFWLFPS  P+HPAKMW YCRTTYMPMSYLY ++YHGP+T+LVLS+RNEIHVK YDQIDW
Sbjct  241   EFWLFPSILPYHPAKMWCYCRTTYMPMSYLYGRKYHGPITDLVLSLRNEIHVKSYDQIDW  300

Query  1695  NNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGAE  1516
             N  R  CCKED YYPHTF+QD+LW+ L YCTEP+M+RWP NKIR+ A+ K I +MRYGAE
Sbjct  301   NKARHHCCKEDVYYPHTFVQDLLWDTLNYCTEPVMKRWPLNKIRQRALDKTIKYMRYGAE  360

Query  1515  ESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDAT  1336
             ESRYITIG +EKSLQMMCWWA D  CDE KYHLARVPD+LWLAEDGMTMQ+FGSQ WD+T
Sbjct  361   ESRYITIGCVEKSLQMMCWWAHDQKCDEFKYHLARVPDYLWLAEDGMTMQSFGSQIWDST  420

Query  1335  FATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGW  1156
              ATQA+IS+GMVEEYGDCL+KAHFY+K+SQIKENPKGDF+ MYRHF+KGAW FSDQD GW
Sbjct  421   LATQAVISTGMVEEYGDCLEKAHFYIKESQIKENPKGDFRGMYRHFTKGAWTFSDQDQGW  480

Query  1155  VVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQ  976
             VVSDCTAEA+KCLLLL QM  EI+GEK  V+  Y+AV++ LYLQS  SGGFA+WEP IPQ
Sbjct  481   VVSDCTAEALKCLLLLSQMPTEISGEKPPVERSYDAVNVLLYLQSSLSGGFAIWEPAIPQ  540

Query  975   PYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLET  796
             PYL++LNPSELFADIVV+ EHVE T SIV AL +FK  +P +R KE+  S+A+   +LE 
Sbjct  541   PYLQVLNPSELFADIVVEQEHVECTASIVQALISFKRMHPGHREKEIENSVARGVSFLEE  600

Query  795   QQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGEC  616
             +Q  DGSWYGYWGICFLYGT F L GL AAG++YEN EA+RKA +FFLS QN+EGGWGE 
Sbjct  601   RQWHDGSWYGYWGICFLYGTFFTLGGLAAAGKTYENCEAVRKAVNFFLSWQNEEGGWGES  660

Query  615   LESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFP  436
             LESCP+MKY P EGNR+N+VQTSWAMLGLMY  QAERDPTPLH+AAKLLIN QM DGDFP
Sbjct  661   LESCPSMKYTPLEGNRTNLVQTSWAMLGLMYGGQAERDPTPLHKAAKLLINEQMSDGDFP  720

Query  435   QQ  430
             QQ
Sbjct  721   QQ  722



>gb|AHF22084.1| OSC2 [Artemisia annua]
Length=760

 Score =  1168 bits (3021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/757 (69%), Positives = 637/757 (84%), Gaps = 3/757 (0%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLK+ EG  PY++STNN+ GRQIWE+DP+AG+P E++  E AR+ F   R++G H CG
Sbjct  1     MWKLKVAEGNDPYLFSTNNFVGRQIWEFDPSAGSPVERQEVEDARQQFKNNRREGVHPCG  60

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             DL MR+Q+IKE+ +DV+SIPPVRL E E+VNY+A+TT V+KA+RLN A+QAKDGHWPAEN
Sbjct  61    DLLMRIQLIKENGIDVMSIPPVRLGENEDVNYDAVTTTVKKALRLNRAIQAKDGHWPAEN  120

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +GP+FFTPPL+IA+YISG+I+  LT EH+ E++RY+YNHQNEDGGWG YI+GHSTMIGSA
Sbjct  121   AGPMFFTPPLLIAMYISGTINTHLTKEHRTEMIRYIYNHQNEDGGWGFYIEGHSTMIGSA  180

Query  2046  LNYVALRLLGEEADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPP  1876
             L+YVALRLLGE  DD   A+ R R WIL HGGA +IPSWGK YLSVLGVYEW+GCNP+PP
Sbjct  181   LSYVALRLLGEGPDDGNGAVDRARKWILDHGGAASIPSWGKTYLSVLGVYEWEGCNPLPP  240

Query  1875  EFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDW  1696
             EFWLFP   PFHPAKMW YCRTTYMPMSYLY ++YHGP+T+LVL +R EIH  PY +I+W
Sbjct  241   EFWLFPEALPFHPAKMWCYCRTTYMPMSYLYGRKYHGPITDLVLQLRQEIHPIPYHKINW  300

Query  1695  NNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGAE  1516
             N  R  CCKED YYPH+ +QD+LW+ L Y +EPI++ WPF K+RE  +++ +  MRYGAE
Sbjct  301   NKQRHNCCKEDLYYPHSTVQDLLWDGLHYLSEPILKYWPFTKLRERGLKRAVELMRYGAE  360

Query  1515  ESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDAT  1336
             ESRY+TIG +EKSLQMMCWWAE+PN DE K+HLARVPD+LWLAEDGMTM +FGSQ WD  
Sbjct  361   ESRYMTIGCVEKSLQMMCWWAENPNGDEFKHHLARVPDYLWLAEDGMTMHSFGSQLWDCV  420

Query  1335  FATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGW  1156
              ATQA+I+S MVEE+GD LKKAHFY+K+SQIK+NP GDF  M R F+KGAW FSDQD GW
Sbjct  421   LATQAIIASDMVEEFGDSLKKAHFYIKESQIKQNPSGDFSKMCRQFTKGAWTFSDQDQGW  480

Query  1155  VVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQ  976
             VVSDCTAEA+KCLLLL QM  EI+G+K D + LYEAV++ LYLQSP SGGFA+WEPP+PQ
Sbjct  481   VVSDCTAEALKCLLLLSQMPEEISGKKADNERLYEAVNVLLYLQSPISGGFAIWEPPVPQ  540

Query  975   PYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLET  796
             PYL+MLNPSE+FADIVV+ EHVE T SI+ AL AFK  +P +R KE+ +S+AKA  +LE 
Sbjct  541   PYLQMLNPSEIFADIVVEKEHVECTSSIIKALLAFKDLHPGHREKEIEISVAKAVCFLEG  600

Query  795   QQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGEC  616
             +Q  DGSWYGYWGICFLYGT F L GL +AG++Y+NSEA+RKA +FFLS QN+EGGWGE 
Sbjct  601   KQCHDGSWYGYWGICFLYGTFFTLAGLVSAGKTYDNSEAVRKAVNFFLSTQNEEGGWGES  660

Query  615   LESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFP  436
             ++SCP+  Y P +GNR+N+VQTSWAMLGLM+  QAERDPTPLH+AAK+LINAQM+DGDFP
Sbjct  661   IKSCPSEVYTPLDGNRTNLVQTSWAMLGLMFGGQAERDPTPLHKAAKILINAQMDDGDFP  720

Query  435   QQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWI  325
             QQ+ITG YMKNCMLHYA +R+ FPL AL EYRKRVW+
Sbjct  721   QQEITGVYMKNCMLHYAEYRNIFPLWALGEYRKRVWV  757



>gb|ADM86392.1| putative beta-amyrin synthase [Bacopa monnieri]
Length=764

 Score =  1158 bits (2995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/758 (70%), Positives = 630/758 (83%), Gaps = 6/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MW+LKI EG GPY+YSTNN+ GRQ WEYDPN GT EE+EAFEKAR+ F + R+KG H C 
Sbjct  1     MWRLKIAEGQGPYLYSTNNFVGRQTWEYDPNGGTAEEREAFEKARQEFNENRKKGVHCCA  60

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             DLFMR+Q+ KES +D+L IPPVR+ E+EE+ YE  T AV KA+RLN A+QA DGHW AEN
Sbjct  61    DLFMRLQLKKESGIDLLQIPPVRVGEKEEITYETATVAVTKALRLNRAVQASDGHWSAEN  120

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
                LFFTPPL+I LYISG+I+ +LT+EHKKEL+R++YNHQNEDGGWGLYI+G STMIGSA
Sbjct  121   ---LFFTPPLIIVLYISGTINTVLTAEHKKELIRFIYNHQNEDGGWGLYIEGRSTMIGSA  177

Query  2046  LNYVALRLLGEEADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPP  1876
             ++YVALRLLGE  DD   ++ARGR WIL HGGAT IPSWGK YLSVLG Y+WDGCNP+PP
Sbjct  178   MSYVALRLLGEGPDDGNGSVARGRKWILDHGGATGIPSWGKPYLSVLGAYDWDGCNPLPP  237

Query  1875  EFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDW  1696
             E WL PS  PFHPAKMW YCRT YMPMSYLY KRYHGP+T+LVLS+R EI+VKPYDQI+W
Sbjct  238   ELWLCPSFLPFHPAKMWCYCRTAYMPMSYLYGKRYHGPITDLVLSLRQEIYVKPYDQINW  297

Query  1695  NNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGAE  1516
             N  R  CCKED YYPHTFIQD++W+AL Y +EP++ RWPFNKIR+ A+ K+I +MRYGA+
Sbjct  298   NKARHDCCKEDLYYPHTFIQDLMWDALNYVSEPVLSRWPFNKIRQRALGKIIEYMRYGAD  357

Query  1515  ESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDAT  1336
             ESRYIT G  EKSLQMMCWW+ DP  DE K HLARVPD+LWLAEDGM +Q+FGSQ WD+T
Sbjct  358   ESRYITSGNAEKSLQMMCWWSHDPKGDEFKRHLARVPDYLWLAEDGMKVQSFGSQLWDST  417

Query  1335  FATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGW  1156
              ATQA+I+SGMVEEYGDCLKKA+F++K+SQIK+NPKGDF +M+RHF+KGAW FSDQD GW
Sbjct  418   LATQAIIASGMVEEYGDCLKKANFFIKESQIKQNPKGDFHAMHRHFTKGAWTFSDQDQGW  477

Query  1155  VVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQ  976
              VSDCTAE +KCLLL+ QM  E  GE V+V+  Y+A+++ LYLQ+ ESGGFAVWEP   Q
Sbjct  478   AVSDCTAEGLKCLLLMSQMPNEARGENVEVERFYDAINVLLYLQNQESGGFAVWEPMSSQ  537

Query  975   PYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLET  796
             PYL+ LNPSELFADIVV+ EHVE T S++ AL  FKH +P +R KE+ +S+AKA  +LE 
Sbjct  538   PYLQALNPSELFADIVVEQEHVECTASVIQALVLFKHLHPSHREKEIEISVAKAVRFLEK  597

Query  795   QQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGEC  616
             +Q  DGSWYGYWGICF+YGT + L GL +AG++YENSE I+K   F LS QN+EGGWGE 
Sbjct  598   KQWPDGSWYGYWGICFVYGTFWVLRGLASAGKTYENSETIQKGVGFLLSTQNEEGGWGES  657

Query  615   LESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFP  436
             L+SCP  KY P EGNR+N+VQT+WAMLGLMY  QAERD TPL +AAKLLINAQMEDGDFP
Sbjct  658   LKSCPRTKYTPLEGNRTNLVQTAWAMLGLMYGGQAERDTTPLDKAAKLLINAQMEDGDFP  717

Query  435   QQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             QQ+ITG +MKNCMLHYA +R+ FPL ALSEYR+RVW S
Sbjct  718   QQEITGVWMKNCMLHYAQYRNIFPLWALSEYRRRVWPS  755



>gb|AAS01523.1| putative beta-amyrin synthase [Centella asiatica]
Length=760

 Score =  1149 bits (2972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/759 (69%), Positives = 633/759 (83%), Gaps = 4/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHTC  2410
             MWKLKI EG G Y+YSTNN+ GRQIWEYDP+AGTPEE+   EK R+ +       G H C
Sbjct  1     MWKLKIAEGNGAYLYSTNNFVGRQIWEYDPDAGTPEERLEVEKLRETYKYNLINNGIHPC  60

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GD+ MR+Q+IKES +D+LSIPPVRL E+EEVNY+ +TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    GDMLMRLQLIKESGLDLLSIPPVRLGEQEEVNYQVVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GP+FFTPPL+IALYISG+ID  LT +HKKE++R++Y HQN+DGGWG YI+GHSTMIGS
Sbjct  121   NAGPMFFTPPLIIALYISGAIDTHLTIQHKKEMIRFIYLHQNKDGGWGFYIEGHSTMIGS  180

Query  2049  ALNYVALRLLGEEADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             AL+YVALRLLGE  DD   A+ R R WIL HGGA +IPSWGK YL+VLGVYEW+GCNP+P
Sbjct  181   ALSYVALRLLGEGPDDGDGAVERARKWILDHGGAASIPSWGKTYLAVLGVYEWEGCNPLP  240

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEFWLFP   P+HPAKMW YCRTTYMPMSYLY K+YHGP+T+LV+S+R EIH  PY++I+
Sbjct  241   PEFWLFPEALPYHPAKMWCYCRTTYMPMSYLYGKKYHGPITDLVISLRKEIHPIPYEKIN  300

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             WN  R  C KED YYPH+FIQD+LW+ L Y TEPI++ WPFNK+R+  M++ I  MRYG 
Sbjct  301   WNKQRHNCNKEDLYYPHSFIQDLLWDGLHYFTEPIIKMWPFNKLRKKGMKRAIELMRYGG  360

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
              ESR+ITIG + KSL MMCWWAE+PN  E K+HLARVPD+LWLAEDGM MQ+FGSQ WD 
Sbjct  361   YESRFITIGCVSKSLDMMCWWAENPNGPEFKHHLARVPDYLWLAEDGMKMQSFGSQLWDC  420

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
               ATQA++S+GMV+EYGDCLKKAHFY+K+SQ K+NP GD+ SM R+F+KG+W FSDQD G
Sbjct  421   VLATQAVMSTGMVDEYGDCLKKAHFYIKESQCKKNPSGDYASMCRYFTKGSWTFSDQDQG  480

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             WVVSDCTAEA+KCLL L QM  EIAGEK DV+ LY+AV++ LYLQSP SGGFA+WEPP+P
Sbjct  481   WVVSDCTAEALKCLLALSQMPEEIAGEKADVERLYDAVNVLLYLQSPISGGFAIWEPPVP  540

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
             +PYL++LNPSE+FADIVV+ EH E T SI++AL AFK  +P +R+KE++++IAKA  +LE
Sbjct  541   RPYLQVLNPSEIFADIVVEKEHTECTASIIAALVAFKRLHPGHRSKEISVAIAKAVHFLE  600

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
              +Q  DGSWYGYWGICFLYGT FAL GL + G++YENSE +RKA  FFLS QN+EGGWGE
Sbjct  601   GKQLEDGSWYGYWGICFLYGTFFALAGLASVGQTYENSETVRKAVKFFLSTQNEEGGWGE  660

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
              LESCP+  + P EGNR+N+VQTSWAMLGLM+  QA RDPTPLHRAAKLLINAQ+ +GDF
Sbjct  661   SLESCPSEIFTPLEGNRTNLVQTSWAMLGLMFGGQATRDPTPLHRAAKLLINAQLNNGDF  720

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             PQQ+ TG YMKNCMLHYA +R+ FPL AL EYRKR+W+S
Sbjct  721   PQQETTGVYMKNCMLHYAEYRNVFPLWALGEYRKRLWLS  759



>gb|AGI15962.1| dammarenediol synthase [Panax quinquefolius]
Length=769

 Score =  1142 bits (2953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/761 (69%), Positives = 629/761 (83%), Gaps = 7/761 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2410
             MWKLK+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  EKARK +   ++  G H C
Sbjct  1     MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC  60

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              D+ MR Q+IKES +D+LSIPPVRL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPVRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  2049  ALNYVALRLLGE---EADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              L+YV LRLLGE   E+DD   A+ RGR WIL HGGA +IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSYVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAASIPSWGKTYLAVLGVYEWEGCN  240

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFWLFPS FPFHPAKMW YCR TYMPMSYLY KRYHGP+T+LVLS+R EI+  PY+
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
             QI WN  R  CCKED YYPH+ +QD++W+ L Y +EP ++RWPFNK+R+  +++V+  MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHSLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             YGA E+R+IT G  EK+LQ+M WWAEDPN DE K+HLAR+PDFLW+AEDGMT+Q+FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD   ATQA+I++ MVEEYGD LKKAHF++K+SQIKENP+GDF  M R F+KGAW FSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHG VVSDCTAEA+KCLLLL QM  +I GEK +V+ LYEAV++ LYLQS  SGGFAVWEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPEVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
             P+P+PYLEMLNPSE+FADIVV+ EH+E T S++  L AFK  +P +R KE+  S+AKA  
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG+WGICFLYGT F L G  +AGR+Y+NSEA+RK   FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE LESCP+ K+ P +GNR+N+VQTSWAMLGLM+  QAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWI  325
             GDFPQQ+ITG Y KN MLHYA +R+ FPL AL EYRKRVW+
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVWL  761



>gb|ACZ71036.1| dammarenediol synthase protein [Panax ginseng]
Length=769

 Score =  1141 bits (2951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/761 (69%), Positives = 628/761 (83%), Gaps = 7/761 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2410
             MWKLK+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  EKARK +   ++  G H C
Sbjct  1     MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC  60

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              D+ MR Q+IKES +D+LSIPP+RL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPLRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  2049  ALNYVALRLLGE---EADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              L+YV LRLLGE   E+DD   A+ RGR WIL HGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSYVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAAGIPSWGKTYLAVLGVYEWEGCN  240

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFWLFPS FPFHPAKMW YCR TYMPMSYLY KRYHGP+T+LVLS+R EI+  PY+
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
             QI WN  R  CCKED YYPHT +QD++W+ L Y +EP ++RWPFNK+R+  +++V+  MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHTLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             YGA E+R+IT G  EK+LQ+M WWAEDPN DE K+HLAR+PDFLW+AEDGMT+Q+FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD   ATQA+I++ MVEEYGD LKKAHF++K+SQIKENP+GDF  M R F+KGAW FSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHG VVSDCTAEA+KCLLLL QM  +I GEK +V+ LYEAV++ LYLQS  SGGFAVWEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPEVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
             P+P+PYLEMLNPSE+FADIVV+ EH+E T S++  L AFK  +P +R KE+  S+AKA  
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG+WGICFLYGT F L G  +AGR+Y+NSEA+RK   FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE LESCP+ K+ P +GNR+N+VQTSWAMLGLM+  QAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWI  325
             GDFPQQ+ITG Y KN MLHYA +R+ FPL AL EYRKRVW+
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVWL  761



>gb|AGK62449.1| dammarenediol-II synthase [Panax quinquefolius]
Length=769

 Score =  1140 bits (2950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/761 (69%), Positives = 628/761 (83%), Gaps = 7/761 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2410
             MWKLK+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  EKARK +   ++  G H C
Sbjct  1     MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC  60

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              D+ MR Q+IKES +D+LSIPPVRL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPVRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  2049  ALNYVALRLLGE---EADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              L+YV LRLLGE   E+DD   A+ RGR WIL HGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSYVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAAGIPSWGKTYLAVLGVYEWEGCN  240

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFWLFPS FPFHPAKMW YCR TYMPMSYLY KRYHGP+T+LVLS+R EI+  PY+
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
             QI WN  R  CCKED YYPHT +QD++W+ L Y +EP ++RWPFNK+R+  +++V+  MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHTLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVZLMR  360

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             YGA E+R+IT G  EK+LQ+M WWAEDPN DE K+HLAR+PDFLW+AEDGMT+Q+FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD   ATQA+I++ MVEEYGD LKKAHF++K+SQIKENP+GDF  M R F+KGAW FSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHG VVSDCTAEA+KCLLLL QM  +I GEK +V+ LYEAV++ LYLQS  SGGFAVWEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPEVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
             P+P+PYLEMLNPSE+FADIVV+ EH+E T S++  L AFK  +P +R KE+  S+AKA  
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG+WGICFLYGT F L G  +AGR+Y+NSEA+RK   FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE LESCP+ K+ P +GNR+N+VQTSWA+LGLM+  QAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAILGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWI  325
             GDFPQQ+ITG Y KN MLHYA +R+ FPL AL EYRKRVW+
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVWL  761



>gb|AED99864.1| DS synthase [Panax quinquefolius]
Length=769

 Score =  1140 bits (2950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/761 (69%), Positives = 628/761 (83%), Gaps = 7/761 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2410
             MWKLK+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  EKARK +   ++  G H C
Sbjct  1     MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC  60

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              D+ MR Q+IKES +D+LSIPPVRL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPVRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  2049  ALNYVALRLLGE---EADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              L+YV LRLLGE   E+DD   A+ RGR WIL HGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSYVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAAGIPSWGKTYLAVLGVYEWEGCN  240

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFWLFPS FPFHPAKMW YCR TYMPMSYLY KRYHGP+T+LVLS+R EI+  PY+
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
             QI WN  R  CCKED YYPHT +QD++W+ L Y +EP ++RWPFNK+R+  +++V+  MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHTLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             YGA E+R+IT G  EK+LQ+M WWAEDPN DE K+HLAR+PDFLW+AEDGMT+Q+FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD   ATQA+I++ MVEEYGD LKKAHF++K+SQIKENP+GDF  M R F+KGAW FSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHG VVSDCTAEA+KCLLLL QM  +I GEK +V+ LYEAV++ LYLQS  SGGFAVWEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPEVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
             P+P+PYLEMLNPSE+FADIVV+ EH+E T S++  L AFK  +P +R KE+  S+AKA  
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG+WGICFLYGT F L G  +AGR+Y+NSEA+RK   FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE LESCP+ K+ P +GNR+N+VQTSWA+LGLM+  QAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAILGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWI  325
             GDFPQQ+ITG Y KN MLHYA +R+ FPL AL EYRKRVW+
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVWL  761



>dbj|BAD15332.1| beta-amyrin synthase [Panax ginseng]
Length=769

 Score =  1140 bits (2948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/761 (68%), Positives = 627/761 (82%), Gaps = 7/761 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2410
             MWKLK+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  EKARK +   ++  G H C
Sbjct  1     MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC  60

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              D+ MR Q+IKES +D+LSIPP+RL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPLRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  2049  ALNYVALRLLGE---EADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              L+YV LRLLGE   E+DD   A+ RGR WIL HGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSYVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAAGIPSWGKTYLAVLGVYEWEGCN  240

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFWLFPS FPFHPAKMW YCR TYMPMSYLY KRYHGP+T+LVLS+R EI+  PY+
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
             QI WN  R  CCKED YYPHT +QD++W+ L Y +EP ++RWPFNK+R+  +++V+  MR
Sbjct  301   QIKWNQQRHICCKEDLYYPHTLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             YGA E+R+IT G  EK+LQ+M WWAEDPN DE K+HLAR+PDFLW+AEDGMT+Q+FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD   ATQA+I++ MVEEYGD LKK HF++K+SQIKENP+GDF  M R F+KGAW FSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKVHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHG VVSDCTAEA+KCLLLL QM  +I GEK +V+ LYEAV++ LYLQS  SGGFAVWEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPEVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
             P+P+PYLEMLNPSE+FADIVV+ EH+E T S++  L AFK  +P +R KE+  S+AKA  
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG+WGICFLYGT F L G  +AGR+Y+NSEA+RK   FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE LESCP+ K+ P +GNR+N+VQTSWAMLGLM+  QAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWI  325
             GDFPQQ+ITG Y KN MLHYA +R+ FPL AL EYRKRVW+
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVWL  761



>gb|AEO27862.1| dammarenediol synthase [Panax ginseng]
Length=769

 Score =  1138 bits (2944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/761 (68%), Positives = 627/761 (82%), Gaps = 7/761 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2410
             MWK K+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  EKARK +   ++  G H C
Sbjct  1     MWKQKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC  60

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              D+ MR Q+IKES +D+LSIPP+RL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPLRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  2049  ALNYVALRLLGE---EADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              L+YV LRLLGE   E+DD   A+ RGR WIL HGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSYVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAAGIPSWGKTYLAVLGVYEWEGCN  240

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFWLFPS FPFHPAKMW YCR TYMPMSYLY KRYHGP+T+LVLS+R EI+  PY+
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
             QI WN  R  CCKED YYPHT +QD++W+ L Y +EP ++RWPFNK+R+  +++V+  MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHTLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             YGA E+R+IT G  EK+LQ+M WWAEDPN DE K+HLAR+PDFLW+AEDGMT+Q+FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD   ATQA+I++ MVEEYGD LKKAHF++K+SQIKENP+GDF  M R F+KGAW FSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHG VVSDCTAEA+KCLLLL QM  +I GEK +V+ LYEAV++ LYLQS  SGGFAVWEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPEVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
             P+P+PYLEMLNPSE+FADIVV+ EH+E T S++  L AFK  +P +R KE+  S+AKA  
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG+WGICFLYGT F L G  +AGR+Y+NSEA+RK   FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE LESCP+ K+ P +GNR+N+VQTSWAMLGLM+  QAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWI  325
             GDFPQQ+ITG Y KN MLHYA +R+ FPL AL EYRKRVW+
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVWL  761



>gb|AIK21788.1| dammarenediol-II synthase [Panax notoginseng]
Length=769

 Score =  1138 bits (2943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/761 (68%), Positives = 627/761 (82%), Gaps = 7/761 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2410
             MWKLK+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  E ARK +   ++  G H C
Sbjct  1     MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVENARKDYVNNKKLHGVHPC  60

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              D+ MR Q+IKES +D+LSIPPVRL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPVRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  2049  ALNYVALRLLGE---EADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              L++V LRLLGE   E+DD   A+ RGR WIL HGGA +IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSFVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAASIPSWGKTYLAVLGVYEWEGCN  240

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFWLFPS FPFHPAKMW YCR TYMPMSYLY KRYHGP+T+LVLS+R EI+  PY+
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
             QI WN  R  CCKED YYPH+ +QD++W+ L Y +EP ++RWPFNK+R+  +++V+  MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHSLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             YGA E+R+IT G  EK+LQ+M WWAEDPN DE K+HLAR+PDFLW+AEDGMT+Q+FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD   ATQA+I++ MVEEYGD LKKAHF++K+SQIKENP+GDF  M R F+KGAW FSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHG VVSDCTAEA+KCLLLL QM  +I GEK  V+ LYEAV++ LYLQS  SGGFAVWEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPKVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
             P+P+PYLEMLNPSE+FADIVV+ EH+E T S++  L AFK  +P +R KE+  S+AKA  
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG+WGICFLYGT F L G  +AGR+Y+NSEA+RK   FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE LESCP+ K+ P +GNR+N+VQTSWAMLGLM+  QAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWI  325
             GDFPQQ+ITG Y KN MLHYA +R+ FPL AL EYRKRVW+
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVWL  761



>gb|AGS79229.1| dammarenediol-II synthase [Panax notoginseng]
Length=769

 Score =  1138 bits (2943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/761 (68%), Positives = 627/761 (82%), Gaps = 7/761 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2410
             MWKLK+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  E ARK +   ++  G H C
Sbjct  1     MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVENARKDYVNNKKLHGIHPC  60

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              D+ MR Q+IKES +D+LSIPPVRL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPVRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  2049  ALNYVALRLLGE---EADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              L++V LRLLGE   E+DD   A+ RGR WIL HGGA +IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSFVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAASIPSWGKTYLAVLGVYEWEGCN  240

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFWLFPS FPFHPAKMW YCR TYMPMSYLY KRYHGP+T+LVLS+R EI+  PY+
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
             QI WN  R  CCKED YYPH+ +QD++W+ L Y +EP ++RWPFNK+R+  +++V+  MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHSLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             YGA E+R+IT G  EK+LQ+M WWAEDPN DE K+HLAR+PDFLW+AEDGMT+Q+FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD   ATQA+I++ MVEEYGD LKKAHF++K+SQIKENP+GDF  M R F+KGAW FSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHG VVSDCTAEA+KCLLLL QM  +I GEK  V+ LYEAV++ LYLQS  SGGFAVWEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPKVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
             P+P+PYLEMLNPSE+FADIVV+ EH+E T S++  L AFK  +P +R KE+  S+AKA  
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG+WGICFLYGT F L G  +AGR+Y+NSEA+RK   FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE LESCP+ K+ P +GNR+N+VQTSWAMLGLM+  QAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWI  325
             GDFPQQ+ITG Y KN MLHYA +R+ FPL AL EYRKRVW+
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVWL  761



>gb|AGS16975.1| dammarenediol synthase II [Panax vietnamensis]
Length=769

 Score =  1136 bits (2938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/761 (69%), Positives = 624/761 (82%), Gaps = 7/761 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2410
             MWKLK+ +G  PY+YSTNN+ GRQ WE+ P AGTPEE+E  EKARK +   ++  G H C
Sbjct  1     MWKLKVAQGNDPYLYSTNNFVGRQYWEFLPEAGTPEEREEVEKARKDYVNNKKLHGIHPC  60

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              D+ MR Q+IKES +D+LSIPPVRL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPVRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             NSG L +TPPL+IALYISG+ID  LT +HKKEL+RY+YNHQNEDGGWG YI+G STMIGS
Sbjct  121   NSGSLLYTPPLIIALYISGTIDTTLTKQHKKELIRYVYNHQNEDGGWGSYIEGSSTMIGS  180

Query  2049  ALNYVALRLLGE---EADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              L+YV LRLLGE   E+DD   A+ RGR WIL HGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSYVMLRLLGEGSAESDDGNGAVERGRKWILDHGGAAGIPSWGKTYLAVLGVYEWEGCN  240

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFWLFPS FPFHPAKMW YCR TYMPMSYLY KRYHGP+T+LVLS+R EI+  PY+
Sbjct  241   PLPPEFWLFPSFFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
             QI WN  R  CCKED YYPHT +QD++W+ L Y +EP ++RWPFNK+R+  +++V+  MR
Sbjct  301   QIKWNLQRHNCCKEDLYYPHTLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             YGA E+R+IT G  EK+LQ+M WWAEDPN DE K+HLARVPDFLW+AEDGMT+Q+FGSQ 
Sbjct  361   YGATETRFITTGCGEKALQIMSWWAEDPNGDEFKHHLARVPDFLWIAEDGMTVQSFGSQL  420

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD   ATQA+I++ MVEEYGD LKKAHFY+K+SQIKENP+GDF  M R F+KGAW FSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFYIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHG VVSDCTAEA+KCLLLL QM  +I GEK +V+ LYEAV++ LYLQS  SGGFAVWEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPEVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
             P+P+PYLEMLNPSE+FADIVV+ EH+E T S++  L AFK  +P +R KE+  S+ KA  
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIENSVVKAIC  600

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG+WGICFLYGT F L G  +AGR+Y+NSEA+RK   FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE LESCP+ K+ P +GNR+N+VQTSWAMLGLM+  QAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWI  325
             GDFPQQ+ITG Y KN MLHYA +R+ FPL AL EYRKRVW+
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVWL  761



>sp|Q08IT1.1|DADIS_PANGI RecName: Full=Dammarenediol II synthase [Panax ginseng]
 dbj|BAF33291.1| dammarenediol-II synthase [Panax ginseng]
Length=769

 Score =  1135 bits (2937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/761 (68%), Positives = 626/761 (82%), Gaps = 7/761 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2410
             MWK K  +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  EKARK +   ++  G H C
Sbjct  1     MWKQKGAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC  60

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              D+ MR Q+IKES +D+LSIPP+RL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPLRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  2049  ALNYVALRLLGE---EADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              L+YV LRLLGE   E+DD   A+ RGR WIL HGGA  IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSYVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAAGIPSWGKTYLAVLGVYEWEGCN  240

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFWLFPS FPFHPAKMW YCR TYMPMSYLY KRYHGP+T+LVLS+R EI+  PY+
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
             QI WN  R  CCKED YYPHT +QD++W+ L Y +EP ++RWPFNK+R+  +++V+  MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHTLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             YGA E+R+IT G  EK+LQ+M WWAEDPN DE K+HLAR+PDFLW+AEDGMT+Q+FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD   ATQA+I++ MVEEYGD LKKAHF++K+SQIKENP+GDF  M R F+KGAW FSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHG VVSDCTAEA+KCLLLL QM  +I GEK +V+ LYEAV++ LYLQS  SGGFAVWEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPEVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
             P+P+PYLEMLNPSE+FADIVV+ EH+E T S++  L AFK  +P +R KE+  S+AKA  
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG+WGICFLYGT F L G  +AGR+Y+NSEA+RK   FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE LESCP+ K+ P +GNR+N+VQTSWAMLGLM+  QAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWI  325
             GDFPQQ+ITG Y KN MLHYA +R+ FPL AL EYRKRVW+
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVWL  761



>gb|AED99865.1| DS synthase [Panax notoginseng]
Length=769

 Score =  1135 bits (2936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/761 (68%), Positives = 626/761 (82%), Gaps = 7/761 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2410
             MWKLK+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  E ARK +   ++  G H C
Sbjct  1     MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVENARKDYVNNKKLHGXHPC  60

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              D+ MR Q+IKES +D+LSIPPVRL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPVRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  2049  ALNYVALRLLGE---EADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              L++V LRLLGE   E+DD   A+ RGR WIL HGGA +IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSFVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAASIPSWGKTYLAVLGVYEWEGCN  240

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFWLFPS FPFHPAKMW YCR TYMPMSYLY KRYHGP+T+LVLS+R EI+  PY+
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
             QI WN  R  CCKED YYPH+ +QD++W+ L Y +EP ++RWPFNK+R+  +++V+  MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHSLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             YGA E+R+IT G  EK+LQ+M WWAEDPN DE K+HLAR+PDFLW+AEDGMT+Q+FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD   ATQA+I++ MVEEYGD LKKAHF++K+SQIKENP+GDF  M R F+KGAW FSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DH  VVSDCTAEA+KCLLLL QM  +I GEK  V+ LYEAV++ LYLQS  SGGFAVWEP
Sbjct  481   DHXCVVSDCTAEALKCLLLLSQMPQDIVGEKPKVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
             P+P+PYLEMLNPSE+FADIVV+ EH+E T S++  L AFK  +P +R KE+  S+AKA  
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG+WGICFLYGT F L G  +AGR+Y+NSEA+RK   FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGTFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE LESCP+ K+ P +GNR+N+VQTSWAMLGLM+  QAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWI  325
             GDFPQQ+ITG Y KN MLHYA +R+ FPL AL EYRKRVW+
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVWL  761



>gb|AGI19258.1| dammarenediol synthase [Panax notoginseng]
Length=769

 Score =  1134 bits (2932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/761 (68%), Positives = 625/761 (82%), Gaps = 7/761 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ-KGPHTC  2410
             MWK K+ +G  PY+YSTNN+ GRQ WE+ P+AGTPEE+E  E ARK +   ++  G H C
Sbjct  1     MWKQKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVENARKDYVNNKKLHGVHPC  60

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              D+ MR Q+IKES +D+LSIPPVRL E E+VNY+A+TTAV+KA+RLN A+QA DGHWPAE
Sbjct  61    SDMLMRRQLIKESGIDLLSIPPVRLDENEQVNYDAVTTAVKKALRLNRAIQAHDGHWPAE  120

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+G L +TPPL+IALYISG+ID ILT +HKKEL+R++YNHQNEDGGWG YI+GHSTMIGS
Sbjct  121   NAGSLLYTPPLIIALYISGTIDTILTKQHKKELIRFVYNHQNEDGGWGSYIEGHSTMIGS  180

Query  2049  ALNYVALRLLGE---EADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              L++V LRLLGE   E+DD   A+ RGR WIL HGGA +IPSWGK YL+VLGVYEW+GCN
Sbjct  181   VLSFVMLRLLGEGLAESDDGNGAVERGRKWILDHGGAASIPSWGKTYLAVLGVYEWEGCN  240

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFWLFPS FPFHPAKMW YCR TYMPMSYLY KRYHGP+T+LVLS+R EI+  PY+
Sbjct  241   PLPPEFWLFPSSFPFHPAKMWIYCRCTYMPMSYLYGKRYHGPITDLVLSLRQEIYNIPYE  300

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
             QI WN  R  CCKED YYPH+ +QD++W+ L Y +EP ++RWPFNK+R+  +++V+  MR
Sbjct  301   QIKWNQQRHNCCKEDLYYPHSLVQDLVWDGLHYFSEPFLKRWPFNKLRKRGLKRVVELMR  360

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             YGA E+R+IT G  EK+LQ+M WWAEDPN DE K+HLAR+PDFLW+AEDGMT+Q+FGSQ 
Sbjct  361   YGATETRFITTGNGEKALQIMSWWAEDPNGDEFKHHLARIPDFLWIAEDGMTVQSFGSQL  420

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD   ATQA+I++ MVEEYGD LKKAHF++K+SQIKENP+GDF  M R F+KGAW FSDQ
Sbjct  421   WDCILATQAIIATNMVEEYGDSLKKAHFFIKESQIKENPRGDFLKMCRQFTKGAWTFSDQ  480

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHG VVSDCTAEA+KCLLLL QM  +I GEK  V+ LYEAV++ LYLQS  SGGFAVWEP
Sbjct  481   DHGCVVSDCTAEALKCLLLLSQMPQDIVGEKPKVERLYEAVNVLLYLQSRVSGGFAVWEP  540

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
             P+P+PYLEMLNPSE+FADIVV+ EH+E T S++  L AFK  +P +R KE+  S+AKA  
Sbjct  541   PVPKPYLEMLNPSEIFADIVVEREHIECTASVIKGLMAFKCLHPGHRQKEIEDSVAKAIR  600

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG+WGICFLYG  F L G  +AGR+Y+NSEA+RK   FFLS QN+EGG
Sbjct  601   YLERNQMPDGSWYGFWGICFLYGAFFTLSGFASAGRTYDNSEAVRKGVKFFLSTQNEEGG  660

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE LESCP+ K+ P +GNR+N+VQTSWAMLGLM+  QAERDPTPLHRAAKLLINAQM++
Sbjct  661   WGESLESCPSEKFTPLKGNRTNLVQTSWAMLGLMFGGQAERDPTPLHRAAKLLINAQMDN  720

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWI  325
             GDFPQQ+ITG Y KN MLHYA +R+ FPL AL EYRKRVW+
Sbjct  721   GDFPQQEITGVYCKNSMLHYAEYRNIFPLWALGEYRKRVWL  761



>gb|ADX01169.1| putative beta-amyrin synthase [Bacopa monnieri]
Length=643

 Score =   986 bits (2548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/634 (71%), Positives = 533/634 (84%), Gaps = 3/634 (0%)
 Frame = -3

Query  2214  FFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSALNYV  2035
             FFTPPL+I LYISG+I+ +LT+EHKKEL+R++YNHQNEDGGWGLYI+G STMIGSA++YV
Sbjct  1     FFTPPLIIVLYISGTINTVLTAEHKKELIRFIYNHQNEDGGWGLYIEGRSTMIGSAMSYV  60

Query  2034  ALRLLGEEADD---AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPPEFWL  1864
             ALRLLGE  DD   ++ARGR WIL HGGAT IPSWGK YLSVLG Y+WDGCNP+PPE WL
Sbjct  61    ALRLLGEGPDDGNGSVARGRKWILDHGGATGIPSWGKPYLSVLGAYDWDGCNPLPPELWL  120

Query  1863  FPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDWNNTR  1684
              PS  PFHPAKMW YCRT YMPMSYLY KRYHGP+T+LVLS+R EI+VKPYDQI+WN  R
Sbjct  121   CPSFLPFHPAKMWCYCRTAYMPMSYLYGKRYHGPITDLVLSLRQEIYVKPYDQINWNKAR  180

Query  1683  MACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGAEESRY  1504
               CCKED YYPHTFIQD++W+AL Y +EP++ RWPFNKIR+ A+ K+I +MRYGA+ESRY
Sbjct  181   HDCCKEDLYYPHTFIQDLMWDALNYVSEPVLSRWPFNKIRQRALGKIIEYMRYGADESRY  240

Query  1503  ITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDATFATQ  1324
             IT G  EKSLQMMCWW+ DP  DE K HLARVPD+LWLAEDGM +Q+FGSQ WD+T ATQ
Sbjct  241   ITSGNAEKSLQMMCWWSHDPKGDEFKRHLARVPDYLWLAEDGMKVQSFGSQLWDSTLATQ  300

Query  1323  ALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGWVVSD  1144
             A+I+SGMVEEYGDCLKKA+F++K+SQIK+NPKGDF +M+RHF+KGAW FSDQD GW VSD
Sbjct  301   AIIASGMVEEYGDCLKKANFFIKESQIKQNPKGDFHAMHRHFTKGAWTFSDQDQGWAVSD  360

Query  1143  CTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQPYLE  964
             CTAE +KCLLL+ QM  E  GE V+V+  Y+A+++ LYLQ+ ESGGFAVWEP   QPYL+
Sbjct  361   CTAEGLKCLLLMSQMPNEARGENVEVERFYDAINVLLYLQNQESGGFAVWEPMSSQPYLQ  420

Query  963   MLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLETQQQA  784
              LNPSELFADIVV+ EHVE T S++ AL  FKH +P +R KE+ +S+AKA  +LE +Q  
Sbjct  421   ALNPSELFADIVVEQEHVECTASVIQALVLFKHLHPSHREKEIEISVAKAVRFLEKKQWP  480

Query  783   DGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGECLESC  604
             DGSWYGYWGICF+YGT + L GL +AG++YENSE I+K   F LS QN+EGGWGE L+SC
Sbjct  481   DGSWYGYWGICFVYGTFWVLRGLASAGKTYENSETIQKGVGFLLSTQNEEGGWGESLKSC  540

Query  603   PTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFPQQDI  424
             P  KY P EGNR+N+VQT+WAMLGLMY  QAERD TPL +AAKLLINAQMEDGDFPQQ+I
Sbjct  541   PRTKYTPLEGNRTNLVQTAWAMLGLMYGGQAERDTTPLDKAAKLLINAQMEDGDFPQQEI  600

Query  423   TGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             TG +MKNCMLHYA +R+ FPL ALSEYR+RVW S
Sbjct  601   TGVWMKNCMLHYAQYRNIFPLWALSEYRRRVWPS  634



>ref|XP_010245756.1| PREDICTED: beta-amyrin synthase-like [Nelumbo nucifera]
Length=763

 Score =   975 bits (2520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/757 (58%), Positives = 575/757 (76%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MW+LKIG+GG PY+YSTNNY GRQIWE+DP+ GTPE++   E AR+ F   R +     G
Sbjct  1     MWRLKIGQGGDPYLYSTNNYVGRQIWEFDPDYGTPEQRAQVETARQEFRNNR-RSVKPSG  59

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             D+ +R Q++KE+   V +IPPV++ + EE+ YEA T A+++AV+ + A+QA DGHWPAEN
Sbjct  60    DVLLRFQLLKENSF-VQTIPPVKIGDNEEITYEAATAALKRAVQFHAAIQASDGHWPAEN  118

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +GPLFF PPL+I LYI+G ++ +  +EH+KE++RY+YNHQNEDGGWGL+I+GHS M  +A
Sbjct  119   TGPLFFLPPLVICLYITGHLNTVFQAEHRKEILRYIYNHQNEDGGWGLHIEGHSIMFCTA  178

Query  2046  LNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             LNY+++R+LGE +    D A+ R R WI+ HGGAT IPSWGK +LS+LGVYEW+G NP+P
Sbjct  179   LNYISMRILGEGSEGGLDGAVPRARKWIIDHGGATMIPSWGKTWLSILGVYEWEGSNPMP  238

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T LVL +R E+H +PY +I 
Sbjct  239   PEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITLLVLQLREELHTQPYHEIK  298

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             W+ TR  C KED YYPH FIQD+LW++L + TEP++ RWPFNK+REMA++  + H+ Y  
Sbjct  299   WSRTRHICAKEDLYYPHPFIQDLLWDSLYFLTEPLLTRWPFNKLREMALKTTMKHIHYED  358

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             + SRYITIG +EK L M+  W EDPN D  K+HLAR+PD++W+AEDGM MQ+FGSQ WD 
Sbjct  359   DNSRYITIGCVEKVLCMLACWVEDPNGDAFKHHLARIPDYIWVAEDGMKMQSFGSQQWDT  418

Query  1338  TFATQALISSGM-VEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
              FA QA+++S + + E G CLKK H ++K+SQ+++NP GDF  MYRH SKG+W FSDQDH
Sbjct  419   GFAVQAIMASNLPLNEIGSCLKKGHDFIKKSQVQDNPSGDFGRMYRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +K  L+   +  E  GEK++   L+++V++ L LQS ++GG   WEP  
Sbjct  479   GWQVSDCTAEGLKACLMFSLLPQEFVGEKMEPNKLFDSVNLLLSLQS-KNGGLTAWEPAR  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
              + +LE+LNP+E FADIV++ E+VE T S + AL  F   YP +R KE+   I+KA  +L
Sbjct  538   AENWLELLNPTEFFADIVIEHEYVECTASAIQALVLFMKLYPSHREKEIENFISKAVHFL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WG+CF YGT FA+ GL AAG++Y N +A++KA HF LS Q + GGWG
Sbjct  598   EQIQMPDGSWYGNWGVCFTYGTWFAMGGLVAAGKTYFNCKAVQKAVHFLLSTQQESGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP  KYIP EG RSN+V T+WAM+GL+++ QAERD TPLHRAAKLLIN+QMEDGD
Sbjct  658   ESYLSCPNKKYIPLEGGRSNLVHTAWAMMGLIHSGQAERDATPLHRAAKLLINSQMEDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+ITG +MKNCMLHYA++R+ FPL AL EYR++V
Sbjct  718   FPQQEITGVFMKNCMLHYAAYRNIFPLWALGEYRRQV  754



>ref|XP_002269395.2| PREDICTED: beta-amyrin synthase isoform X1 [Vitis vinifera]
Length=762

 Score =   972 bits (2513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/759 (60%), Positives = 571/759 (75%), Gaps = 8/759 (1%)
 Frame = -3

Query  2595  IRKMWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GP  2419
             +R MWKLKI EG GP++YS NN+ GRQIWE+DP AGTPEE+E   K ++ FTK R +  P
Sbjct  1     MRIMWKLKIAEGHGPWLYSLNNFVGRQIWEFDPEAGTPEEREEVWKVQENFTKNRFRYKP  60

Query  2418  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2239
             +  GDL MRMQ+IKE+++D LSIPPVRL E EEV  EA+TTAVRK+VRLN A+QAKDGHW
Sbjct  61    N--GDLLMRMQLIKENQID-LSIPPVRLGENEEVTCEAVTTAVRKSVRLNRAIQAKDGHW  117

Query  2238  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  2059
             PAEN+GPLFFTPPL++ LY +G++++ LT EHK EL+RY+ NHQNEDGGWG +I+GHSTM
Sbjct  118   PAENAGPLFFTPPLIMVLYFTGTLNIALTPEHKVELLRYITNHQNEDGGWGFHIEGHSTM  177

Query  2058  IGSALNYVALRLLGEEADD-AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             +G+ LNY+++R+LG   DD A+A GR WIL  GGAT  PSWGK YLSV G+YEW GCNP+
Sbjct  178   LGTTLNYISMRVLGVGPDDKAVAAGRKWILDRGGATYSPSWGKCYLSVFGLYEWSGCNPL  237

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWLFPS  P HP KMW YCRT YMPMSYLY  R+  P+T+LV+ +R E+H +PY +I
Sbjct  238   PPEFWLFPSFLPMHPDKMWCYCRTIYMPMSYLYGTRFQAPITDLVVQLREEMHTEPYHEI  297

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +W   R+ C KED YYPH+ +QDVLW  L +  EPI++ WP +KIRE A++K I  + + 
Sbjct  298   NWAKARLLCAKEDYYYPHSLVQDVLWGGLYHFGEPILKHWPVSKIRERAVKKAIDIIHWE  357

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDP--NCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
              E SRYIT G +EK+  MM  WAE+P  N D  K+HLAR+PD+LW+AEDGM +Q+FGSQ 
Sbjct  358   DENSRYITPGCVEKAFHMMAVWAENPDSNSDVFKHHLARIPDYLWMAEDGMKVQSFGSQL  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD +   QA++ SGMVEEYG  LKK H Y+K SQ +ENP GD++S YRHFSKGAW FSD+
Sbjct  418   WDTSLCIQAILESGMVEEYGTTLKKGHDYVKLSQCQENPSGDYRSRYRHFSKGAWTFSDR  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCT+EA++ LLLL Q   E+ GEK + QCL++AV+    LQ  +SGG AVWEP
Sbjct  478   DHGWQVSDCTSEALRVLLLLSQFPKELVGEKAEPQCLFDAVNFLFSLQG-KSGGLAVWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                + +LE LNPSELFA+IV + E+VE T S +  L  FK  YP++R KEV   I KA  
Sbjct  537   AGAEEWLEKLNPSELFANIVTEHEYVECTSSAIQTLLLFKKLYPNHRRKEVDNFIEKATR  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             Y+E  Q+ +GSWYG WG+CF Y   FAL GL A G++Y NS+ +RK   F LSKQ   GG
Sbjct  597   YVENVQRPNGSWYGGWGVCFTYAAWFALSGLAAVGKTYSNSKTVRKGVDFLLSKQKANGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP M Y+  EG+R+N+VQT+W ++GL+   Q E+DPTPLH+AAKLLIN+Q++ 
Sbjct  657   WGESYLSCPDMVYVHLEGDRTNLVQTAWCLMGLIEAGQVEKDPTPLHKAAKLLINSQLDS  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQ++ITG YM NCMLHYAS+R+ FP  AL  Y +RV
Sbjct  717   GDFPQEEITGVYMNNCMLHYASYRNIFPTWALGMYHRRV  755



>ref|XP_010655672.1| PREDICTED: beta-amyrin synthase isoform X2 [Vitis vinifera]
 ref|XP_010655673.1| PREDICTED: beta-amyrin synthase isoform X2 [Vitis vinifera]
 ref|XP_010655674.1| PREDICTED: beta-amyrin synthase isoform X2 [Vitis vinifera]
 ref|XP_010655675.1| PREDICTED: beta-amyrin synthase isoform X2 [Vitis vinifera]
 emb|CBI30891.3| unnamed protein product [Vitis vinifera]
Length=759

 Score =   970 bits (2508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/756 (60%), Positives = 569/756 (75%), Gaps = 8/756 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHTC  2410
             MWKLKI EG GP++YS NN+ GRQIWE+DP AGTPEE+E   K ++ FTK R +  P+  
Sbjct  1     MWKLKIAEGHGPWLYSLNNFVGRQIWEFDPEAGTPEEREEVWKVQENFTKNRFRYKPN--  58

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL MRMQ+IKE+++D LSIPPVRL E EEV  EA+TTAVRK+VRLN A+QAKDGHWPAE
Sbjct  59    GDLLMRMQLIKENQID-LSIPPVRLGENEEVTCEAVTTAVRKSVRLNRAIQAKDGHWPAE  117

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFFTPPL++ LY +G++++ LT EHK EL+RY+ NHQNEDGGWG +I+GHSTM+G+
Sbjct  118   NAGPLFFTPPLIMVLYFTGTLNIALTPEHKVELLRYITNHQNEDGGWGFHIEGHSTMLGT  177

Query  2049  ALNYVALRLLGEEADD-AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPPE  1873
              LNY+++R+LG   DD A+A GR WIL  GGAT  PSWGK YLSV G+YEW GCNP+PPE
Sbjct  178   TLNYISMRVLGVGPDDKAVAAGRKWILDRGGATYSPSWGKCYLSVFGLYEWSGCNPLPPE  237

Query  1872  FWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDWN  1693
             FWLFPS  P HP KMW YCRT YMPMSYLY  R+  P+T+LV+ +R E+H +PY +I+W 
Sbjct  238   FWLFPSFLPMHPDKMWCYCRTIYMPMSYLYGTRFQAPITDLVVQLREEMHTEPYHEINWA  297

Query  1692  NTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGAEE  1513
               R+ C KED YYPH+ +QDVLW  L +  EPI++ WP +KIRE A++K I  + +  E 
Sbjct  298   KARLLCAKEDYYYPHSLVQDVLWGGLYHFGEPILKHWPVSKIRERAVKKAIDIIHWEDEN  357

Query  1512  SRYITIGAIEKSLQMMCWWAEDP--NCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             SRYIT G +EK+  MM  WAE+P  N D  K+HLAR+PD+LW+AEDGM +Q+FGSQ WD 
Sbjct  358   SRYITPGCVEKAFHMMAVWAENPDSNSDVFKHHLARIPDYLWMAEDGMKVQSFGSQLWDT  417

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
             +   QA++ SGMVEEYG  LKK H Y+K SQ +ENP GD++S YRHFSKGAW FSD+DHG
Sbjct  418   SLCIQAILESGMVEEYGTTLKKGHDYVKLSQCQENPSGDYRSRYRHFSKGAWTFSDRDHG  477

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCT+EA++ LLLL Q   E+ GEK + QCL++AV+    LQ  +SGG AVWEP   
Sbjct  478   WQVSDCTSEALRVLLLLSQFPKELVGEKAEPQCLFDAVNFLFSLQG-KSGGLAVWEPAGA  536

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
             + +LE LNPSELFA+IV + E+VE T S +  L  FK  YP++R KEV   I KA  Y+E
Sbjct  537   EEWLEKLNPSELFANIVTEHEYVECTSSAIQTLLLFKKLYPNHRRKEVDNFIEKATRYVE  596

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
               Q+ +GSWYG WG+CF Y   FAL GL A G++Y NS+ +RK   F LSKQ   GGWGE
Sbjct  597   NVQRPNGSWYGGWGVCFTYAAWFALSGLAAVGKTYSNSKTVRKGVDFLLSKQKANGGWGE  656

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                SCP M Y+  EG+R+N+VQT+W ++GL+   Q E+DPTPLH+AAKLLIN+Q++ GDF
Sbjct  657   SYLSCPDMVYVHLEGDRTNLVQTAWCLMGLIEAGQVEKDPTPLHKAAKLLINSQLDSGDF  716

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             PQ++ITG YM NCMLHYAS+R+ FP  AL  Y +RV
Sbjct  717   PQEEITGVYMNNCMLHYASYRNIFPTWALGMYHRRV  752



>ref|XP_002270051.2| PREDICTED: beta-amyrin synthase [Vitis vinifera]
 emb|CBI30906.3| unnamed protein product [Vitis vinifera]
Length=759

 Score =   966 bits (2498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/756 (59%), Positives = 566/756 (75%), Gaps = 8/756 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHTC  2410
             MWKLK+ EG GP++YS NN+ GRQIWE+DP AGTPEE+E   K ++ FT  R +  P+  
Sbjct  1     MWKLKVAEGHGPWLYSLNNFVGRQIWEFDPEAGTPEEREEVRKVQENFTTNRFRYKPN--  58

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL MRMQ+IKE+++D LSIPPVRL E EEV YEA+TTAVRK+VRLN A+QAKDGHWPAE
Sbjct  59    GDLLMRMQLIKENKID-LSIPPVRLGENEEVTYEAVTTAVRKSVRLNRAIQAKDGHWPAE  117

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFFTPPL++ LY +G++++ LT EHK EL+RY+ NHQNEDGGWG +I+GHSTM+G+
Sbjct  118   NTGPLFFTPPLIMVLYFTGTLNIALTPEHKVELLRYITNHQNEDGGWGFHIEGHSTMLGT  177

Query  2049  ALNYVALRLLGEEADD-AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPPE  1873
              LNY+++R+LG   DD A+A GR WI+  GGAT  PSWGK YLSV G+YEW GCNP+PPE
Sbjct  178   TLNYISMRILGVGPDDKAVAAGRKWIVDRGGATHSPSWGKCYLSVFGLYEWSGCNPLPPE  237

Query  1872  FWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDWN  1693
             FWLFPS  P HP KMW YCRT YMPMSYLY  R+  P+T+LVL +R E+H +PY +I+W 
Sbjct  238   FWLFPSFLPMHPDKMWCYCRTIYMPMSYLYGTRFQAPITDLVLQLREEMHTEPYHEINWA  297

Query  1692  NTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGAEE  1513
               R+ C KED YYPH+ IQDVLW  L +  EPI++ WP +KIRE A++K I  + +  E 
Sbjct  298   KARLLCAKEDYYYPHSLIQDVLWGGLYHFGEPILKHWPVSKIRERAVKKAIDIIHWEDEN  357

Query  1512  SRYITIGAIEKSLQMMCWWAEDP--NCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             SRYIT G +EK+  MM  WAE+P  N D  K+HLAR+PD+LW+AEDGM +Q+FGSQ WD 
Sbjct  358   SRYITPGCVEKAFHMMAVWAENPDSNSDAFKHHLARIPDYLWMAEDGMKVQSFGSQLWDT  417

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
             +   QA++ SGMVEEYG  LKK H Y+K SQ +ENP GD++S YRHFSKGAW FSD+DHG
Sbjct  418   SLCIQAILESGMVEEYGTTLKKGHDYVKLSQCQENPSGDYRSRYRHFSKGAWTFSDRDHG  477

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCT+EA++ LLLL Q   E+ GEK + Q L++AV+    LQ  +SGG AVWEP   
Sbjct  478   WQVSDCTSEALRVLLLLSQFPKELVGEKAEPQRLFDAVNFLFSLQG-KSGGVAVWEPAGA  536

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
             + +LE LNPSELFA+IV + E+VE T S +  L  FK  YP++R KEV     KA  Y+E
Sbjct  537   EEWLEKLNPSELFANIVTEHEYVECTSSTIQTLLLFKKLYPNHRRKEVDNFTEKATRYVE  596

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
               Q+ DGSWYG WG+CF Y   FAL GL A G++Y NS+ +RK   F LSKQ   GGWGE
Sbjct  597   NVQRPDGSWYGGWGVCFTYAAWFALSGLAAVGKTYSNSKTVRKGVDFLLSKQKANGGWGE  656

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                SCP M Y+  EG+ +N+VQT+W ++GL+   Q E DPTPLH+AAKLLIN+Q+++GDF
Sbjct  657   SYLSCPDMVYVHLEGDHTNLVQTAWCLMGLIEAGQVESDPTPLHKAAKLLINSQLDNGDF  716

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             PQ+++TG YM NCM HYAS+R+ FP  AL  YR+RV
Sbjct  717   PQEEVTGVYMNNCMQHYASYRNIFPTWALGMYRRRV  752



>gb|AHF49822.1| bAS [Maesa lanceolata]
Length=760

 Score =   958 bits (2476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/759 (57%), Positives = 568/759 (75%), Gaps = 10/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPY---IYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2416
             MW+LK+ EGGGPY   +YSTNN+ GRQIWE++P+ GTPEE++  EKAR  FT+ R +   
Sbjct  1     MWRLKVAEGGGPYEPYLYSTNNFVGRQIWEFNPDYGTPEERDEVEKARTHFTENRSRVKP  60

Query  2415  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2236
             + GD+ +R+ ++KE+     +IP V++ + EE+ YEA  T +++A+    A+QA DGHWP
Sbjct  61    S-GDVLLRLHLLKENNFQQ-TIPQVKVGDNEEITYEAANTTLKRAMHFFSAMQASDGHWP  118

Query  2235  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  2056
             AEN+GPL+F PPL++ALYI+G +D+I  SEHKKE++RY+YNHQN DGGWG +I+GHS M 
Sbjct  119   AENAGPLYFLPPLVMALYITGHLDIIFPSEHKKEILRYIYNHQNGDGGWGFHIEGHSIMF  178

Query  2055  GSALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              + L+Y+ +R+LG+      ++A+ RGR WI  HGG  A+PSWGK +LS+ G+++W GCN
Sbjct  179   CTVLSYICMRILGDGPFGGRNNAVERGRKWIHDHGGVVALPSWGKTWLSIFGLFDWSGCN  238

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFW+ P + P HPAKMW YCR  YMPMSYLY KR+ GP+T+LVL +R E+H + Y+
Sbjct  239   PMPPEFWILPPYLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITDLVLQLRKELHSQSYE  298

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
              I+W   R  CCKED YYPH  +QD+LW++L   TEP++ RWPFNK+RE A++K I ++ 
Sbjct  299   TINWKKYRHVCCKEDLYYPHPMLQDLLWDSLYILTEPLLMRWPFNKLREKALKKTIDYIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  WAE+PN D  K HLAR+PD++W+AEDG+ MQ+FGSQ 
Sbjct  359   YEDENSRYITIGCVEKVLCMLSCWAEEPNSDYFKKHLARIPDYIWVAEDGIKMQSFGSQQ  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FATQA+++  M+EE    LKK H Y+K+SQ+K+NP GDFK M+RH SKG+W FSDQ
Sbjct  419   WDTGFATQAVLACNMIEETSAVLKKGHDYIKKSQVKDNPSGDFKKMFRHISKGSWTFSDQ  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC L+L Q+ PE+ GEK D Q LYEAV++ L LQS ++GG A WEP
Sbjct  479   DHGWQVSDCTAEGLKCCLMLSQLPPELVGEKHDPQLLYEAVNVILSLQS-KTGGIAAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LE+LNP+E FADIV++ E+VE T + + A   FK  YP +R KE+   I KA  
Sbjct  538   VKAGAWLELLNPTEFFADIVIEHEYVECTAASIQAFVLFKKLYPGHRTKEIDAFIIKAIG  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             +L+  Q  DGSWYG WG+CF YGT FAL G  AAG++Y N EA+RK   F LS Q   GG
Sbjct  598   FLQDIQMPDGSWYGNWGVCFTYGTWFALGGFAAAGKNYNNCEAVRKGVEFLLSSQRDNGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  KY+P E NRSN+V TSWAM+GL++T QAERDPTPLHRAAKLLIN+Q E+
Sbjct  658   WGESYLSCPLKKYVPLEDNRSNLVHTSWAMMGLIHTGQAERDPTPLHRAAKLLINSQFEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYR +V
Sbjct  718   GDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRNKV  756



>emb|CDP08999.1| unnamed protein product [Coffea canephora]
Length=759

 Score =   955 bits (2469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/758 (58%), Positives = 566/758 (75%), Gaps = 10/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LK+ EG   PY+YSTNN+ GRQIWE+DPN G+PEE+E  E AR  F   R Q  P  
Sbjct  1     MWRLKVAEGDNSPYLYSTNNFVGRQIWEFDPNGGSPEEREEVENARVQFWNNRYQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E      SIP V++ + +E+ +E  T A+R+AV    ALQA DGHWPA
Sbjct  59    SADLLWRMQFLREKNFKQ-SIPQVKVEDGQEITHEVATVALRRAVHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++ LYI+G ++ I  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCLYITGHLNSIFPAEHQKEILRYIYCHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +AL+Y+ +R+LGE  D    +A +R R WIL HG ATA+PSWGK +L++LG+++W G NP
Sbjct  178   TALSYICMRILGEGPDGGLNNACSRARKWILDHGSATAMPSWGKTWLAILGLFDWSGTNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PYDQ
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAEPYDQ  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             IDW   R  C KED YYPH  IQD++W++L  C EP++  WPFNK+RE A++  + H+ Y
Sbjct  298   IDWRKVRHVCAKEDLYYPHPLIQDLIWDSLYICAEPLLTHWPFNKLRERALQTTMKHIHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLAR+PD++W+AEDGM MQ+FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGMKMQSFGSQEW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  FA QAL++S + EE  + L+K H ++K+SQ+ +NP GDF+SM+RH SKG+W FSDQD
Sbjct  418   DTAFALQALLASDLTEEIEETLRKGHDFVKKSQVTDNPSGDFRSMHRHISKGSWTFSDQD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LL   M PEI GEK++ + LY+AV+I LYLQS ++GG + WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSTMPPEIVGEKLEPERLYDAVNILLYLQS-KNGGLSAWEPA  536

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               Q +LE+LNP+E FADIVV+ E+VE T S + AL  FK  YP +R KE+   I  A++Y
Sbjct  537   GAQKWLELLNPTEFFADIVVEHEYVECTSSAIHALILFKKLYPGHRKKEIESFITNASKY  596

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q  DGSWYG WG+CF YGT FAL GL AAG++Y+N +A+RKA  F L  Q  +GGW
Sbjct  597   LEDVQMPDGSWYGNWGVCFTYGTWFALGGLAAAGKTYDNCQAVRKAVEFLLKSQRNDGGW  656

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  KY+P EG +SN+V T+WAM+GL+++ QA+RDP PLHRAAKLLIN+QME+G
Sbjct  657   GESYRSCPEKKYVPLEGEQSNLVHTAWAMMGLIHSGQADRDPRPLHRAAKLLINSQMENG  716

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  717   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKRV  754



>ref|XP_010245746.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Nelumbo nucifera]
Length=762

 Score =   952 bits (2462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/757 (57%), Positives = 561/757 (74%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MW+LKI +GGGPYIYSTNNY GRQ WE+DPN  T EE+   EKAR+ F K R        
Sbjct  1     MWRLKIAQGGGPYIYSTNNYVGRQTWEFDPNYYTEEERAKVEKAREEFRKNRHH-VKPSA  59

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             D+ +R+Q++KE+   V +IPP ++ + E++ YEA T  +R+A++   A+QA DGHWP+E 
Sbjct  60    DVLLRLQLLKENNF-VQTIPPAKIGDNEDITYEAATATLRRALQYYGAIQASDGHWPSEI  118

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +G LFF PPL++ LYI+G ++ +  +EH+KE++RY+YNHQNEDGGWGL+I+GHSTM  + 
Sbjct  119   AGALFFLPPLVMCLYITGHLNTVFQAEHRKEILRYIYNHQNEDGGWGLHIEGHSTMFCTT  178

Query  2046  LNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             LNY+ +R+LGE      D A+ R R WIL HGGAT IPSWGK +LS+LGVYEW+G NP+P
Sbjct  179   LNYICMRILGEGPEGGLDGAVPRSRKWILDHGGATMIPSWGKTWLSILGVYEWEGSNPMP  238

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T LVL +R E+H +PY++I 
Sbjct  239   PEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLVLQLREELHTQPYNEIK  298

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             W+ TR  C KED YYPH FIQD+LW++L +  EP++ RWPFNK+REMA++  + H+ Y  
Sbjct  299   WSRTRHICAKEDLYYPHPFIQDMLWDSLYFLIEPLLTRWPFNKLREMALKTTMKHIHYED  358

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             E SRYIT G IEK L M+  W EDPN D  K+HLAR+PD++W+AEDGM MQ+ GSQ WD 
Sbjct  359   ENSRYITTGCIEKVLHMLACWVEDPNGDAFKHHLARIPDYIWVAEDGMKMQSLGSQQWDT  418

Query  1338  TFATQALISSGM-VEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
              FA QA+++S + + E G CLKK H ++K+SQI++NP GDF+SMYRH +KGAW  SDQD+
Sbjct  419   GFAVQAIMASNLPLNEIGSCLKKGHDFIKKSQIRDNPSGDFQSMYRHITKGAWPLSDQDN  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +K  L+   M PE+ GEK+  + L+++VD+ L LQS  +GG   WEP  
Sbjct  479   GWQVSDCTAEGLKACLMFSLMPPEVVGEKMKSEYLFDSVDLLLTLQS-NNGGVTAWEPAK  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
              Q +LE+LNP+ELF DIV++ EHVE TGS + ALA F   YP YR  E+   I+KA  +L
Sbjct  538   GQNWLELLNPTELFEDIVLEHEHVECTGSAIQALALFMKLYPKYRRNEIESFISKAVHFL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG+WGICF Y T FA+ GL A  ++Y N +A+RKA  F LS Q + GGWG
Sbjct  598   EQTQMPDGSWYGFWGICFTYATWFAVRGLAAVDKTYFNCQAVRKAVDFLLSSQQESGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP  KY P E  RSN+VQT+WAM+GLM+  QAERD TPLHRAAKLLIN+Q+E+GD
Sbjct  658   ESYLSCPNKKYTPLENGRSNLVQTAWAMMGLMHAGQAERDATPLHRAAKLLINSQLENGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ++TG + KNCMLHY+S+++ FPL AL EYR+R+
Sbjct  718   FPQQELTGVFCKNCMLHYSSYKNIFPLWALGEYRRRL  754



>ref|XP_010245749.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Nelumbo nucifera]
Length=763

 Score =   950 bits (2455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/757 (57%), Positives = 568/757 (75%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MW+LKI +GGGPY+YSTNNY GRQ WE++P+ GT EE+   EKAR  FTK R       G
Sbjct  1     MWRLKIAQGGGPYMYSTNNYVGRQTWEFNPDYGTSEERAEVEKARDEFTKNRH-CVKPSG  59

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             D+ +R+Q++KE+   + +IPPVR+ E+EE++YEA T A+++AV+ + ALQA DGHWPAEN
Sbjct  60    DVLLRLQLLKENNF-IQTIPPVRIGEDEEISYEAATAALKRAVQFHSALQASDGHWPAEN  118

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             SG  FF PP+++ LYI+G ++ + T E++KE++RY+YNHQNEDGGWGL+I+GHS M  + 
Sbjct  119   SGCPFFLPPMVMCLYITGDLNKVFTEEYRKEILRYIYNHQNEDGGWGLHIEGHSIMFSTV  178

Query  2046  LNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             LNY+++R+LGE      D A+ R R WI  HGGAT+IPSWGK +LS+ GVYEW+G NP+P
Sbjct  179   LNYISMRILGEGPEGGRDRAVPRARKWIHDHGGATSIPSWGKTWLSIFGVYEWEGSNPMP  238

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEFWL PS FP  P K+W YCR TYMPM YLY KR+ GP+T L+L +R EIH +PY +I 
Sbjct  239   PEFWLLPSFFPLSPEKLWCYCRMTYMPMCYLYGKRFVGPITPLILQLREEIHTQPYHKIK  298

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             W+ TR  C KED YYPH FIQD+LW+ L   TEP++ RWPFNK+RE A+++ + H+ Y  
Sbjct  299   WSRTRHMCAKEDLYYPHPFIQDLLWDTLYILTEPLLTRWPFNKLRERALKQTMKHIHYED  358

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             E SRYITIG +EK L M+  W EDPN D  KYHL R+PD++W+AEDGM MQ++GSQ WD 
Sbjct  359   ENSRYITIGCVEKPLFMLACWVEDPNGDAYKYHLERIPDYIWVAEDGMKMQSYGSQLWDT  418

Query  1338  TFATQALISSGM-VEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             +FA QA+++S +  +E G CLKK H YLK SQ++ENP GDFK M+RH SKG+W FSDQDH
Sbjct  419   SFAIQAIMASNLSFDEIGLCLKKGHDYLKNSQVRENPSGDFKRMFRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW +SDCTAEA+K  L+   M PEI GEK++ +CL++AV++ L LQS ++GG A WEP  
Sbjct  479   GWQISDCTAEALKACLMFSLMPPEIVGEKMEKECLFDAVNVLLSLQS-QNGGLACWEPAR  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
              + +LE+ NP+E F++IV++ E++E T S + AL  FK  YP++R KEV   I+K+  Y+
Sbjct  538   SENWLELFNPTEFFSNIVIEHEYIECTASAIQALVLFKKLYPNHRKKEVESFISKSVHYI  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  +GSWYG WGICF+Y   FAL GL A G++Y+N   +RK   F LS Q    GWG
Sbjct  598   EQIQMPNGSWYGNWGICFIYSAWFALGGLAAVGKTYDNCPTVRKCVDFLLSTQKDSCGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP ++Y P +G ++N+VQT+WA++GL++  QAERD TPLHRAAKLLIN+QME+GD
Sbjct  658   ESYLSCPNVEYTPLKGEKTNLVQTAWALMGLIHAGQAERDATPLHRAAKLLINSQMENGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQ++ITG ++KNCM+HYA++R+ FPL AL EYR RV
Sbjct  718   FPQEEITGVFLKNCMIHYAAYRNIFPLWALGEYRARV  754



>sp|E2IUA9.1|LUPS_KALDA RecName: Full=Lupeol synthase; Short=KdLUS [Kalanchoe daigremontiana]
 gb|ADK35126.1| lupeol synthase [Kalanchoe daigremontiana]
Length=765

 Score =   947 bits (2449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/759 (57%), Positives = 559/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHT  2413
             MWKLKI +GG  PYI++TNN+ GRQIWE+DP A  P++    E AR  F   R K  P++
Sbjct  1     MWKLKIADGGSNPYIFTTNNFVGRQIWEFDPQATDPQQLAKVEAARLDFYHNRYKLKPNS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E      +IP V++ + EEV+YEA+T A+R+ V L  ALQA DGHWPA
Sbjct  61    --DLLWRMQFLEEKAF-TQTIPQVKVEDGEEVSYEAVTAALRRGVHLYSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GP+FF PP+++ LYI+G ++ I T EH+ E +RY+Y HQNEDGGWG +I+GHSTM G
Sbjct  118   ENAGPMFFMPPMVMCLYITGHLNAIFTEEHRSETLRYIYYHQNEDGGWGFHIEGHSTMFG  177

Query  2052  SALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + LNY+ +RLLGE      D+A++RGR WIL HGGAT+IPSWGK +LS++G+ +W GCNP
Sbjct  178   TVLNYICMRLLGEGPEGGQDNAVSRGRKWILDHGGATSIPSWGKTWLSIMGLCDWSGCNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFWL PS+ P HP KMW YCR  YMPMSYLY KR+   +T L+L +R EIH++PYDQ
Sbjct  238   MPPEFWLLPSYLPMHPGKMWCYCRMVYMPMSYLYGKRFTARITPLILQLREEIHIQPYDQ  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             IDW   R  CCKED YYPH  +QD+LW+ L   TEP++ RWP NK IR+ A++  + H+ 
Sbjct  298   IDWKKVRHVCCKEDMYYPHPLLQDLLWDTLYLTTEPLLTRWPLNKLIRKRALQTTMKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ+
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWIAEDGMKMQSFGSQH  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  F+ QAL++S M EE G  L K H ++K+SQ+K+NP GDFK MYRH SKGAW FSDQ
Sbjct  418   WDTAFSIQALLASNMAEEIGITLAKGHDFIKKSQVKDNPSGDFKGMYRHISKGAWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LL   M PE+ GE +  + LY +V++ L LQS ++GG   WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLFSMMQPEVVGESMAPESLYNSVNVLLSLQS-QNGGLPAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LE+LNP+E F +IV++ E+VE T S V AL  FK  YP +R KEV   I   A+
Sbjct  537   AGAPEWLELLNPTEFFENIVIEHEYVECTSSAVQALVLFKKLYPLHRRKEVERFITNGAK  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG WG+CF YG  FAL GL+AAG++Y N  A+RK   F L+ Q ++GG
Sbjct  597   YLEDIQMPDGSWYGNWGVCFTYGAWFALEGLSAAGKTYNNCAAVRKGVDFLLNIQLEDGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE  +SCP  KY+P E NRSN+VQTSWA++GL+Y  QA+RDPTPLHRAA+LLIN+Q+ED
Sbjct  657   WGESYQSCPDKKYVPLEDNRSNLVQTSWALMGLIYAGQADRDPTPLHRAAQLLINSQLED  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG + +NCMLHYA++R+ FPL AL+EYR+++
Sbjct  717   GDFPQQEITGVFQRNCMLHYAAYRNIFPLWALAEYRRQI  755



>emb|CBI18407.3| unnamed protein product [Vitis vinifera]
Length=846

 Score =   946 bits (2445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/756 (58%), Positives = 558/756 (74%), Gaps = 7/756 (1%)
 Frame = -3

Query  2589  KMWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPH  2416
             KMW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   E AR+ F K R Q  P 
Sbjct  92    KMWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAARENFWKNRYQVKP-  150

Query  2415  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2236
               GDL  RMQ ++E      +IP V++ + EE+ YE  T AVR+      ALQA DGHWP
Sbjct  151   -SGDLLWRMQFLREKNFKQ-TIPQVKVGDGEEITYETATAAVRRGAHFFSALQASDGHWP  208

Query  2235  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  2056
             AEN+GPL+F PPL++ LYI+G +D +   E++KE++RYLY HQNEDGGWG +I+GHSTM 
Sbjct  209   AENAGPLYFLPPLVMCLYITGHLDTVFPGEYRKEILRYLYCHQNEDGGWGFHIEGHSTMF  268

Query  2055  GSALNYVALRLLGEEAD-DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
              + L+Y+ +R+LGE  D +A ARGR WIL  GG T+IPSWGK +LS+ G+++W G NP+P
Sbjct  269   CTTLSYICMRILGEGPDENACARGRKWILDRGGVTSIPSWGKTWLSIFGLFDWSGSNPMP  328

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEFWLFPS  P HPAKMW YCR  YMPMSYLY KR+ GP+T LVL +R E+ ++PY++I+
Sbjct  329   PEFWLFPSRLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLVLELREELFLQPYNEIN  388

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             W   R  C KED YYPH  IQD++W+ L  CTEP++ RWPFNK+R+ A+   + H+ Y  
Sbjct  389   WRKVRHLCAKEDLYYPHPLIQDLMWDGLYICTEPLLTRWPFNKLRQKALEVTMKHIHYED  448

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             E SRYITIG +EK L M+  W EDPN +  K HLAR+PD++W+ EDG+ MQ+FGSQ WD 
Sbjct  449   ENSRYITIGCVEKVLCMLSCWVEDPNGNYFKKHLARIPDYIWVGEDGIKMQSFGSQEWDT  508

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
              FA QA+++  M +E G  LKK H ++K+SQ+K+NP GDFKSMYRH SKG+W FSDQDHG
Sbjct  509   GFALQAVLACNMTDEIGPTLKKGHEFVKESQVKDNPSGDFKSMYRHISKGSWTFSDQDHG  568

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCTAE +KC LL   M PEI G K++ + L+++V+I L LQS ++GG A WEP   
Sbjct  569   WQVSDCTAEGLKCCLLFSMMPPEIVGVKMEPERLFDSVNILLSLQS-KNGGLAAWEPAGA  627

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
               +LE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+   I  AA+Y+E
Sbjct  628   SEWLELLNPTEFFADIVIEHEYVECTASAIQALVLFKKLYPGHRKKEIDNFITYAAKYIE  687

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
               Q  DGSWYG WG+CF YG+ FAL GL AAG++Y N  AIR+A  F L+ Q  +GGWGE
Sbjct  688   DIQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYHNCHAIRRAVEFLLNSQRDDGGWGE  747

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                SCP  KY P EGNRSN+V T WA++GL+ + QAERDPTPLHRAAKLLIN QMEDGDF
Sbjct  748   SYVSCPDKKYTPLEGNRSNLVHTGWALMGLISSGQAERDPTPLHRAAKLLINFQMEDGDF  807

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             PQQ+ITG +MKNCMLHYA++R+ +PL AL+EYR+RV
Sbjct  808   PQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRRRV  843



>gb|EYU38890.1| hypothetical protein MIMGU_mgv1a001796mg [Erythranthe guttata]
Length=758

 Score =   946 bits (2445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/754 (58%), Positives = 562/754 (75%), Gaps = 5/754 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EG    Y+YSTN Y GRQIWE+DPN G+PE ++  +KAR+ F   R     + 
Sbjct  1     MWRLKIAEGVDSAYLYSTNKYVGRQIWEFDPNYGSPELRQEVDKARQDFWDNRHHVKPS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  R+Q + E++    +IP V++ + E++ YE  T  +R+AV    ALQA DGHWPAE
Sbjct  60    SDLLWRIQFLHENKFKQ-TIPQVKVADGEDITYETATATLRRAVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFF PPL++ LYI+G ++ + ++EH++E++RY+Y HQNEDGGWG +I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMILYITGHLNTVFSAEHRREILRYIYCHQNEDGGWGFHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD-DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPPE  1873
             AL+Y+ +R+LGE  D +A +R R WIL HG   AIPSWGK +LS+LGV+EW G NP+PPE
Sbjct  179   ALSYICMRILGEGPDENACSRARKWILDHGTVKAIPSWGKTWLSILGVFEWSGSNPMPPE  238

Query  1872  FWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDWN  1693
             FWL PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PY++++W 
Sbjct  239   FWLLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYDQPYEEVNWK  298

Query  1692  NTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGAEE  1513
             + R  C KED YYPH  +QD++W+     TEP++ RWP NK+RE A++  + H+ Y  E 
Sbjct  299   SIRHLCAKEDLYYPHPLLQDLMWDTCYVLTEPLLTRWPLNKLREKALKVTMEHIHYEDEN  358

Query  1512  SRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDATF  1333
             SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ WD  F
Sbjct  359   SRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQWDTGF  418

Query  1332  ATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGWV  1153
             A QAL+ S M EE G+ LKK H ++K+SQ+KE+P GDF+SMYRH SKG+W FSDQDHGW 
Sbjct  419   AIQALLDSDMSEEIGETLKKGHDFVKKSQVKEDPSGDFRSMYRHISKGSWTFSDQDHGWQ  478

Query  1152  VSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQP  973
             VSDCTAE +KC LL   M PE+ GEK+  Q LY AV+I LYLQS ++GG A WEP     
Sbjct  479   VSDCTAEGLKCCLLFSMMPPELVGEKMQPQDLYNAVNILLYLQS-KNGGLAAWEPAGSSE  537

Query  972   YLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLETQ  793
             +LE+LNP+E FADIV++ E+VE T S + AL  FK  +P +R KE+   I KAA YLE  
Sbjct  538   WLELLNPTEFFADIVIEHEYVECTSSAIQALVLFKKLHPHHRKKEIETFITKAAGYLEDV  597

Query  792   QQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGECL  613
             Q+ DGSWYG WG+CF YG+ FAL GL AAG+SY N EA+RK+ +F L+ Q  +GGWGE  
Sbjct  598   QKPDGSWYGNWGVCFTYGSWFALGGLAAAGKSYNNCEAVRKSVNFLLNSQRDDGGWGESY  657

Query  612   ESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFPQ  433
              SCP  +Y+P EGNRSN+V TSWAM+GL++  QA+RDPTPLHRAAKLLIN+Q++DGDFPQ
Sbjct  658   LSCPKKEYVPLEGNRSNLVHTSWAMMGLIHAGQADRDPTPLHRAAKLLINSQLQDGDFPQ  717

Query  432   QDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             Q+ITG +MKNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  718   QEITGVFMKNCMLHYAAYRNIYPLWALAEYRKRV  751



>ref|XP_010063692.1| PREDICTED: beta-amyrin synthase [Eucalyptus grandis]
 ref|XP_010063693.1| PREDICTED: beta-amyrin synthase [Eucalyptus grandis]
 gb|KCW70922.1| hypothetical protein EUGRSUZ_F04038 [Eucalyptus grandis]
 gb|KCW70923.1| hypothetical protein EUGRSUZ_F04038 [Eucalyptus grandis]
Length=761

 Score =   944 bits (2440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/757 (58%), Positives = 560/757 (74%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EG  GPY+YSTNNY GRQIWE+DP AGT EE+   E AR+ F   R +    C
Sbjct  1     MWRLKIAEGEDGPYLYSTNNYVGRQIWEFDPEAGTAEERAEVEAARQHFYDHRHQ-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  RMQ ++E E    +IPPVR+ + EE+ Y+  +TA+++AV    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREKEFKQ-TIPPVRVEDGEEITYDKASTALKRAVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFF PPL++ +YI+G +D +  +EH+KE++RY+YNHQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCVYITGHLDAVFPAEHRKEILRYIYNHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE      D+A AR R WI   GG T IPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGPDGGKDNACARARKWIHDRGGVTYIPSWGKTWLSILGVFEWTGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY K++ GP+T LV  +R E+H +PYD I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKKFVGPITPLVQQLREELHTQPYDTI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
              W   R  C KED YYPH  IQD++W++L  CTEP + RWP NK+RE A++  + H+ Y 
Sbjct  299   CWRKVRHLCAKEDLYYPHPLIQDLMWDSLYICTEPFLNRWPLNKLREKALQVTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDP+ D  K HLAR+PD+LW+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPDGDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
               FA QAL++S M EE    L + H ++K+SQ+K+NP GDFKSM+RH SKG+W FSDQDH
Sbjct  419   TGFAIQALLASNMTEEIAPVLARGHDFIKKSQVKDNPSGDFKSMHRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +KC LL   M PEI GEK++ + LY++V+I L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLFSMMPPEIVGEKMEPERLYDSVNILLSLQS-KNGGLAAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
              Q +LE+LNP+E FADIVV+ E+VE T S + AL  F+  YP +R KE+   +  A ++L
Sbjct  538   AQEWLEILNPTEFFADIVVEHEYVECTSSAIHALVMFRKLYPGHRKKEIENFLVNAVQFL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WG+CF YG+ FAL GL AAG++Y N  A+RK   F L  Q Q+GGWG
Sbjct  598   ENIQNPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYSNCAAMRKGVAFLLQTQLQDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP  +Y+P EGNRSN+V T+WAM+GL++  Q ERDPTPLHRAAKLLIN+QMEDGD
Sbjct  658   ESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIHAGQTERDPTPLHRAAKLLINSQMEDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             +PQQ+ITG +MKNCMLHYA++R+ +PL AL+EYR+RV
Sbjct  718   YPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRRRV  754



>ref|XP_011093795.1| PREDICTED: beta-amyrin synthase [Sesamum indicum]
Length=763

 Score =   944 bits (2439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/758 (58%), Positives = 561/758 (74%), Gaps = 10/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LKI EG   PY+YSTNNY GRQIWE+DPN GTP+ ++  EKAR+ F   R Q  P +
Sbjct  1     MWRLKIAEGVDSPYLYSTNNYVGRQIWEFDPNYGTPQLRQEVEKARQDFWANRYQVKPSS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  R+Q + E+     +IP V++ + E+V YE  TT +R+AV    ALQA DGHWPA
Sbjct  61    --DLLWRLQFLHENNFKQ-TIPQVKVGDGEDVTYETATTTLRRAVHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++ LYI+G ++ +  +EH+KE++RY+Y HQNEDGGWG +I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMILYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGFHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + L+Y+ +R+LGE  D    +A  R R WIL HG  TAIPSWGK +LS+LGV++W G NP
Sbjct  178   TVLSYICMRILGEGPDGGENNACTRARKWILDHGTVTAIPSWGKTWLSILGVFDWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFWL PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PY+Q
Sbjct  238   MPPEFWLLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYDQPYEQ  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I+W + R  C KED YYPH  IQD++W++    TEP++ RWPFNK+RE A++  + H+ Y
Sbjct  298   INWRSVRHRCAKEDLYYPHPLIQDLIWDSCYVLTEPLLTRWPFNKLREKALQVTMKHIHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLAR+PD++W+AEDGM MQ+FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGMKMQSFGSQEW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  FA QAL++S + +E G+ L+  H ++K+SQ+K++P GDF+SMYRH SKG+W FSDQD
Sbjct  418   DTGFAIQALLASNLTDEIGETLRLGHDFIKKSQVKDDPSGDFRSMYRHISKGSWTFSDQD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LL   M P+I GEK++ +  Y AV+I L LQS ++GG A WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSMMPPDIVGEKMEPEGFYNAVNILLSLQS-KNGGLAAWEPA  536

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LE+LNP+E FADIVV+ E+VE T S + AL  FK  YP++R KE+   IAKA  Y
Sbjct  537   GASDWLELLNPTEFFADIVVEHEYVECTSSAIQALVLFKQLYPEHRKKEIESFIAKAVGY  596

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q+ DGSWYG WG+CF YGT FAL GL AAG+SY N  A+RKA  F L  Q  +GGW
Sbjct  597   LEDVQRPDGSWYGNWGVCFTYGTWFALGGLAAAGKSYNNCAAVRKAVDFLLKAQRDDGGW  656

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP   Y+P E NRSN+V T+WAM+GL+++ QA+RDPTPLHR AKLLIN+Q+EDG
Sbjct  657   GESYLSCPKKVYVPLEDNRSNLVHTAWAMMGLIHSGQADRDPTPLHRGAKLLINSQLEDG  716

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  717   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKRV  754



>gb|ABY90140.2| beta-amyrin synthase [Bupleurum chinense]
Length=764

 Score =   942 bits (2436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/760 (57%), Positives = 561/760 (74%), Gaps = 12/760 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG---PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGP  2419
             MWKLKI EGG    PY+YSTNN+ GRQ W +DP  GTPEE+   E+AR  F   R Q  P
Sbjct  1     MWKLKIAEGGSSNDPYLYSTNNFVGRQTWTFDPEYGTPEERAKVEEARTNFWNNRYQVKP  60

Query  2418  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2239
                GDL  RMQ +KE   +  +IP V++ + EE++YE  TT +R+AV    ALQA DGHW
Sbjct  61    --SGDLLWRMQFLKEKNFEQ-TIPQVKVEDGEEISYETATTTLRRAVNFFSALQADDGHW  117

Query  2238  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  2059
             PAEN+GPLFF PPL++ LYI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM
Sbjct  118   PAENAGPLFFLPPLVMCLYITGHLNTVFPAEHQKEILRYIYCHQNEDGGWGLHIEGHSTM  177

Query  2058  IGSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGC  1891
               +AL+Y+ +R+LGE  D    +A AR R WIL HG  TAIPSWGK +LS+LG++EW G 
Sbjct  178   SCTALSYICMRILGEGVDGGKHNACARARKWILDHGTVTAIPSWGKTWLSILGLFEWSGT  237

Query  1890  NPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPY  1711
             NP+PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PY
Sbjct  238   NPMPPEFWVLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAEPY  297

Query  1710  DQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHM  1531
             D+++W   R  C KED YYPH  IQD++W++L  C EP + RWPFNK+RE A++  + H+
Sbjct  298   DKVNWRKVRHDCAKEDLYYPHPLIQDLMWDSLYICMEPFLTRWPFNKLREKALQTTMKHI  357

Query  1530  RYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQ  1351
              Y  E SRYITIG +EK L M+  W EDPN D  K HLAR+PD++W+AEDGM MQ+FGSQ
Sbjct  358   HYEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGMKMQSFGSQ  417

Query  1350  NWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSD  1171
              WD  FA QAL++SG+ +E    L K H ++K+SQ+ ENP GDFK+M+RH SKG+W FSD
Sbjct  418   EWDTGFAIQALLASGLTDEIQSTLMKGHDFIKKSQVTENPSGDFKNMHRHISKGSWTFSD  477

Query  1170  QDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWE  991
             QDHGW VSDCTAE +KC LL  +M  +I G K++   L++AV+I L LQS ++GG + WE
Sbjct  478   QDHGWQVSDCTAEGLKCCLLFSRMPKDIVGSKMEDSRLFDAVNILLSLQS-KNGGISAWE  536

Query  990   PPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAA  811
             P     +LE+LNP+E FADIV++ E+VE T S + A+  FK  YP +R KE+ ++I+ + 
Sbjct  537   PAGSSEWLELLNPTEFFADIVIEHEYVECTSSAIQAMVMFKKLYPGHRKKEIEIAISNSV  596

Query  810   EYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEG  631
             +YL+  Q +DGSWYG WG+CF YGT FA+ GLTAAG++YEN ++IRK   F L  Q  +G
Sbjct  597   QYLQDIQMSDGSWYGNWGVCFTYGTWFAIGGLTAAGKTYENCQSIRKGVEFLLDSQRNDG  656

Query  630   GWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQME  451
             GWGE   SCP  KY P EG RSN+V T+WA +GL+++ QA+RDPTPLHRAAKLLIN+QME
Sbjct  657   GWGESYVSCPNKKYTPLEGCRSNLVHTTWATMGLIHSGQAKRDPTPLHRAAKLLINSQME  716

Query  450   DGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
              GDFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYR+ V
Sbjct  717   SGDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRRNV  756



>ref|XP_010531942.1| PREDICTED: beta-amyrin synthase-like [Tarenaya hassleriana]
Length=760

 Score =   942 bits (2434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/759 (57%), Positives = 563/759 (74%), Gaps = 10/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLKIG+G G  PY++S N + GRQ WE+D  +GTPEE+ A E+AR+ F + R +    
Sbjct  1     MWKLKIGKGEGESPYLHSKNGFVGRQTWEFDEESGTPEERAAVEEARRRFYQNRPR-VKA  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ +KE +++ L IPPV++ + E++ +  +T A+R+ V    ALQ+ DGHWPA
Sbjct  60    SSDLLWRMQFLKERKLEQL-IPPVKVGDAEKITHVKLTNALRRGVHFFSALQSDDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL+  LYI+G +D + T+EH+KE++RY+Y HQNEDGGWGL+I+ HSTM  
Sbjct  119   ENAGPLFFLPPLVFCLYITGHLDNVFTAEHRKEVLRYIYCHQNEDGGWGLHIESHSTMFC  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             ++LNY+ +R+LGE  D    +A  R R WIL HGG T IPSWGK +LS+LGV+EW GCNP
Sbjct  179   TSLNYICMRILGEGPDGGQENACKRARQWILDHGGVTFIPSWGKTWLSILGVFEWSGCNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ P+  PFHPAKMW YCR  YMPMSYLY +R+ GPLT LVL +R E++++PY++
Sbjct  239   MPPEFWILPAFLPFHPAKMWCYCRMVYMPMSYLYGRRFVGPLTPLVLQLRQELYLQPYEK  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHMR  1528
             I+W   R  C KEDTYYPH  +QD++W+ L    EP +  WPFNK+ RE A++ V+ H+ 
Sbjct  299   INWTKARCLCAKEDTYYPHPLVQDLIWDCLYVFGEPFLTNWPFNKLLREKALKVVMEHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E S YITIG +EK L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSCYITIGCVEKVLCMLACWVEDPNGDCFKKHLARIPDYLWVAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S +  E  + LK+ H ++K+SQ+++NP GDFK MYRH S+GAW FSDQ
Sbjct  419   WDTGFAIQALLASNLSNEVSNVLKRGHDFIKKSQVRDNPTGDFKGMYRHISRGAWTFSDQ  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE IKC LLL  MSPE+ G K+D + LY++V+I L LQS E+GG   WEP
Sbjct  479   DHGWQVSDCTAEGIKCCLLLSMMSPEVVGPKIDPEKLYDSVNILLSLQS-ENGGVTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LE+LNP+E FADIV++ E+ E + S V AL  FK  YPD+R +E+   I KA +
Sbjct  538   AGAPKWLELLNPTEFFADIVIEHEYNECSSSAVQALLLFKQLYPDHRTEEINAFIQKAVK  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             Y+ET Q ADGSWYG WG+CF YGT FAL GL AAG++Y+N  A+RK  HF L  Q   GG
Sbjct  598   YIETIQMADGSWYGNWGVCFTYGTWFALGGLEAAGKTYDNCLALRKGVHFLLETQRGNGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +Y+P EG RSN+VQTSWA++GL++  QAERD  PLHRAAKL+IN+Q+E+
Sbjct  658   WGESYLSCPRKRYVPLEGERSNLVQTSWALMGLLHAGQAERDQVPLHRAAKLIINSQLEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ++TG +MKNCMLHYAS+R+ FPL ALSEYR+RV
Sbjct  718   GDFPQQEVTGVFMKNCMLHYASYRNIFPLWALSEYRRRV  756



>gb|ADK12003.1| beta-amyrin synthase [Aralia elata]
Length=763

 Score =   942 bits (2434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/760 (58%), Positives = 558/760 (73%), Gaps = 12/760 (2%)
 Frame = -3

Query  2586  MWKLKIGEGG--GPYIYSTNNYAGRQIWEYDPN-AGTPEEQEAFEKARKGFTKQR-QKGP  2419
             MWKLKI EG    PY+YSTNN+ GRQ WE+DP+   +P E E  E+AR+ F + R Q  P
Sbjct  1     MWKLKIAEGNKNDPYLYSTNNFVGRQTWEFDPDYVASPGELEEVEQARRQFWENRYQVKP  60

Query  2418  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2239
                GDL  RMQ ++E      +IP V++ ++E V YEA TT +R+AV    ALQA DGHW
Sbjct  61    --SGDLLWRMQFLREKNFKQ-TIPQVKVGDDEAVTYEAATTTLRRAVHFFSALQASDGHW  117

Query  2238  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  2059
             PAEN+GPLFF PPL++ +YI+G +D +  +EH+KE++RY+Y HQNEDGGWG +I+GHSTM
Sbjct  118   PAENAGPLFFLPPLVMCVYITGHLDTVFPAEHRKEILRYIYCHQNEDGGWGFHIEGHSTM  177

Query  2058  IGSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGC  1891
               + L+Y+ +R+LGE  D    +A  RGR WIL HG  TAIPSWGK +LS+LGVYEW G 
Sbjct  178   FCTTLSYICMRILGEGPDGGVNNACVRGRKWILDHGSVTAIPSWGKTWLSILGVYEWTGS  237

Query  1890  NPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPY  1711
             NP+PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PY
Sbjct  238   NPMPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPY  297

Query  1710  DQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHM  1531
             ++I+W  TR  C KED YYPH  IQD+LW++L   TEP++ RWPFNK+RE A++  + H+
Sbjct  298   NEINWRKTRHVCAKEDIYYPHPLIQDLLWDSLYVLTEPLLTRWPFNKLREKALQTTMKHI  357

Query  1530  RYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQ  1351
              Y  E SRYITIG +EK L M+  W EDPN D  K HLAR+PD++W+AEDGM MQ+FGSQ
Sbjct  358   HYEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGMKMQSFGSQ  417

Query  1350  NWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSD  1171
              WD  F  QAL++S +  E G  L K H ++K+SQ+K+NP GDFK MYRH SKG+W FSD
Sbjct  418   EWDTGFGIQALLASDLTHEIGPTLMKGHDFIKKSQVKDNPSGDFKGMYRHISKGSWTFSD  477

Query  1170  QDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWE  991
             QDHGW VSDCTAE +KC L+   M  EI G+K++ + LY++V++ L LQS ++GG A WE
Sbjct  478   QDHGWQVSDCTAEGLKCCLIFSTMPEEIVGKKMEPERLYDSVNVLLSLQS-KNGGLAAWE  536

Query  990   PPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAA  811
             P   Q +LE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+   I  A 
Sbjct  537   PAGAQEWLELLNPTEFFADIVIEHEYVECTSSAIQALVLFKKLYPGHRKKEIDNFIMNAV  596

Query  810   EYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEG  631
              YLE  Q  DGSWYG WG+CF YG+ FAL GL AAG++Y N  A+RKA  F L  Q  +G
Sbjct  597   RYLEDIQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYYNCAAVRKAVDFLLKSQMDDG  656

Query  630   GWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQME  451
             GWGE   SCP   Y+P EGNRSN+V T WA++GL+++EQAERDPTPLHRAAKLLIN+QME
Sbjct  657   GWGESYLSCPKKVYVPLEGNRSNLVHTGWALMGLIHSEQAERDPTPLHRAAKLLINSQME  716

Query  450   DGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DGDFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYR+RV
Sbjct  717   DGDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRRRV  756



>ref|XP_002270934.1| PREDICTED: beta-amyrin synthase [Vitis vinifera]
 ref|XP_010655248.1| PREDICTED: beta-amyrin synthase [Vitis vinifera]
Length=757

 Score =   941 bits (2432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/758 (58%), Positives = 557/758 (73%), Gaps = 10/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   E AR+ F K R Q  P  
Sbjct  1     MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAARENFWKNRYQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GDL  RMQ ++E      +IP V++ + EE+ YE  T AVR+      ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLREKNFKQ-TIPQVKVGDGEEITYETATAAVRRGAHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPL+F PPL++ LYI+G +D +   E++KE++RYLY HQNEDGGWG +I+GHSTM  
Sbjct  118   ENAGPLYFLPPLVMCLYITGHLDTVFPGEYRKEILRYLYCHQNEDGGWGFHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + L+Y+ +R+LGE  D    +A ARGR WIL  GG T+IPSWGK +LS+ G+++W G NP
Sbjct  178   TTLSYICMRILGEGPDGGRENACARGRKWILDRGGVTSIPSWGKTWLSIFGLFDWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFWLFPS  P HPAKMW YCR  YMPMSYLY KR+ GP+T LVL +R E+ ++PY++
Sbjct  238   MPPEFWLFPSRLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLVLELREELFLQPYNE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I+W   R  C KED YYPH  IQD++W+ L  CTEP++ RWPFNK+R+ A+   + H+ Y
Sbjct  298   INWRKVRHLCAKEDLYYPHPLIQDLMWDGLYICTEPLLTRWPFNKLRQKALEVTMKHIHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN +  K HLAR+PD++W+ EDG+ MQ+FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLSCWVEDPNGNYFKKHLARIPDYIWVGEDGIKMQSFGSQEW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  FA QA+++  M +E G  LKK H ++K+SQ+K+NP GDFKSMYRH SKG+W FSDQD
Sbjct  418   DTGFALQAVLACNMTDEIGPTLKKGHEFVKESQVKDNPSGDFKSMYRHISKGSWTFSDQD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LL   M PEI G K++ + L+++V+I L LQS ++GG A WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSMMPPEIVGVKMEPERLFDSVNILLSLQS-KNGGLAAWEPA  536

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+   I  AA+Y
Sbjct  537   GASEWLELLNPTEFFADIVIEHEYVECTASAIQALVLFKKLYPGHRKKEIDNFITYAAKY  596

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             +E  Q  DGSWYG WG+CF YG+ FAL GL AAG++Y N  AIR+A  F L+ Q  +GGW
Sbjct  597   IEDIQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYHNCHAIRRAVEFLLNSQRDDGGW  656

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  KY P EGNRSN+V T WA++GL+ + QAERDPTPLHRAAKLLIN QMEDG
Sbjct  657   GESYVSCPDKKYTPLEGNRSNLVHTGWALMGLISSGQAERDPTPLHRAAKLLINFQMEDG  716

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYR+RV
Sbjct  717   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRRRV  754



>dbj|BAE53429.1| beta-amyrin synthase [Lotus japonicus]
Length=762

 Score =   941 bits (2431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/758 (57%), Positives = 564/758 (74%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLK+ +GG  PYI+STNN+ GRQ WEYDP+AGTPEE+   E+AR+ F   R K    C
Sbjct  1     MWKLKVADGGKDPYIFSTNNFVGRQTWEYDPDAGTPEERAQVEEARQDFYNNRYK-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  R Q+++E+     +IP V++ + EE+ YE  TT +++A     ALQ  DGHWPA+
Sbjct  60    GDLLWRFQVLRENNFKQ-TIPSVKIEDGEEITYEKATTTLKRAAHHLAALQTSDGHWPAQ  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPLFF PPL+  +YI+G ++ +   E++KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFQPPLVFCMYITGHLNSVFPEEYRKEILRYIYVHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             ALNY+ +R+LGE  D    +A AR R WIL HGG T IPSWGK +LS+LG+++W G NP+
Sbjct  179   ALNYICMRMLGEGPDGGQDNACARARKWILDHGGVTHIPSWGKTWLSILGIFDWKGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+  +PY+++
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKV  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W   R  C KED YYPH  IQD++W++L   TEP++ RWPFNK +RE A+   + H+ Y
Sbjct  299   NWKKARHQCAKEDIYYPHPLIQDLMWDSLYLFTEPLLTRWPFNKLVREKALEVTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW++EDGM MQ+FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARIPDYLWVSEDGMCMQSFGSQEW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA FA QAL+++ +V+E G  L K H ++K+SQ+++NP GDFK+M+RH SKG+W FSDQD
Sbjct  419   DAGFAVQALLATNLVDELGPTLAKGHDFIKKSQVRDNPSGDFKNMHRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LLL  + P+I GEK++ +CL+++V++ L LQS + GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSMLPPDIVGEKMEPECLFDSVNLLLSLQS-KKGGLAAWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               Q +LE+LNP+E FADIVV+ E+VE TGS + AL  FK  YP +R KE+   I++A  +
Sbjct  538   GAQEWLELLNPTEFFADIVVEHEYVECTGSAIGALVLFKKLYPGHRKKEIENFISEAVRF  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q ADGSWYG WG+CF YG+ FAL GL AAG++Y N  AIRKA  F L+ Q  +GGW
Sbjct  598   LEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTYANCAAIRKAVKFLLTTQRGDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   S P   Y+PFEGNRSNVV T+WA++GL+++ QAERDPTPLHRAAKLLIN+Q+E+G
Sbjct  658   GESYLSSPKKIYVPFEGNRSNVVHTAWALMGLIHSGQAERDPTPLHRAAKLLINSQLEEG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             D+PQQ+ITG +MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  718   DWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  755



>ref|XP_009779988.1| PREDICTED: beta-amyrin synthase [Nicotiana sylvestris]
 ref|XP_009779989.1| PREDICTED: beta-amyrin synthase [Nicotiana sylvestris]
 ref|XP_009779990.1| PREDICTED: beta-amyrin synthase [Nicotiana sylvestris]
Length=761

 Score =   940 bits (2430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/757 (57%), Positives = 557/757 (74%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLKI EG  GPY+YSTNNY GRQ WE+DPNAGTPE+++  E+AR+ F   R K   + 
Sbjct  1     MWKLKIAEGQDGPYLYSTNNYVGRQTWEFDPNAGTPEQRKEIEEARQQFWNNRYKVKPS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  R+Q ++E    V +IP V++ E EE+  E  TT++R+AV    ALQA DGHWPAE
Sbjct  60    GDLLWRLQFLREKNFKV-TIPAVKVEEGEEITDEVATTSLRRAVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE  D    +A AR R WIL HG  TAIPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGPDGGENNACARARKWILDHGSITAIPSWGKTWLSILGVFEWLGTNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PY++I
Sbjct  239   PPEFWILPSFLPIHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYDQPYNEI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +W   R +C KED YYPH  +QD++W++L  CTEP++ RWPFNK+R  A+   + H+ Y 
Sbjct  299   NWRKVRHSCAKEDLYYPHPLVQDLMWDSLYICTEPLLTRWPFNKLRNKALEVTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
               FA QAL++S M +E  D LK+ H +LK+SQ+K++P GDFK MYRH SKG+W FSDQDH
Sbjct  419   TGFAIQALLASEMNDEIADTLKRGHNFLKESQVKDDPSGDFKGMYRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAEA+KC LL   M PE+ GE ++   LY++V++ L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEALKCCLLFSTMPPELVGEAMEPSRLYDSVNVILSLQS-KNGGLAAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                YLE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R K +   +A A +YL
Sbjct  538   ASEYLELLNPTEFFADIVIEHEYVECTASSIQALVLFKKLYPGHRTKAIDNFVANAVKYL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WG+CF YG+ FAL GL AAG+SY N  A+RK   F L  Q  +GGWG
Sbjct  598   EDVQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKSYSNCAAVRKGVEFLLQTQRSDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP   Y   E  +SN+VQT+WA++GL+++ Q  RDP PLHRAA+LLIN+QMEDGD
Sbjct  658   ESYRSCPDKVYRELETAKSNLVQTAWALMGLIHSGQVGRDPRPLHRAARLLINSQMEDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+ITG +MKNCMLHYA++R+ +PL  L+EYRK V
Sbjct  718   FPQQEITGVFMKNCMLHYAAYRNIYPLWGLAEYRKNV  754



>gb|AHX97777.1| beta-amyrin synthase [Gentiana straminea]
Length=758

 Score =   940 bits (2429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/757 (58%), Positives = 564/757 (75%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EGG  PY+YSTNNY GRQ WEYDPNAGTPEE+   E+AR+ F   R +     
Sbjct  1     MWRLKIAEGGNDPYLYSTNNYVGRQTWEYDPNAGTPEERAEVEEARRQFWDNR-RDVKPS  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  R+Q ++E      +IP V++ + +E+ ++  T ++R+AV    ALQA DGHWPAE
Sbjct  60    GDLLWRLQFLREKNFKQ-TIPAVKVEDGQEITHQMATDSLRRAVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFF PPL++ LYI+G ++ +  +EHK+E++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCLYITGHLNSVFPAEHKREILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +RLLGE  D    +A AR R WIL HG  T+IPSWGK +LS+LGVYEW G NP+
Sbjct  179   ALSYICMRLLGEGPDGGINNACARARKWILDHGSVTSIPSWGKTWLSILGVYEWSGTNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P +PAKMW YCR  YMPMSYLY KR+ GP+T L+  +R+E+H  PYDQ+
Sbjct  239   PPEFWILPSFLPMYPAKMWCYCRMVYMPMSYLYGKRFVGPITPLIRELRDELHSXPYDQV  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
              W   R  C KED YYPH F+QD++W++L  CTEP++ RWPFNK+R  A+   + H+ Y 
Sbjct  299   SWKKYRHVCAKEDLYYPHPFVQDLIWDSLYVCTEPLLTRWPFNKLRAKALEVTMEHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDP  D  K HLAR+PD++W+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPKGDYFKKHLARIPDYIWVAEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
               FA QAL++  M EE  + L+K H ++K+SQ+K+NP GDFKSM+RH SKG+W FSDQDH
Sbjct  419   TGFAIQALLACDMTEEIAETLRKGHDFVKKSQVKDNPSGDFKSMHRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +K  L    M PEI GEK++ + +Y+AV+I L LQS ++GG + WEP  
Sbjct  479   GWQVSDCTAEGLKVCLHFSTMPPEIVGEKMEPEKIYDAVNILLPLQS-KNGGLSAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+  SI  A++YL
Sbjct  538   SSEWLELLNPTEFFADIVIEHEYVECTASSIHALILFKKLYPGHRKKEIETSIINASKYL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WG+CF YGT FAL GL A+G++Y+N  A+RKA +F L+ Q Q+GGWG
Sbjct  598   EDVQMPDGSWYGNWGVCFTYGTWFALGGLAASGKTYDNCNAVRKAVNFLLNSQRQDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP   Y+P EG RSN+V TSWAM+GL+++ QAERDPTPLHRAAKL+IN+QMEDGD
Sbjct  658   ESYLSCPQKIYVPLEGERSNLVHTSWAMMGLIHSGQAERDPTPLHRAAKLIINSQMEDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  718   FPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKRV  754



>sp|O82140.1|BAMS1_PANGI RecName: Full=Beta-Amyrin Synthase 1 [Panax ginseng]
 dbj|BAA33461.1| beta-Amyrin Synthase [Panax ginseng]
Length=763

 Score =   940 bits (2429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/760 (58%), Positives = 557/760 (73%), Gaps = 12/760 (2%)
 Frame = -3

Query  2586  MWKLKIGEGG--GPYIYSTNNYAGRQIWEYDPN-AGTPEEQEAFEKARKGFTKQR-QKGP  2419
             MWKLKI EG    PY+YSTNN+ GRQ WE+DP+   +P E E  E+ R+ F   R Q  P
Sbjct  1     MWKLKIAEGNKNDPYLYSTNNFVGRQTWEFDPDYVASPGELEEVEQVRRQFWDNRYQVKP  60

Query  2418  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2239
                GDL  RMQ ++E      +IP V++ ++E V YEA TT +R+AV    ALQA DGHW
Sbjct  61    --SGDLLWRMQFLREKNFRQ-TIPQVKVGDDEAVTYEAATTTLRRAVHFFSALQASDGHW  117

Query  2238  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  2059
             PAENSGPLFF PPL++ +YI+G +D +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM
Sbjct  118   PAENSGPLFFLPPLVMCVYITGHLDTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTM  177

Query  2058  IGSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGC  1891
               + L+Y+ +R+LGE  D    +A ARGR WIL HG  TAIPSWGK +LS+LGVYEW G 
Sbjct  178   FCTTLSYICMRILGEGPDGGVNNACARGRKWILDHGSVTAIPSWGKTWLSILGVYEWIGS  237

Query  1890  NPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPY  1711
             NP+PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PY
Sbjct  238   NPMPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYGQPY  297

Query  1710  DQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHM  1531
             ++I+W  TR  C KED YYPH  IQD+LW++L   TEP++ RWPFNK+RE A++  + H+
Sbjct  298   NEINWRKTRRVCAKEDIYYPHPLIQDLLWDSLYVLTEPLLTRWPFNKLREKALQTTMKHI  357

Query  1530  RYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQ  1351
              Y  E SRYITIG +EK L M+  W EDPN D  + HLAR+PD++W+AEDGM MQ+FGSQ
Sbjct  358   HYEDENSRYITIGCVEKVLCMLVCWVEDPNGDYFRKHLARIPDYIWVAEDGMKMQSFGSQ  417

Query  1350  NWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSD  1171
              WD  F+ QAL+ S +  E G  L K H ++K+SQ+K+NP GDFKSMYRH SKG+W FSD
Sbjct  418   EWDTGFSIQALLDSDLTHEIGPTLMKGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSD  477

Query  1170  QDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWE  991
             QDHGW VSDCTAE +KC L+   M  EI G+K+  + LY++V++ L LQ  ++GG + WE
Sbjct  478   QDHGWQVSDCTAEGLKCCLIFSTMPEEIVGKKIKPERLYDSVNVLLSLQR-KNGGLSAWE  536

Query  990   PPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAA  811
             P   Q +LE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+   I  A 
Sbjct  537   PAGAQEWLELLNPTEFFADIVIEHEYVECTSSAIQALVLFKKLYPGHRKKEIDNFITNAV  596

Query  810   EYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEG  631
              YLE  Q  DGSWYG WG+CF YG+ FAL GL AAG++Y N  A+RKA  F L  Q  +G
Sbjct  597   RYLEDTQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYYNCAAVRKAVEFLLKSQMDDG  656

Query  630   GWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQME  451
             GWGE   SCP   Y+P EGNRSN+V T WA++GL+++EQAERDPTPLHRAAKLLIN+QME
Sbjct  657   GWGESYLSCPKKVYVPLEGNRSNLVHTGWALMGLIHSEQAERDPTPLHRAAKLLINSQME  716

Query  450   DGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DGDFPQQ+I+G +MKNCMLHYA++R+ +PL AL+EYR+RV
Sbjct  717   DGDFPQQEISGVFMKNCMLHYAAYRNIYPLWALAEYRRRV  756



>sp|E2IUA6.1|TARS_KALDA RecName: Full=Taraxerol synthase; Short=KdTAS [Kalanchoe daigremontiana]
 gb|ADK35123.1| taraxerol synthase [Kalanchoe daigremontiana]
Length=779

 Score =   940 bits (2429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/758 (57%), Positives = 564/758 (74%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLKI +GG  PY+YSTNNY GRQ WE+DP AGTPEE+   E AR  F   R +     
Sbjct  20    MWKLKIAQGGKDPYLYSTNNYVGRQTWEFDPEAGTPEERAEVEAARLNFYNNRYR-VKPS  78

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  RMQ +KE      +IPPV++ + EE+ YE  TTA+++AV    ALQA DGHWPAE
Sbjct  79    ADLLYRMQFLKEKNFKQ-TIPPVKVEDGEEITYETATTALKRAVHFYSALQASDGHWPAE  137

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             NSGPLFF PPL++ LYI+G ++ +  +EH++E++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  138   NSGPLFFLPPLVMCLYITGHLNTVFPAEHQREILRYIYYHQNEDGGWGLHIEGHSTMFCT  197

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE  D    +A+ARGR WIL HG  TA+PSWGK +LS++G+++W G NP+
Sbjct  198   ALSYICMRILGEGPDGGLDNAVARGRKWILDHGTVTAMPSWGKTWLSIMGLFDWSGSNPM  257

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWL PS  P +PAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PY+Q+
Sbjct  258   PPEFWLLPSFLPMYPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYDQPYEQV  317

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W   R  C KED YYPH  IQD+LW+ L    EP++ RWPFNK +RE A+++ + H+ Y
Sbjct  318   NWKQVRHECAKEDIYYPHPKIQDLLWDTLYIAIEPLLTRWPFNKLVRERALQRTMKHIHY  377

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLARVPD++W+AEDGM MQ+FGSQ W
Sbjct  378   EDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARVPDYIWVAEDGMKMQSFGSQQW  437

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  FA QAL++S M +E G+ L K H ++K+SQ+K+NP GDFKSM+RH SKG+W FSDQD
Sbjct  438   DTGFAIQALLASNMSDEIGETLAKGHDFVKKSQVKDNPSGDFKSMHRHISKGSWTFSDQD  497

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LL   M PE+ GEK++ + LY++V+I L LQS ++GG A WEP 
Sbjct  498   HGWQVSDCTAEGLKCCLLFSLMPPELVGEKMEPERLYDSVNILLSLQS-KNGGLAAWEPA  556

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R K++   I  AA+Y
Sbjct  557   GAPEWLELLNPTEFFADIVIEHEYVECTASAIQALVLFKKLYPGHRKKDIETFIKGAAQY  616

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             +E +Q  DGSWYG WG+CF YGT FAL GL AAG++Y+N  AIRK   F L+ Q + GGW
Sbjct  617   IEDRQMPDGSWYGSWGVCFTYGTWFALGGLAAAGKNYDNCAAIRKGTEFLLNTQCENGGW  676

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  +Y+P E N+SN+V T+WA++GL+++ QAERD TPLHRAAKLLIN+Q+E+G
Sbjct  677   GESYRSCPEKRYVPLEENKSNLVHTAWALMGLIHSRQAERDITPLHRAAKLLINSQLENG  736

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DFPQQ+ITG +MKNCM HYA++R+ +PL  ++EYRK++
Sbjct  737   DFPQQEITGVFMKNCMQHYAAYRNIYPLWGIAEYRKQI  774



>gb|ACH88048.1| beta-amyrin synthase [Nigella sativa]
 gb|ACH88049.1| beta-amyrin synthase [Nigella sativa]
Length=761

 Score =   938 bits (2425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/759 (57%), Positives = 558/759 (74%), Gaps = 10/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGP---YIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2416
             MWKLKI +  GP   Y+YSTNNY GRQ WE+DP+AGTPEE+   EKAR+ F K R     
Sbjct  1     MWKLKIADATGPFSEYLYSTNNYIGRQTWEFDPDAGTPEERAEVEKARQDFHKNRFD-IK  59

Query  2415  TCGDLFMRMQMIKESEVDV-LSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2239
              CGD+ +R+QM+KE++    LSIPPV+L E +  +YE +TT +R+AVR   A+Q  DGHW
Sbjct  60    PCGDVLLRLQMLKENKDRFDLSIPPVKLSENQIASYEDVTTTLRRAVRFVSAMQTSDGHW  119

Query  2238  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  2059
              A+  GPL+F PPL+ ALYI+G++D I + EHKKE++RY+Y HQNEDGGWG +I+GHSTM
Sbjct  120   AADIGGPLYFMPPLVFALYITGTLDTIFSPEHKKEILRYMYVHQNEDGGWGFHIEGHSTM  179

Query  2058  IGSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGC  1891
              G+ LNY+ +R+LGE  D    +A ARGR WI  HGG T IPSWGK +LS+LG+YEW GC
Sbjct  180   FGTTLNYICMRMLGEGPDGGEDNACARGRKWIRDHGGVTWIPSWGKTWLSILGLYEWSGC  239

Query  1890  NPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPY  1711
             NP+PPEFW+ PS  PFHPAKMW YCR  YMPMSYLY KR+ GP+T L+L++R E+H++PY
Sbjct  240   NPMPPEFWVLPSFLPFHPAKMWCYCRLVYMPMSYLYGKRFVGPITGLILTLREELHLQPY  299

Query  1710  DQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHM  1531
             D+I W  +R AC KED YYPH  +Q++LW+ L    E ++ RWP +K+R+ A++  + H+
Sbjct  300   DEIRWFKSRNACAKEDLYYPHPLVQNLLWDTLNVFGETVLTRWPMSKLRDKALQVTMKHI  359

Query  1530  RYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQ  1351
              Y  E SRYITIG +EKSL M+  W EDP+ D  K HLARV D+LW+AEDGM MQ+FGSQ
Sbjct  360   HYEDENSRYITIGCVEKSLCMLACWVEDPDSDAFKKHLARVQDYLWVAEDGMRMQSFGSQ  419

Query  1350  NWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSD  1171
             NWD  FA   L++S + +E  D L K H Y+KQSQ+K+NP GDF+SM+RH SKG+W FSD
Sbjct  420   NWDTGFALHGLLASNLHDEIWDTLNKGHDYVKQSQVKDNPSGDFRSMHRHLSKGSWTFSD  479

Query  1170  QDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWE  991
             QDHGW VSDCT E +   LL+ Q+SPE  G K++ + LY++V+I L LQS ++GG A WE
Sbjct  480   QDHGWQVSDCTGEGLMVCLLMSQLSPEYVGPKMEPEGLYDSVNILLSLQS-KNGGLAAWE  538

Query  990   PPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAA  811
             P     +LE++NP+E F DIV++ E+VE T S ++AL  FK  YP +R KE+   IAKA 
Sbjct  539   PVSAPEWLEVINPTEFFQDIVIEHEYVECTASGIAALELFKKLYPGHRKKEIESFIAKAV  598

Query  810   EYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEG  631
              +LE  Q  DGSWYG WGICF+YGT FAL GL A G +  NS  +RKA  F LS Q + G
Sbjct  599   HFLEETQMPDGSWYGNWGICFIYGTWFALRGLAAVGNNCNNSPTVRKACDFLLSTQLESG  658

Query  630   GWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQME  451
             GWGE  +SCP  K+IP E  R+N+V T+WA++GL+   QA+RDPTPLHRA K+LIN QME
Sbjct  659   GWGESYKSCPEKKFIPLEDKRTNLVHTAWALMGLINGGQAQRDPTPLHRAVKVLINGQME  718

Query  450   DGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKR  334
             +GDFPQQ+ITG +MKNCMLHYA+ R+ FPL AL EYR++
Sbjct  719   NGDFPQQEITGVFMKNCMLHYAAFRNMFPLWALGEYRRK  757



>dbj|BAE43642.1| beta-amyrin synthase [Euphorbia tirucalli]
Length=762

 Score =   937 bits (2421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/758 (58%), Positives = 548/758 (72%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGP-YIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLKI EGG   Y+YSTNNY GRQ W +DP   TP+E    ++AR  F   R     + 
Sbjct  1     MWKLKIAEGGNDEYLYSTNNYVGRQTWVFDPQPPTPQELAQVQQARLNFYNNRYHVKPS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  R Q ++E      +IP  ++ E E++ YE  TTA+R+AV    ALQA DGHWPAE
Sbjct  60    SDLLWRFQFLREKNFKQ-TIPQAKINEGEDITYEKATTALRRAVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFF PPL++ LYI+G +D +  + H+ E++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCLYITGHLDTVFPAPHRLEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              L+Y+ +RLLGE      D+A +R R WI+ HGGAT IPSWGK +LS+LGVYEW G NP+
Sbjct  179   VLSYICMRLLGEGPNGGQDNACSRARKWIIDHGGATYIPSWGKTWLSILGVYEWSGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ P+  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+H +PY  I
Sbjct  239   PPEFWILPTFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLRQELHTQPYHHI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHMRY  1525
             +W  TR  C  ED YYPH  IQD++W++L   TEP++ RWPFNKI R+ A+   + H+ Y
Sbjct  299   NWTKTRHLCAHEDVYYPHPLIQDLMWDSLYIFTEPLLTRWPFNKIIRKKALEVTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  WAEDPN    K HLAR+PD++W+AEDGM MQ+FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWAEDPNGVPFKKHLARIPDYMWVAEDGMKMQSFGSQQW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  FA QAL++S + EE G  LKK H ++K+SQ+KENP GDFKSM+RH SKG+W FSDQD
Sbjct  419   DTGFAIQALLASNLTEEIGQVLKKGHDFIKKSQVKENPSGDFKSMHRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LL   M PEI GEK+D Q LY AV+I + LQS ++GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLFSMMPPEIVGEKMDAQHLYNAVNILISLQS-KNGGLAAWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               Q +LEMLNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+   I  A +Y
Sbjct  538   GAQQWLEMLNPTEFFADIVIEHEYVECTASAIHALIMFKKLYPGHRKKEIENFITNAVKY  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q ADG WYG WG+CF YGT FA+ GL AAG++Y N  A+RKA  F L  Q Q+GGW
Sbjct  598   LEDVQTADGGWYGNWGVCFTYGTWFAVGGLAAAGKNYNNCAAMRKAVDFLLRTQKQDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  KY+P E NRSN+V TSWA++GL+   Q +RDPTPLHRAAKLLIN+Q+EDG
Sbjct  658   GESYLSCPHKKYVPLEDNRSNLVHTSWALMGLISAGQMDRDPTPLHRAAKLLINSQLEDG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYR RV
Sbjct  718   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRNRV  755



>ref|XP_007023608.1| Beta-Amyrin Synthase [Theobroma cacao]
 gb|EOY26230.1| Beta-Amyrin Synthase [Theobroma cacao]
Length=758

 Score =   936 bits (2419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/759 (58%), Positives = 562/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MWKLKI EG  GPY+YSTNNY GRQ WE+DP+AGTPEE+   E+AR+ F K R Q  P  
Sbjct  1     MWKLKIAEGVDGPYLYSTNNYVGRQTWEFDPDAGTPEERAEVEEARQNFYKDRYQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GDL  RMQ ++E      +IP V++ E E+++YE  T A+R+AV    ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLREQNFKQ-TIPAVKIEEGEQISYEKATAALRRAVHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL+ + YI+G ++ +   EH++E++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVFSTYITGHLNTVFPEEHRREILRYIYYHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +AL+Y+ +R+LG E D    +A AR R WIL HG  T +PSWGK +LS+LGV++W G NP
Sbjct  178   TALSYICMRILGVEPDGGQDNACARARKWILDHGSVTHMPSWGKTWLSILGVFDWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+  +R E++++PY++
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLIEQLREELYLQPYNE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W   R  C  ED YYPH  IQD++W++L  CTEP++ RWP NK +RE A++  I H+ 
Sbjct  298   INWRKVRHLCAPEDIYYPHPLIQDLMWDSLYICTEPLLTRWPLNKLVREKALQVTIKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  WAE+PN D  K HLAR+PD+LW+AEDGM MQ+FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWAEEPNSDYFKKHLARIPDYLWVAEDGMKMQSFGSQE  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S + +E G  LK+ H ++K+SQ+K+NP GDFK MYRH SKG+W FSDQ
Sbjct  418   WDTGFAIQALLASNLTDEIGPVLKRGHDFIKKSQVKDNPSGDFKKMYRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LL+  + PEI GEK++ Q LY AV++ L LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLMSMLPPEIVGEKMEPQQLYNAVNVLLSLQS-KNGGLAAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LEMLNP+E FADIVV+ E+VE T S + AL  FK  YP +R KE+   I  A  
Sbjct  537   AGAQDWLEMLNPTEFFADIVVEHEYVECTASAIHALFLFKKLYPGHRKKEIDNFITNAVR  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG WG+CF YG+ FAL GL AAG++Y N  A+RK   F L  Q + GG
Sbjct  597   YLENIQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYTNCLAVRKGVEFLLRTQRENGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE  +SCP  +Y+P E  RSN+V T+WAM+GL++  QAERDPTPLHRAAKL+IN+Q+ED
Sbjct  657   WGESYKSCPDKRYVPLEEGRSNLVHTAWAMMGLIHAGQAERDPTPLHRAAKLIINSQLED  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  717   GDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKRV  755



>sp|Q8W3Z1.1|BAMS_BETPL RecName: Full=Beta-amyrin synthase [Betula platyphylla]
 dbj|BAB83088.1| beta-amyrin synthase [Betula platyphylla]
Length=779

 Score =   935 bits (2417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/759 (56%), Positives = 561/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LKI +GG  PYIYSTNN+ GRQ WE+DP AG+P+E+   E+AR+ F   R Q  P  
Sbjct  1     MWRLKIADGGSDPYIYSTNNFVGRQTWEFDPQAGSPQERAEVEEARRNFYDNRYQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GDL  RMQ +KE      +IPPV++ + EE+ YE  T A+R+AV    ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLKEKNFKQ-TIPPVKVEDGEEITYEKSTAALRRAVHFYSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCMYITGHLNTVFPAEHQKEILRYIYYHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +AL+Y+ +R+LGE  D    +A AR R WIL HGG T +PSWGK +LS+LG++EW G NP
Sbjct  178   TALSYICMRILGEGPDGGQDNACARARKWILDHGGVTHMPSWGKTWLSILGIFEWIGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PY Q
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYTQPYHQ  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             ++W   R  C KED YYPH  IQD+LW++L   TEP++ RWPFNK +RE A++  + H+ 
Sbjct  298   VNWKKVRHLCAKEDIYYPHPLIQDLLWDSLYIFTEPLLTRWPFNKLVREKALQVTMKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDPN D  K H+AR+PD++W+AEDG+ MQ+FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHIARIPDYIWVAEDGIKMQSFGSQE  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S + +E G  L + H ++K+SQ+K+NP GDF+SM+RH SKG+W FSDQ
Sbjct  418   WDTGFAIQALLASNLTDEIGPTLARGHDFIKKSQVKDNPSGDFESMHRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LL   M PEI GEK++ + LY++V++ L LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLFSIMPPEIVGEKMEPEQLYDSVNVLLSLQS-KNGGLAAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LN +E FADIV++ E++E T S +  L  FK  YP +R KE+   I  AA+
Sbjct  537   AGAQEWLELLNSTEFFADIVIEHEYIECTASAMQTLVLFKKLYPGHRKKEIENFIKNAAQ  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             +L+  Q  DGSWYG WG+CF YGT FAL GL A G++Y N  A+R+A  F L  Q   GG
Sbjct  597   FLQVIQMPDGSWYGNWGVCFTYGTWFALGGLAAVGKTYNNCLAVRRAVDFLLRAQRDNGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +Y+P EGN+SN+V T+WAM+GL++  QAERDPTPLHRAAKL+IN+Q+ED
Sbjct  657   WGESYLSCPKKEYVPLEGNKSNLVHTAWAMMGLIHAGQAERDPTPLHRAAKLIINSQLED  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG +MKNCMLHYA++++ +PL AL+EYRK V
Sbjct  717   GDFPQQEITGVFMKNCMLHYAAYKNIYPLWALAEYRKHV  755



>ref|NP_001234604.1| beta-amyrin synthase [Solanum lycopersicum]
 sp|E7DN63.1|BAMS_SOLLC RecName: Full=Beta-amyrin synthase; AltName: Full=Triterpenoid 
synthase 1; Short=SlTTS1 [Solanum lycopersicum]
 gb|ADU52574.1| beta-amyrin synthase [Solanum lycopersicum]
Length=761

 Score =   935 bits (2417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/757 (57%), Positives = 551/757 (73%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLKI EG  GPY+YSTNNY GRQ WE+DPN GT EE+   E+AR+ F   R K   + 
Sbjct  1     MWKLKIAEGQNGPYLYSTNNYVGRQTWEFDPNGGTIEERAKIEEARQQFWNNRYKVKPS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  R+Q + E       IP V++ E EE+++E  T A+ +AV    ALQA DGHWPAE
Sbjct  60    SDLLWRIQFLGEKNFKQ-KIPAVKVEEGEEISHEVATIALHRAVNFFSALQATDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE  D    +A AR R WIL HG  TAIPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGPDGGVNNACARARKWILDHGSVTAIPSWGKTWLSILGVFEWIGTNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PYD+I
Sbjct  239   PPEFWILPSFLPVHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYDRPYDEI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +W   R  C KED YYPH  +QD++W++L  CTEP++ RWPFNK+R  A+   + H+ Y 
Sbjct  299   NWKKVRHVCAKEDLYYPHPLVQDLMWDSLYICTEPLLTRWPFNKLRNKALEVTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
               FA QAL++S M +E  D L+K H ++KQSQ+  NP GDFK MYRH SKG+W FSDQDH
Sbjct  419   TGFAIQALLASEMNDEIADTLRKGHDFIKQSQVTNNPSGDFKGMYRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAEA+KC LLL  M  E+ G+ ++   LY++V++ L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEALKCCLLLSTMPRELVGQAMEPGRLYDSVNVVLSLQS-KNGGLAAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                YLE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+ + I  A +YL
Sbjct  538   ASEYLELLNPTEFFADIVIEHEYVECTASSIQALVLFKKLYPGHRTKEINIFIDNAVKYL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WG+CF YG+ FAL GL AAG+SY NS A+RK   F L  Q  +GGWG
Sbjct  598   EDVQMPDGSWYGNWGVCFTYGSWFALGGLVAAGKSYNNSAAVRKGVEFLLRTQRSDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP   Y   E N SN+VQT+WA++GL+++ QA+RDP PLHRAAKLLIN+QMEDGD
Sbjct  658   ESYRSCPDKVYRELETNDSNLVQTAWALMGLIHSGQADRDPKPLHRAAKLLINSQMEDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+ITG +MKNCMLHYA++R+ +PL  L+EYRK V
Sbjct  718   FPQQEITGVFMKNCMLHYAAYRNIYPLWGLAEYRKNV  754



>ref|XP_011009932.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Populus euphratica]
 ref|XP_011009933.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Populus euphratica]
Length=758

 Score =   934 bits (2415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/756 (58%), Positives = 563/756 (74%), Gaps = 7/756 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKL++ EG GP+++STN + GRQIW ++PNA TPEEQ   E AR+ F   R       G
Sbjct  1     MWKLEVAEGDGPWLFSTNKFVGRQIWRFEPNAWTPEEQAQVEMAREKFRLNRFY-TKASG  59

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             D+    Q+IKE+++D L IPPVRL   EE++ E + TA+RKAVR   A+QA DGHWPAE 
Sbjct  60    DVLKNFQLIKENQID-LRIPPVRLGNGEEISREKVETALRKAVRFTSAIQASDGHWPAEF  118

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             SGPLF  PPL++ LY+S S+D +L++EHKKE++RY+YNHQNEDGGWG +I+ HSTM+G+A
Sbjct  119   SGPLFLMPPLIMVLYLSRSLDTVLSTEHKKEIIRYIYNHQNEDGGWGFHIESHSTMLGTA  178

Query  2046  LNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             LNYVALRLLGE      D A  + R W+L HGGAT IP+WGK+YLSVLG YEW GCNP+P
Sbjct  179   LNYVALRLLGEGPEGGRDGAATKARKWVLDHGGATMIPAWGKVYLSVLGTYEWSGCNPVP  238

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEF LFPS  PF P K+W + RT Y PMSYLY K++ GP+T+L+L +R E++++PY++ID
Sbjct  239   PEFLLFPSFLPFSPGKVWCHLRTVYTPMSYLYGKKFVGPITDLILQLRRELYIQPYEEID  298

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             WN  R  C KED Y   +  Q++L + + Y +E ++++WPF+K+RE A+++ I H+ Y  
Sbjct  299   WNKARHLCLKEDLYTSRSIAQNLLLDGVHYLSERLLKQWPFSKLREQALQEAIKHIHYED  358

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             E +RY+T  +IEKSL MM  WAEDP  D  K+HLARVPD LWLAEDGM  Q+ GSQ WDA
Sbjct  359   ESTRYMTHASIEKSLNMMACWAEDPTSDAFKFHLARVPDILWLAEDGMKTQSIGSQLWDA  418

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
              FATQA+I+S +V+EYG  L+KAH +LK SQI+EN  GDF+SMYRH SKGAW  S +DHG
Sbjct  419   AFATQAIIASNLVDEYGSTLRKAHEFLKLSQIQENAYGDFRSMYRHISKGAWTLSVKDHG  478

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCTAEA++ LLLL QM  EI GE +D + L+ A+D  L LQS ++GGF+VWEP   
Sbjct  479   WQVSDCTAEALRALLLLSQMPAEIVGETIDTERLHNAIDFLLSLQS-KNGGFSVWEPARG  537

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
             Q +LE+LNP++ F D++V+ E+VE T S +  L  FK  +P YR KE+ +S+A A+ Y+E
Sbjct  538   QRWLEVLNPTQAFGDVMVETEYVECTASAIQVLVLFKSLHPGYRRKEIEVSVANASSYIE  597

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
               Q +DGSWYG WGIC+ YGT FAL GL + G++Y NS  +RKA  F LSKQ+  GGWGE
Sbjct  598   DAQMSDGSWYGNWGICYTYGTYFALKGLASVGKTYRNSRTVRKACEFLLSKQHNSGGWGE  657

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                SC   KY   EGN+SNVVQT+WAM+GL+Y  QAE+DP PLH+AA+LLIN+QME+G+F
Sbjct  658   SYLSCANSKYTETEGNKSNVVQTAWAMMGLIYAGQAEKDPAPLHQAARLLINSQMENGEF  717

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             PQQ ITG+ ++ CMLHYAS ++ FPL AL EYRKRV
Sbjct  718   PQQQITGASLRTCMLHYASFKNIFPLWALGEYRKRV  753



>ref|XP_009612988.1| PREDICTED: beta-amyrin synthase [Nicotiana tomentosiformis]
 ref|XP_009612989.1| PREDICTED: beta-amyrin synthase [Nicotiana tomentosiformis]
 ref|XP_009612990.1| PREDICTED: beta-amyrin synthase [Nicotiana tomentosiformis]
 ref|XP_009612991.1| PREDICTED: beta-amyrin synthase [Nicotiana tomentosiformis]
Length=761

 Score =   934 bits (2414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/757 (57%), Positives = 555/757 (73%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLKI EG  GPY+YSTNNY GRQ WE+DPNAGT EE++  E+AR+ F   R K   + 
Sbjct  1     MWKLKIAEGQDGPYLYSTNNYVGRQTWEFDPNAGTQEERKEIEEARQQFWNNRYKVKPS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  RMQ +++      +IP V++ E EE+++E  T A+R+AV    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLRDKNFKQ-TIPAVKVEEGEEISHEVATAALRRAVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             +L+Y+ +R+LGE  D    +A AR R WIL HG  TAIPSWGK +LS+LGV+EW G NP+
Sbjct  179   SLSYICMRILGEGPDGGENNACARARKWILDHGSVTAIPSWGKTWLSILGVFEWLGTNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ G +T L+L +R E++ +PYD+I
Sbjct  239   PPEFWILPSFLPVHPAKMWCYCRMVYMPMSYLYGKRFVGSITPLILQLREELYDQPYDEI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +W   R  C KED YYPH  +QD++W++L  CTEP++ RWP NK+R  A+   + H+ Y 
Sbjct  299   NWRKVRHVCAKEDLYYPHPLVQDLMWDSLYICTEPLLTRWPVNKLRNKALEVTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
               FA QAL++S M +E  D LK+ H ++K+SQ+KENP GDFKSMYRH SKG+W FSDQDH
Sbjct  419   TGFAIQALLASEMNDEIADTLKRGHNFIKESQVKENPSGDFKSMYRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAEA+KC LL   M PE+ GE ++ + LY++V++ L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEALKCCLLFSTMPPELVGEAMEPRRLYDSVNVILSLQS-KNGGLAAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                YLE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+   IA A +YL
Sbjct  538   ASEYLELLNPTEFFADIVIEHEYVECTASSIQALVLFKKLYPGHRTKEIDNFIANAVKYL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WG+CF YG+ FAL GL AAG+SY +  A+RK   F L  Q  +GGWG
Sbjct  598   EDVQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKSYSSCAAVRKGVEFLLQTQRSDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP   Y   E + SN+VQT+WA++GL+++ Q  RDP PLH AA+LLIN+QMEDGD
Sbjct  658   ESYRSCPDKVYRELETDNSNLVQTAWALMGLIHSGQVGRDPRPLHHAARLLINSQMEDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+ITG +MKNCMLHYA++R+ +PL  L+EYRK V
Sbjct  718   FPQQEITGVFMKNCMLHYAAYRNIYPLWGLAEYRKNV  754



>ref|XP_009344015.1| PREDICTED: beta-amyrin synthase [Pyrus x bretschneideri]
Length=761

 Score =   934 bits (2414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/758 (58%), Positives = 564/758 (74%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLK+ +GG  PYIYSTN++ GRQI+E+DP AGT EE+   E+AR  F   R +   + 
Sbjct  1     MWKLKVADGGNDPYIYSTNSFVGRQIFEFDPEAGTTEERAEMEEARLHFYNNRHQVKPS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  RMQ ++E      +IPPV++   EE+ YE  T ++R++V    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREKNFKQ-TIPPVKVEVGEEITYEKATASLRRSVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCVYITGHLNTVFHAEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             ALNY+ +R+LGE  D    +A AR R WIL HG  T IPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALNYICMRILGEGPDGGQDNACARARKWILDHGSVTHIPSWGKTWLSILGVFEWFGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PYD+I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDEI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W   R  C KED YYPH +IQD LW++L  CTEP++ RWPFNK IR+ A+   + H+ Y
Sbjct  299   NWKGVRHHCAKEDIYYPHPWIQDFLWDSLYICTEPLLTRWPFNKLIRKRALEVTMEHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  WAEDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  FA QAL++S + +E    L + H ++K+SQ+K+NP GDFKSM+RH SKG+W FSDQD
Sbjct  419   DTGFAIQALLASNLTDEIAPTLARGHDFVKKSQVKDNPSGDFKSMHRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LLL  M PE+ GEK++ + LY+AV++ + LQS ++GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSMMPPELVGEKMEPERLYDAVNVLITLQS-KNGGLAAWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LEMLNP+E FADIVV+ E+VE T S + AL  FK  YP +R KE+   I  AA+Y
Sbjct  538   GAAEWLEMLNPTEFFADIVVEHEYVECTSSAIQALVLFKKLYPGHRKKEIDQFITNAAQY  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q  DGSWYG WG+CF YGT FAL GLTAAG+++ N   IRKA  F L+ QN+ GGW
Sbjct  598   LENIQMEDGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCAVIRKAVSFLLTMQNENGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  +Y+P EGNRSN+V T+WAM+GL+Y  QAERDP PLHRAAKL+IN+QME+G
Sbjct  658   GESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIYAGQAERDPAPLHRAAKLIINSQMENG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYRK V
Sbjct  718   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKWV  755



>ref|XP_010313624.1| PREDICTED: beta-amyrin synthase isoform X1 [Solanum lycopersicum]
Length=761

 Score =   934 bits (2413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/757 (57%), Positives = 549/757 (73%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLKI EG  GPY+YSTNNY GRQ WE+DPN GT EE+   E+ARK F   R K     
Sbjct  1     MWKLKIAEGQNGPYLYSTNNYVGRQTWEFDPNGGTIEERAKIEEARKQFWNNRYK-VKPS  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  R+Q + E       IP V++ E EE+++E  T A+ +AV    ALQA DGHWPAE
Sbjct  60    SDLLWRIQFLGEKNFKQ-KIPAVKVEEGEEISHEVATIALHRAVNFFSALQATDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE  D    +A AR R WIL HG  TAIPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGPDGGVNNACARARKWILDHGSVTAIPSWGKTWLSILGVFEWIGTNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PYD+I
Sbjct  239   PPEFWILPSFLPVHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYDRPYDEI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +W   R  C KED YYPH  +QD++W++L  CTEP++ RWPFNK+R  A+   + H+ Y 
Sbjct  299   NWKKVRHVCAKEDLYYPHPLVQDLMWDSLYICTEPLLTRWPFNKLRNKALEVTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDPN D  K HLAR+ D+LW+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARISDYLWVAEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
               FA QAL++S M +E  D L+K H ++KQSQ+  NP GDFK MYRH SKG+W FSDQDH
Sbjct  419   TGFAIQALLASEMNDEIADTLRKGHDFIKQSQVTNNPSGDFKGMYRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAEA+KC LLL  M  E+ G+ ++   LY++V++ L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEALKCCLLLSTMPRELVGQAMEPGRLYDSVNVILSLQS-KNGGLAAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                YLE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+ + I  A +YL
Sbjct  538   ASEYLELLNPTEFFADIVIEHEYVECTASSIQALVLFKKLYPGHRTKEINIFIDNAVKYL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WG+CF YG+ FAL GL AAG+SY NS A+RK   F L  Q  +GGWG
Sbjct  598   EDVQMPDGSWYGNWGVCFTYGSWFALGGLVAAGKSYNNSAAVRKGVEFLLRTQRSDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP   Y   E N SN+VQT+WA++GL+++ QA+RDP PLHRAAKLLIN+QMEDGD
Sbjct  658   ESYRSCPDKVYRELETNDSNLVQTAWALMGLIHSGQADRDPKPLHRAAKLLINSQMEDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+ITG +MKNCMLHYA++R+ +PL  L+EYRK V
Sbjct  718   FPQQEITGVFMKNCMLHYAAYRNIYPLWGLAEYRKNV  754



>ref|XP_010063691.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW70924.1| hypothetical protein EUGRSUZ_F04039 [Eucalyptus grandis]
Length=761

 Score =   931 bits (2407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/755 (57%), Positives = 554/755 (73%), Gaps = 8/755 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EG   PY+YSTNNY GRQIWE+DP AGT EE    E AR+ F   R +    C
Sbjct  1     MWRLKIAEGKDSPYLYSTNNYVGRQIWEFDPEAGTTEEHAEVEAARQHFHDHRHQ-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  R+Q ++E +    +IPPV++ + EE+ Y+  +TA+R+ V    ALQA+DGHWPAE
Sbjct  60    GDLLWRLQFLREKQFKQ-TIPPVKVEDGEEITYDKASTALRRTVHFFSALQARDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPL+F PPL++ +YI+G ++ +  +EH+KE++RYLYNHQN DGGWG +I+GHSTM  +
Sbjct  119   IAGPLYFLPPLVMGVYITGHLNAVFPAEHRKEILRYLYNHQNGDGGWGFHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE  D    +A  R R WIL  GG T IPSWGK +LS+ G+++W G NP+
Sbjct  179   ALSYICMRILGEGPDGGQDNACTRARKWILDRGGVTYIPSWGKTWLSIFGLFDWSGTNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T LV  +R E+H +PYD I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLVQQLREELHTQPYDMI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
              W   R  C KED YYPH  +QD++W++L   TEP++ RWPFNK+R  A++  I H+ Y 
Sbjct  299   CWRKVRHLCAKEDLYYPHPLVQDLIWDSLYIFTEPLLNRWPFNKLRGKALQVTIKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDP+ D  K HLAR+PD+LW+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPDSDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
               FA QAL++S M EE G  L + H ++K+SQ+K+NP GDFKSM+RH +KG+W FSDQDH
Sbjct  419   TGFAIQALLASNMTEEIGPVLARGHDFIKKSQVKDNPSGDFKSMHRHITKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +KC LLL  M PEI GEK++ + LY+AV+I L LQS ++GG   WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLLSMMRPEIVGEKMEPEKLYDAVNILLSLQS-KNGGLPAWEPTG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE+LNP+E F DIV++ E+VE T S ++AL  F+  YP +R KE+A  I+ + +YL
Sbjct  538   APAWLELLNPTEFFEDIVLEHEYVECTSSAINALVLFQKLYPGHRKKEIADFISNSVQYL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q+ DGSWYG WG+CF YG  FAL GL AAG++Y N  A+RK   F L  Q Q+GGWG
Sbjct  598   ENVQKPDGSWYGCWGVCFTYGLWFALGGLAAAGKTYSNCAAMRKGVAFLLRTQLQDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP  +Y+P EGNRSN+VQT+WAM+GL++  QAERDPTPLHRAAKLLIN+QMEDGD
Sbjct  658   ESYLSCPKKEYVPLEGNRSNLVQTAWAMMGLIHAGQAERDPTPLHRAAKLLINSQMEDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             +PQQ+ITG + KNCMLHY ++R+ +PL AL+EYR+
Sbjct  718   YPQQEITGVFNKNCMLHYPNYRNIYPLWALAEYRR  752



>gb|AIK19223.1| triterpene synthase [Eugenia uniflora]
Length=761

 Score =   931 bits (2406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/757 (57%), Positives = 551/757 (73%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EG  GP +YSTNNY GRQIWE+DP AGT EE+   E AR+ F   R +    C
Sbjct  1     MWRLKIAEGEDGPCLYSTNNYVGRQIWEFDPEAGTLEERAEVEAARRHFYDHRHQ-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  RMQ ++E +    +I PVR+ + EE+ Y+ ++TA+R+ V+   ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREKKFKQ-TIKPVRVEDGEEITYDKVSTALRRTVQFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPL+  PPL++ +YI+G +D +  +EH KE++RY+YNHQNEDGGWG +I+GHSTM  +
Sbjct  119   IAGPLYLLPPLVMCIYITGHLDAVFPAEHCKEILRYIYNHQNEDGGWGFHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE  D    +A AR R WIL  GG T+IPSWGK +LS+ G+++W G NP+
Sbjct  179   ALSYICMRILGEGPDGGQDNACARARKWILDRGGVTSIPSWGKTWLSIFGLFDWSGTNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T LV  +R E+H +PYD I
Sbjct  239   PPEFWILPSFLPIHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLVQQLREELHTQPYDTI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
              W   R  C KED YYPH  +QD++W++L   TEP + RWPFNK+RE A++  + H+ Y 
Sbjct  299   CWRKVRHLCAKEDLYYPHPLVQDLMWDSLYIFTEPFLNRWPFNKLREKALQVTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDP  D  K HLAR+PD+LW+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPEGDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
               FA QAL++S M EE    L + H ++K+SQ+K+NP GDFK M+RH SKG+W FSDQDH
Sbjct  419   TAFAVQALLASNMTEEIAPVLARGHDFIKKSQVKDNPSGDFKRMHRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +KC LL   M PEI GEK++ + LY+AV+I L LQS ++GG + WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLFSMMPPEIVGEKMEPEKLYDAVNILLSLQS-KNGGLSAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
              Q +LE+LNP+E F DIV++ ++VE T S + AL  F+  YP +R +E+   I  A  +L
Sbjct  538   AQAWLELLNPTEFFEDIVIEHQYVECTSSAIQALVLFRKLYPGHRKEEIENCIPNAVRFL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WG+CF YG+ FAL GL AAG++Y N  A+RK   F L  Q Q+GGWG
Sbjct  598   ENIQNPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYSNCAAVRKGVAFLLRTQLQDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP  +Y+P EGNRSN VQT WAM+GL++  QAERDPTPLHRAAKLLIN+QMEDGD
Sbjct  658   ESYLSCPKKEYVPLEGNRSNRVQTGWAMMGLIHAGQAERDPTPLHRAAKLLINSQMEDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             +PQQ+ITG+Y+KN MLHYA++R+ FPL AL+EYR+ V
Sbjct  718   YPQQEITGAYLKNGMLHYAAYRNIFPLWALAEYRRLV  754



>sp|E2IUA7.1|GLUTS_KALDA RecName: Full=Glutinol synthase; Short=KdGLS [Kalanchoe daigremontiana]
 gb|ADK35124.1| glutinol synthase [Kalanchoe daigremontiana]
Length=767

 Score =   931 bits (2406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/757 (57%), Positives = 557/757 (74%), Gaps = 11/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHT  2413
             MWKLKI +GG  PYI++TNN+ GRQIWE+DP A  P++    E AR  F   R K  P++
Sbjct  1     MWKLKIADGGSNPYIFTTNNFVGRQIWEFDPQATDPQQLAKVEAARLDFYHNRYKLKPNS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E +    +IP V++ + EEV+YEA+T A+R+ V L  ALQA DGHWPA
Sbjct  61    --DLLWRMQFLEEKDFRQ-NIPQVKVEDGEEVSYEAVTAALRRGVHLYSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GP+FF PP+++ LYI+G ++ I T EH+ E +RY+Y HQNEDGGWG +I+GHSTM G
Sbjct  118   ENAGPMFFMPPMVMCLYITGHLNAIFTEEHRSETLRYIYYHQNEDGGWGFHIEGHSTMFG  177

Query  2052  SALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + LNY+ +RLLGE      D+A++RGR WIL HGGAT+IPSWGK +LS++G+ +W GCNP
Sbjct  178   TVLNYICMRLLGEGPEGGQDNAVSRGRKWILDHGGATSIPSWGKTWLSIMGLCDWSGCNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFWL PS+ P HP KMW YCR  YMPMSYLY KR+   +T L+L +R EIH++PYDQ
Sbjct  238   MPPEFWLLPSYLPMHPGKMWCYCRMVYMPMSYLYGKRFTARITPLILQLREEIHIQPYDQ  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             IDW   R  CCKED YYPH  +QD+LW+ L   TEP++ RWP NK IR+ A++K + H+ 
Sbjct  298   IDWKKVRHVCCKEDMYYPHPLLQDLLWDTLYLTTEPLLTRWPLNKLIRQRALQKTMKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDPN D  K HLARVPD+ W+AEDGM +Q+FGSQ+
Sbjct  358   YEDENSRYITIGTVEKVLCMLACWVEDPNGDYFKKHLARVPDYFWVAEDGMKIQSFGSQH  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  F+ QAL++S M +E G  L KAH+ +K+SQ+K+NP GDF+SMYRH SKG+W FSDQ
Sbjct  418   WDTVFSAQALLASDMADEIGTTLAKAHYCIKESQVKDNPSGDFRSMYRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW +SDCTAE +KC LL   M PE+ GE +  + L+++V+I LYLQS ++GG   WEP
Sbjct  478   DHGWQLSDCTAEGLKCCLLFSLMQPEVVGEAMPPERLFDSVNILLYLQS-KNGGMPGWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LE+LNP+E F +IV++ E+VE T S V AL  FK  +P +R KEV   I   A+
Sbjct  537   AGASEWLELLNPTEFFENIVIEHEYVECTSSAVQALVLFKKLHPGHRRKEVERFITNGAK  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             Y+E  Q  DG+WYG WG+CF YG  FAL GL AAG++Y N  A+RK   F L  Q ++GG
Sbjct  597   YIEDIQMPDGAWYGNWGVCFTYGAWFALGGLAAAGKTYNNCAAVRKGVDFLLRIQLEDGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE  +SCP  KY+P E NRSN+V TSWA++GL+ + QA+RDP PLHRAAKLLIN+Q+ED
Sbjct  657   WGESYQSCPDKKYVPLEDNRSNLVHTSWALMGLLCSGQADRDPNPLHRAAKLLINSQLED  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             GDFPQQ+ITG +  NCMLH+A++RS FP+ AL+EY++
Sbjct  717   GDFPQQEITGVFKMNCMLHFAAYRSIFPVWALAEYKR  753



>gb|AAO33580.1|AF478455_1 multifunctional beta-amyrin synthase [Lotus japonicus]
Length=762

 Score =   931 bits (2406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/758 (57%), Positives = 552/758 (73%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLK+ +GG  PYI+S NN+ GRQ WEYDP+AGTPEE+   E+AR+ F   R K   TC
Sbjct  1     MWKLKVADGGKNPYIFSINNFVGRQTWEYDPDAGTPEERAQVEEARQDFYNNRYK-VKTC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GD   R Q+++E+     +IP V++ + E+V Y+ +TT VR+A      LQ  DGHWPA+
Sbjct  60    GDRLWRFQVMRENNFKQ-TIPSVKIEDGEKVTYDKVTTTVRRAAHHLAGLQTSDGHWPAQ  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPL FTPPL+  +YI+G +D +    ++KE++RY Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLLFTPPLIFCMYITGHLDSVFPEVYRKEILRYTYVHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              LNY+ +R+LGE  D    +A AR R WI  HGGAT I SWGK +LS+LG+++W G NP+
Sbjct  179   VLNYICMRILGEGPDGGQDNACARARKWIHDHGGATHIASWGKTWLSILGIFDWSGTNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+  +PY+++
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKV  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W   R  C KED YYPH  IQD++W++L   TEP + RWPFNK IRE A++  + H+ Y
Sbjct  299   NWKKARHQCAKEDLYYPHPLIQDLMWDSLYLFTEPFLTRWPFNKLIRERALQVTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
                 SRYITIG +EK L M+  W EDPN    K HLARVPD+LWLAEDGM MQ+FGSQ W
Sbjct  359   EDHNSRYITIGCVEKVLCMLACWVEDPNGIAFKRHLARVPDYLWLAEDGMCMQSFGSQEW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA FA QAL+S+ +++E G  L K H ++K SQ+K+NP GDFKSM+RH SKGAW FSDQD
Sbjct  419   DAGFAVQALLSTNLIDELGPALAKGHDFIKNSQVKDNPSGDFKSMHRHISKGAWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE  KC LLL  + PEI GEK++ + L++ V++ L LQS + GGFAVWEP 
Sbjct  479   HGWQVSDCTAEGFKCCLLLSMLPPEIVGEKIEPERLFDTVNLLLSLQS-KKGGFAVWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               Q +LE+LNP E F DIV++ E VE TGS + AL  FK+ YP++R KE+   IA A  Y
Sbjct  538   GAQEWLELLNPIEFFEDIVIEHELVECTGSAIGALVLFKNHYPEHRKKEIEDCIANAVRY  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
              E  Q ADGSWYG  GICF+YGT FAL GL AAG++Y N  AIRK   F L+ Q+++GGW
Sbjct  598   FEDIQTADGSWYGNAGICFIYGTWFALGGLEAAGKTYANCAAIRKGVKFLLTTQSKDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP   Y+P EGNRSNVVQT+WA++GL++  QAERDPTPLHRAAKLLIN+Q+EDG
Sbjct  658   GESYLSCPKKIYVPLEGNRSNVVQTAWALMGLIHAGQAERDPTPLHRAAKLLINSQLEDG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             D+PQQDITG Y+KNC LHY  +R+ F  MAL+EYR+RV
Sbjct  718   DWPQQDITGVYVKNCTLHYPMYRNNFTTMALAEYRRRV  755



>ref|XP_010027664.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
Length=761

 Score =   930 bits (2404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/757 (56%), Positives = 550/757 (73%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EG  GPY+YSTNNY GRQ W++DP AGT EE    E AR+ F   R +    C
Sbjct  1     MWRLKIAEGEDGPYLYSTNNYVGRQTWKFDPEAGTTEEHAQVEAARQHFYDHRHQ-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  RMQ ++E +    +IPPVR+ + EE+ Y+  +TA+R+ V    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREQQFKQ-AIPPVRVEDGEEITYDKASTALRRTVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPL+F PPL++ +YI+G ++ +  +EH+KE++RYLYNHQNEDGGWG +I+GHSTM  +
Sbjct  119   IAGPLYFLPPLVMCVYITGHLNTVFPAEHRKEILRYLYNHQNEDGGWGFHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE  D    +A  R R WIL  GG T IPSWGK +LS+ G+++W G NP+
Sbjct  179   ALSYICMRILGEGPDGGQYNACTRARKWILDRGGVTYIPSWGKTWLSIFGLFDWSGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCRT YMPMSYLY KR+ GP+T  V  +R E+H +PYD I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRTVYMPMSYLYGKRFVGPITPFVQQLRKELHTQPYDMI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
              W   R  C KED YYPH  +QD++W++L    EP++  WPFN++RE A++  + H+ Y 
Sbjct  299   CWRKVRHLCAKEDLYYPHPLVQDLIWDSLYIFIEPLLNHWPFNRLREKALQVTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDP+ D  K HLAR+PD+LW+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPDSDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
               FA QAL++S M EE G  L + H ++K+SQ+K+NP GDFKSM+RH +KG+W FSDQDH
Sbjct  419   TGFAIQALLASNMTEEIGPVLARGHDFIKKSQVKDNPSGDFKSMHRHITKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +KC LL   M PEI GEK+  + LY+AV+I L LQS ++GG   WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLFSMMPPEIVGEKMKPERLYDAVNILLSLQS-KNGGLPAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE+LNP+E F DIV++ E+VE T S + AL  F+  YP++R KE+   I+ + EYL
Sbjct  538   APAWLELLNPTEFFEDIVIEHEYVECTSSAIQALVLFRKLYPEHREKEIEDFISNSVEYL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WG+CF YG+ FAL GL AAG++Y N  A+RK   F L  Q Q+GGWG
Sbjct  598   ENVQLPDGSWYGCWGVCFTYGSWFALGGLAAAGKTYSNCAAMRKGVAFLLRTQLQDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP  +Y+P EGNRSN+VQT+WAM+GL+   QAERDPTPLHRAAKLLIN+QMEDGD
Sbjct  658   ESYLSCPKKEYVPLEGNRSNLVQTAWAMMGLIQAGQAERDPTPLHRAAKLLINSQMEDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             +PQQ++TG + KNCMLHY ++R+ +PL AL+EYR RV
Sbjct  718   YPQQELTGVFNKNCMLHYPNYRNTYPLWALAEYRTRV  754



>ref|XP_007214978.1| hypothetical protein PRUPE_ppa001812mg [Prunus persica]
 gb|EMJ16177.1| hypothetical protein PRUPE_ppa001812mg [Prunus persica]
Length=761

 Score =   930 bits (2403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/761 (57%), Positives = 566/761 (74%), Gaps = 11/761 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLK+ +GG  PYIYSTNN+ GRQI+E+DP AGTPEE+   E+AR  F   R +     
Sbjct  1     MWKLKVADGGNDPYIYSTNNFVGRQIFEFDPEAGTPEERAEVEEARLNFYNNRHQ-VKPS  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  RMQ +KE+     +IPPV++ + EE+ YE  T ++R++V    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLKENNFKQ-TIPPVKVEDGEEITYEKATASLRRSVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFF PPL++  YI+G ++ +  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCTYITGHLNTVFPAEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE  D    +A AR R WIL HG  T +PSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGPDGGQDNACARVRKWILDHGSVTHMPSWGKTWLSILGVFEWSGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PY++I
Sbjct  239   PPEFWVLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYNEI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W   R  C KED YYPH +IQD++W++L  CTEP++ RWPFNK +RE A++  + H+ Y
Sbjct  299   NWKGVRHHCAKEDIYYPHPWIQDIMWDSLYICTEPLLTRWPFNKLVREKALQVTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  WAEDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQEW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  FA QAL++S + +E G  L + H ++K+SQ+K+NP GDFKSMYRH SKG+W FSDQD
Sbjct  419   DTGFAIQALLASNLTDEIGPTLARGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LL   M P+I GEK++ + LY+++++ L LQS ++GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLFSMMRPDIVGEKMEPERLYDSINVLLSLQS-KNGGLAAWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LEMLNP+E FADIVV+ E+VE T S + AL  FK  YP +R KE+   I  A +Y
Sbjct  538   GAADWLEMLNPTEFFADIVVEHEYVECTSSAIQALVLFKKLYPGHRKKEIDHFITNATQY  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE+ Q  DGSWYG WG+CF YG+ FAL GL AAG+++ N  A+RK  +F L  Q + GGW
Sbjct  598   LESIQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTFINCLAMRKGVNFLLKTQRENGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  +Y+P EGNRSN+V T WAM+GL++  QA+RDP PLHRAAKL+IN+QME+G
Sbjct  658   GESYLSCPKKEYVPLEGNRSNLVHTGWAMMGLIHAGQADRDPAPLHRAAKLIINSQMENG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             DFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYRK  W+S
Sbjct  718   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRK--WVS  756



>ref|XP_008228023.1| PREDICTED: beta-amyrin synthase [Prunus mume]
Length=761

 Score =   929 bits (2401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/759 (57%), Positives = 562/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MWKLK+ +GG  PYIYSTN++ GRQI+E+D  AGTPEE+   E+AR  F   R Q  P  
Sbjct  1     MWKLKVADGGNDPYIYSTNDFVGRQIFEFDAEAGTPEERAEVEEARLNFYNNRYQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GDL  RMQ +KE      +IPPV++ + EE+ YE  T ++R++V    ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLKEKNFKQ-TIPPVKVEDGEEITYEKATASLRRSVHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++  YI+G ++ +  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM G
Sbjct  118   ENAGPLFFLPPLVMCTYITGHLNTVFPAEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFG  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +AL+Y+ +R+LGEE D    +A AR R WIL HG  T +PSWGK +LS+LGV+EW G NP
Sbjct  178   TALSYICMRILGEEPDGGQDNACARARKWILDHGSVTHMPSWGKTWLSILGVFEWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PY +
Sbjct  238   MPPEFWMLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAEPYHE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W   R  C KED YYPH +IQD++W++L  CTEP++ RWPFNK IRE A++  + H+ 
Sbjct  298   INWKGVRHLCAKEDIYYPHPWIQDIMWDSLYICTEPLLNRWPFNKLIREKALQVTMKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWDEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQ  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S + +E G  L + H ++K+SQ+K+NP GDFKSMYRH SKG+W FSDQ
Sbjct  418   WDTGFAIQALLASNLTDEIGPTLARGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LL   M PEI GEK++ + LY++V++ L LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLFSMMRPEIIGEKMEPERLYDSVNVLLSLQS-KNGGLAAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LEMLNP+E F DIVV+ E+VE T S + AL  FK  YP +R KE+   I  A E
Sbjct  537   AGAADWLEMLNPTEFFEDIVVEHEYVECTSSAIQALVLFKKLYPGHRKKEIDHFITNATE  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG WG+CF YG+ FAL GL AAG+++ N  A+RK  +F L  Q + GG
Sbjct  597   YLENIQIPDGSWYGNWGVCFTYGSWFALGGLAAAGKTFNNCLAMRKGVNFLLKTQRENGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +Y+P EGNRSN+V T+WAM+GL++  QA+RDP PLHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIHAGQADRDPAPLHRAAKLIINSQMEN  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG + KNCMLHYA++R+ +PL AL+EYRK+V
Sbjct  717   GDFPQQEITGVFQKNCMLHYATYRNIYPLWALAEYRKQV  755



>gb|AGG09939.1| beta-amyrin synthase [Panax quinquefolius]
 gb|AGK62450.1| beta-amyrin synthase [Panax quinquefolius]
Length=761

 Score =   929 bits (2401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/758 (57%), Positives = 556/758 (73%), Gaps = 10/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGP-YIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+L   +GG   Y+YSTNN+ GRQ WE+DP+ GTP E+   E+AR  F   R Q  P  
Sbjct  1     MWRLMTAKGGNDLYLYSTNNFIGRQTWEFDPDYGTPAERAEVEEARLHFWNNRYQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GD+  RMQ +KE     + IP V++ + EE+ YEA TT +R+AV    ALQA DGHWPA
Sbjct  59    SGDVLWRMQFLKEKNFKQI-IPQVKVEDGEEITYEAATTTLRRAVHYFSALQADDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++ LYI+G ++ +  +EH+ E++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCLYITGHLNTVFPAEHRIEILRYIYCHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +AL+Y+ +R+LGE      ++A AR R WIL HG  TAIPSWGK +LS+LG+++W G NP
Sbjct  178   TALSYICMRILGEGRNGGENNACARARKWILDHGSVTAIPSWGKTWLSILGLFDWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ P   P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ + YD+
Sbjct  238   MPPEFWILPPFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQAYDE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I+W   R  C KED YYPH  IQD++W++L   TEP + RWPFNK+RE A++  + H+ Y
Sbjct  298   INWRKVRHNCAKEDLYYPHPLIQDLMWDSLYIFTEPFLTRWPFNKLREKALQTTMKHIHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLAR+PD++W+AEDGM MQ+FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGMKMQSFGSQEW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  FA QAL++S + +E    L K H ++K+SQ+KENP GDFKSM+RH SKG+W FSDQD
Sbjct  418   DTGFAIQALLASDLTDEIRPTLMKGHDFIKKSQVKENPSGDFKSMHRHISKGSWTFSDQD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAEA+KC LL  +M  EI G+K++   L++AV+I L LQS ++GG A WEP 
Sbjct  478   HGWQVSDCTAEALKCCLLFSRMPTEIVGDKMEDNQLFDAVNILLSLQS-KNGGLAAWEPA  536

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LE+LNP+E F DIV++ E+VE T S + A+  FK  YP +R KE+ +SI  A +Y
Sbjct  537   GSSEWLELLNPTEFFEDIVIEHEYVECTSSAIQAMVMFKKLYPGHRKKEIEVSITNAVQY  596

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q+ DGSWYG WG+CF YGT FA+ GLTAAG++Y NS+ + KA  F +  Q  +GGW
Sbjct  597   LEDIQKPDGSWYGNWGVCFTYGTWFAMGGLTAAGKTYNNSQTLHKAVDFLIKSQRSDGGW  656

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  +Y P EGNRSN+V TSWAM+GL+++ QAERDPTPLHRAAKLLIN+QME G
Sbjct  657   GESYLSCPNKEYTPLEGNRSNLVHTSWAMMGLIHSGQAERDPTPLHRAAKLLINSQMESG  716

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYRK V
Sbjct  717   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKNV  754



>ref|XP_011085901.1| PREDICTED: beta-amyrin synthase-like [Sesamum indicum]
Length=763

 Score =   929 bits (2400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/758 (57%), Positives = 555/758 (73%), Gaps = 10/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LKI EG   PY+YSTNNY GRQIWE+DPN GTP+ ++  EKAR+ F   R Q  P +
Sbjct  1     MWRLKIAEGVDSPYLYSTNNYVGRQIWEFDPNYGTPQLRQEVEKARQDFWANRYQVKPSS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  R+Q + E+     +IP V++ + E+V YE  TT +R+AV    ALQA DGHWPA
Sbjct  61    --DLLWRLQFLHENNFKQ-TIPQVKVGDGEDVTYEMATTTLRRAVHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++ LYI+G ++ +  +EH+  ++R  Y HQNEDGGWG +I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMILYITGHLNTVFPAEHRYTVIRCTYTHQNEDGGWGFHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +AL+Y+ +R+LGE  D    +A  R R WIL HG  TAIPSWGK +LS+LGV++W G NP
Sbjct  178   TALSYICMRILGEGPDGGENNACTRARKWILDHGTVTAIPSWGKTWLSILGVFDWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFWL PS  P HPAKM  YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PY+Q
Sbjct  238   MPPEFWLLPSFLPMHPAKMMCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYDQPYEQ  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I+W + R  C KED YYPH  IQD++W++    TEP++ RWPFNK+RE A++  + H+ Y
Sbjct  298   INWRSVRHRCAKEDLYYPHPLIQDLIWDSCYVLTEPLLTRWPFNKLREKALQVTMKHIHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLAR+PD++W+AEDGM MQ+FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGMKMQSFGSQEW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D +FA QAL++S + +E G+ L+  H ++K+SQ+K++P GDF+SMYRH SKG+W FSDQD
Sbjct  418   DTSFAIQALLASNLTDEIGETLRLGHDFIKKSQVKDDPSGDFRSMYRHISKGSWTFSDQD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LL   M P+I GEK++ +  Y AV+I L LQ  ++GG AVWEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSMMPPDIVGEKMEPEGFYNAVNILLSLQR-KNGGLAVWEPA  536

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LE+LNP+E F DIVV+ E+VE T S + AL  FK  YP++  KE+   IAKA  Y
Sbjct  537   GASDWLELLNPTEFFVDIVVEHEYVECTSSAIQALVLFKQLYPEHWKKEIESFIAKAVGY  596

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q+ DGSWYG WG+CF YGT FAL GL AAG+SY N  A+RKA  F L  Q   GGW
Sbjct  597   LEDVQRPDGSWYGNWGVCFTYGTWFALGGLAAAGKSYNNCAAVRKAVDFLLKAQRDNGGW  656

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP   Y+P E NRSN+V T+WAM+GL+++ QA+RDPTPLHR AKLLIN+Q+EDG
Sbjct  657   GESYLSCPKKVYVPLEDNRSNLVHTAWAMMGLIHSGQADRDPTPLHRGAKLLINSQLEDG  716

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  717   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKRV  754



>sp|Q9MB42.1|BAMS_GLYGL RecName: Full=Beta-amyrin synthase [Glycyrrhiza glabra]
 dbj|BAA89815.1| beta-amyrin synthase [Glycyrrhiza glabra]
Length=765

 Score =   929 bits (2400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/759 (57%), Positives = 558/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LKI EGG  PYIYSTNN+ GRQ WEYDP+ GTPEE+   + AR  F   R Q  P  
Sbjct  1     MWRLKIAEGGKDPYIYSTNNFVGRQTWEYDPDGGTPEERAQVDAARLHFYNNRFQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             CGDL  R Q+++E+     +I  V++ + EE+ YE  TTAVR+A     ALQ  DGHWPA
Sbjct  59    CGDLLWRFQILRENNFKQ-TIASVKIGDGEEITYEKATTAVRRAAHHLSALQTSDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             + +GPLFF PPL+  +YI+G +D +   E++KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   QIAGPLFFLPPLVFCMYITGHLDSVFPEEYRKEILRYIYYHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ +R+LGE  D    +A AR R WI  HGG T IPSWGK +LS+LGV++W G NP
Sbjct  178   TALNYICMRILGEGPDGGQDNACARARKWIHDHGGVTHIPSWGKTWLSILGVFDWCGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+  +PY++
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTEPYEK  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             ++W   R  C KED YYPH  +QD++W++L   TEP++ RWPFNK +RE A++  + H+ 
Sbjct  298   VNWKKARHQCAKEDLYYPHPLLQDLIWDSLYLFTEPLLTRWPFNKLVREKALQVTMKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDPN D  K HLARVPD+LW++EDGMTMQ+FGSQ 
Sbjct  358   YEDETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMTMQSFGSQE  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WDA FA QAL+++ +VEE    L K H ++K+SQ+++NP GDFKSMYRH SKG+W FSDQ
Sbjct  418   WDAGFAVQALLATNLVEEIAPTLAKGHDFIKKSQVRDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LLL  + PEI GEK++ + LY++V++ L LQS + GG + WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQS-KKGGLSAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP+E FADIVV+ E+VE TGS + AL  FK  YP +R KE+   IA A  
Sbjct  537   AGAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFIANAVR  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             +LE  Q ADGSWYG WG+CF YG+ FAL GL AAG+++ N  AIRKA  F L+ Q ++GG
Sbjct  597   FLEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTFANCAAIRKAVKFLLTTQREDGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   S P   Y+P EG+RSNVV T+WA++GL++  QAERDP PLHRAAKL+IN+Q+E+
Sbjct  657   WGESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQAERDPAPLHRAAKLIINSQLEE  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GD+PQQ+ITG +MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  717   GDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  755



>gb|AAO33579.1|AF478454_1 putative beta-amyrin synthase [Lotus japonicus]
Length=750

 Score =   928 bits (2399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/746 (57%), Positives = 555/746 (74%), Gaps = 8/746 (1%)
 Frame = -3

Query  2553  PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCGDLFMRMQMIKE  2374
             PYI+STNN+ GRQ WEYDP+AGTPEE+   E+AR+ F   R K    CGDL  R Q+++E
Sbjct  1     PYIFSTNNFVGRQTWEYDPDAGTPEERAQVEEARQDFYNNRYK-VKPCGDLLWRFQVLRE  59

Query  2373  SEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAENSGPLFFTPPLM  2194
             +     +IP V++ + EE+ YE  TT +++A     ALQ  DGHWPA+ +GPLFF PPL+
Sbjct  60    NNFKQ-TIPSVKIEDGEEITYEKATTTLKRAAHHLAALQTSDGHWPAQIAGPLFFQPPLV  118

Query  2193  IALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSALNYVALRLLGE  2014
               +YI+G ++ +   E++KE++RY+Y HQNEDGGWGL+I+GHSTM  +ALNY+ +R+LGE
Sbjct  119   FCMYITGHLNSVFPEEYRKEILRYIYVHQNEDGGWGLHIEGHSTMFCTALNYICMRMLGE  178

Query  2013  EAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPPEFWLFPSHFP  1846
               D    +A AR R WIL HGG T IPSWGK +LS+LG+++W G NP+PPEFW+ PS  P
Sbjct  179   GPDGGQDNACARARKWILDHGGVTHIPSWGKTWLSILGIFDWKGSNPMPPEFWILPSFLP  238

Query  1845  FHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDWNNTRMACCKE  1666
              HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+  +PY++++W   R  C KE
Sbjct  239   MHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKVNWKKARHQCAKE  298

Query  1665  DTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRYGAEESRYITIGA  1489
             D YYPH  IQD++W++L   TEP++ RWPFNK +RE A+   + H+ Y  E SRYITIG 
Sbjct  299   DIYYPHPLIQDLMWDSLYLFTEPLLTRWPFNKLVREKALEVTMKHIHYEDENSRYITIGC  358

Query  1488  IEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDATFATQALISS  1309
             +EK L M+  W EDPN D  K HLARVPD+LW++EDGM MQ+FGSQ WDA FA QAL+++
Sbjct  359   VEKVLCMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMCMQSFGSQEWDAGFAVQALLAT  418

Query  1308  GMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGWVVSDCTAEA  1129
              +V+E G  L K H ++K+SQ+++NP GDFK+M+RH SKG+W FSDQDHGW VSDCTAE 
Sbjct  419   NLVDELGPTLAKGHDFIKKSQVRDNPSGDFKNMHRHISKGSWTFSDQDHGWQVSDCTAEG  478

Query  1128  IKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQPYLEMLNPS  949
             +KC LLL  + P+I GEK++ +CL+++V++ L LQS + GG A WEP   Q +LE+LNP+
Sbjct  479   LKCCLLLSMLPPDIVGEKMEPECLFDSVNLLLSLQS-KKGGLAAWEPAGAQEWLELLNPT  537

Query  948   ELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLETQQQADGSWY  769
             E FADIVV+ E+VE TGS + AL  FK  YP +R KE+   I++A  +LE  Q ADGSWY
Sbjct  538   EFFADIVVEHEYVECTGSAIGALVLFKKLYPGHRKKEIENFISEAVRFLEDTQTADGSWY  597

Query  768   GYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGECLESCPTMKY  589
             G WG+CF YG+ FAL GL AAG++Y N  AIRKA  F L+ Q  +GGWGE   S P   Y
Sbjct  598   GNWGVCFTYGSWFALGGLAAAGKTYANCAAIRKAVKFLLTTQRGDGGWGESYLSSPKKIY  657

Query  588   IPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFPQQDITGSYM  409
             +PFEGNRSNVV T+WA++GL+++ QAERDPTPLHRAAKLLIN+Q+E+GD+PQQ+ITG +M
Sbjct  658   VPFEGNRSNVVHTAWALMGLIHSGQAERDPTPLHRAAKLLINSQLEEGDWPQQEITGVFM  717

Query  408   KNCMLHYASHRSYFPLMALSEYRKRV  331
             KNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  718   KNCMLHYPMYRDIYPMWALAEYRRRV  743



>sp|O82146.1|BAMS2_PANGI RecName: Full=Beta-Amyrin Synthase 2 [Panax ginseng]
 dbj|BAA33722.1| beta-Amyrin Synthase [Panax ginseng]
Length=761

 Score =   928 bits (2398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/758 (56%), Positives = 555/758 (73%), Gaps = 10/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+L   +GG  PY+YSTNN+ GRQ WE+DP+ GTP E+   E+AR  F   R Q  P +
Sbjct  1     MWRLMTAKGGNDPYLYSTNNFIGRQTWEFDPDYGTPAERAEVEEARLHFWNNRYQVKPSS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               D+  RMQ +KE     + IP V++ + EE+ YEA TT +R+AV    ALQA DGHWPA
Sbjct  61    --DVLWRMQFLKEKNFKQI-IPQVKVEDGEEITYEAATTTLRRAVHYFSALQADDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++ LYI+G ++ +  +EH+ E++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCLYITGHLNTVFPAEHRIEILRYIYCHQNDDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +AL+Y+ +R+LGE  D    +A AR R WIL HG  TAIPSWGK +LS+LG+++W G NP
Sbjct  178   TALSYICMRILGEGRDGGENNACARARKWILDHGSVTAIPSWGKTWLSILGLFDWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ P   P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ + YD+
Sbjct  238   MPPEFWILPPFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQAYDE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I+W   R  C KED YYPH  IQD++W++L   TEP + RWPFNK+RE A++  + H+ Y
Sbjct  298   INWRKVRHNCAKEDLYYPHPLIQDLMWDSLYIFTEPFLTRWPFNKLREKALQTTMKHIHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLAR+PD++W+AEDGM MQ+FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLACWVEDPNGDYFKQHLARIPDYIWVAEDGMKMQSFGSQEW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  FA QAL++S +++E    L K H ++K+SQ+KENP GDFKSM+RH SKG+W FSDQD
Sbjct  418   DTGFAIQALLASDLIDEIRPTLMKGHDFIKKSQVKENPSGDFKSMHRHISKGSWTFSDQD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAEA+KC LL  +M  EI G+K++   L++AV++ L LQS ++GG A WEP 
Sbjct  478   HGWQVSDCTAEALKCCLLFSRMPTEIVGDKMEDNQLFDAVNMLLSLQS-KNGGLAAWEPA  536

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LE+LNP+E F DIV++ E+VE T S + A+  FK  YP +R KE+ +SI  A +Y
Sbjct  537   GSSEWLELLNPTEFFEDIVIEHEYVECTSSAIQAMVMFKKLYPGHRKKEIEVSITNAVQY  596

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q  DGSWYG WG+CF YGT FA+ GLTAAG++Y N + + KA  F +  Q  +GGW
Sbjct  597   LEDIQMPDGSWYGNWGVCFTYGTWFAMGGLTAAGKTYNNCQTLHKAVDFLIKSQRSDGGW  656

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  +Y P EGNRSN+V TSWAM+GL+++ QAERDPTPLHRAAKLLIN+QME G
Sbjct  657   GESYLSCPNKEYTPLEGNRSNLVHTSWAMMGLIHSRQAERDPTPLHRAAKLLINSQMESG  716

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DFPQQ+ITG +MKNCMLHYA+ R+ +PL AL+EYRK V
Sbjct  717   DFPQQEITGVFMKNCMLHYAASRNIYPLWALAEYRKNV  754



>ref|XP_007214977.1| hypothetical protein PRUPE_ppa001810mg [Prunus persica]
 gb|EMJ16176.1| hypothetical protein PRUPE_ppa001810mg [Prunus persica]
Length=761

 Score =   928 bits (2398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/759 (57%), Positives = 562/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MWKLK+ +GG  PYIYSTN++ GRQI+E+DP AGTPEE+   E+AR  F   R Q  P  
Sbjct  1     MWKLKVADGGNDPYIYSTNDFVGRQIFEFDPEAGTPEERAEVEEARLNFYNNRYQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GDL  RMQ +KE+     +IPPV++ + EE+ YE  T ++R++V    ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLKENNFKQ-TIPPVKVEDGEEITYEKATASLRRSVHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++  YI+G ++ +  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCTYITGHLNTVFPAEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +AL+Y+ +R+LGE  D    +A AR R WIL HG  T +PSWGK +LS+LGV+EW G NP
Sbjct  178   TALSYICMRILGEGPDGGQNNACARARKWILDHGSVTHMPSWGKTWLSILGVFEWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PYD 
Sbjct  238   MPPEFWMLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDA  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W   R  C KED YYPH +IQD++W++L  CTEP++ RWPFNK +RE A++  + H+ 
Sbjct  298   INWKGVRHLCAKEDIYYPHPWIQDIMWDSLYICTEPLLTRWPFNKLVREKALQVTMKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  WAEDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQ  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S + +E G  L + H ++K+SQ+K+NP GDFKSM+RH SKG+W FSDQ
Sbjct  418   WDTGFAIQALLASNLTDEIGPTLARGHDFIKKSQVKDNPSGDFKSMHRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LL   M P+I GEK++ Q LY++V++ L LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLFSTMRPDIVGEKMEPQRLYDSVNVLLSLQS-KNGGLAAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LEMLNP+E FADIVV+ E+VE T S + +L  FK  YP +R KE+   I  A E
Sbjct  537   AGAAEWLEMLNPTEFFADIVVEHEYVECTSSAIQSLVLFKKLYPGHRKKEIDNFITNATE  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG WG+CF YG+ FAL GL AAG+++ N   +RK  +F L+ Q + GG
Sbjct  597   YLENIQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTFNNCLTVRKGVNFLLTTQRENGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +Y+P E NRSN+V T+WAM+GL+   QAERDP PLHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEENRSNLVHTAWAMMGLIQAGQAERDPAPLHRAAKLIINSQMEN  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYRK V
Sbjct  717   GDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKWV  755



>ref|XP_006582958.1| PREDICTED: beta-amyrin synthase isoform X1 [Glycine max]
Length=762

 Score =   926 bits (2393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/758 (56%), Positives = 556/758 (73%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI +GG  PYI+STNN+ GRQ WE+DP AG+PEE+   E AR+ F   R K    C
Sbjct  1     MWRLKIADGGNDPYIFSTNNFVGRQTWEFDPEAGSPEERAQVEAARQHFYHNRFK-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  R Q+++E+     +IP V + + EE+ Y+ +T+AVR+      ALQ  DGHWPA+
Sbjct  60    ADLLWRFQVLRENNFKQ-TIPRVTIEDGEEITYQKVTSAVRRGAHHLAALQTSDGHWPAQ  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPLFF PPL+  +YI+G+++ +   EH+KE++RY Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFLPPLVFCMYITGNLESVFPEEHRKEILRYTYYHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             ALNY+ +R+LGE      D+A AR R WI  HGG T IPSWGK +LS+LGV++W G NP+
Sbjct  179   ALNYICMRMLGEGPNGGHDNACARARKWIRDHGGVTHIPSWGKTWLSILGVFDWCGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+  +PY+++
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKV  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W   R  C KED YYPH  IQD++W++L   TEP++ RWPFNK IRE A++  + H+ Y
Sbjct  299   NWKKARHQCAKEDLYYPHPLIQDLIWDSLYIFTEPLLTRWPFNKLIREKALQVTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLARVPD+LW++EDGMTMQ+FGSQ W
Sbjct  359   EDETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMTMQSFGSQEW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA FA QAL+++ ++EE G    K H ++K+SQ+K+NP GDFKSM+RH SKG+W FSDQD
Sbjct  419   DAGFAVQALLATNIIEEIGPTFAKGHDFIKKSQVKDNPFGDFKSMHRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LLL  + PEI GEK++ + LY++V++ L LQS + GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQS-KKGGLAAWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               Q +LE+LNP+E FADIVV+ E+VE TGS + AL  FK  YP +R KE+   I  A  +
Sbjct  538   GAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFITNAVRF  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q ADGSWYG WG+CF YG+ FAL GL AAG++Y N  AIRKA  F L+ Q ++GGW
Sbjct  598   LEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTYTNCAAIRKAVKFLLTTQREDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   S P   Y+P EG+RSNVV T+WA++GL++  QA+RDP PLHRAAKLLIN+Q+E+G
Sbjct  658   GESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQADRDPMPLHRAAKLLINSQLEEG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             D+PQQ+ITG +MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  718   DWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  755



>ref|XP_003531781.1| PREDICTED: beta-amyrin synthase-like isoform 1 [Glycine max]
Length=762

 Score =   926 bits (2392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/758 (56%), Positives = 557/758 (73%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EGG   YI+STNN+ GRQ WE+DP AGTPEE+   E ARK F   R K    C
Sbjct  1     MWRLKIAEGGNEAYIFSTNNFVGRQTWEFDPEAGTPEERAQVEAARKDFYHHRFK-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  R Q+++E+     +IP V++ + EE+ Y+ +T+ VR+      ALQ  DGHWPA+
Sbjct  60    ADLLWRFQILRENNFKQ-TIPSVKIEDGEEITYQKVTSTVRRGAHHLAALQTSDGHWPAQ  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPLFF PPL+  +YI+G ++ +   EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFLPPLVFCMYITGHLESVFPEEHRKEILRYIYYHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             ALNY+ +R+LGE  +    +A AR RNWI  HGG T IPSWGK +LS+LGV++W G NP+
Sbjct  179   ALNYICMRILGEGPNGGHYNACARARNWIRDHGGVTHIPSWGKTWLSILGVFDWCGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+  +PY+++
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKV  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W   R    KED YYPH  +QD++W++L   TEP++ RWPFNK IRE A++  + H+ Y
Sbjct  299   NWKKARHQYAKEDLYYPHPLVQDLIWDSLYIFTEPLLTRWPFNKLIREKALQVTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW++EDGMTMQ+FGSQ W
Sbjct  359   EDETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARIPDYLWVSEDGMTMQSFGSQEW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA FA QA +++ ++EE G  L K H ++K+SQ+K+NP GDFKSMYRH SKG+W FSDQD
Sbjct  419   DAGFAVQAFLATNLIEEIGPTLAKGHDFIKKSQVKDNPLGDFKSMYRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE++KC LLL  + PEI GEK++ + LY++V++ L LQS + GG A WE  
Sbjct  479   HGWQVSDCTAESLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQS-KKGGLAAWELA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               Q +LE+LNP+E FADIVV+ E+VE TGS + AL  FK+ YP +R KE+   IA A  +
Sbjct  538   GAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKNLYPGHRKKEIENFIANAVRF  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q ADGSWYG WG+CF YG+ FAL GL AAG++Y N  AIRKA  F LS Q ++GGW
Sbjct  598   LEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTYINCAAIRKAVKFLLSTQREDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   S P   Y+P EG+RSNVV T+WA++GL++  QA+RDP PLHRAAKLLIN+Q+E+G
Sbjct  658   GESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQADRDPKPLHRAAKLLINSQLEEG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             D+PQQ+ITG +MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  718   DWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  755



>ref|XP_010027785.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW83384.1| hypothetical protein EUGRSUZ_B00318 [Eucalyptus grandis]
Length=761

 Score =   925 bits (2391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/757 (56%), Positives = 547/757 (72%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EG  GPY+YSTNNY GRQ WE+DP AGT EE    E AR+ F   R +    C
Sbjct  1     MWRLKIAEGEDGPYLYSTNNYVGRQTWEFDPEAGTTEEHAEVEAARQHFYDHRHQ-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  RMQ ++E +    +IPPVR+ + EE+ Y+  +TA+R+ V    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREQQFKQ-TIPPVRVEDGEEITYDKASTALRRTVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPL+F PPL++ +YI+G ++ +  +EH+KE++RYLYNHQNEDGGWG +I+GHSTM  +
Sbjct  119   IAGPLYFLPPLVMCVYITGHLNTVFPAEHRKEILRYLYNHQNEDGGWGFHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE  D    +A  R R WIL  GG T IPSWGK +LS+ G+++W G NP+
Sbjct  179   ALSYICMRILGEGPDGGQYNACTRARKWILDRGGVTYIPSWGKTWLSIFGLFDWSGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYL  KR+ GP+T  V  +R E+H +PYD I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLCGKRFVGPITPFVQQLREELHTQPYDMI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
              W   R  C KED YYPH  +QD++W++L    EP++  WPFN++RE A++  + H+ Y 
Sbjct  299   CWRKVRHLCAKEDLYYPHPLVQDLIWDSLYIFIEPLLNHWPFNRLREKALQVTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDP  D  K HLAR+PD+LW+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPESDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
               FA QAL++S M EE G  L + H ++K+SQ+K+NP GDFKSM+RH +KG+W FSDQDH
Sbjct  419   TGFAIQALLASNMTEEIGPVLARGHDFIKKSQVKDNPSGDFKSMHRHITKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +KC LL   M PEI GEK+  + LY+AV+I L LQS ++GG   WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLFSMMPPEIVGEKMKPERLYDAVNILLSLQS-KNGGLPAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE+LNP+E F DIV++ E+VE T S + AL  F+  YP++R KE+   I+ + EYL
Sbjct  538   APAWLELLNPTEFFEDIVIEHEYVECTSSAIQALVLFRKLYPEHREKEIEDFISNSVEYL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WG+CF YG+ FAL GL AAG++Y N  A+RK   F L  Q Q+GGWG
Sbjct  598   ENVQLPDGSWYGCWGVCFTYGSWFALGGLAAAGKTYSNCAAMRKGVAFLLRTQLQDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP  +Y+P EGNRSN+VQT+WAM+GL+   QAERDPTPLHRAAKLLIN+QMEDGD
Sbjct  658   ESYLSCPKKEYVPLEGNRSNLVQTAWAMMGLIQAGQAERDPTPLHRAAKLLINSQMEDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             +PQQ++TG + KNCMLHY ++R+ +PL AL+EYR RV
Sbjct  718   YPQQELTGVFNKNCMLHYPNYRNTYPLWALAEYRTRV  754



>ref|XP_010065062.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW70925.1| hypothetical protein EUGRSUZ_F04040 [Eucalyptus grandis]
Length=761

 Score =   925 bits (2391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/757 (57%), Positives = 549/757 (73%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLKI EG  G Y+YSTNNY GRQ WE+DP AG  EE+   E   + F   R +    C
Sbjct  1     MWKLKIAEGEDGSYLYSTNNYVGRQTWEFDPEAGNAEERAEVEATCQHFYDHRHQ-VKAC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  RMQ ++E +    +I PVR+ + EE+ Y+  +TA+R+ V    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREKQFRQ-TISPVRVEDGEEITYDKASTALRRTVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPL+F PPL++ +YI+G ++ +  +EH+KE++RYLYNHQN DGGWG +I+GHSTM  +
Sbjct  119   IAGPLYFLPPLVMCVYITGHLNAVFPAEHRKEILRYLYNHQNGDGGWGFHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y  +R+LGE  D    +A  R R WIL  GG T IPSWGK +LS+ G+++W G NP+
Sbjct  179   ALSYRCMRILGEGPDGGQDNACTRARKWILDRGGVTYIPSWGKTWLSIFGLFDWSGTNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T LV  +R E+H +PYD I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLVQQLREELHTQPYDTI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
              W      C KED YYPH  +QD++W++L   TEP++ RWPFNK+RE A++  + H+ Y 
Sbjct  299   CWRKVCHLCAKEDLYYPHPLVQDLIWDSLYIFTEPLLNRWPFNKLREKALQVTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDP+ D  K HLAR+PD+LW+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPDSDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
               FA QAL++S M EE    L + H ++K+SQ+K+NP GDFKSM+RH SKG+W FSDQDH
Sbjct  419   TGFAIQALLASNMTEEIAPVLARGHDFIKKSQVKDNPSGDFKSMHRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +KC LL   M PEI GEK++ + LY+AV+I L LQS E+GG   WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLFSMMPPEIVGEKMEPEKLYDAVNILLSLQS-ENGGLPAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE+LNP+E FADIV+Q E+VE T S + AL  F+  YP +R KE+A  I+ + +YL
Sbjct  538   APAWLELLNPTEFFADIVIQHEYVECTSSAIQALVLFRKLYPGHRKKEIADFISNSVKYL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q+ DGSWYG WG+CF YG+ FAL GL AAG++Y N  A+RK   F L  Q Q+GGWG
Sbjct  598   ENVQKPDGSWYGCWGVCFTYGSWFALGGLAAAGKTYSNCAAMRKGVAFLLRTQLQDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP  +Y+P EGNRSN+VQT+WAM+G++Y  QAERDPTPLHRAAKLLIN+QMEDGD
Sbjct  658   ESYLSCPKEEYVPLEGNRSNLVQTAWAMMGMIYAGQAERDPTPLHRAAKLLINSQMEDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             +PQQ+ITG + KNCMLHYA++R+ +PL AL+EY +RV
Sbjct  718   YPQQEITGVFSKNCMLHYANYRNIYPLWALAEYCRRV  754



>ref|XP_006425178.1| hypothetical protein CICLE_v10027855mg [Citrus clementina]
 gb|ESR38418.1| hypothetical protein CICLE_v10027855mg [Citrus clementina]
Length=785

 Score =   925 bits (2391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/765 (58%), Positives = 561/765 (73%), Gaps = 16/765 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG---PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2416
             MWKLK+GEG G    YIYSTNNYAGRQIW++DP AG+ EE+   E AR  F   R     
Sbjct  1     MWKLKVGEGNGEKDAYIYSTNNYAGRQIWQFDPEAGSDEERAQVEAARLHFYNNRDHLKP  60

Query  2415  TCGDLFMRMQMIKESEVDVLSIPPVRLR---EEEEVNYE-AITTAVRKAVRLNCALQAKD  2248
             +  DL  RMQ +KE +    +IP V+++   +EEE+ YE A TTA+R+ VR   ALQA D
Sbjct  61    S-ADLLWRMQFLKEKKFKQ-TIPQVKIKVDGDEEEITYETAATTALRRGVRFFSALQAID  118

Query  2247  GHWPAENSGPLFFTPPLMIALYISGSIDMIL--TSEHKKELVRYLYNHQNEDGGWGLYID  2074
             GHWPAEN+GPLFF PPL++ LYI+G ++ +    SEH+KE++RY++ HQNEDGGWGL+I+
Sbjct  119   GHWPAENAGPLFFLPPLVMCLYITGHLNTVFPAESEHRKEILRYIHYHQNEDGGWGLHIE  178

Query  2073  GHSTMIGSALNYVALRLLGEEADD-AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWD  1897
             GHSTM  +ALNY+ LR+LG+     A A  RNWIL  GG T IPSWGKI+LS+LGV++W 
Sbjct  179   GHSTMFCTALNYICLRILGQPPHHIACATARNWILDRGGVTLIPSWGKIWLSILGVFDWS  238

Query  1896  GCNPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIH--  1723
             GCNP+PPEFW+ PS  P HP KMW YCR  YMPMSYLY KR+ G +T LV+ +R E++  
Sbjct  239   GCNPMPPEFWILPSFLPMHPGKMWCYCRMVYMPMSYLYGKRFVGAITPLVVELRQELYPE  298

Query  1722  VKPYDQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRK  1546
             V+PY +++W   R  C KED YYPH +IQD++W+ L   TEP++ RWPF+K IRE A++ 
Sbjct  299   VEPYHKVNWGKARHLCAKEDAYYPHPWIQDLIWDTLYVFTEPLLTRWPFSKFIREKALQV  358

Query  1545  VIMHMRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQ  1366
              + H+ Y    SRYITIG +EK L M+  W E PN D  K HLAR+PD+LW+AEDGM MQ
Sbjct  359   TMDHIHYEDHNSRYITIGCVEKVLCMLACWVEHPNGDSFKKHLARIPDYLWVAEDGMKMQ  418

Query  1365  TFGSQNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGA  1186
             +FGSQ WD  FA QAL++S +++E G  LK+ H ++K SQ+K+NP GDFK MYRH SKG+
Sbjct  419   SFGSQQWDTGFAIQALLASNLIDEIGPVLKRGHEFIKASQVKDNPSGDFKRMYRHISKGS  478

Query  1185  WAFSDQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGG  1006
             W FSDQDHGW VSDCTAE +KC LLL  M  EI GEK++ + LY++V++ L LQS + GG
Sbjct  479   WTFSDQDHGWQVSDCTAEGLKCCLLLSMMPTEIVGEKMEPERLYDSVNLLLSLQS-KIGG  537

Query  1005  FAVWEPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMS  826
                WEP     +LE+LNP+E FADIV++ E+VE T S + AL  F   YP +R KE+   
Sbjct  538   LPAWEPVGAHKWLELLNPTEFFADIVIEHEYVECTSSAIQALTMFSKLYPGHRKKEIDKF  597

Query  825   IAKAAEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSK  646
             I KA  YLE  Q ADGSWYG WG+CF YGT FAL GL AAG++Y NS  +RKA HF L+ 
Sbjct  598   IGKAIGYLEDAQMADGSWYGCWGVCFTYGTWFALGGLAAAGKTYTNSPTVRKAVHFLLNS  657

Query  645   QNQEGGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLI  466
             Q Q GGWGE   SCP  KYIP EGNRSN+VQT+WAM+GL++  QAERDPTPLHRAAKLLI
Sbjct  658   QTQNGGWGESFRSCPQKKYIPLEGNRSNLVQTAWAMMGLLHAGQAERDPTPLHRAAKLLI  717

Query  465   NAQMEDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             N+Q+EDGDFPQ++ITG +M+NCMLHYA++R+ +PL AL+EY +++
Sbjct  718   NSQLEDGDFPQEEITGVFMRNCMLHYAAYRNIYPLWALAEYCRKL  762



>ref|XP_004305792.1| PREDICTED: beta-amyrin synthase-like [Fragaria vesca subsp. vesca]
Length=764

 Score =   925 bits (2391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/762 (57%), Positives = 560/762 (73%), Gaps = 14/762 (2%)
 Frame = -3

Query  2586  MWKLKIGEGG---GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGP  2419
             MWKLKI EGG    PYIYSTNN+ GRQ WE+DP+AGT EE+   E+AR  F   R Q  P
Sbjct  1     MWKLKIAEGGEDSSPYIYSTNNFVGRQTWEFDPDAGTDEERAEVEEARLQFYNNRYQVKP  60

Query  2418  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2239
                GDL  RMQ ++E +    +IPPV++ + E + +E  T A+R++V    ALQA DGHW
Sbjct  61    --SGDLLWRMQFLREKKFKP-TIPPVKIEDGEAITHEKTTDALRRSVHFFSALQASDGHW  117

Query  2238  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  2059
             PAEN+GPLFF PPL+I +YI+G ++ +   EH+KE++RYLY HQNEDGGWGL+I+GHSTM
Sbjct  118   PAENAGPLFFLPPLVICMYITGHLNSVFPEEHRKEILRYLYYHQNEDGGWGLHIEGHSTM  177

Query  2058  IGSALNYVALRLLGEEADD-----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDG  1894
               + L+Y+ +R+LGE  DD     A +R R WIL HGG T +PSWGK +LS+LG+++W G
Sbjct  178   FSTGLSYICMRILGEGPDDGGQDNACSRARKWILDHGGVTHMPSWGKTWLSILGLFDWSG  237

Query  1893  CNPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKP  1714
              NP+PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+ ++P
Sbjct  238   SNPMPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELFIQP  297

Query  1713  YDQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIM  1537
             Y++I+W   R  C KED YYPH +IQD+LW++L   TEP++ RWPFNK IRE A++  + 
Sbjct  298   YNEINWKKVRHLCAKEDIYYPHPWIQDLLWDSLYISTEPLLTRWPFNKLIREKALQVTMK  357

Query  1536  HMRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFG  1357
             H+ Y  E SRYITIG +EK L M+  WAEDPN D  K HLAR+PD+LW++EDGM MQ+FG
Sbjct  358   HIHYEDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVSEDGMKMQSFG  417

Query  1356  SQNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAF  1177
             SQ WD  F+ QAL+++ + +E G  L + H ++K+SQ+K+NP GDFK M+RH SKG+W F
Sbjct  418   SQQWDTGFSIQALLATNLTDEIGPALARGHDFIKKSQVKDNPSGDFKCMHRHISKGSWTF  477

Query  1176  SDQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAV  997
             SDQDHGW VSDCTAE +KC LLL  M  EI GEK++ + LY++V++ L LQS ++GG + 
Sbjct  478   SDQDHGWQVSDCTAEGLKCCLLLSMMPSEIVGEKMEPERLYDSVNVLLSLQS-KNGGLSA  536

Query  996   WEPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAK  817
             WEP     +LE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+  SI K
Sbjct  537   WEPAGAAEWLELLNPTEFFADIVIEHEYVECTSSAIQALVLFKKLYPGHRKKEIEHSITK  596

Query  816   AAEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQ  637
             +  YLE  Q  DGSWYG WG+CF YGT FAL GL AAG ++  S A+RK   F L  Q +
Sbjct  597   SIHYLENIQMPDGSWYGNWGVCFTYGTWFALGGLAAAGETFRTSAAMRKGVSFLLKAQRE  656

Query  636   EGGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQ  457
              GGWGE   SCP   YIP EGNRSN+V T+WAM+GL++  QAERDPTPLHRAAK +IN+Q
Sbjct  657   NGGWGESYLSCPQKTYIPLEGNRSNLVHTAWAMMGLIHAGQAERDPTPLHRAAKFIINSQ  716

Query  456   MEDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             +E+GDFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  717   LENGDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKRV  758



>ref|XP_009369010.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=761

 Score =   925 bits (2390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/759 (58%), Positives = 563/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MWKLK+ +GG  PYIYSTNN+ GRQI+E+DP AGT EE+   E+AR  F   R Q  P  
Sbjct  1     MWKLKVADGGNDPYIYSTNNFVGRQIFEFDPEAGTTEERAEVEEARLHFYNNRYQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GDL  RMQ ++E      + PP+++ + EE+ +E  TT++R++V    ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLREKNFKQTN-PPIKVEDGEEITHEKATTSLRRSVHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++ ++I+  ++ I  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCVHITEHLNTIFHAEHRKEILRYIYCHQNQDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +AL+Y+ +R+LGE  D    +A AR R WIL HG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TALSYICMRILGEGPDGGQDNACARARKWILDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PYD+
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W   R  C KED YYPH +IQD LW++L  CTEP++ RWPFNK IR+ A+   + H+ 
Sbjct  298   INWKGVRHHCAKEDIYYPHPWIQDFLWDSLYICTEPLLTRWPFNKLIRKRALEVTMEHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  WAEDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQ  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S + +E    L + H ++K SQ+K+NP GDFKSM+RH SKG+W FSDQ
Sbjct  418   WDTGFAIQALLASNLTDEIAPTLARGHDFVKNSQVKDNPSGDFKSMHRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LLL  M PE+ GEK++ + LY+AV++ + LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMMPPELVGEKMEPERLYDAVNVLITLQS-KNGGLAAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LEMLNP+E FADIVV+ E+VE T S + AL  FK  YP +R KE+   I  AA+
Sbjct  537   AGAAEWLEMLNPTEFFADIVVEHEYVECTSSAIQALVLFKKLYPGHRNKEIDQFITNAAQ  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG WG+CF YGT FAL GLTAAG+++ N   IRKA +F L+ Q + GG
Sbjct  597   YLENIQMEDGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCAVIRKAINFLLTIQKENGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +Y+P EGNRSN+V T+WAM+GL+Y  QAERDP PLHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIYAGQAERDPAPLHRAAKLIINSQMEN  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYRK V
Sbjct  717   GDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKWV  755



>emb|CDP15852.1| unnamed protein product [Coffea canephora]
Length=757

 Score =   925 bits (2390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/759 (57%), Positives = 556/759 (73%), Gaps = 14/759 (2%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LKI EG   PY+YSTNN+ GRQIWE++PN G+PEE+E  E AR  F   R Q  P  
Sbjct  1     MWRLKIAEGYNSPYLYSTNNFIGRQIWEFNPNGGSPEEREEVENARTQFWNNRCQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             C DL  RMQ ++E      SIP V + + +E+ +   TTAVR+AV    ALQA DGHWPA
Sbjct  59    CSDLLWRMQFLREKNFKQ-SIPQVTVEDGKEITHAMATTAVRRAVLFFAALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++ LYI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFVPPLVMCLYITGHLNSVFPAEHQKEILRYIYYHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD-----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
             +AL+Y+ +R+LGE  D     +A +R R WIL HG  TAIPSWGK +LS+LG+++W G N
Sbjct  178   TALSYICMRILGEGPDGGGLNNACSRARKWILDHGSVTAIPSWGKTWLSILGLFDWYGTN  237

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFW+ PS  P HPAK+W YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PYD
Sbjct  238   PMPPEFWILPSFLPVHPAKVWCYCRLIYMPMSYLYGKRFVGPITPLILQLREELYAEPYD  297

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
             QI+W   R  C  ED YYPH  IQD++W++L    EP++ RWPFNK+RE A++  + H+ 
Sbjct  298   QINWRKVRHICATEDLYYPHPLIQDLIWDSLHIFAEPLLTRWPFNKLRERALQTTMKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +   L M+  W EDPN D  K HLAR+PD++W+AEDGM MQ+FGSQ 
Sbjct  358   YEDENSRYITIGCV---LCMLACWVEDPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQV  414

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD +FA QAL++ G+ EE G+ L+K H +LK+SQ+ +NP GDF+SMYRH SKGAW FSDQ
Sbjct  415   WDTSFALQALLAGGLTEEIGETLRKGHDFLKKSQVTDNPSGDFRSMYRHISKGAWTFSDQ  474

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAEA+KC LL   M PEI GEK++ + LY+AV+I L LQS ++GG   WEP
Sbjct  475   DHGWQVSDCTAEALKCCLLFSTMPPEIVGEKLEPERLYDAVNILLSLQS-KNGGLPAWEP  533

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LE+LNP+E+ A+  V+ E+   T S ++AL  F+  +P +R KE+   IA A++
Sbjct  534   VRADNWLELLNPTEILANCAVEHEYAVCTSSAINALVMFQQLFPGHREKEIENFIANASK  593

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG WG+CF YGT FAL GL AAG++Y+N +AI KA  F L  Q  +GG
Sbjct  594   YLENVQMPDGSWYGDWGVCFTYGTWFALGGLVAAGKTYDNCQAISKAVDFLLKSQRNDGG  653

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SC  MKYIP +G RSN+V T+WAM+GL+Y  QA+RDP PLH AAKLL+N+QME+
Sbjct  654   WGESYRSCSEMKYIPLKGERSNLVHTAWAMMGLIYAGQADRDPRPLHHAAKLLMNSQMEN  713

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG++  NCMLHYA++R+ FPL AL+EYRKRV
Sbjct  714   GDFPQQEITGAFKNNCMLHYATYRNIFPLWALAEYRKRV  752



>ref|XP_003604121.1| Beta-amyrin synthase [Medicago truncatula]
 emb|CAD23247.1| beta-amyrin synthase [Medicago truncatula]
 gb|AES86318.1| beta-amyrin synthase [Medicago truncatula]
Length=762

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/758 (57%), Positives = 558/758 (74%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLKIGEG   PY++STNN+ GRQ WEYDP AG+ EE+   E+ARK F   R K    C
Sbjct  1     MWKLKIGEGKNEPYLFSTNNFVGRQTWEYDPEAGSEEERAQVEEARKNFYDNRFK-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  R Q+++E+   + +I  V++ + EE+ YE  TT +R+      ALQ  DGHWPA+
Sbjct  60    GDLLWRFQVLRENNF-MQTIDGVKIEDGEEITYEKATTTLRRGTHHLAALQTSDGHWPAQ  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPLFF PPL+  +YI+G +D +   EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFMPPLVFCVYITGHLDSVFPREHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             ALNY+ +R+LGE  D    +A AR RNWI  HGG T IPSWGK +LS+LG+++W G NP+
Sbjct  179   ALNYICMRILGEGPDGGQDNACARARNWIRAHGGVTYIPSWGKTWLSILGLFDWLGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+H +PY++I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELHTQPYEKI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W  +R  C KED YYPH  IQD++W++L   TEP++ RWPFNK +R+ A+   + H+ Y
Sbjct  299   NWTKSRHLCAKEDIYYPHPLIQDLIWDSLYIFTEPLLTRWPFNKLVRKRALEVTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRY+TIG +EK L M+  W EDPN D  K HLARV D+LW++EDGMTMQ+FGSQ W
Sbjct  359   EDENSRYLTIGCVEKVLCMLACWVEDPNGDAYKKHLARVQDYLWMSEDGMTMQSFGSQEW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA FA QAL+++ + +E    L K H ++K+SQ+ ENP GDFKSM+RH SKG+W FSDQD
Sbjct  419   DAGFAVQALLAANLNDEIEPALAKGHDFIKKSQVTENPSGDFKSMHRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LLL  + PEI GEK++ + LY++V++ L LQS + GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQS-KKGGLAAWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               Q +LE+LNP+E FADIVV+ E+VE TGS + AL  FK  YP +R KE+   I++A  +
Sbjct  538   GAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFISEAVRF  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             +E  Q ADGSWYG WG+CF YG+ FAL GL AAG++Y N  AIRKA  F L+ Q ++GGW
Sbjct  598   IEDIQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTYTNCAAIRKAVKFLLTTQREDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   S P   Y+P EG+RSNVV T+WA++GL++  QAERDPTPLHRAAKLLIN+Q+E+G
Sbjct  658   GESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQAERDPTPLHRAAKLLINSQLEEG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             D+PQQ+ITG +MKNCMLHY  +R  +PL AL+EYR+RV
Sbjct  718   DWPQQEITGVFMKNCMLHYPMYRDIYPLWALAEYRRRV  755



>gb|ADE88148.1| beta-amyrin synthase [Glycyrrhiza uralensis]
Length=762

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/759 (57%), Positives = 556/759 (73%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LKI EGG  PYIYSTNN+ GRQ WEYDP  G+ EE+   + AR  F   R Q  P  
Sbjct  1     MWRLKIAEGGKDPYIYSTNNFVGRQTWEYDPGGGSAEERAQVDAARLHFYNNRFQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             CGDL  R Q+++E+     +I  V++ + EE+ YE  TTAVR+A     ALQ  DGHWPA
Sbjct  59    CGDLLWRFQILRENNFKQ-TIASVKIGDGEEITYEKATTAVRRAAHHLSALQTSDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             + +GPLFF PPL+  +YI+G +D +   E++KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   QIAGPLFFLPPLVFCMYITGHLDSVFPEEYRKEILRYIYYHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ +R+LGE  D    +A AR R WI  HGG T IPSWGK +LS+LGV++W G NP
Sbjct  178   TALNYICMRILGEGPDGGQDNACARARKWIHDHGGVTHIPSWGKTWLSILGVFDWCGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+  +PY++
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTEPYEK  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             ++W   R  C KED YYPH  +QD++W++L   TEP++ RWPFNK +RE A++  + H+ 
Sbjct  298   VNWKKARHQCAKEDLYYPHPLLQDLIWDSLYLFTEPLLTRWPFNKLVREKALQVTMKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDPN D  K HLARVPD+LW++EDGMTMQ+FGSQ 
Sbjct  358   YEDETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMTMQSFGSQE  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WDA FA QAL+++ +VEE    L K H ++K+SQ+++NP GDFKSMYRH SKG+W FSDQ
Sbjct  418   WDAGFAVQALLATNLVEEIAPTLAKGHDFIKKSQVRDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LLL  + PEI GEK++ + LY++V++ L LQS + GG + WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQS-KKGGLSAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP+E FADIVV+ E+VE TGS + AL  FK  YP +R KE+   IA A  
Sbjct  537   AGAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFIANAVR  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             +LE  Q ADGSWYG WG+CF YG+ FAL GL AAG+++ N  AIRKA  F L+ Q ++GG
Sbjct  597   FLEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTFANCAAIRKAVKFLLTTQREDGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   S P   Y+P EG+RSNVV T+WA++GL++  QAERDP PLHRAAKL+IN+Q+E+
Sbjct  657   WGESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQAERDPAPLHRAAKLIINSQLEE  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GD+PQQ+ITG +MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  717   GDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  755



>ref|XP_009344148.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=760

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/759 (58%), Positives = 562/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MWKLK+ +GG  PYIYSTNN+ GRQI+E+DP AGT EE+   E+AR  F   R Q  P +
Sbjct  1     MWKLKVADGGNDPYIYSTNNFVGRQIFEFDPEAGTTEERAEVEEARLHFYNNRYQVKPSS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E      +IPPV++ + EE+ YE    A+R++V    ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-TIPPVKVEDGEEITYEKAIAALRRSVHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++  YI+G ++ +  +EH+KE++RYLY HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCTYITGHLNTVFLAEHRKEILRYLYYHQNQDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + LNY+ +R+LGE  D    +A AR R WI  HG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TVLNYICMRILGEGPDGGQDNACARARKWIHDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW Y R  YMPMSYLY KR+ GP+T+L+L +R E++ +PYD+
Sbjct  238   LPPEFWILPSFLPMHPAKMWCYSRMFYMPMSYLYGKRFVGPITSLILQLREELYAQPYDE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W   R  C K D YYPH +IQD LW++L  CTEP++  WPFNK IR+ A+   + H+ 
Sbjct  298   INWKGVRHHCAKVDIYYPHPWIQDFLWDSLYVCTEPLLTHWPFNKLIRKRALEVTMKHVH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIGA+EK L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQTFGSQ 
Sbjct  358   YEDENSRYITIGAVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQTFGSQQ  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S + +E    L + H ++K+SQ+K+NP GDFKSMYRH SKG+W FSDQ
Sbjct  418   WDTGFAIQALLASNLTDEIAPTLARGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE++KC LLL  M PEI GEK++ + LY+AV++ + L+S ++GG   WEP
Sbjct  478   DHGWQVSDCTAESLKCCLLLSMMPPEIVGEKMEPEQLYDAVNVLISLRS-KNGGLPAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LEM NP+ELFADIVV+ E+VE T S + AL  FK  YP +R +E+   I  AA 
Sbjct  537   AGAAEWLEMFNPTELFADIVVEHEYVECTSSAIQALVLFKKLYPGHRKEEIDQFITAAAL  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q ADGSWYG WG+CF YGT FAL GLTAAG+++ N  AIRKA  F L+ Q + GG
Sbjct  597   YLENVQMADGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCAAIRKAISFLLAIQKENGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +Y+P EGNRSN+VQT+WAM+GL++  QAERDPTPLHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVQTAWAMMGLIHVGQAERDPTPLHRAAKLIINSQMEN  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+I+G++MKNCMLHYA++R+ +PL AL+EY +RV
Sbjct  717   GDFPQQEISGAFMKNCMLHYAAYRNIYPLWALAEYCRRV  755



>ref|XP_004488915.1| PREDICTED: beta-amyrin synthase-like [Cicer arietinum]
Length=762

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/759 (57%), Positives = 555/759 (73%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LKI +GG  PYI+STN + GRQIWEYD  AG+ EE+E  E+AR  F   R Q  P  
Sbjct  1     MWRLKIADGGKDPYIFSTNEFVGRQIWEYDSEAGSKEEREQVEQARLNFYNNRFQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             C DL  R Q+++E+     +I  V++ + EE+ YE  T+A+R+      ALQ  DGHWPA
Sbjct  59    CADLLWRFQVLRENNFKQ-TIDSVKIEDGEEITYEKATSALRRGTHHLAALQTSDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             + +GPLFF PPL+  +YI+G +D + + EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   QIAGPLFFLPPLVFCVYITGHLDSVFSEEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ +R+LGE      D+A AR R WI  HGG T IPSWGK +LS+LGV++W G NP
Sbjct  178   TALNYICMRILGEGPNGGLDNACARARKWIRDHGGVTHIPSWGKTWLSILGVFDWCGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+H +PY++
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELHTQPYEK  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W   R  C KED YYPH FIQD++W++L   TEP + RWPFNK IRE A+   + H+ 
Sbjct  298   INWTKARHLCAKEDLYYPHPFIQDLIWDSLYIFTEPFLTRWPFNKLIREKALEVTMKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW++EDGMTMQ+FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARIPDYLWISEDGMTMQSFGSQE  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WDA FA QAL+++ ++EE G  L K H ++K+SQ++ENP GDFKSM+RH SKG+W FSDQ
Sbjct  418   WDAGFAVQALLATNLIEEIGPALAKGHDFIKKSQVRENPSGDFKSMHRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LLL  + PE+ GEK++ + LY++V++ L LQS + GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMLPPEVVGEKMEPERLYDSVNLLLSLQS-KKGGLAAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP+E FADIVV+ E+VE TGS + AL  FK  YP +R KE+   I  A  
Sbjct  537   AGAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFIVNAVR  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             +LE  Q ++GSWYG WG+CF YGT FAL GL AAG+++ N  AIRKA  F L+ Q  +GG
Sbjct  597   FLEDTQTSNGSWYGNWGVCFTYGTWFALGGLAAAGKTFTNCSAIRKAVQFLLTTQRDDGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   S P   Y+P E +RSNVV T+WA++GL++  QAE +PTPLHRAAKLLIN+Q+E+
Sbjct  657   WGESYLSSPKKIYVPLERSRSNVVHTAWALMGLIHAGQAEINPTPLHRAAKLLINSQLEE  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GD+PQQ+ITG +MKNCMLHY  +R  +PL AL+EYR+RV
Sbjct  717   GDWPQQEITGVFMKNCMLHYPMYRDIYPLWALAEYRRRV  755



>gb|AIE17466.1| oxidosqualene cyclase [Centella asiatica]
Length=764

 Score =   923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/761 (56%), Positives = 553/761 (73%), Gaps = 13/761 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG----PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKG  2422
             MW+LKI EGG      Y+YSTNN+ GRQ WE+DPN G+ EE+   E+AR  F   R Q  
Sbjct  1     MWRLKIAEGGNGEHDQYLYSTNNFVGRQTWEFDPNHGSLEERAEVEQARLHFWNNRYQIK  60

Query  2421  PHTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGH  2242
             P   GDL  RMQ ++E      +IP V++ + EE+ YE  TT +R+ V    ALQA DGH
Sbjct  61    P--SGDLLWRMQFLQEKNFKQ-TIPQVKVEDGEEITYETATTTLRRGVHFFAALQADDGH  117

Query  2241  WPAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHST  2062
             WPAEN+GPLFF PPL++ LYI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHST
Sbjct  118   WPAENAGPLFFLPPLVMCLYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHST  177

Query  2061  MIGSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDG  1894
             M  +AL+Y+ +R+LG+  D    +A AR R WIL HG  TAIPSWGK +LS+LG+++W G
Sbjct  178   MFCTALSYICMRILGQGRDGGQENACARARKWILDHGTVTAIPSWGKTWLSILGLFDWSG  237

Query  1893  CNPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKP  1714
              NP+PPEFW+ P   P HPAKMW YCRT YMPMSYLY KR+ GP+T L+L +R E++ +P
Sbjct  238   SNPMPPEFWILPRFLPMHPAKMWCYCRTVYMPMSYLYGKRFVGPITPLILQLREELYDQP  297

Query  1713  YDQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMH  1534
             YDQI+W   R  C KED YYPH  ++D++W++L   TEP + RWP NK+RE A++  + H
Sbjct  298   YDQINWRKARHNCAKEDLYYPHPLLRDLMWDSLYIFTEPFLNRWPLNKLREKALQTTMKH  357

Query  1533  MRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGS  1354
             + Y  E SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGS
Sbjct  358   IHYEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGS  417

Query  1353  QNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFS  1174
             Q WD  FA QAL++S + +E    L K H ++K SQ+ ENP GDFKSM+RH SKG+W FS
Sbjct  418   QEWDTGFAIQALLASDLTDEIRPVLMKGHDFIKNSQVTENPSGDFKSMHRHISKGSWTFS  477

Query  1173  DQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVW  994
             DQDHGW VSDCTAEA+KC LL  +M  EI G K++ + L++AV++ L LQS ++GG A W
Sbjct  478   DQDHGWQVSDCTAEALKCCLLFSRMPSEIVGNKMEDRWLFDAVNVLLSLQS-KNGGLAAW  536

Query  993   EPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKA  814
             EP     +LE+LNP+E FADIV++ E+VE T S + A+  F   YP +R KE  M+I+ A
Sbjct  537   EPAGSSEWLELLNPTEFFADIVIEHEYVECTSSAIQAMVMFMKLYPGHRKKETEMTISSA  596

Query  813   AEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQE  634
              +YLE  Q  DGSWYG WG+CF YGT FAL GLTAAG++Y N  +IRKA  F L  Q   
Sbjct  597   VQYLENVQMPDGSWYGNWGVCFTYGTWFALGGLTAAGKTYSNCHSIRKAVDFLLRSQCSN  656

Query  633   GGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQM  454
             GGWGE   SCP  +Y P EGNRSN+V T+WAM+GL+++ QA R+PTPLHRAAKLLIN+Q+
Sbjct  657   GGWGESYLSCPNKEYTPLEGNRSNLVHTAWAMMGLIHSGQAYRNPTPLHRAAKLLINSQL  716

Query  453   EDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             + GDFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYRK V
Sbjct  717   DSGDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKHV  757



>sp|E2IUA8.1|FRIES_KALDA RecName: Full=Friedelin synthase; Short=KdFRS [Kalanchoe daigremontiana]
 gb|ADK35125.1| friedelin synthase [Kalanchoe daigremontiana]
Length=767

 Score =   923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/777 (56%), Positives = 557/777 (72%), Gaps = 18/777 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLKI EGG  PYIY+TNN+ GRQIWE+DP A  P++    E AR  F   R K   + 
Sbjct  1     MWKLKIAEGGSDPYIYTTNNFVGRQIWEFDPQATDPQQLAKVEAARLNFYNHRHKIKPS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  R+Q ++E +    +I  V++ + EEV+YEA T A+++ V    ALQA DGHWPAE
Sbjct  60    SDLLWRLQFLEEKDFRQ-NIAQVKVEDGEEVSYEAATAALKRGVHFYSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GP+FF  PL++ LYI+G ++ I T EH++E +RY+Y HQNEDGGWG +I+G STM G+
Sbjct  119   NAGPMFFMSPLVMCLYITGHLNTIFTEEHRRETLRYIYYHQNEDGGWGFHIEGQSTMFGT  178

Query  2049  ALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              LNY+ +RLLGE      D+A++RGR WIL HGGATAIPSWGK +LS++G+ +W GCNP+
Sbjct  179   VLNYICMRLLGEGPEGGQDNAVSRGRKWILDHGGATAIPSWGKTWLSIMGLCDWSGCNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWL PS+ P HPAKMW YCR  YMPMSYLY KR+   +T L+L +R E+H +PYDQI
Sbjct  239   PPEFWLLPSYLPMHPAKMWCYCRMVYMPMSYLYGKRFTTHITPLILQLREELHTQPYDQI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W   R  CCKEDTYYPH  +QD++W+ L   TEP++ RWP NK IRE A++K + H+ Y
Sbjct  299   NWKKVRHVCCKEDTYYPHPILQDLIWDTLYLTTEPLLTRWPLNKLIRERALKKTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYI IGA+EK L M+  W EDPN D  K HLARVPD+ W+AEDGM +Q+FGSQ+W
Sbjct  359   EDENSRYIVIGAVEKVLCMLACWVEDPNGDYFKKHLARVPDYFWVAEDGMKIQSFGSQHW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  F  QAL++S M +E    L KAH  +K+SQ+K+NP GDF+SMYRH SKGAW FSDQD
Sbjct  419   DTAFFVQALLASDMTDEIRTTLAKAHDCIKKSQVKDNPSGDFRSMYRHISKGAWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW +SDCTAE +KC LL   M PE+ GE +  + LY++V++ LYLQS ++GG   WEP 
Sbjct  479   HGWQLSDCTAEGLKCCLLFSLMQPEVVGEAMPPERLYDSVNVLLYLQS-KNGGMPGWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LE+LNP+E F +IV++ E+VE T S V AL  FK  YP +R KEV   I   A+Y
Sbjct  538   GESEWLELLNPTEFFENIVIEHEYVECTSSAVQALVLFKKLYPLHRRKEVERFITNGAKY  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q  DGSWYG WG+CF YG  FAL GL+AAG++Y N  A+RK   F L+ Q ++GGW
Sbjct  598   LEDIQMPDGSWYGNWGVCFTYGAWFALEGLSAAGKTYNNCAAVRKGVDFLLNIQLEDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE  +SCP  KY+P E NRSN+VQTSWA++GL+Y  QA+RDPTPLHRAAKLLIN+Q+EDG
Sbjct  658   GESYQSCPDKKYVPLEDNRSNLVQTSWALMGLIYAGQADRDPTPLHRAAKLLINSQLEDG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS*SH*NPNPGSKA*VQP  274
             DFPQQ+I G +  NC LH+A++R+ FP+ AL+ YR+           NP S+A  +P
Sbjct  718   DFPQQEIAGVFKMNCTLHFAAYRNIFPIWALAVYRRFC---------NPNSEAISKP  765



>sp|A8CDT2.1|BAS_BRUGY RecName: Full=Beta-amyrin synthase; Short=BgbAS [Bruguiera gymnorhiza]
 dbj|BAF80443.1| beta amyrin synthase [Bruguiera gymnorhiza]
Length=759

 Score =   923 bits (2385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/759 (57%), Positives = 557/759 (73%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW++KI EGG  PY+YSTNNY GRQ WE+DP+AGTPEE+   E+AR+ F K R Q  P  
Sbjct  1     MWRIKIAEGGKDPYLYSTNNYVGRQTWEFDPDAGTPEERAEVEEARQNFYKNRYQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             CGDL  R+Q + E   +  +IP VR+ E E + YE  T A+R+ V+   ALQA DGHWPA
Sbjct  59    CGDLLWRLQFLGEKNFEQ-TIPQVRIEEGEGITYEKATRALRRTVQFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +GPLFF PPL++ +YI+G +D +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   EIAGPLFFLPPLVMCVYITGHLDAVFPAEHRKEILRYIYYHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ +R++GE      DDA AR R WI  HG  T IPSWGK +LS+LGVY+W G NP
Sbjct  178   TALNYICMRIIGEGPNGGQDDACARARKWIHDHGSVTNIPSWGKTWLSILGVYDWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+  +R E+  +PYDQ
Sbjct  238   MPPEFWMLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLIQQLREELFTQPYDQ  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHMR  1528
             I+W  TR  C  ED YYPH F+QD++W+ L   TEP++ RWP N+I R+ A+   + H+ 
Sbjct  298   INWKKTRHQCAPEDLYYPHPFVQDLIWDCLYIFTEPLLTRWPLNEIIRKKALEVTMKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDPN D  K HLAR+PD++W+AEDGM MQ+FGSQ 
Sbjct  358   YEDESSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGMKMQSFGSQE  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL+++ + +E GD L++ H ++K+SQ+++NP GDFKSMYRH SKG+W FSDQ
Sbjct  418   WDTGFAIQALLATNLTDEIGDVLRRGHDFIKKSQVRDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LL   M PEI GE +  + LY++V++ L LQS ++GG + WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLFSMMPPEIVGEHMVPERLYDSVNVLLSLQS-KNGGLSAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+   I  A  
Sbjct  537   AGAQEWLELLNPTEFFADIVIEHEYVECTSSAIHALVLFKKLYPGHRKKEIDNFIVNAVR  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE+ Q +DG WYG WG+CF YGT FAL GL AAG++Y N  A+RKA  F L  Q   GG
Sbjct  597   YLESIQTSDGGWYGNWGVCFTYGTWFALGGLAAAGKTYNNCLAMRKAVDFLLRIQRDNGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +Y+P EGNRSN+V T+WA++ L++  Q +RDPTPLHRAA+L+IN+Q+ED
Sbjct  657   WGESYLSCPEKRYVPLEGNRSNLVHTAWALMALIHAGQMDRDPTPLHRAARLMINSQLED  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYR+RV
Sbjct  717   GDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRRRV  755



>ref|XP_006488698.1| PREDICTED: beta-amyrin synthase-like [Citrus sinensis]
Length=829

 Score =   922 bits (2384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/765 (58%), Positives = 555/765 (73%), Gaps = 16/765 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGGP---YIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2416
             MWKLK+GEG G     IYSTNNYAGRQIWE+DP AGT EE+   E AR  F   R     
Sbjct  1     MWKLKVGEGNGEKDESIYSTNNYAGRQIWEFDPEAGTDEERAQVEAARLHFYNNRDHLKP  60

Query  2415  TCGDLFMRMQMIKESEVDVLSIPPVRLR---EEEEVNYE-AITTAVRKAVRLNCALQAKD  2248
             +  DL  RMQ +KE +    +IP V+++   +EEE+ YE A TTA+R+ VR   ALQA D
Sbjct  61    S-ADLLWRMQFLKEKKFKQ-TIPQVKIKVDGDEEEITYETAATTALRRGVRFFSALQASD  118

Query  2247  GHWPAENSGPLFFTPPLMIALYISGSIDMIL--TSEHKKELVRYLYNHQNEDGGWGLYID  2074
             GHWPAEN+GPLFF PPL++ LYI+G ++ +    SEH+KE++RY++ HQNEDGGWGL+I+
Sbjct  119   GHWPAENAGPLFFLPPLVMCLYITGHLNNVFPAESEHRKEILRYIHYHQNEDGGWGLHIE  178

Query  2073  GHSTMIGSALNYVALRLLGEEADD-AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWD  1897
             G STM  +ALNY+ LR+LG+     A A  RNWIL  GG T IPSWGK +LS+LGV++W 
Sbjct  179   GASTMFCTALNYICLRILGQPPHHIACATARNWILDRGGVTLIPSWGKTWLSILGVFDWS  238

Query  1896  GCNPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIH--  1723
             GCNP+PPEFW+ PS  P HP KMW YCR  YMPMSYLY KR+ G +T LV+ +R E++  
Sbjct  239   GCNPMPPEFWILPSFLPMHPGKMWCYCRMVYMPMSYLYGKRFVGAITPLVVELRQELYPE  298

Query  1722  VKPYDQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRK  1546
              +PY +++W   R  C KED YYPH +IQD++WN L   TEP++ RWPFNK IRE A++ 
Sbjct  299   AEPYHKVNWGKARHLCAKEDAYYPHPWIQDLIWNTLYVFTEPLLTRWPFNKFIREKALQV  358

Query  1545  VIMHMRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQ  1366
              + H+ Y    SRYITIG +EK L M+  W E PN D  K HLAR+PD+LW+AEDGM MQ
Sbjct  359   TMDHIHYEDHNSRYITIGCVEKVLCMLACWVEHPNGDSFKKHLARIPDYLWVAEDGMKMQ  418

Query  1365  TFGSQNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGA  1186
             +FGSQ WD  FA QAL++S +++E G  LK+ H ++K SQ+K+NP GDFK MYRH SKG+
Sbjct  419   SFGSQQWDTGFAIQALLASNLIDEIGPVLKRGHEFIKASQVKDNPSGDFKRMYRHISKGS  478

Query  1185  WAFSDQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGG  1006
             W FSDQDHGW VSDCTAE +KC LLL  M  EI GEK++ + LY++V+I L LQS + GG
Sbjct  479   WTFSDQDHGWQVSDCTAEGLKCCLLLSMMPTEIVGEKMEPERLYDSVNILLSLQS-KIGG  537

Query  1005  FAVWEPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMS  826
                WEP     +LE+LNP+E FADIV++ E+VE T S + AL  F   YP +R KE+   
Sbjct  538   LPAWEPVGAHKWLELLNPTEFFADIVIEHEYVECTSSAIQALTMFSKLYPGHRKKEIDKF  597

Query  825   IAKAAEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSK  646
             I KA  YLE  Q ADGSWYG WG+CF YGT FAL GL AAG++Y NS  +RKA HF L+ 
Sbjct  598   IGKAIGYLEDAQMADGSWYGCWGVCFTYGTWFALGGLAAAGKTYTNSPTVRKAVHFLLNS  657

Query  645   QNQEGGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLI  466
             Q Q GGWGE   SCP  KYIP EGNRSN+VQT+W M+GL++  QAERDP PLHRAAKLLI
Sbjct  658   QTQNGGWGESFRSCPQKKYIPLEGNRSNLVQTAWGMMGLLHAGQAERDPAPLHRAAKLLI  717

Query  465   NAQMEDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             N+Q+EDGDFPQ++ITG +M+NCMLHYA++R+ +PL AL+EY +R+
Sbjct  718   NSQLEDGDFPQEEITGVFMRNCMLHYAAYRNIYPLWALAEYCRRL  762



>ref|XP_007214979.1| hypothetical protein PRUPE_ppa001817mg [Prunus persica]
 gb|EMJ16178.1| hypothetical protein PRUPE_ppa001817mg [Prunus persica]
Length=761

 Score =   922 bits (2384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/759 (57%), Positives = 561/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MWKLK+ +GG  PYIYSTN++ GRQI+E+D  AGTPEE+   E+AR  F   R Q  P  
Sbjct  1     MWKLKVADGGNDPYIYSTNDFVGRQIFEFDAEAGTPEERAEVEEARLNFYNNRYQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GDL  RMQ +KE      +IPPV++ + EE+ YE  T ++R++V    ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLKEKNFKQ-TIPPVKVEDGEEITYEKATASLRRSVHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++  YI+G ++ +  +EH++E++RY+Y HQN+DGGWGL+I+GHSTM G
Sbjct  118   ENAGPLFFLPPLVMCTYITGHLNTVFPAEHRREILRYIYYHQNQDGGWGLHIEGHSTMFG  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +AL+Y+ +R+LG+  D    +A AR R WIL HG  T +PSWGK +LS+LGV+EW G NP
Sbjct  178   TALSYICMRILGDGPDGGQDNACARARKWILDHGSVTHMPSWGKTWLSILGVFEWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PY +
Sbjct  238   MPPEFWMLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFIGPITPLILQLREELYAQPYHE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W   R  C KED YYPH +IQD++W++L  CTEP++ RWPFNK IRE A++  + H+ 
Sbjct  298   INWKGVRHLCAKEDIYYPHPWIQDIMWDSLYICTEPLLNRWPFNKLIREKALQVTMKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  WAEDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQ  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S + +E G  L + H ++K+SQ+K+NP GDFKSMYRH SKG+W FSDQ
Sbjct  418   WDTGFAIQALLASNLTDEIGPTLARGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LL   M PEI GEK++ + LY++V++ L LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLFSMMRPEIIGEKMEPERLYDSVNVLLSLQS-KNGGLAAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LEMLNP+E F DIVV+ E+V+ T S + AL  FK  YP +R KE+   I  A E
Sbjct  537   AGAADWLEMLNPTEFFEDIVVEHEYVDCTSSAIQALVLFKKLYPGHRKKEIDHFITNATE  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG WG+CF YG+ FAL GL AAG+++ N  A+RK  +F L  Q + GG
Sbjct  597   YLENIQMPDGSWYGSWGVCFTYGSWFALGGLAAAGKTFNNCLAMRKGVNFLLKTQRENGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +Y+P EGNRSN+V T+WAM+GL++  QA+RDP  LHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIHAGQADRDPARLHRAAKLIINSQMEN  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG + KNCMLHYA++R+ +PL AL+EYRK+V
Sbjct  717   GDFPQQEITGVFQKNCMLHYATYRNIYPLWALAEYRKQV  755



>gb|KHN39383.1| Beta-amyrin synthase [Glycine soja]
Length=773

 Score =   922 bits (2383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/768 (56%), Positives = 556/768 (72%), Gaps = 18/768 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI +GG  PYI+STNN+ GRQ WE+DP AG+PEE+   E AR+ F   R K    C
Sbjct  1     MWRLKIADGGNDPYIFSTNNFVGRQTWEFDPEAGSPEERAQVEAARQHFYHNRFK-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  R Q+++E+     +IP V + + EE+ Y+ +T+AVR+      ALQ  DGHWPA+
Sbjct  60    ADLLWRFQVLRENNFKQ-TIPRVTIEDGEEITYQKVTSAVRRGAHHLAALQTSDGHWPAQ  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPLFF PPL+  +YI+G+++ +   EH+KE++RY Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFLPPLVFCMYITGNLESVFPEEHRKEILRYTYYHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             ALNY+ +R+LGE      D+A AR R WI  HGG T IPSWGK +LS+LGV++W G NP+
Sbjct  179   ALNYICMRMLGEGPNGGHDNACARARKWIRDHGGVTHIPSWGKTWLSILGVFDWCGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+  +PY+++
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKV  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W   R  C KED YYPH  IQD++W++L   TEP++ RWPFNK IRE A++  + H+ Y
Sbjct  299   NWKKARHQCAKEDLYYPHPLIQDLIWDSLYIFTEPLLTRWPFNKLIREKALQVTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLARVPD+LW++EDGMTMQ+FGSQ W
Sbjct  359   EDETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMTMQSFGSQEW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA FA QAL+++ ++EE G    K H ++K+SQ+K+NP GDFKSM+RH SKG+W FSDQD
Sbjct  419   DAGFAVQALLATNIIEEIGPTFAKGHDFIKKSQVKDNPFGDFKSMHRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSP----------E  1015
             HGW VSDCTAE +KC LLL  + PEI GEK++ + LY++V++ L LQ+           +
Sbjct  479   HGWQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQASTIKFRETIYSK  538

Query  1014  SGGFAVWEPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEV  835
              GG A WEP   Q +LE+LNP+E FADIVV+ E+VE TGS + AL  FK  YP +R KE+
Sbjct  539   KGGLAAWEPAGAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEI  598

Query  834   AMSIAKAAEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFF  655
                I  A  +LE  Q ADGSWYG WG+CF YG+ FAL GL AAG++Y N  AIRKA  F 
Sbjct  599   ENFITNAVRFLEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTYTNCAAIRKAVKFL  658

Query  654   LSKQNQEGGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAK  475
             L+ Q ++GGWGE   S P   Y+P EG+RSNVV T+WA++GL++  QA+RDP PLHRAAK
Sbjct  659   LTTQREDGGWGESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQADRDPMPLHRAAK  718

Query  474   LLINAQMEDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             LLIN+Q+E+GD+PQQ+ITG +MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  719   LLINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  766



>ref|XP_008380418.1| PREDICTED: beta-amyrin synthase [Malus domestica]
Length=761

 Score =   922 bits (2383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/759 (58%), Positives = 561/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MWKLK  +GG  PYIYSTNN+ GRQI+E+DP AGT EE+   E+AR  F   R Q  P  
Sbjct  1     MWKLKXADGGNDPYIYSTNNFVGRQIFEFDPEAGTTEERAEVEEARLHFYNNRYQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GD   RMQ ++E      +IPP ++ + EE+ +E  T ++R++V    ALQA DGHWPA
Sbjct  59    SGDFLWRMQFLREXNFKQ-TIPPXKVEDGEEITHEKATASLRRSVHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCVYITGHLNTVFHAEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +AL+Y+ +R+LGE  D    +A AR R WIL HG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TALSYICMRILGEGPDGGQDNACARARKWILDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PYD+
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W   R  C KED YYPH +IQD LW++L  CTEP++ RWPFNK IR+ A+   + H+ 
Sbjct  298   INWKGVRHHCAKEDIYYPHPWIQDFLWDSLYICTEPLLTRWPFNKMIRKRALEVTMKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  WAEDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQ  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S + +E    L + H ++K+SQ+K+NP GDFKSM+RH SKG+  FSDQ
Sbjct  418   WDTGFAIQALLASNLTDEIAPTLARGHDFVKKSQVKDNPSGDFKSMHRHISKGSXTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LLL  M PE+ GEK++ + LY+AV++ + LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMMPPELVGEKMEPERLYDAVNVLISLQS-KNGGLAAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LEMLNP+E FADIVV+ E+VE T S + AL  FK  YP +R KE+   I  AA+
Sbjct  537   AGAAEWLEMLNPTEFFADIVVEHEYVECTSSAIQALVLFKKLYPGHRKKEIDQFITNAAQ  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG WG+CF YGT FAL GLTAAG+++ N   IRKA +F L+ Q + GG
Sbjct  597   YLENIQMEDGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCXVIRKAINFLLAIQKENGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +Y+P EGNRSN+V T+WAM+GL+Y  QAERDP PLHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIYAGQAERDPAPLHRAAKLIINSQMEN  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYRK V
Sbjct  717   GDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRKWV  755



>emb|CBI30890.3| unnamed protein product [Vitis vinifera]
Length=753

 Score =   922 bits (2383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/725 (59%), Positives = 545/725 (75%), Gaps = 8/725 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHTC  2410
             MW LK+ EG GP++YS NNY GRQIWE+DP AGTPEE+E   K ++ FTK R +  P+  
Sbjct  1     MWMLKVAEGHGPWLYSLNNYLGRQIWEFDPEAGTPEEREEVRKVQENFTKNRFRYKPN--  58

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL MRMQ+IKE+++D LSIPPVRL E+E+V YEA+TTAV+KAVRLN A+QAKDGHWPAE
Sbjct  59    GDLLMRMQLIKENQID-LSIPPVRLGEKEKVTYEAVTTAVKKAVRLNRAIQAKDGHWPAE  117

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFFTPPL++ LY +G++++ LT EHK EL+RY+ NHQNEDGGWG +I+GHSTM+G+
Sbjct  118   NAGPLFFTPPLIMVLYFTGTLNIALTPEHKVELLRYITNHQNEDGGWGFHIEGHSTMLGT  177

Query  2049  ALNYVALRLLGEEADD-AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPPE  1873
              L+Y+++R+LG   DD  +A GR WIL  GGAT  PSWGK YLSV G+YEW GCNP+PPE
Sbjct  178   TLSYISMRILGVGPDDKVVAAGRKWILDRGGATYSPSWGKCYLSVFGLYEWSGCNPLPPE  237

Query  1872  FWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDWN  1693
             FWLFPS+ P HP KMW Y RT YMPMSYLY  R+  P+T+LVL +R E+H +PY +IDW 
Sbjct  238   FWLFPSYLPMHPDKMWCYSRTVYMPMSYLYGTRFQAPITDLVLQLREEMHTEPYHEIDWA  297

Query  1692  NTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGAEE  1513
               R+ C KED YYPH+ IQD++W  L +  EPI++RWP +KIRE A++K I  + +  E 
Sbjct  298   KARLLCTKEDYYYPHSLIQDMIWGGLYHFGEPILKRWPVSKIRETAVKKAIEIIHWEDEN  357

Query  1512  SRYITIGAIEKSLQMMCWWAEDP--NCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             SRY+T G + K+  MM  WAE+P  N +  K+HLAR+PD+LWLAEDGM +Q+FGSQ WDA
Sbjct  358   SRYLTPGCVHKAFHMMAVWAENPDSNLNAFKHHLARIPDYLWLAEDGMKVQSFGSQLWDA  417

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
             +F  QA++ SGMVEEYG  LKK H ++K SQ +ENP GD++S YRHFSKGAW FSD+DHG
Sbjct  418   SFCIQAILESGMVEEYGTALKKGHDFIKLSQCQENPSGDYRSRYRHFSKGAWTFSDRDHG  477

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCT+EA++ LLLL Q   E+ GEK + QCL++A++     Q  +SGG A+WEP   
Sbjct  478   WQVSDCTSEALRVLLLLSQFPEELVGEKAEPQCLFDAINFLFSFQG-KSGGLALWEPAGA  536

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
             + +LE LNPSELFA+IV + E+VE T S +  L  FK  YP++R KEV   I KA  Y+E
Sbjct  537   EEWLEKLNPSELFANIVTEHEYVECTSSAIQTLLLFKKLYPNHRRKEVDNFIEKATGYVE  596

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
               Q+ DGSWYG WGICF Y   FAL GL A G++Y NS+ +RK   F LSKQ   GGWG 
Sbjct  597   NVQRPDGSWYGGWGICFTYAAWFALSGLAAVGKTYSNSKTVRKGVDFLLSKQKANGGWGG  656

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                SCP M Y+  EG+ +N+VQT+W ++GL+   Q ERDPTPLH AAKLLIN+Q+++GDF
Sbjct  657   SYLSCPDMLYVHLEGDHTNLVQTAWCLMGLIEAGQVERDPTPLHNAAKLLINSQLDNGDF  716

Query  438   PQQDI  424
             PQQ+I
Sbjct  717   PQQEI  721



>gb|AAO33578.1|AF478453_1 beta-amyrin synthase [Medicago truncatula]
Length=762

 Score =   922 bits (2383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/758 (57%), Positives = 557/758 (73%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLKIGEG   PY++STNN+ GRQ WEYDP AG+ EE+   E+ARK F   R K    C
Sbjct  1     MWKLKIGEGKNEPYLFSTNNFVGRQTWEYDPEAGSEEERAQVEEARKNFYDNRFK-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  R Q+++E+   + +I  V++ + EE+ YE  TT +R+      ALQ  DGHWPA+
Sbjct  60    GDLLWRFQVLRENNF-MQTIDGVKIEDGEEITYEKATTTLRRGTHHLAALQTSDGHWPAQ  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPLFF PPL+  +YI+G +D +   EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFMPPLVFCVYITGHLDSVFPREHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             ALNY+ +R+LGE  D    +A AR RNWI  HGG T IPSWGK +LS+LG+++W G NP+
Sbjct  179   ALNYICMRILGEGPDGGQDNACARARNWIRAHGGVTYIPSWGKTWLSILGLFDWLGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+H +PY++I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELHTQPYEKI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W  +R  C KED YYPH  IQD++W++L   TEP++ RWPFNK +R+ A+   + H+ Y
Sbjct  299   NWTKSRHLCAKEDIYYPHPLIQDLIWDSLYIFTEPLLTRWPFNKLVRKRALEVTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRY+TIG +EK L M+  W EDPN D  K HLARV D+LW++EDGMTMQ+FGSQ W
Sbjct  359   EDENSRYLTIGCVEKVLCMLACWVEDPNGDAYKKHLARVQDYLWMSEDGMTMQSFGSQEW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA FA QAL+++ + +E    L K H ++K+SQ+ ENP GDFKSM+RH SKG+W FSDQD
Sbjct  419   DAGFAVQALLAANLNDEIEPALAKGHDFIKKSQVTENPSGDFKSMHRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LLL  + PEI GEK++ + LY++V++ L LQS + GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQS-KKGGLAAWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               Q +LE+LNP+E FADIVV+ E+VE TGS + AL  FK  YP +R KE+   I++A  +
Sbjct  538   GAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFISEAVRF  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             +E  Q ADGSWYG WG+CF YG+  AL GL AAG++Y N  AIRKA  F L+ Q ++GGW
Sbjct  598   IEDIQTADGSWYGNWGVCFTYGSWVALGGLAAAGKTYTNCAAIRKAVKFLLTTQREDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   S P   Y+P EG+RSNVV T+WA++GL++  QAERDPTPLHRAAKLLIN+Q+E+G
Sbjct  658   GESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQAERDPTPLHRAAKLLINSQLEEG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             D+PQQ+ITG +MKNCMLHY  +R  +PL AL+EYR+RV
Sbjct  718   DWPQQEITGVFMKNCMLHYPMYRDIYPLWALAEYRRRV  755



>ref|XP_006364890.1| PREDICTED: beta-amyrin synthase-like [Solanum tuberosum]
Length=761

 Score =   922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/757 (57%), Positives = 552/757 (73%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLKI EG  GPY+YSTNNY GRQ WE+DPNAGT EE+   E+AR+ F   R K   + 
Sbjct  1     MWKLKIAEGQKGPYLYSTNNYVGRQTWEFDPNAGTIEERAEIEEARQQFWNNRYKVKPS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  RMQ + E     + IP V++ E+EE+++E  T A+ +AV    ALQA DGHWPAE
Sbjct  60    SDLLWRMQFLGEKNFKQI-IPAVKVEEDEEISHEVATIALHRAVNFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFF PPL++ +YI+G ++ +  +EH+KE++RYLY HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYLYCHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE  D    +A AR R WIL HG  TAIPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGPDGGVNNACARARKWILDHGSVTAIPSWGKTWLSILGVFEWIGTNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PY++I
Sbjct  239   PPEFWILPSFLPVHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYDQPYNEI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +W   R  C KED YYPH  +QD++W++L  CTEP++ RWPFNK+R  A+   + H+ Y 
Sbjct  299   NWKKVRHVCAKEDLYYPHPLVQDLMWDSLYICTEPLLTRWPFNKLRNKALEVTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
               FA QAL++S M +E  D L+K H ++KQSQ+ +NP GDFK MYRH SKG+W FSDQDH
Sbjct  419   TGFAIQALLASEMNDEIADTLRKGHDFIKQSQVTDNPSGDFKGMYRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAEA+KC LL   M  E+ G+ ++   LY++V++ L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEALKCCLLFSTMPRELVGQAMEPGRLYDSVNVILSLQS-KNGGLAAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                YLE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+ + I  A +YL
Sbjct  538   ASEYLELLNPTEFFADIVIEHEYVECTASSIQALVLFKKLYPGHRTKEINIFIDNAVKYL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WG+CF YG+ FAL GL AAG+SY N  A+RK   F L  Q  +GGWG
Sbjct  598   EDVQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKSYNNCAAVRKGVEFLLRTQRSDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP   Y   E N SN+VQT+WA++GL+++ Q +RDP PLHRAAKLLIN+QMEDGD
Sbjct  658   ESYRSCPDKVYRELETNDSNLVQTAWALMGLIHSGQVDRDPRPLHRAAKLLINSQMEDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+ITG +MKNCMLHYA++R+ +PL  L+EYRK V
Sbjct  718   FPQQEITGVFMKNCMLHYAAYRNIYPLWGLAEYRKNV  754



>gb|AFM82492.1| lupeol synthase [Eleutherococcus trifoliatus]
Length=763

 Score =   922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/759 (56%), Positives = 552/759 (73%), Gaps = 10/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEG--GGPYIYSTNNYAGRQIWEYDPN-AGTPEEQEAFEKARKGFTKQRQKGPH  2416
             MWKLKI EG    PY+YSTNN+ GRQ WE+DP+  G+P E E  E+AR+ F + R K   
Sbjct  1     MWKLKIAEGDKNDPYLYSTNNFVGRQTWEFDPDYVGSPGELEEVEEARRQFWENRYK-VK  59

Query  2415  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2236
              CGDL  RMQ ++E      +IP V++ ++E V Y+A TT +R+AV    ALQA DGHWP
Sbjct  60    PCGDLLWRMQFLREKNFKQ-TIPQVKVGDDEAVTYDAATTTLRRAVHFFSALQASDGHWP  118

Query  2235  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  2056
             AE +GPLFF PPL++ +YI+G +D +  ++H+KE++RY+Y HQNE+GG GL+I+GHSTM 
Sbjct  119   AEIAGPLFFLPPLVMCVYITGHLDTVFPAKHRKEILRYIYCHQNENGGGGLHIEGHSTMF  178

Query  2055  GSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
             G+  +Y+ +R+LG+  D    +A A+GR WIL HG ATAIPSWGK +LS+LGVYEW G N
Sbjct  179   GTTFSYICMRILGKGPDGGVNNACAKGRKWILDHGSATAIPSWGKTWLSILGVYEWTGSN  238

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFWL PS    HPAKM  YCR  Y+PMSYLY KR+ GP+T L+L ++ E++ +PY+
Sbjct  239   PMPPEFWLLPSSLSVHPAKMLCYCRMVYLPMSYLYGKRFVGPITPLILQLKEELYAQPYN  298

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
             +I W   R  C KED YYPH  IQD+LW++L    EP++ RWPFNK+RE A++  + H+ 
Sbjct  299   EIRWGKVRHVCAKEDIYYPHPLIQDLLWDSLHVLAEPLLTRWPFNKLREKALQTTMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSRYITIGCVEKILCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQE  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  F  QAL++S +  E G  L K H ++K+SQ+K+NP GDFKSMYRH SKG+W FSDQ
Sbjct  419   WDIGFGIQALLASDLTHELGPTLMKGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQ  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC L+   M  EI G+K++ + LY +V++ L LQS ++GG A WEP
Sbjct  479   DHGWQVSDCTAEGLKCCLIFSTMPEEIVGKKMEPELLYNSVNVLLSLQS-KNGGVAAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+ NP+E FAD +++ E+VE T S + AL  FK  YP +R KE+   I  A  
Sbjct  538   ATAQDWLELFNPTEFFADTIIEHEYVECTSSAIQALTLFKKLYPGHRKKEIDNFITNAIR  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             ++E  Q  DGSWYG WG+CF YGT FAL GL A G++Y N  A+RKA +F L  Q  +GG
Sbjct  598   FIEDIQIPDGSWYGNWGVCFTYGTWFALGGLAAGGKTYNNCAAVRKAVNFLLESQLDDGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP   Y+P EGNRSN+V T WA++GL+++ QAERDPTPLHRAAKLLIN+QMED
Sbjct  658   WGESHLSCPRKVYVPLEGNRSNLVHTGWALMGLIHSGQAERDPTPLHRAAKLLINSQMED  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG++MKNCMLHYA +R+ +PL AL+EYR+RV
Sbjct  718   GDFPQQEITGAFMKNCMLHYAVYRNIYPLWALAEYRRRV  756



>gb|AIS39794.1| mixed amyrin synthase 2 [Ilex asprella var. asprella]
Length=761

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/758 (57%), Positives = 552/758 (73%), Gaps = 10/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LKI EGG  PY+YSTNNY GRQIWE+DP+ GTPEE+   E+AR  F   R Q  P  
Sbjct  1     MWRLKIAEGGNDPYLYSTNNYVGRQIWEFDPDYGTPEERAEVEEARLQFWNNRYQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             CGDL  RMQ ++E      +IP V++ + EE+ YE  TT +R+AV    ALQA DGHWPA
Sbjct  59    CGDLLWRMQFLREKNFKQ-TIPQVKVEDGEEITYETATTTLRRAVHFFAALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +GPL+F PPL++ LYI+G  + +  +E++KE++RYLY HQNEDGGWG +I+GHS M  
Sbjct  118   EIAGPLYFLPPLVMCLYITGHFNTVFPAEYRKEILRYLYCHQNEDGGWGFHIEGHSIMFC  177

Query  2052  SALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + L+Y+ +R+LGE      ++A AR R WIL HG  TAIPSWGK +LS+ GV+EW G NP
Sbjct  178   TTLSYICMRILGEGPHGGKNNACARARKWILDHGSVTAIPSWGKTWLSIFGVFEWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPE+W  P+  P HPA MW YCR  Y+PMSYLY KR+ GP+T LVL +R E++ +PY +
Sbjct  238   MPPEYWSLPTFLPIHPANMWCYCRLIYLPMSYLYGKRFVGPITPLVLQLREELYDQPYHE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I W+  R  CCKED YYPH  IQD+LW+ L  CTEP++ RWPFNK+RE +++  + H+ Y
Sbjct  298   IKWSKVRHLCCKEDLYYPHPLIQDLLWDGLYICTEPLLTRWPFNKLREKSLQTAMKHIHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLARVPD++W+AEDG+ MQ+FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARVPDYIWVAEDGIKMQSFGSQEW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  FA QAL++SG+  +    L K H ++KQSQ+K+NP GDFKSMYRH SKG+W FSDQD
Sbjct  418   DTVFALQALLASGLTNDIEPTLSKGHDFVKQSQVKDNPSGDFKSMYRHISKGSWTFSDQD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LL   M  EI GEK++ Q LY++V+I L LQS ++GG A WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSLMPQEIVGEKMEPQRLYDSVNILLSLQS-KNGGLAAWEPI  536

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 ++E+LNP+E FADIV++ E+VE T S + +L  F   YP +R KE+   I  A  +
Sbjct  537   RAYDWMELLNPTEFFADIVIEHEYVECTSSAIQSLVLFNKLYPGHRTKEIESFITNAVRF  596

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q +DGSWYG WG+CF YGT FAL GL AAG++Y N  ++RKA  F L  Q  +GGW
Sbjct  597   LEDVQMSDGSWYGNWGVCFTYGTWFALGGLEAAGKTYNNCLSVRKAVDFLLKSQRDDGGW  656

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  K+ P EGNRSN+V T WAM+GL+++ QAERDPTPLHRAAKLLIN+QME+G
Sbjct  657   GESYVSCPNKKFTPLEGNRSNLVHTGWAMMGLIHSGQAERDPTPLHRAAKLLINSQMENG  716

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DFPQQ+ITG + KNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  717   DFPQQEITGVFNKNCMLHYAAYRNIYPLWALAEYRKRV  754



>gb|KHN38108.1| Beta-amyrin synthase [Glycine soja]
Length=783

 Score =   920 bits (2377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/778 (55%), Positives = 557/778 (72%), Gaps = 28/778 (4%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EGG   YI+STNN+ GRQ WE+DP AGTPEE+   E ARK F   R K    C
Sbjct  1     MWRLKIAEGGNEAYIFSTNNFVGRQTWEFDPEAGTPEERAQVEAARKDFYHHRFK-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  R Q+++E+     +IP V++ + EE+ Y+ +T+ VR+      ALQ  DGHWPA+
Sbjct  60    ADLLWRFQILRENNFKQ-TIPSVKIEDGEEITYQKVTSTVRRGAHHLAALQTSDGHWPAQ  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPLFF PPL+  +YI+G ++ +   EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFLPPLVFCMYITGHLESVFPEEHRKEILRYIYYHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             ALNY+ +R+LGE      D+A AR RNWI  HGG T IPSWGK +LS+LGV++W G NP+
Sbjct  179   ALNYICMRILGEGPNGGHDNACARARNWIRDHGGVTHIPSWGKTWLSILGVFDWCGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+  +PY+++
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKV  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W   R  C KED YYPH  +QD++W++L   TEP++ RWPFNK IRE A++  + H+ Y
Sbjct  299   NWKKARHQCAKEDLYYPHPLVQDLIWDSLYIFTEPLLTRWPFNKLIREKALQVTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW++EDGMTMQ+FGSQ W
Sbjct  359   EDETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARIPDYLWVSEDGMTMQSFGSQEW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA FA QA +++ ++EE G  L K H ++K+SQ+K+NP GDFKSMYRH SKG+W FSDQD
Sbjct  419   DAGFAVQAFLATNLIEEIGPTLAKGHDFIKKSQVKDNPLGDFKSMYRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQS------------  1021
             HGW VSDCTAE++KC LLL  + PEI GEK++ + LY++V++ L LQ+            
Sbjct  479   HGWQVSDCTAESLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQARLTINDDMMGSF  538

Query  1020  --------PESGGFAVWEPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKH  865
                      + GG A WE    Q +LE+LNP+E FADIVV+ E+VE TGS + AL  FK+
Sbjct  539   LKFNTTSFSKKGGLAAWELAGAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKN  598

Query  864   DYPDYRAKEVAMSIAKAAEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENS  685
              YP +R KE+   IA A  +LE  Q ADGSWYG WG+CF YG+ FAL GL AAG++Y N 
Sbjct  599   LYPGHRKKEIENFIANAVRFLEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTYTNC  658

Query  684   EAIRKAAHFFLSKQNQEGGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAER  505
              AIRKA  F LS Q ++GGWGE   S P   Y+P EG+RSNVV T+ A++GL++  QA+R
Sbjct  659   AAIRKAVKFLLSTQREDGGWGESYLSSPKKIYVPLEGSRSNVVHTALALMGLIHAGQADR  718

Query  504   DPTPLHRAAKLLINAQMEDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DP PLHRAAKLLIN+Q+E+GD+PQQ+ITG +MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  719   DPKPLHRAAKLLINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  776



>gb|AHI17180.1| beta-amyrin synthase, partial [Glycine max]
Length=762

 Score =   920 bits (2377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/759 (57%), Positives = 553/759 (73%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LKI EGG  PYIYSTNN+ GRQ WEYDP  G+ EE+   + AR  F   R Q  P  
Sbjct  1     MWRLKIAEGGKDPYIYSTNNFVGRQTWEYDPGGGSAEERAQVDAARLHFYNNRFQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             CGDL  R Q+++E+     +I  V++ + EE+ YE  TTAVR+A     ALQ  DGHWPA
Sbjct  59    CGDLLWRFQILRENNFKQ-TIASVKIGDGEEITYEKATTAVRRAAHHLSALQTSDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             + +GPLFF PPL+  +YI+G +D +   E++KE++RY+Y HQN DGGWGL+I+GHSTM  
Sbjct  118   QIAGPLFFLPPLVFCMYITGHLDSVFPEEYRKEILRYIYYHQNMDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ +R+LGE      D+A AR R WI  HGG T IPSWGK +LS+LGV++W G NP
Sbjct  178   TALNYICMRMLGEGPNGGHDNACARARKWIRDHGGVTHIPSWGKTWLSILGVFDWCGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+  +PY++
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEK  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             ++W   R  C KED YYPH  IQD++W++L   TEP++ RWPFNK IRE A++  + H+ 
Sbjct  298   VNWKKARHQCAKEDLYYPHPLIQDLIWDSLYIFTEPLLTRWPFNKLIREKALQVTMKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDPN D  K HLARVPD+LW++EDGMTMQ+FGSQ 
Sbjct  358   YEDETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMTMQSFGSQE  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WDA FA QAL+++ ++EE G    K H ++K+SQ+K+NP GDFKSM+RH SKG+W FSDQ
Sbjct  418   WDAGFAVQALLATNIIEEIGPTFAKGHDFIKKSQVKDNPFGDFKSMHRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LLL  + PEI GEK++ + LY++V++ L LQS + GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQS-KKGGLAAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP+E FAD VV+ E+VE TGS + AL  FK  YP +R KE+   I  A  
Sbjct  537   AGAQEWLELLNPTEFFADTVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFITNAVR  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             +LE  Q ADGSWYG WG+CF YG+ FAL GL AAG++Y N  AIRKA  F L+ Q ++GG
Sbjct  597   FLEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTYTNCAAIRKAVKFLLTTQREDGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   S P   Y+P EG+RSNVV T+WA++GL++  QA+RDP PLHRAAKLLIN+Q+E+
Sbjct  657   WGESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQADRDPMPLHRAAKLLINSQLEE  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GD+PQQ+ITG +MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  717   GDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  755



>gb|AIE17465.1| oxidosqualene cyclase [Centella asiatica]
Length=761

 Score =   919 bits (2376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/757 (55%), Positives = 548/757 (72%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKIG+G    Y++STNNY GRQ WE+DP  GTPEE+   E AR  F   R K     
Sbjct  1     MWRLKIGDGTHDSYLFSTNNYVGRQTWEFDPEYGTPEERAEVEDARLQFWNNRHK-VRAN  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  R+Q ++E      +IP V++ + EE+ YE +TT +R+AV     LQ+  GHWPAE
Sbjct  60    GDLLWRLQFLREKNFKQ-TIPQVKVEDGEEITYETVTTTLRRAVHFWAELQSDHGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GP++F PPL+  +YI+G ++ +  +EH+KE++RY+Y  QNEDGGWG +I+GHSTM  +
Sbjct  119   IAGPMYFLPPLVFCMYITGHLNTVFPAEHRKEILRYIYCQQNEDGGWGFHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             ALNY+ +R+LGE      D+A ARGR WI+ HG  TAIPSWGK +LS+LG+Y+W G NP+
Sbjct  179   ALNYITMRILGEGPDGGIDNACARGRKWIIDHGSVTAIPSWGKTWLSILGLYDWSGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWL PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PY+ I
Sbjct  239   PPEFWLLPSILPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLRKELYSRPYETI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
              W + R  C KE  YYPH  IQD++W+ L   TEP++ RWPFNK+RE A++  + H+ Y 
Sbjct  299   KWKSVRHICAKEGVYYPHPLIQDLMWDGLYIFTEPLLTRWPFNKLRERALQTTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  WAEDP+ D  K HLARVPD++WLAEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWAEDPDGDCFKKHLARVPDYIWLAEDGMKMQSFGSQQWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             A FA QAL++S M +E    LKK HF++K+SQ+K+NP GDFKSM+RH SKG+W FSDQDH
Sbjct  419   AGFAIQALLASDMTDEIQTTLKKGHFFIKESQVKDNPSGDFKSMHRHVSKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +KC LL   M PEI GEK++   L++AV+I L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLFSMMPPEIVGEKMEDSQLFDAVNILLSLQS-KNGGLAAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE+LNP+E F DIV++ E+ E T S + AL  FK  YP +R K++   +     +L
Sbjct  538   SSEWLELLNPTEFFEDIVIEHEYAECTSSAIQALVLFKKLYPGHRKKKIESFLRSTVRFL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  +G WYG WG+CF YGT  A+ GL AAG++Y NS+ +RKA  F L +Q  +GGWG
Sbjct  598   ENIQTPEGGWYGNWGVCFTYGTWLAMGGLAAAGKTYNNSKTVRKAVEFLLKRQCSDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP  +Y+P EGNRSN+V T+WA++ L+++ QAERDPTPLHRAAKLLIN+QME GD
Sbjct  658   ESYRSCPEKRYVPLEGNRSNLVHTAWALMSLIHSGQAERDPTPLHRAAKLLINSQMETGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ++TG +M+NCMLHY ++R+ +PL AL+EYRK+V
Sbjct  718   FPQQEVTGVFMRNCMLHYTTYRNTYPLWALAEYRKKV  754



>gb|ACV21067.1| beta-amyrin synthase [Glycyrrhiza uralensis]
Length=762

 Score =   919 bits (2376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/759 (57%), Positives = 556/759 (73%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LKI EGG  PYIYSTNN+ GRQ WEYDP+ G+ EE+   + AR  F   R Q  P  
Sbjct  1     MWRLKIAEGGKDPYIYSTNNFVGRQTWEYDPDGGSAEERAQVDAARLHFYNNRFQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             CGDL  R Q+++E+     +I  V++ + EE+ YE  TTAVR+A     ALQ  DGHWPA
Sbjct  59    CGDLLWRFQILRENNFKQ-TIASVKIGDGEEITYEKATTAVRRAAHHLSALQTSDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             + +GPLFF PPL+  +YI+G +D +   E++KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   QIAGPLFFLPPLVFCMYITGHLDSVFPEEYRKEILRYIYYHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ +R+LGE  D    +A AR R WI  HGG T IPSWGK +LS+LGV++  G NP
Sbjct  178   TALNYICMRILGEGPDGGQDNACARARKWIHDHGGVTHIPSWGKTWLSILGVFDRCGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+  +PY++
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTEPYEK  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             ++W   R  C KED YYPH  +QD++W++L   TEP++ RWPFNK +RE A++  + H+ 
Sbjct  298   VNWKKARHQCAKEDLYYPHPLLQDLIWDSLCLFTEPLLTRWPFNKLVREKALQVTMKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDPN D  K HLARVPD+LW++EDGMTMQ+FGSQ 
Sbjct  358   YEDETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMTMQSFGSQE  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WDA FA QAL+++ +VEE    L K H ++K+SQ+++NP GDFKSMYRH SKG+W FSDQ
Sbjct  418   WDAGFAVQALLATNLVEEIAPTLAKGHDFIKKSQVRDNPSGDFKSMYRHVSKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LLL  + PEI GEK++ + LY++V++ L LQS + GG + WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQS-KKGGLSAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP+E FADIVV+ E+VE TGS + AL  FK  YP +R KE+   IA A  
Sbjct  537   AGAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFIANAVR  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             +LE  Q ADGSWYG WG+CF YG+ FAL GL AAG+++ N  AIRKA  F L+ Q ++GG
Sbjct  597   FLEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTFANCAAIRKAVKFLLTTQREDGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   S P   Y+P EG+RSNVV T+WA++GL++  QAERDP PLHRAAKL+IN+Q+E+
Sbjct  657   WGESYLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQAERDPAPLHRAAKLIINSQLEE  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GD+PQQ+ITG +MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  717   GDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  755



>ref|XP_004305793.1| PREDICTED: beta-amyrin synthase-like [Fragaria vesca subsp. vesca]
Length=769

 Score =   919 bits (2375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/758 (56%), Positives = 551/758 (73%), Gaps = 11/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG--GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLK+ EGG    YIYSTNN+ GRQ WE+DPNAGT EE+   E AR  F   R +    
Sbjct  1     MWKLKVAEGGDSSAYIYSTNNFVGRQTWEFDPNAGTDEERAEVEAARLHFYNNRHQ-VKA  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GDL  RMQ ++E +    +IPPV++ + E + +E  T A+R++V    ALQA DGHWPA
Sbjct  60    NGDLLWRMQFLREKKFKQ-TIPPVKVEDGEVITHEKTTDALRRSVHFFSALQASDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL+I LYI+G +D +   EH+KE++RY+Y HQNEDGGWGL+++GHSTM  
Sbjct  119   ENAGPLFFLPPLVIGLYITGHLDSVFHEEHRKEILRYIYYHQNEDGGWGLHVEGHSTMFS  178

Query  2052  SALNYVALRLLGEEADD-----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
             +AL+Y+++R LGE +DD     A  R R WIL HGG T IPSWGK +LS LG+++W GCN
Sbjct  179   TALSYISMRFLGEGSDDGGQDNACPRARKWILDHGGVTHIPSWGKTWLSFLGLFDWSGCN  238

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFW+ PS  P HPAKMW YCR  YMPMSYLY +R+ GP+T L+L +R E+ V+PY+
Sbjct  239   PVPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGRRFVGPITPLILQLREELFVQPYN  298

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHM  1531
             +I+W   R  C KED YYPH +IQ++LW++L   TEP++ RWPFNK IRE A++  + H+
Sbjct  299   EINWKKIRHLCAKEDIYYPHPWIQNLLWDSLYISTEPLLTRWPFNKLIREKALQVTMKHI  358

Query  1530  RYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQ  1351
              Y  E SRYITIG +EK L M+  WAEDPN +  K HLAR+PD+LW+AEDGM MQ+FGSQ
Sbjct  359   HYEDENSRYITIGCVEKVLCMLACWAEDPNGEYFKKHLARIPDYLWIAEDGMKMQSFGSQ  418

Query  1350  NWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSD  1171
              WD  FA QAL+++ + +E G  L + H ++K SQ+K+NP GDFKSM+RH SKG+W FSD
Sbjct  419   MWDTGFAIQALLATNLTDEIGPTLARGHDFIKISQVKDNPSGDFKSMHRHISKGSWTFSD  478

Query  1170  QDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWE  991
             QDHGW VSDCTAE +KC LLL  M  E  GEK++ + LY++V++ L LQS ++GG + WE
Sbjct  479   QDHGWQVSDCTAEGLKCCLLLSMMPSETVGEKMEPERLYDSVNVLLSLQS-KNGGLSAWE  537

Query  990   PPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAA  811
             P     +LE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+   I  A 
Sbjct  538   PAGAAEWLELLNPTEFFADIVIEHEYVECTSSAIQALVLFKKLYPGHRKKEIEHFITNAT  597

Query  810   EYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEG  631
              Y+E  Q  DGSWYG WGICF YGT FAL GL AAG+++    A+RKA  F L+ Q + G
Sbjct  598   HYIENTQMPDGSWYGNWGICFTYGTWFALGGLAAAGKTFSTCAAMRKAVRFLLTTQKENG  657

Query  630   GWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQME  451
             GWGE   S P   YIP EGNRSN+V T+WAM+ L+++ QAER+ TPL RA K +IN+Q+E
Sbjct  658   GWGESYLSSPQKTYIPLEGNRSNLVHTAWAMMALIHSGQAERNRTPLRRATKFIINSQLE  717

Query  450   DGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             +GDFPQQ++TG ++KNCMLHYA++R+ FPL AL+EYR+
Sbjct  718   NGDFPQQELTGVFLKNCMLHYAAYRNIFPLWALAEYRR  755



>sp|A8C980.1|GERS_RHISY RecName: Full=Germanicol synthase; Short=RsM1 [Rhizophora stylosa]
 dbj|BAF80441.1| multifunctional triterpene synthase [Rhizophora stylosa]
Length=759

 Score =   919 bits (2374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/759 (56%), Positives = 553/759 (73%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LKI EGG  PY+YSTNNY GRQIWE+DP+AGTPEE+   E+AR+ F K R Q  P  
Sbjct  1     MWRLKIAEGGNDPYLYSTNNYVGRQIWEFDPDAGTPEERAKAEEARQNFYKNRYQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GDL  R+Q ++E      +IP VR+ E EE+  E  TTA+R+AV+   ALQA DGHWPA
Sbjct  59    SGDLLWRLQFLREKNFKQ-TIPQVRIEEGEEITREKATTALRRAVQFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++ + I+G +D +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCMCITGHLDTVFPAEHRKEILRYIYYHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ +R+LGE      DDA  R R WI  HG  T IPSWGK +LS+LGVY+W GCNP
Sbjct  178   TALNYICMRILGEGPNGGQDDACTRARKWIHDHGSVTNIPSWGKTWLSILGVYDWSGCNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ G +T L+  +R E+  +PYDQ
Sbjct  238   MPPEFWMLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGLITPLIQQLREELFTQPYDQ  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHMR  1528
             I+W      C  ED YYPH FIQD++W+ L    EP++ RWP N I R+ A+   + H+ 
Sbjct  298   INWKKNCHQCAPEDLYYPHPFIQDLIWDCLYISMEPLLTRWPLNMIIRKKALELTMKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y    SRYITIG +EK L M+  W EDPN D  K HLAR+PD++W+AEDGM MQ+FGSQ 
Sbjct  358   YEDGSSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGMKMQSFGSQQ  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL+++ + +E G  L++ H ++K+SQ+++NP GDFKSMYRH SKG+W FSDQ
Sbjct  418   WDTGFAIQALLATNLTDEIGGVLRRGHDFIKKSQVQDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LL   M PEI GE ++ + LY++V++ L LQS ++GG + WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLFSMMPPEIVGEHMEPERLYDSVNVLLSLQS-KNGGLSAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+   IAK+  
Sbjct  537   AGAQDWLELLNPTEFFADIVIEHEYVERTSSAIHALVLFKKLYPGHRKKEIEDFIAKSVR  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             +LE+ Q +DG+WYG WG+CF YGT FAL GL AAG++Y +  A+RKA  F L  Q  +GG
Sbjct  597   FLESIQTSDGTWYGNWGVCFTYGTWFALGGLAAAGKTYNSCLAMRKAVDFLLRIQKDDGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  KY+P E N SN+V T+WAM+ L++  Q +RDPTPLHRAAKL+IN+Q+ED
Sbjct  657   WGESYLSCPEKKYVPLEANHSNLVHTAWAMMALVHAGQMDRDPTPLHRAAKLMINSQLED  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG + +NCMLHYA++R+ +PL AL+EY +RV
Sbjct  717   GDFPQQEITGVFNRNCMLHYAAYRNIYPLWALAEYCRRV  755



>gb|ACA13386.1| beta-amyrin synthase [Artemisia annua]
Length=761

 Score =   918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/757 (56%), Positives = 556/757 (73%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EG   PY+YSTNN+ GRQIWE+DPN GTPEE+   E+AR  F   R +   + 
Sbjct  1     MWRLKIAEGRNDPYLYSTNNFVGRQIWEFDPNYGTPEERAEVEQARVDFWNHRHEVKPS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              D+  RMQ ++E   +  +IP V++ + EE++YE  TT +R++V    ALQA DGHWPAE
Sbjct  60    SDVLWRMQFLREKGFEQ-TIPQVKIEDGEEISYEKATTTLRRSVNFFAALQADDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPL+F  PL+I LYI+G ++ +  +E++KE++RY+Y HQNEDGGWG +I+GHSTM  +
Sbjct  119   NAGPLYFMQPLVICLYITGHLNTVFPAEYRKEILRYIYCHQNEDGGWGFHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              L+Y+ +RLLGE      D A  + R WIL HG  T IPSWGK +LS+LGV EW G NP+
Sbjct  179   TLSYICMRLLGEGRDGGLDGACTKARKWILDHGSVTTIPSWGKTWLSILGVCEWAGTNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P +PAKMW YCR  YMPMSYLY KR+ GP+T L+L +R+E++ +PYD+I
Sbjct  239   PPEFWILPSFLPMYPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLRDELYAQPYDEI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
              W + R  C KED YYPH  +QD++W++L   TEP++  WPFNK+RE A++  + H+ Y 
Sbjct  299   KWRSIRHLCAKEDLYYPHPLLQDLMWDSLYVFTEPVLNHWPFNKLREKALQTTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG++EK+L M+  W EDPN    K H+AR+PD+LW+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGSVEKALCMLACWVEDPNGVCFKKHIARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             A FA QAL+++ + +E G  L K H ++K SQ+K+NP GDFKSM+RH SKG+W FSDQDH
Sbjct  419   AGFAIQALMATDLTDEIGSTLMKGHEFIKASQVKDNPSGDFKSMHRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAEA+KC LL   M PEI GEK+  + L +AV++ L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEALKCCLLFATMPPEIVGEKMKPEQLNDAVNVILSLQS-KNGGLAAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+   +  ++ YL
Sbjct  538   SSEWLEILNPTEFFADIVIEHEYVECTSSAIQALVMFKKKYPGHRKKEIENFLLGSSGYL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WG+CF YGT FAL GL+A G++Y+N  AIRKA  F L  Q ++GGWG
Sbjct  598   EKIQMEDGSWYGNWGVCFTYGTWFALGGLSAVGKTYDNCPAIRKAVKFLLETQLEDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E  +SCP  KYIP EG RSN+V T+WAM+GL+++ QAERD TPLHRAAKLLIN+Q+E GD
Sbjct  658   ESYKSCPEKKYIPLEGGRSNLVHTAWAMMGLIHSRQAERDATPLHRAAKLLINSQLETGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+I G +MKNCMLHYA +R+ +P+ AL++YRK+V
Sbjct  718   FPQQEIAGVFMKNCMLHYALYRNIYPMWALADYRKQV  754



>ref|XP_010245752.1| PREDICTED: taraxerol synthase-like [Nelumbo nucifera]
 ref|XP_010245753.1| PREDICTED: taraxerol synthase-like [Nelumbo nucifera]
 ref|XP_010245754.1| PREDICTED: taraxerol synthase-like [Nelumbo nucifera]
Length=764

 Score =   918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/759 (55%), Positives = 564/759 (74%), Gaps = 9/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MW+LKI +GGGP+IYSTNNY GRQIWE+DPN GTPEE    E+AR+ F   R K     G
Sbjct  1     MWRLKIAQGGGPFIYSTNNYIGRQIWEFDPNYGTPEEIAQVEQARQEFWNNRFK-VKPGG  59

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             D+ +R+Q++KE+   V +IPPVR+ E+EEV+YEA T  +R+AVR + ALQA DGHWPAEN
Sbjct  60    DVLLRLQLLKENNF-VQTIPPVRIGEDEEVSYEAATAVLRRAVRFHAALQASDGHWPAEN  118

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             SG  FF PPL+I LYI+G ++ I++ EH KE++RY+YNHQNEDGGWGL+I+G S M  + 
Sbjct  119   SGSNFFVPPLIICLYITGDLNKIISEEHCKEILRYIYNHQNEDGGWGLHIEGQSIMFSTV  178

Query  2046  LNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             LNY+++R+LGE      D A+ R R WI  HGGAT+IPSWGK +LSV+G+YEW+G NP+ 
Sbjct  179   LNYISMRILGEGPEGGRDGAVPRARKWIHDHGGATSIPSWGKAWLSVIGLYEWEGNNPMA  238

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEFWL PS FP  P  +W Y R  Y+PMSYLYAKR+ GP+T LVL +R EIH +PY +I 
Sbjct  239   PEFWLLPSFFPLSPENLWCYARLVYLPMSYLYAKRFVGPITPLVLQLREEIHSEPYHKIR  298

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             W+ TR  C KED +YPH FIQD+LW+ L    EP++ RWPFNK+RE A+++ + H+ Y  
Sbjct  299   WSKTRHMCAKEDLHYPHPFIQDLLWDTLYILIEPLLMRWPFNKLRERALKQTMKHIHYED  358

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTF-GSQNWD  1342
             + SRYITI  +EKS+ M+  W EDPN D  K+HLAR+PD++W+AEDGM +Q   GSQ+WD
Sbjct  359   QNSRYITIACVEKSILMLACWVEDPNGDAYKHHLARIPDYMWVAEDGMKLQCCSGSQSWD  418

Query  1341  ATFATQALISSGM-VEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             A+F  QA+++S +  +E G CLKK H ++K SQ+++NP GDFK MYRH SKG+W FS+QD
Sbjct  419   ASFVAQAIMASNLSFDEIGLCLKKGHDFIKNSQVRDNPSGDFKRMYRHISKGSWTFSNQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCT E +K  L+L  M PEI GEK++ + +++AV+I L LQS E+GG   WEP 
Sbjct  479   HGWQVSDCTGEGLKACLMLSLMPPEIVGEKLEEERIFDAVNILLSLQS-ENGGLPCWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               + + E+ NP+E+F+++ ++ E+VE T + + ++  F   YP++R +E+   I+KA  Y
Sbjct  538   KSKKWWELFNPTEIFSNVTIENEYVECTATTIQSIVLFMKLYPNHRKEEIESFISKATHY  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             +E +Q  +GSWYG WGICF+YGT FAL GL A G+ Y++  A+RK   F LS Q + GGW
Sbjct  598   IEQKQMPNGSWYGNWGICFIYGTWFALRGLAAVGKGYDDCVAVRKGVDFLLSIQKETGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  +Y P +G ++N+VQT+WA++GL++  QAERD TPLHRAAKLLIN+QME+G
Sbjct  658   GESYLSCPNEEYTPLKGGKTNLVQTAWALMGLIHGGQAERDTTPLHRAAKLLINSQMENG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVW  328
             DFPQ++ITG+ +K CM+HYA++R+ FPL AL EYR RV+
Sbjct  718   DFPQEEITGASIKTCMIHYATYRNIFPLWALGEYRTRVF  756



>gb|KEH28511.1| beta-amyrin synthase [Medicago truncatula]
Length=764

 Score =   918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/758 (56%), Positives = 552/758 (73%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLKI EGG  PY++STN++ GRQ WEYDP AG+ EE+   E+ARK F   R     TC
Sbjct  1     MWKLKIAEGGNEPYLFSTNSFVGRQTWEYDPEAGSEEERAQVEEARKNFYNNR-FNVKTC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  R Q+++E+     +I  V++ + EE+ YE  T  +RK  R   ALQ +DGHWPA+
Sbjct  60    GDLLWRFQVLRENNFKQ-TIDSVKIEDGEEITYEKATKTLRKGTRHLVALQTQDGHWPAQ  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPLF+ PPL+  +YI+G +D +   EH+KE++RY+Y HQNEDGGWGL I+GHSTM  +
Sbjct  119   IAGPLFYMPPLVFCVYITGHLDSVFPQEHRKEILRYIYCHQNEDGGWGLQIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             ALNY+ +R+LGE      D+A AR RNWI  HGG T IPSWGK +LS+LGVY+W G NP+
Sbjct  179   ALNYICMRILGEGPDGGQDNACARARNWIRDHGGVTRIPSWGKTWLSILGVYDWSGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+H +PY++ 
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELHTQPYEKT  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W  +R  C KED YYPH  IQD++W++L   TEP++ RWPFNK +R+ A+   + H+ Y
Sbjct  299   NWTKSRHLCAKEDLYYPHPLIQDLIWDSLYIFTEPLLTRWPFNKLVRKRALEVTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITI ++EK L M+  W EDPN D  K HLARVPD+LW++EDGMTMQTFGSQ W
Sbjct  359   EDENSRYITIASVEKVLCMLACWVEDPNGDAYKKHLARVPDYLWMSEDGMTMQTFGSQVW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D +FA QAL+++ ++EE    L K H ++K+SQ+++NP GDFKSMYRH SKG+W FSDQD
Sbjct  419   DTSFAIQALLATNLIEETAPALVKGHDFIKKSQVRDNPSGDFKSMYRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
              GW +SDCTAE +KC L L  + PEI GEK++ + LY++V+I L LQS ++GG A WEP 
Sbjct  479   QGWQLSDCTAEGLKCCLHLSMLPPEIVGEKMEPERLYDSVNILLSLQS-KNGGLAAWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LE+LNP+E F DIVV+ E+VE T S + AL  FK  YP +R KE+   I++A  +
Sbjct  538   GAPKWLEVLNPTEFFVDIVVEHEYVECTASAIQALILFKKLYPGHRKKEIENFISEAVRF  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             +E  Q ADGSWYG WG+CF YG  FAL GL AAG++Y N   IRKA  F L  Q ++GGW
Sbjct  598   IEDIQTADGSWYGNWGVCFTYGCWFALGGLAAAGKTYTNCATIRKAVKFLLRIQGKDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP   YI  EG RSNVVQT+WA++ L++  QAERDPTPLHRAAKLLIN+Q+E+G
Sbjct  658   GESYLSCPKKMYIQLEGRRSNVVQTAWALMALIHGGQAERDPTPLHRAAKLLINSQLEEG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             ++PQQDI+G++MKNCMLHY  +R  FPL AL+EYR++V
Sbjct  718   NWPQQDISGAFMKNCMLHYPMYRDIFPLWALTEYRRQV  755



>ref|XP_009344016.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=761

 Score =   917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/758 (57%), Positives = 560/758 (74%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLK+ +GG  PYIYSTNN+ GRQI+E+DP AGT EE+   E+AR  F   R +     
Sbjct  1     MWKLKVADGGNDPYIYSTNNFVGRQIFEFDPEAGTTEERAEVEEARLHFYNNRHQ-VKPS  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  RMQ ++E      +IPPV++ + EE+ +E  T ++R+++ L  ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREKNFKQ-TIPPVKIEDGEEITHEKATASLRRSIHLFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFF PPL+I +YI+G ++ +  +EH+KE++RY+Y HQN+DGGWG +I+GHS M  +
Sbjct  119   NAGPLFFLPPLVICIYITGHLNTVFHAEHRKEILRYIYYHQNQDGGWGFHIEGHSIMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE +D    +A AR R WIL HG  T +PSWGK +LS+LGV+EW GCNP+
Sbjct  179   ALSYICMRILGEGSDGGQDNACARARKWILDHGSVTHMPSWGKTWLSILGVFEWSGCNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P +PAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+  +PYD+I
Sbjct  239   PPEFWILPSFLPIYPAKMWCYCRMIYMPMSYLYGKRFVGPITPLILQLREELLAQPYDEI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +WN  R  C KED YYPH +IQD LW++L  CTEP++ RWP NK IR+ A+   + H+ Y
Sbjct  299   NWNGVRHHCAKEDIYYPHPWIQDFLWDSLYICTEPLLTRWPLNKLIRKRALEVAMEHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG++EK+L MM  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ W
Sbjct  359   EDENSRYITIGSVEKALCMMACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQMW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA FA QAL++S + +E    L + H ++K+SQ+K+NP GDFKSM+RH SKG+W FSDQD
Sbjct  419   DAGFAIQALLASNLTDEIAPTLARGHDFVKKSQVKDNPSGDFKSMHRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW +SD TAE +KC LLL  M PE+ GEK++ + LYEAV+I +YLQS ++GG AVWE  
Sbjct  479   HGWTLSDSTAEGLKCCLLLSMMPPELVGEKMEPEWLYEAVNIIIYLQS-KNGGLAVWERA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LE+LNP+E F DIV++ E++E T + + A+  FK  YP +R KE    I  AA+Y
Sbjct  538   GAAKWLEILNPTEFFVDIVLEHEYLECTAAAIQAIVLFKKLYPGHRKKETDQFITNAAQY  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             +E  Q  DGSWYG WG+CF YGT FAL GLTAAG+++ N   IRKA  F L  QN+ GGW
Sbjct  598   VENTQMEDGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCAVIRKAISFLLRMQNENGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  +Y+P EGNRSN+VQT+WAM+GL+Y  QAERDP PLHRAAKL+IN+Q+E+G
Sbjct  658   GESYLSCPKREYVPLEGNRSNLVQTAWAMMGLIYGGQAERDPAPLHRAAKLIINSQLENG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DFPQQ+I G +  NCMLHY ++R+ FPL AL+EYRK V
Sbjct  718   DFPQQEIAGVFKMNCMLHYPTYRNVFPLWALAEYRKWV  755



>gb|ACM89978.1| putative beta amyrin synthase [Malus domestica]
Length=762

 Score =   917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/759 (57%), Positives = 561/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MWKLK+ +GG  PYIYSTNN+ G QI+E+DP AGT EE+   E+AR  F   R Q  P  
Sbjct  1     MWKLKVADGGNDPYIYSTNNFVGMQIFEFDPEAGTTEERAEVEEARLHFYNNRYQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GDL  RMQ ++E      +IPP ++ + EE+ +E  T ++R++V    ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLREKNFKQ-TIPPFKVEDGEEITHEKATASLRRSVHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCVYITGHLNTVFHAEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +AL+Y+ +R+LGE  D    +A AR R WIL HG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TALSYICMRILGEGPDGGQDNACARARKWILDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PYD+
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W   R  C KED YYPH +IQD LW++L  CTEP++ RWPFNK IR+ A+   + H+ 
Sbjct  298   INWKGVRHHCAKEDIYYPHPWIQDFLWDSLYICTEPLLTRWPFNKLIRKRALDVTMKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  WAEDPN D  K HLAR+PD+LW+AEDG+ MQ+FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGLKMQSFGSQL  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD   A QAL++S + +E    L + H ++K+SQ+K+NP GDFKSM+RH SKG+W FSDQ
Sbjct  418   WDTGCAIQALLASNLTDEIAPTLARGHDFVKKSQVKDNPSGDFKSMHRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSD TA+ +KC LLL  M PE+ GE+++ + LY+AV++ + LQS ++GG A WEP
Sbjct  478   DHGWQVSDSTADGLKCCLLLSMMPPEMVGEQMEPERLYDAVNVIISLQS-KNGGLAAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LEMLNP+E FADIVV+ E+VE T S + AL  FK  YP +R KE+   I  AA+
Sbjct  537   AGAADWLEMLNPTEFFADIVVEHEYVECTSSAIQALVLFKKLYPGHRKKEIDQFITNAAQ  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q ADGSWYG WG+CF YGT FAL GLTAAG+++ N   IRKA  F L+ Q + GG
Sbjct  597   YLENTQMADGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCAVIRKAISFLLTIQKENGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +Y+P EGNRSN+V T+WAM+GL++  QAERDPTPLHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIHAGQAERDPTPLHRAAKLIINSQMEN  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG  MKNCMLHYA++R+  PL AL+EYRKRV
Sbjct  717   GDFPQQEITGVIMKNCMLHYAAYRNIHPLWALAEYRKRV  755



>emb|CBI18393.3| unnamed protein product [Vitis vinifera]
Length=872

 Score =   917 bits (2370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/755 (57%), Positives = 549/755 (73%), Gaps = 12/755 (2%)
 Frame = -3

Query  2589  KMWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPH  2416
             KMW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GT EE+   E AR+ F K R Q  P 
Sbjct  80    KMWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTTEERAEVEAARENFWKNRFQVKPS  139

Query  2415  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2236
             +  DL  RMQ ++E      +IP  ++ + EE+ YE  T AVR+      ALQA DGHWP
Sbjct  140   S--DLLWRMQFLREKNFKQ-TIPQAKVGDGEEITYETATAAVRRGAHFFSALQASDGHWP  196

Query  2235  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  2056
             AEN+GPL+F PPL++ LYI+G +D +   E++KE++RYLY HQNEDGGWGL+I+GHSTM 
Sbjct  197   AENAGPLYFLPPLVMCLYITGHLDTVFPGEYRKEILRYLYCHQNEDGGWGLHIEGHSTMF  256

Query  2055  GSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              + L+Y+ +R+LGE  D    +A ARGR WIL  GG T+IPSWGK +LS+ G+++W G N
Sbjct  257   CTTLSYICMRILGEGRDGGRDNACARGRKWILDRGGVTSIPSWGKTWLSIFGLFDWSGSN  316

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFWLFPS  P HPAKMW Y R  YMPMSYLY KR+ GP+T LVL +R E+ ++ Y+
Sbjct  317   PMPPEFWLFPSRLPMHPAKMWCYSRLVYMPMSYLYGKRFVGPITPLVLELREELFLQAYN  376

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
             +I+W   R  C KED YYPH  IQD++W++L  CTEP++ RWPFNK+R+ A+   + H+ 
Sbjct  377   EINWKKVRHLCAKEDLYYPHPLIQDLMWDSLYICTEPLLTRWPFNKLRQKALEVTMKHIH  436

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITI ++EK+L M+  W EDPN D  K HLAR+PDF+W+AEDG+ MQTFGSQ 
Sbjct  437   YEDENSRYITIASVEKALCMLTCWVEDPNGDYFKKHLARIPDFIWVAEDGIKMQTFGSQE  496

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++  M  E G  LKK H ++K+SQ+K+NP GDFKSMYR  S+G+W FSDQ
Sbjct  497   WDTGFALQALLACNMTNEIGPTLKKGHEFIKESQVKDNPSGDFKSMYRKISQGSWTFSDQ  556

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LL   M+PEI G  ++ + L+++V+I L LQS ++GG AVWEP
Sbjct  557   DHGWQVSDCTAEGLKCCLLFSMMAPEIVG--MEPERLFDSVNILLSLQS-KNGGLAVWEP  613

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LE+ NPSE+F DIV++ E+VE T S + AL  FK  YP +R KE+   I  A +
Sbjct  614   AGASEWLELFNPSEIFEDIVIEHEYVECTASAIQALVLFKKLYPQHRTKEIDNFITNATK  673

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             Y+E QQ  DGSWYG WG+CF YG+ FAL GL AAGR+Y N  AI +A  F L  Q  +GG
Sbjct  674   YIEDQQMPDGSWYGNWGVCFTYGSWFALGGLAAAGRTYHNCLAIGRAVEFLLKSQRDDGG  733

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SC   K    EGN+SN+VQT WA++GL+ + QAERDPTPLHRAAKLLIN+QMED
Sbjct  734   WGESYISCQDKKLTHLEGNKSNLVQTGWALMGLLSSGQAERDPTPLHRAAKLLINSQMED  793

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEY  343
             GDFPQQ+ITG++MKNCMLHYA +R+ FPL AL+EY
Sbjct  794   GDFPQQEITGAFMKNCMLHYADYRNIFPLWALAEY  828


 Score = 55.1 bits (131),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 12/53 (23%)
 Frame = -3

Query  501  PTPLHRAAKLLINAQMEDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEY  343
            PTPLH+  +L            +++ITG++MKNCMLHYA++R+ FPL AL++Y
Sbjct  12   PTPLHKPIRL------------RKEITGAFMKNCMLHYAAYRNIFPLWALAQY  52



>ref|XP_010472733.1| PREDICTED: amyrin synthase LUP2 isoform X1 [Camelina sativa]
Length=763

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/765 (55%), Positives = 559/765 (73%), Gaps = 10/765 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LKIGEG G  PY++S+NN+ GRQ WE+DP AGTPEE+ A E+AR+ F   R +    
Sbjct  1     MWRLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTPEERAAVEEARRKFVDNRSR-VKG  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             C DL  RMQ +KE++ + + IPPV++ + E + ++  T A+R+ V    ALQA DGHWP 
Sbjct  60    CSDLLWRMQFLKEAKFEQV-IPPVKIDDGEGITHQNATDALRRGVSFFSALQASDGHWPG  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +GPLFF PPL+  LYI+G ++ +  +EH+KE++R++Y HQNEDGGWGL+I+  S M  
Sbjct  119   EITGPLFFLPPLVFCLYITGHLEKVFDAEHRKEMLRHIYCHQNEDGGWGLHIESKSMMFC  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ LRLLGE  D    +A  R R+WIL  GG T IPSWGKI+LS+LG+Y+W G NP
Sbjct  179   TALNYICLRLLGEGPDGGRDNACKRARDWILDRGGVTYIPSWGKIWLSILGIYDWSGTNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPE WL PS  P H  K+  YCR  YMPMSYLY KR+ GP+T L+L +R E+H++PY  
Sbjct  239   MPPEIWLLPSFLPIHLGKVLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPYKS  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+WN +R    KED Y+PH  +QD++W+AL    EP + RWP NK +RE A+R+ + H+ 
Sbjct  299   INWNKSRRLYAKEDMYFPHPLVQDLVWDALYVFVEPFLTRWPLNKLVREKALRRAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E S YITIG +EK L M+  W E+PN D  K HLAR+PD++W+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QA+++S + +E GD LKK H Y+K+SQI+ENP GD++SMYRH SKGAW  SD+
Sbjct  419   WDTGFAVQAILASDLSDETGDVLKKGHDYIKKSQIRENPSGDYESMYRHISKGAWTLSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAEA KC LLL  M  E+ G+K+D + LY++V++ L  QS + GG   WEP
Sbjct  479   DHGWQVSDCTAEAFKCCLLLSMMPAEVVGQKMDPEQLYDSVNLLLSFQS-DKGGMTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  ++E+LNP+E  A++VV+ E+VE T S++ AL  FK  YPD++ KE++ SI KA +
Sbjct  538   VRAYEWIELLNPTEFLANLVVEREYVECTSSVMKALVLFKQLYPDHKTKEISRSIEKAVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             +LE +Q+ DGSWYG+WG+CF+Y T F L GL AAG++Y+NS+AIRK   F L+ Q  +GG
Sbjct  598   FLENEQRPDGSWYGFWGVCFIYATWFGLGGLAAAGKTYQNSQAIRKGVEFLLTTQKDDGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +YIP EG  SN+VQT+WA++GL+   QAERDP PLHRAAKL+IN+QME+
Sbjct  658   WGESYLSCPEQRYIPSEGKSSNLVQTAWAIMGLINAGQAERDPIPLHRAAKLIINSQMEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS*SH  313
             GDFPQQ+I G +MKNC+ HYA++R+ FPL AL+EYRK V+++  H
Sbjct  718   GDFPQQEIVGVFMKNCLTHYATYRNTFPLWALAEYRKAVFVTHQH  762



>ref|XP_002265019.2| PREDICTED: beta-amyrin synthase-like [Vitis vinifera]
Length=767

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/754 (57%), Positives = 548/754 (73%), Gaps = 12/754 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GT EE+   E AR+ F K R Q  P +
Sbjct  1     MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTTEERAEVEAARENFWKNRFQVKPSS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E      +IP  ++ + EE+ YE  T AVR+      ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-TIPQAKVGDGEEITYETATAAVRRGAHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPL+F PPL++ LYI+G +D +   E++KE++RYLY HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGPLYFLPPLVMCLYITGHLDTVFPGEYRKEILRYLYCHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + L+Y+ +R+LGE  D    +A ARGR WIL  GG T+IPSWGK +LS+ G+++W G NP
Sbjct  178   TTLSYICMRILGEGRDGGRDNACARGRKWILDRGGVTSIPSWGKTWLSIFGLFDWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFWLFPS  P HPAKMW Y R  YMPMSYLY KR+ GP+T LVL +R E+ ++ Y++
Sbjct  238   MPPEFWLFPSRLPMHPAKMWCYSRLVYMPMSYLYGKRFVGPITPLVLELREELFLQAYNE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I+W   R  C KED YYPH  IQD++W++L  CTEP++ RWPFNK+R+ A+   + H+ Y
Sbjct  298   INWKKVRHLCAKEDLYYPHPLIQDLMWDSLYICTEPLLTRWPFNKLRQKALEVTMKHIHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITI ++EK+L M+  W EDPN D  K HLAR+PDF+W+AEDG+ MQTFGSQ W
Sbjct  358   EDENSRYITIASVEKALCMLTCWVEDPNGDYFKKHLARIPDFIWVAEDGIKMQTFGSQEW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  FA QAL++  M  E G  LKK H ++K+SQ+K+NP GDFKSMYR  S+G+W FSDQD
Sbjct  418   DTGFALQALLACNMTNEIGPTLKKGHEFIKESQVKDNPSGDFKSMYRKISQGSWTFSDQD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LL   M+PEI G  ++ + L+++V+I L LQS ++GG AVWEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSMMAPEIVG--MEPERLFDSVNILLSLQS-KNGGLAVWEPA  534

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LE+ NPSE+F DIV++ E+VE T S + AL  FK  YP +R KE+   I  A +Y
Sbjct  535   GASEWLELFNPSEIFEDIVIEHEYVECTASAIQALVLFKKLYPQHRTKEIDNFITNATKY  594

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             +E QQ  DGSWYG WG+CF YG+ FAL GL AAGR+Y N  AI +A  F L  Q  +GGW
Sbjct  595   IEDQQMPDGSWYGNWGVCFTYGSWFALGGLAAAGRTYHNCLAIGRAVEFLLKSQRDDGGW  654

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SC   K    EGN+SN+VQT WA++GL+ + QAERDPTPLHRAAKLLIN+QMEDG
Sbjct  655   GESYISCQDKKLTHLEGNKSNLVQTGWALMGLLSSGQAERDPTPLHRAAKLLINSQMEDG  714

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEY  343
             DFPQQ+ITG++MKNCMLHYA +R+ FPL AL+EY
Sbjct  715   DFPQQEITGAFMKNCMLHYADYRNIFPLWALAEY  748



>ref|XP_010531951.1| PREDICTED: camelliol C synthase-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010531958.1| PREDICTED: camelliol C synthase-like isoform X8 [Tarenaya hassleriana]
Length=762

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/760 (56%), Positives = 550/760 (72%), Gaps = 11/760 (1%)
 Frame = -3

Query  2586  MWKLKIGEG---GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2416
             MWKLKIGEG      Y+YSTNN+ GRQ W +D +AG+PEE  A E++R+ F + R +   
Sbjct  1     MWKLKIGEGKKEDTDYLYSTNNFLGRQTWVFDADAGSPEELAAVEESRRSFYENRYR-IK  59

Query  2415  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2236
                DL  RMQ +KE + + L IPPV++ + E++ +E +T A+R+ VRL  ALQ+ DGHWP
Sbjct  60    ASSDLLWRMQFLKEKKFEQL-IPPVKVADAEKITHETLTNALRRGVRLFSALQSDDGHWP  118

Query  2235  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  2056
             AEN+GPLFF PPL+  LYI+G +D + T+EH+KE +RY+Y HQNEDGGWGL+I+GHSTM 
Sbjct  119   AENAGPLFFLPPLVFCLYITGYLDEVFTAEHRKEALRYIYCHQNEDGGWGLHIEGHSTMF  178

Query  2055  GSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              +ALNY+ +R+LGE  D    +A  R R WIL HGG T IPSWGK +LS+LGV++W G N
Sbjct  179   CTALNYICMRILGEGPDGGRENACRRARQWILGHGGVTYIPSWGKAWLSILGVFDWSGSN  238

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFW+ PS  P HPAKM  YCRT YMP+SYLY KR+   +T L L +R E++++PY+
Sbjct  239   PMPPEFWILPSFLPIHPAKMLCYCRTVYMPLSYLYGKRFVAQITPLALQLREELYLQPYE  298

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHM  1531
              I+WN  R  C KED YYPH  IQD++W+ L    EP + RWP NK+ RE A++  + H+
Sbjct  299   TINWNKARHLCAKEDLYYPHPLIQDLIWDCLHTFMEPFLTRWPLNKLLREKALKVAMKHI  358

Query  1530  RYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQ  1351
              Y  E SRYIT+G IEK+L M+  W EDPN D  K HLAR+PDFLW+AEDGM MQTFGSQ
Sbjct  359   HYEDENSRYITLGCIEKALCMLACWVEDPNGDYFKKHLARIPDFLWIAEDGMKMQTFGSQ  418

Query  1350  NWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSD  1171
              WD  FA QAL++S +  E  D LK+ H ++K SQ+ ENP  DFKSM RH SKGAW FSD
Sbjct  419   QWDTGFAIQALLASNLSNEISDVLKRGHNFIKMSQVTENPSDDFKSMCRHISKGAWTFSD  478

Query  1170  QDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWE  991
             +DHGW VSDCTA+ +KC L+L  M  +I G K+D + LY++V+I L LQS ++GG   WE
Sbjct  479   RDHGWQVSDCTADGLKCCLMLSTMPSDIVGPKMDPERLYDSVNIILSLQS-KNGGVTAWE  537

Query  990   PPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAA  811
             P     +LE+ N  E FAD +++ +H E T S + AL  F+  YPD+RAKE+ + I KA 
Sbjct  538   PARAYGWLELFNAIEFFADTMIEYQHAECTSSAIQALVLFRKLYPDHRAKEIDIFIEKAV  597

Query  810   EYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEG  631
             EY++  Q  DGSWYG WG+CF YGT FAL GL AAG++Y+N    RK  HF L+ Q   G
Sbjct  598   EYIQRIQMPDGSWYGSWGVCFTYGTWFALTGLAAAGKTYDNCLVTRKGVHFLLTTQKDNG  657

Query  630   GWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQME  451
             GWGE   SCP  +Y+  +G RSN+VQTSWAM+GL+++ QAERDP PLHRAAKL+IN+Q+E
Sbjct  658   GWGESYLSCPEKRYVQLDGERSNLVQTSWAMMGLLHSGQAERDPNPLHRAAKLIINSQLE  717

Query  450   DGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
              GDFPQQ+ITG++MKNCMLHY+++R+ FPL AL+EYR+RV
Sbjct  718   KGDFPQQEITGAFMKNCMLHYSAYRNTFPLWALAEYRRRV  757



>gb|ACB87531.1| beta-amyrin synthase [Artemisia annua]
Length=761

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/757 (56%), Positives = 555/757 (73%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EG   PY+YSTNN+ GRQIWE+D N GTPEE+   E+AR  F   R +   + 
Sbjct  1     MWRLKIAEGRNDPYLYSTNNFVGRQIWEFDSNYGTPEERAEVEQARVDFWNHRHEVKPS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              D+  RMQ ++E   +  +IP V++ + EEV+YE  TT +R++V    ALQA DGHWPAE
Sbjct  60    SDVLWRMQFLREKGFEQ-TIPQVKIEDGEEVSYEKATTTLRRSVNFFAALQADDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPL+F  PL+I LYI+G ++ +  +E++KE++RY+Y HQNEDGGWG +I+GHSTM  +
Sbjct  119   NAGPLYFMQPLVICLYITGHLNTVFPAEYRKEILRYMYCHQNEDGGWGFHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              L+Y+ +RLLGE  D     A  + R WIL HG  T IPSWGK +LS+LGV EW G NP+
Sbjct  179   TLSYICMRLLGEGPDGGLDGACTKARKWILDHGSVTTIPSWGKTWLSILGVCEWAGTNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P +PAKMW YCR  YMPMSYLY KR+ GP+T L+L +R+E++ +PYD+I
Sbjct  239   PPEFWILPSFLPMYPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLRDELYAQPYDEI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
              W + R  C KED YYPH  +QD++W++L   TEP++  WPFNK+RE A++  + H+ Y 
Sbjct  299   KWRSIRHLCAKEDLYYPHPLLQDLMWDSLYVFTEPVLNHWPFNKLREKALQTTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG++EK+L M+  W EDPN    K H+AR+PD+LW+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGSVEKALCMLACWVEDPNGVCFKKHIARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             A FA QAL+++ + +E G  L K H ++K SQ+K+NP GDFKSM+RH SKG+W FSDQDH
Sbjct  419   AGFAIQALLATDLTDEIGSTLMKGHEFIKASQVKDNPSGDFKSMHRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAEA+KC LL   M PEI GEK+  + L +AV++ L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEALKCCLLFATMPPEIVGEKMKPEQLNDAVNVILSLQS-KNGGLAAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+   +  ++ YL
Sbjct  538   SSEWLEILNPTEFFADIVIEHEYVECTSSAIQALVMFKKKYPGHRKKEIENFLLGSSGYL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WG+CF YGT FAL GL+A G++Y+N  AIRKA  F L  Q ++GGWG
Sbjct  598   EKIQMEDGSWYGNWGVCFTYGTWFALGGLSAVGKTYDNCPAIRKAVKFLLETQLEDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E  +SCP  KYIP EG RSN+V T+WAM+GL+++ QAERD TPLHRAAKLLIN+Q+E GD
Sbjct  658   ESYKSCPEKKYIPLEGGRSNLVHTAWAMMGLIHSRQAERDATPLHRAAKLLINSQLETGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+I G +MKNCMLHYA +R+ +P+ AL++YRK+V
Sbjct  718   FPQQEIAGVFMKNCMLHYALYRNIYPMWALADYRKQV  754



>ref|XP_010063690.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
Length=761

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/755 (56%), Positives = 545/755 (72%), Gaps = 8/755 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EG  GPY+YSTNNY GRQ WE+DP AG  EE+   E   + F   R +    C
Sbjct  1     MWRLKIAEGEDGPYLYSTNNYVGRQTWEFDPEAGNAEERAEVEATCQHFYDHRHQ-VKAC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  RMQ ++E +    +I PVR+ + EE+ Y+  +TA+R+ V    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREKQFRQ-TISPVRVEDGEEITYDKASTALRRTVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPL+F PPL+I +YI+G ++ +  +EH+KE++RYLYNHQN DGGWG +I+GHSTM  +
Sbjct  119   IAGPLYFLPPLVICVYITGHLNAVFPAEHRKEILRYLYNHQNGDGGWGFHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE  D    +A  R R WIL  GG T IPSWGK +LS+ G++ W G NP+
Sbjct  179   ALSYICMRILGEGPDGGQDNACTRARKWILDRGGVTYIPSWGKTWLSIFGLFNWSGTNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ G +T LV  +R E+H +PYD I
Sbjct  239   PPEFWILPSFLPIHPAKMWCYCRMVYMPMSYLYGKRFVGLITPLVQQLREELHTQPYDMI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
              W   R  C KED YYPH  +QD++W++L   TEP++ RWPFNK+R  A++  I H+ Y 
Sbjct  299   CWRKVRHLCAKEDLYYPHPLVQDLIWDSLYIFTEPLLNRWPFNKLRGKALQVTIKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDP+ D  K HLAR+PD+LW+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPDSDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
               FA QAL++S M EE G  L + H ++K+SQ+K+NP GDFKSM+RH +KG+W FSDQDH
Sbjct  419   TGFAIQALLASNMTEEIGPVLARGHDFIKKSQVKDNPSGDFKSMHRHITKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
              W V DCTAE +KC LLL  M PEI GEK++ + LY+AV+I L LQS ++GG   WEP  
Sbjct  479   SWQVYDCTAEGLKCCLLLSMMRPEIVGEKMEPEKLYDAVNILLSLQS-KNGGLPAWEPTG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE+LNP+E F DIV++ E+VE T   ++AL  F+  YP +R KE+A  I+ + +YL
Sbjct  538   APAWLELLNPTEFFEDIVLEHEYVECTSLAINALVLFQKLYPGHRKKEIADFISNSVQYL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q+ DGSWYG WG+CF YG+ FAL GL AAG++Y N  A RK   F L  Q Q+GGWG
Sbjct  598   ENVQKPDGSWYGCWGVCFTYGSWFALGGLAAAGKTYSNCAATRKGVTFLLRTQLQDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP  +Y+P EGNRSN+VQT+WAM+GL++  QAERDPTPLHRAAKLLIN+QMEDGD
Sbjct  658   ESYLSCPKKEYVPLEGNRSNLVQTAWAMMGLIHAGQAERDPTPLHRAAKLLINSQMEDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             +PQQ+ITG + KNCMLHY ++R+ +PL AL+EYR+
Sbjct  718   YPQQEITGVFNKNCMLHYPNYRNIYPLWALAEYRR  752



>ref|XP_008365698.1| PREDICTED: beta-amyrin synthase-like [Malus domestica]
Length=760

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/759 (57%), Positives = 559/759 (74%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MWKLK+ +GG  PYI+STNN+ GRQI+E+DP AGT EE+   E+AR  F   R Q  P++
Sbjct  1     MWKLKVADGGNDPYIHSTNNFVGRQIFEFDPEAGTTEERAEVEEARLNFYNNRYQVKPNS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E      +IPPV++ + E++ YE  T A+R++V    ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-TIPPVKVEDGEKITYEKATFALRRSVHFFSALQAGDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++  YI+G ++ +  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCTYITGHLNTVFPAEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGE----EADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ LR+LGE      D+A A+ R WIL HG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TALNYICLRILGEGPDGAQDNACAKARKWILDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PYD+
Sbjct  238   MPPEFWILPSFLPVHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W   R  C K D YYPH +IQD LW++L  CTEP++ RWPFNK IR+ A+   + H+ 
Sbjct  298   INWKGVRHHCAKVDIYYPHPWIQDFLWDSLYVCTEPLLTRWPFNKLIRKRALEVTMEHVH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIGA+EK L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ 
Sbjct  358   YEDENSRYITIGAVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQ  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL+++ + +E    L + H ++K+SQ+K+NP GDFKSMYRH SKG+W FSDQ
Sbjct  418   WDTGFAIQALLAANLTDEIAPTLARGHDFVKKSQVKDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW +SDCTAE +KC LLL  M PEI GEK++ + LY+AV++ + LQS ++GG A WEP
Sbjct  478   DHGWQLSDCTAEGLKCCLLLSMMPPEIVGEKMEPERLYDAVNVIISLQS-KNGGLAAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  + EM NP+E F DIVV+ E+VE T S + AL  FK  YP +R +E+   I  A  
Sbjct  537   AGAPEWWEMFNPTEFFEDIVVEHEYVECTSSAIQALVLFKKLYPGHRKEEIDQFITAAVL  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q ADGSWYG WG+CF YGT FAL GLTAAG+++ N  A+RK   F L+ Q + GG
Sbjct  597   YLENVQMADGSWYGEWGVCFTYGTWFALGGLTAAGKTFNNCAAMRKGISFLLAIQKENGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +Y+P EGNRSN+V T+WAM+GL++  QAERDPTPLHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIHAGQAERDPTPLHRAAKLIINSQMEN  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITGS+ KNCMLH+ ++R+ FPL AL+EY +RV
Sbjct  717   GDFPQQEITGSFKKNCMLHFPAYRNIFPLWALAEYCRRV  755



>gb|EPS65499.1| beta-amyrin synthase, partial [Genlisea aurea]
Length=754

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/753 (56%), Positives = 554/753 (74%), Gaps = 6/753 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EG  GPY+YSTNNY GRQIWE+DP+ G+PE +   EKAR+ F + R +    C
Sbjct  1     MWRLKIAEGEDGPYLYSTNNYVGRQIWEFDPDYGSPELRAEVEKARRDFWENRYR-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  R+Q + E +    +IP VR+ E+E V+YE  T AVR++V    ALQA DGHWPAE
Sbjct  60    GDLLWRLQFLHEKKFQQ-TIPKVRVAEDENVSYEKATAAVRRSVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPL+F PPL+I+LYI G ++ +  S H+KE++RYLY HQNEDGGWG +I+GHS M  +
Sbjct  119   NAGPLYFLPPLVISLYIMGHLNAVFPSPHQKEILRYLYCHQNEDGGWGFHIEGHSIMFCT  178

Query  2049  ALNYVALRLLGEEAD-DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPPE  1873
             AL+Y+ +R+LGE  D DA AR R WI+ HG   A PSWGK +LS+ G+Y+W G NP+PPE
Sbjct  179   ALSYICMRVLGEGPDNDACARARKWIMDHGTLKASPSWGKTWLSIFGLYDWSGSNPMPPE  238

Query  1872  FWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDWN  1693
             FW+ PS+ P HPAKMW YCR  YMPMSYLY KR+  P+T L+L +R E++ +PY+ I+W 
Sbjct  239   FWILPSYLPVHPAKMWCYCRMVYMPMSYLYGKRFVAPITPLILELRRELYDEPYENINWR  298

Query  1692  NTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGAEE  1513
             + R  C KED YYPH +IQD +W++    TEP++ RWPFNKIRE A+R  + H+ Y  E 
Sbjct  299   SIRHLCAKEDMYYPHPWIQDFIWDSCYLITEPLLARWPFNKIREKALRVTMEHIHYEDEN  358

Query  1512  SRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDATF  1333
             SRYITIG +EK L M+  W EDP+ D +K HLARVPD++W+AEDGM MQ+FGSQ WDA F
Sbjct  359   SRYITIGCVEKVLCMLACWVEDPDGDYVKKHLARVPDYIWVAEDGMKMQSFGSQMWDAGF  418

Query  1332  ATQALISSGMVEEYGDCLKKAHFYLKQSQ-IKENPKGDFKSMYRHFSKGAWAFSDQDHGW  1156
             A QAL++S + +E G+ L++ H ++K+SQ +K++P GDFK M+RH SKG+W FSDQDHGW
Sbjct  419   AIQALLASDLTDEIGETLRRGHDFVKKSQVVKDDPSGDFKKMHRHISKGSWTFSDQDHGW  478

Query  1155  VVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQ  976
              VSDCTAE +KC L+   M  EI GE++D   L+ +V++ L LQS ++GG A WEP    
Sbjct  479   QVSDCTAEGLKCCLIFSTMPREIVGEEMDPGLLFNSVNLLLSLQS-KNGGLAAWEPAGAS  537

Query  975   PYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLET  796
              +LE+LNP+E FADIV++ E+VE T S +  L  F   +P +R KE+   +  AA++LE 
Sbjct  538   EWLELLNPTEFFADIVIEHEYVECTSSAIHGLVMFSKMFPHHRKKEIETFVTSAADFLED  597

Query  795   QQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGEC  616
              Q+ DGSWYG WG+CF YG+ FAL GL AAGR+Y+N  A+R+   F L  Q  +GGWGE 
Sbjct  598   IQRPDGSWYGNWGVCFTYGSWFALGGLKAAGRNYQNCSAVRRGVDFLLKTQTADGGWGES  657

Query  615   LESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFP  436
               SCP  +Y+P EGNRSN+V T+WAM+GL+++ Q ERDP P+HR+AKLLIN+Q+E GDFP
Sbjct  658   YRSCPDKQYVPLEGNRSNLVHTAWAMMGLIHSGQFERDPIPIHRSAKLLINSQLESGDFP  717

Query  435   QQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             QQ+I+G +MKNCMLHYA +R+ FP+ AL+EYR+
Sbjct  718   QQEISGVFMKNCMLHYALYRNVFPIWALAEYRR  750



>ref|XP_010027674.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Eucalyptus grandis]
Length=755

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/757 (56%), Positives = 544/757 (72%), Gaps = 14/757 (2%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EG  GPY+YSTNNY GRQ W++DP AGT EE    E AR+ F   R +    C
Sbjct  1     MWRLKIAEGEDGPYLYSTNNYVGRQTWKFDPEAGTTEEHAQVEAARQHFYDHRHQ-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  RMQ ++E +    +IPPVR+ + EE+ Y+  +TA+R+ V    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREQQFKQ-AIPPVRVEDGEEITYDKASTALRRTVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPL+F PPL++ +YI+G ++ +  +EH+KE++RYLYNHQNEDGGWG +I+GHSTM  +
Sbjct  119   IAGPLYFLPPLVMCVYITGHLNTVFPAEHRKEILRYLYNHQNEDGGWGFHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE  D    +A  R R WIL  GG T IPSWGK +LS+ G+++W G NP+
Sbjct  179   ALSYICMRILGEGPDGGQYNACTRARKWILDRGGVTYIPSWGKTWLSIFGLFDWSGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCRT YMPMSYLY KR+ GP+T  V  +R E+H +PYD I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRTVYMPMSYLYGKRFVGPITPFVQQLRKELHTQPYDMI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
              W   R  C KED YYPH  +QD++W++L    EP++  WPFN++RE A++  + H+ Y 
Sbjct  299   CWRKVRHLCAKEDLYYPHPLVQDLIWDSLYIFIEPLLNHWPFNRLREKALQVTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDP+ D  K HLAR+PD+LW+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPDSDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
               FA QAL++S M EE G  L + H ++K+SQ+K+NP GDFKSM+RH +KG+W FSDQDH
Sbjct  419   TGFAIQALLASNMTEEIGPVLARGHDFIKKSQVKDNPSGDFKSMHRHITKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +KC LL   M PEI GEK+  + LY+AV+I L LQS ++GG   WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLFSMMPPEIVGEKMKPERLYDAVNILLSLQS-KNGGLPAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +L      E F DIV++ E+VE T S + AL  F+  YP++R KE+   I+ + EYL
Sbjct  538   APAWL------EFFEDIVIEHEYVECTSSAIQALVLFRKLYPEHREKEIEDFISNSVEYL  591

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WG+CF YG+ FAL GL AAG++Y N  A+RK   F L  Q Q+GGWG
Sbjct  592   ENVQLPDGSWYGCWGVCFTYGSWFALGGLAAAGKTYSNCAAMRKGVAFLLRTQLQDGGWG  651

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP  +Y+P EGNRSN+VQT+WAM+GL+   QAERDPTPLHRAAKLLIN+QMEDGD
Sbjct  652   ESYLSCPKKEYVPLEGNRSNLVQTAWAMMGLIQAGQAERDPTPLHRAAKLLINSQMEDGD  711

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             +PQQ++TG + KNCMLHY ++R+ +PL AL+EYR RV
Sbjct  712   YPQQELTGVFNKNCMLHYPNYRNTYPLWALAEYRTRV  748



>ref|XP_006488602.1| PREDICTED: beta-amyrin synthase-like [Citrus sinensis]
Length=781

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/775 (57%), Positives = 556/775 (72%), Gaps = 26/775 (3%)
 Frame = -3

Query  2586  MWKLKIGEGGG---PYIYSTNNYAGRQIW----------EYDPNAGTPEEQEAFEKARKG  2446
             MWKLK+GEG G    YIYSTNNYAGRQIW          E+DP AGT EE+   E AR  
Sbjct  1     MWKLKVGEGNGEKDAYIYSTNNYAGRQIWQFDPEAGRIWEFDPEAGTDEERAQVEAARLH  60

Query  2445  FTKQRQKGPHTCGDLFMRMQMIKESEVDVLSIPPVRLR---EEEEVNYE-AITTAVRKAV  2278
             F   R     +  DL  RMQ +KE +    +IP V+++   +EEE+ YE A TTA+R+ V
Sbjct  61    FYNNRDHLKPS-ADLLWRMQFLKEKKFKQ-TIPQVKIKVDGDEEEITYETAATTALRRGV  118

Query  2277  RLNCALQAKDGHWPAENSGPLFFTPPLMIALYISGSIDMIL--TSEHKKELVRYLYNHQN  2104
             R   ALQA DGHWPAEN+GPLFF PPL++ LYI+G ++ +    SEH+KE++RY++ HQN
Sbjct  119   RFFSALQASDGHWPAENAGPLFFLPPLVMCLYITGHLNTVFPAESEHRKEILRYIHYHQN  178

Query  2103  EDGGWGLYIDGHSTMIGSALNYVALRLLGEEADD-AIARGRNWILQHGGATAIPSWGKIY  1927
             EDGGWGL+I+GHSTM  +ALNY+ LR+LG+     A A  RNWIL  GG T IPSWGKI+
Sbjct  179   EDGGWGLHIEGHSTMFCTALNYICLRILGQPPHHIACATARNWILDRGGVTLIPSWGKIW  238

Query  1926  LSVLGVYEWDGCNPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLV  1747
             LS+LGV++W GCNP+PPEFW+ PS  P HP KMW YCR  YMPMSYLY KR+ G +T LV
Sbjct  239   LSILGVFDWSGCNPMPPEFWILPSFLPMHPGKMWCYCRMVYMPMSYLYGKRFVGAITPLV  298

Query  1746  LSIRNEIH--VKPYDQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFN  1573
             + +R E++   +PY +++W   R  C KED YYPH +IQD++WN L   TEP++ RWPFN
Sbjct  299   VELRQELYPEAEPYHKVNWGKARHLCAKEDAYYPHPWIQDLIWNTLYVFTEPLLTRWPFN  358

Query  1572  K-IREMAMRKVIMHMRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFL  1396
             K IRE A++  + H+ Y    SRYITIG +EK L M+  W E PN D  K HLAR+PD+L
Sbjct  359   KFIREKALQVTMDHIHYEDHNSRYITIGCVEKVLCMLACWVEHPNGDSFKKHLARIPDYL  418

Query  1395  WLAEDGMTMQTFGSQNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFK  1216
             W+AEDGM MQ+FGSQ WD  FA QAL++S +++E G  LK+ H ++K SQ+K+NP GDFK
Sbjct  419   WVAEDGMKMQSFGSQQWDTGFAIQALLASNLIDEIGPVLKRGHEFIKASQVKDNPSGDFK  478

Query  1215  SMYRHFSKGAWAFSDQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDIC  1036
              MYRH SKG+W FSDQDHGW VSDCTAE +KC LLL  M  EI GEK++ + LY++V+I 
Sbjct  479   RMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPTEIVGEKMEPERLYDSVNIL  538

Query  1035  LYLQSPESGGFAVWEPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYP  856
             L LQS + GG   WEP     +LE+LNP+E FADIV++ E+VE T S + AL  F   YP
Sbjct  539   LSLQS-KIGGLPAWEPVGAHKWLELLNPTEFFADIVIEHEYVECTSSAIQALTMFSKLYP  597

Query  855   DYRAKEVAMSIAKAAEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAI  676
              +R KE+   I KA  YLE  Q ADGSWYG WG+CF YGT FAL GL AAG++Y NS  +
Sbjct  598   GHRKKEIDKFIGKAIGYLEDAQMADGSWYGCWGVCFTYGTWFALGGLAAAGKTYTNSPTV  657

Query  675   RKAAHFFLSKQNQEGGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPT  496
             RKA HF L+ Q Q GGWGE   SCP  KYIP EGNRSN+VQT+W M+GL++  QA+RDPT
Sbjct  658   RKAVHFLLNSQTQNGGWGESFRSCPQKKYIPLEGNRSNLVQTAWGMMGLLHAGQADRDPT  717

Query  495   PLHRAAKLLINAQMEDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             PLH AAKLLIN+Q+E GDFPQ++ITG + KNCMLHYA++R+ +PL AL+EY +R+
Sbjct  718   PLHLAAKLLINSQLEHGDFPQEEITGVFNKNCMLHYAAYRNIYPLWALAEYCRRL  772



>gb|KEH17471.1| beta-amyrin synthase [Medicago truncatula]
Length=763

 Score =   913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/759 (55%), Positives = 553/759 (73%), Gaps = 10/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EGG  PY++STNN+ GRQ WEYDP AG+ EE+   E+ARK F   R K    C
Sbjct  1     MWRLKIAEGGNNPYLFSTNNFVGRQTWEYDPEAGSEEERAQVEEARKNFYNNRFK-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  R Q++KE+     +I  V++ +EEE+ YE  TTA+R+      ALQ  DGHWPA+
Sbjct  60    GDLLWRFQVLKENNFKQ-TIAGVKIEDEEEITYEKATTALRRGTHHLAALQTSDGHWPAQ  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPLF+ PPL+  LYI+G +D +   EH+KE++RY+Y HQNEDGGWGL+I+GHS M  +
Sbjct  119   IAGPLFYVPPLVFCLYITGHLDSVFPPEHRKEILRYIYCHQNEDGGWGLHIEGHSIMFST  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             ALNY+ +R+LG+  D    +A AR R+WI  HGG T IPSWGK +LS+LG+++W G NP+
Sbjct  179   ALNYICMRILGQGPDGGQNNACARARHWIRVHGGVTHIPSWGKTWLSILGLFDWSGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWL PS  P HPAKMW YCR  Y+PMSYLY KR+ GP+T LVL +R E+H +PY ++
Sbjct  239   PPEFWLLPSFLPMHPAKMWCYCRLVYLPMSYLYGKRFVGPITPLVLQLREELHTQPYGKV  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W   R  C KED YYPH  IQD++W++    TEP++ RWPFNK +RE A++  + H+ Y
Sbjct  299   NWKKARHLCAKEDIYYPHPLIQDLIWDSFYLFTEPLLTRWPFNKLVREKALQVAMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYIT+  +EK+L M+  W EDPN D  K HLARVPD+LW++EDGMTMQ+ GSQ W
Sbjct  359   EDENSRYITVACVEKALCMLACWVEDPNGDAFKKHLARVPDYLWISEDGMTMQSLGSQGW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             + +F+ QAL+++G+ EE G  L K H ++K+SQ+ +NP GDFKSMYRH SKG+W FSDQD
Sbjct  419   NTSFSVQALLATGLTEEIGPVLAKGHDFIKKSQVSDNPSGDFKSMYRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSD TAE +KC LLL    P   GEK++ + LY++V++ L LQ  ++GG A WEP 
Sbjct  479   HGWQVSDSTAEGLKCCLLLSMFPPATVGEKMEPERLYDSVNLLLSLQG-KNGGLAAWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               Q +LE+LNP+ELF D+V++ E+VE TG+ + AL  FK  YP +R  E+   IA A  +
Sbjct  538   GGQEWLELLNPTELFEDMVIEHEYVECTGTTIEALVLFKKLYPGHRKNEIDNLIANAVRF  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q+ DGSWYG WGICF YG+ FAL GL AAG++Y N +AIRKA  F L+ Q  +GGW
Sbjct  598   LEDTQKTDGSWYGSWGICFTYGSWFALGGLAAAGKNYTNCDAIRKAVKFLLTIQRNDGGW  657

Query  624   GECLESCPTMKYIPFEGNR-SNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             GE   SCP   Y+P EG++ SNVVQT+WA++GL++  QAE DPTPLHRAAKLLIN+Q++ 
Sbjct  658   GESYLSCPKKVYVPLEGSQESNVVQTAWALMGLIHAGQAETDPTPLHRAAKLLINSQLKQ  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GD+PQQ++TG +MKNCMLHY  +R+ FPL AL+EYR+RV
Sbjct  718   GDWPQQELTGVFMKNCMLHYPMYRNIFPLWALAEYRRRV  756



>ref|XP_002513298.1| Cycloartenol synthase, putative [Ricinus communis]
 gb|EEF48701.1| Cycloartenol synthase, putative [Ricinus communis]
Length=744

 Score =   913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/759 (57%), Positives = 541/759 (71%), Gaps = 29/759 (4%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LKI E G   PY+YSTNNY GRQIWE+DP+AGTPEE+   E+AR+ F   R +    
Sbjct  1     MWRLKIAEEGSSDPYLYSTNNYVGRQIWEFDPDAGTPEERAQVEEARRVFHNNRHQ-VKP  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E + +   +  V++ E EE+  E  T A+R+AV    ALQA DGHWPA
Sbjct  60    SSDLLWRMQYMREKKFEQ-KVGKVKIEEGEEITNEKATEALRRAVHFFSALQASDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++ +YI+G +D IL SEH+KE++RY+YNHQNEDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVMCMYITGHLDTILPSEHRKEILRYIYNHQNEDGGWGLHIEGHSTMFC  178

Query  2052  SALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + L+Y+ +RLLGE      D+A  R R WILQHGG T IPSWGK +LS+LGVY+W G NP
Sbjct  179   TVLSYICMRLLGEAPDGGQDNACQRARTWILQHGGVTYIPSWGKTWLSILGVYDWSGSNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFWL PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+H +PYDQ
Sbjct  239   MPPEFWLLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLRQELHTQPYDQ  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             ++W  TR  C +ED YYPH  IQD++W+AL   TEP++ RWP NK IR  A+R  + H+ 
Sbjct  299   VNWKRTRHQCAREDLYYPHPLIQDLMWDALYIFTEPLLTRWPLNKFIRNKALRVTMNHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDP+ D  K HLAR+PD++W+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSRYITIGCVEKVLCMLACWVEDPDGDYFKKHLARIPDYIWVAEDGMKMQSFGSQQ  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S + EE GD LK+ H ++K+SQ+K+NP GDFKSMYRH SKG+W FSDQ
Sbjct  419   WDTGFAIQALLASNLTEEIGDVLKRGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQ  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LL   M  EI GEK++ + LY+AV+I L LQ            
Sbjct  479   DHGWQVSDCTAEGLKCCLLFSMMPSEIVGEKMEPKQLYDAVNILLSLQ------------  526

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                     +LNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+   I+ A  
Sbjct  527   --------VLNPTEFFADIVIEHEYVECTASAIHALVLFKRLYPGHRKKEIENFISNAVR  578

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE+ Q  +G WYG WG+CF YGT FAL GL AAG++Y N  A+RK   F L  Q  +GG
Sbjct  579   YLESIQSEEGGWYGNWGVCFTYGTWFALGGLAAAGKTYNNCVAMRKGVDFLLRIQKDDGG  638

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  KY+  EG R N+V T+W M+GL+   Q +RDP PLH AAKL+IN+Q+ED
Sbjct  639   WGESYISCPQKKYVALEGKRWNLVHTAWGMMGLINGGQMDRDPKPLHAAAKLIINSQLED  698

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYR RV
Sbjct  699   GDFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYRNRV  737



>sp|Q9LRH8.1|BAMS_PEA RecName: Full=Beta-amyrin synthase [Pisum sativum]
 dbj|BAA97558.1| beta-amyrin synthase [Pisum sativum]
Length=758

 Score =   913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/758 (56%), Positives = 554/758 (73%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EGG  PY++STNN+ GRQ WEYDP AG+ EE+   E+AR+ F   R +    C
Sbjct  1     MWRLKIAEGGNDPYLFSTNNFVGRQTWEYDPEAGSEEERAQVEEARRNFYNNRFE-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  R Q+++E+     +I  V++ +EEE+ YE  TT +R+       LQ  DGHWPA+
Sbjct  60    GDLLWRFQVLRENNFKQ-TIGGVKIEDEEEITYEKTTTTLRRGTHHLATLQTSDGHWPAQ  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPLFF PPL+  +YI+G +D +   EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFMPPLVFCVYITGHLDSVFPPEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             ALNY+ +R+LGE  D    +A  R RNWI QHGG T IPSWGK +LS+LGV++W G NP+
Sbjct  179   ALNYICMRILGEGPDGGEDNACVRARNWIRQHGGVTHIPSWGKTWLSILGVFDWLGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+H +PY++I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELHTEPYEKI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W  TR  C KED YYPH  IQD++W++L   TEP++ RWPFNK +R+ A+   + H+ Y
Sbjct  299   NWTKTRHLCAKEDIYYPHPLIQDLIWDSLYIFTEPLLTRWPFNKLVRKRALEVTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRY+TIG +EK L M+  W EDPN D  K H+ARVPD+LW++EDGMTMQ+FGSQ W
Sbjct  359   EDENSRYLTIGCVEKVLCMLACWVEDPNGDAFKKHIARVPDYLWISEDGMTMQSFGSQEW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA FA QAL+++ ++EE    L K H ++K+SQ+ ENP GDFKSM+RH SKG+W FSDQD
Sbjct  419   DAGFAVQALLATNLIEEIKPALAKGHDFIKKSQVTENPSGDFKSMHRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LLL  + PEI GEK++ + L+++V++ L LQS + GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSLLPPEIVGEKMEPERLFDSVNLLLSLQS-KKGGLAAWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               Q +LE+LNP+E FADIVV+ E+VE TGS + AL  FK  YP +R KE+   I  A  +
Sbjct  538   GAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFIFNAVRF  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q  DGSWYG WG+CF YG+ FAL GL AAG++Y N  AIRK   F L+ Q ++GGW
Sbjct  598   LEDTQTEDGSWYGNWGVCFTYGSWFALGGLAAAGKTYTNCAAIRKGVKFLLTTQREDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   S P   Y+P EGNRSNVV T+WA++GL++  Q+ERDPTPLHRAAKLLIN+Q+E G
Sbjct  658   GESYLSSPKKIYVPLEGNRSNVVHTAWALMGLIHAGQSERDPTPLHRAAKLLINSQLEQG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             D+PQQ+ITG +MKNCMLHY  +R  +PL AL+EYR+RV
Sbjct  718   DWPQQEITGVFMKNCMLHYPMYRDIYPLWALAEYRRRV  755



>ref|XP_010655243.1| PREDICTED: beta-Amyrin Synthase 1 [Vitis vinifera]
 emb|CBI18392.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   913 bits (2359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/754 (56%), Positives = 550/754 (73%), Gaps = 10/754 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   E AR+ F K R Q  P +
Sbjct  1     MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERNEVEAARENFWKNRYQVKPSS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E      +IP V++ + E + YE  T A+R++     ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-TIPQVKVGDGEAITYETATIALRRSAHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             ENSGPL+F PPL++ LYI+G +D++   E  KE++RYLY HQNEDGGWG +I+G STM  
Sbjct  118   ENSGPLYFLPPLVMCLYITGHLDIVFPGEFLKEILRYLYCHQNEDGGWGFHIEGQSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + L+Y+ +R+LGE  D    +A ARGR WI   GG T+IPSWGK +LS+ G+++W G NP
Sbjct  178   TTLSYICMRILGEGRDGGRDNACARGRKWIHDRGGVTSIPSWGKTWLSLFGLFDWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFWL PS  P HPA+M+ Y R  YMPMSYLY KR+ GP+T LVL +R E+ ++PY++
Sbjct  238   MPPEFWLLPSFLPMHPARMFCYSRMVYMPMSYLYGKRFIGPITPLVLELREELFLQPYNE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I+W   R  C KED YYPH  IQD++W++L  CTEP++ RWPF K+R+ A+   + H+ Y
Sbjct  298   INWKKVRHLCAKEDLYYPHPLIQDLMWDSLYICTEPLLTRWPFKKLRKKALEVTMKHIHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLAR+PD++W+AEDG+ MQ+FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYIWVAEDGIKMQSFGSQEW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D +FA QAL++  M +E G  LKK H ++K+SQ+K+NP GDFKSMYRH SKG+W FSDQD
Sbjct  418   DTSFALQALLACNMTDELGLALKKGHEFIKESQVKDNPSGDFKSMYRHISKGSWTFSDQD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LL   M+P+I G K++ + L+++V+I L LQS ++GG A WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSMMAPKIVGMKMEPERLFDSVNILLSLQS-KNGGLAAWEPA  536

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LE+LNP+E F DIV++ E+VE T S + AL  FK  YP +R  E+   I  AA+Y
Sbjct  537   GASKWLELLNPTEFFTDIVIEHEYVECTASAIQALVLFKKLYPGHRKNEIDNFITNAAKY  596

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             +E  Q  DGSWYG WG+CF YG+ FAL GL AAG++Y N  AI +A  F L  Q  +GGW
Sbjct  597   IEDMQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYHNCLAIGRAVEFLLKSQRDDGGW  656

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  KY P +GNRSN+VQT WA++GL+ + QAERDPTPLH+AAKLLIN+QMEDG
Sbjct  657   GENCTSCPDKKYTPLKGNRSNLVQTGWALMGLLSSGQAERDPTPLHKAAKLLINSQMEDG  716

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEY  343
             DFPQQ+ITG++MKNCMLHYA++R+ FPL AL++Y
Sbjct  717   DFPQQEITGAFMKNCMLHYATYRNTFPLWALAQY  750



>ref|XP_010537755.1| PREDICTED: camelliol C synthase-like isoform X1 [Tarenaya hassleriana]
Length=762

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/758 (58%), Positives = 550/758 (73%), Gaps = 10/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG--GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLKI EG    PY+ STNN+ GRQ W+YDP+AGTPEE++A E AR+ F   R +   +
Sbjct  1     MWKLKIAEGDEEDPYLKSTNNFLGRQTWDYDPDAGTPEERDAVEDARRNFYDNRSRVKAS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ +KE +    +IP V++ +  ++ YEA+T AVR+ V    ALQA DGHWPA
Sbjct  61    -SDLLWRMQFLKEKKFKQ-AIPQVKVEDALKITYEAVTDAVRRGVHFFSALQADDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL+  LYI+G +D I T++H+KE+ RY+Y HQNEDGGWGL+I+GHS M  
Sbjct  119   ENAGPLFFLPPLVFCLYITGHLDEIFTADHRKEIFRYIYCHQNEDGGWGLHIEGHSIMFS  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ +R+LGE  D    +A  R R WIL HGG T IPSWGK +LS+LGVY+W G NP
Sbjct  179   TALNYICMRILGEGPDGGQENACKRARQWILDHGGVTYIPSWGKTWLSILGVYDWSGSNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T LVL +R E++V+PY +
Sbjct  239   MPPEFWILPSFVPVHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLVLQLRKELYVQPYSK  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHMR  1528
             I+WN  R  C KED Y PH  IQD LW+ L   TEP +  WPFNK+ RE A++  + H+ 
Sbjct  299   INWNIARHLCAKEDAYCPHPLIQDFLWDCLYVFTEPFLLCWPFNKLLREKALQAAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG IEK L M+  W EDPN D  K HLARVPD+LW+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSRYITIGCIEKVLCMLACWVEDPNGDHFKKHLARVPDYLWIAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S +  E  D L+K H ++K+SQ+ ENP  DFK MYRH SKGAW FSD+
Sbjct  419   WDTGFAIQALLASNLSNEIPDILRKGHDFMKKSQVGENPSCDFKGMYRHISKGAWTFSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW  SDCTAE  KC LL   MSPEI G K+D Q LYE+V+I L LQS ++GG   WEP
Sbjct  479   DHGWQASDCTAEGFKCCLLFSMMSPEIVGSKMDPQQLYESVNILLSLQS-KNGGVTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP+E+FADIVV+ E+ E T S + AL  FK  +P++  KE+   I KA  
Sbjct  538   ARGQNWLELLNPTEVFADIVVEHEYNECTSSAIQALVLFKQLHPNHMTKEINSFIKKAVR  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             Y+E  Q  DGSWYG WG+CF Y T FAL GL AAG++Y++  AI+K  HF L+ Q   GG
Sbjct  598   YIENIQMPDGSWYGSWGVCFTYSTWFALAGLAAAGKTYKSCLAIQKGVHFLLTTQKDNGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +YIP EG RSN+VQT+WAM+GL++  Q ERDP PLHRAAKL+IN+Q+E+
Sbjct  658   WGESYLSCPRKRYIPLEGERSNLVQTAWAMMGLIHAGQGERDPVPLHRAAKLIINSQLEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKR  334
             GDFPQQ+ITG++MKNC+LHYA++R+ FPL AL++YR++
Sbjct  718   GDFPQQEITGAFMKNCLLHYATYRNTFPLWALADYRRQ  755



>ref|XP_008362478.1| PREDICTED: beta-amyrin synthase [Malus domestica]
Length=750

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/752 (57%), Positives = 546/752 (73%), Gaps = 11/752 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MWKLK+ +GG  PYIYSTNN+ GRQI+E+DP AGT E++   E+AR  F   R Q  P++
Sbjct  1     MWKLKVADGGNDPYIYSTNNFVGRQIFEFDPEAGTTEZRAEVEEARLHFYNNRYQVKPNS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E      +IPPV + + EE+ YE  T A+R++V    ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-TIPPVXVEDGEEITYEKATAALRRSVHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++  YI+G +      EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCTYITGHLXTXXXXEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ +R+LGE  D    +A AR R WIL HG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TALNYICMRILGEGPDGGQDNACARARXWILDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P  P K+W +CRT Y PMSYLY  R+ GP+T L+L +R E++ +PYD+
Sbjct  238   MPPEFWILPSFLPMXPGKIWCFCRTVYKPMSYLYGIRFVGPITPLILQLREELYAQPYDE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W   R  C K D YYPH +IQD LW++L  CTEP++ RWPFNK IR+ A+   + H+ 
Sbjct  298   INWKGVRHHCAKVDIYYPHPWIQDFLWDSLYVCTEPLLTRWPFNKLIRKRALEVTMEHVH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYIT G ++K L M+  W EDPN D  K HLAR+ D+LW+AEDGM MQ+FGSQ 
Sbjct  358   YEDENSRYITJGCVZKVLCMLACWXEDPNGDYFKKHLARIXDYLWVAEDGMKMQSFGSQQ  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD   A QAL++S + +E    L + H ++K+SQ+K+NP GDFKSMYRH SKG+W FSDQ
Sbjct  418   WDTGLAIQALLASNLTDEIAPTLARGHDFVKKSQVKDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LLL  M PEI GEK++ + LY+AV++ + LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMMPPEIVGEKMEPEQLYDAVNVLISLQS-KNGGLAAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LEMLNP+E F DIV++ EHVE T S + AL  FK  YP +R +E+   I  AA 
Sbjct  537   AGAAEWLEMLNPTEFFEDIVIEHEHVECTSSAIQALVLFKKLYPGHRKEEIDQFITAAAR  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q ADGSWYG WG+CF YGT FAL GLTAAG+++ N  A+RKA  F L+ Q + GG
Sbjct  597   YLENVQMADGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCAAMRKAVSFLLAIQKENGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +Y+P EGNRSN+V T+WAM+GL++  QAERDPTPLHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIHAGQAERDPTPLHRAAKLIINSQMEN  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMAL  352
             GDFPQQ+ITG ++KNCMLHY ++R+ FP+ AL
Sbjct  717   GDFPQQEITGVFLKNCMLHYPAYRNIFPMWAL  748



>gb|ADM89633.1| beta-amyrin synthase [Bupleurum chinense]
Length=762

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/758 (55%), Positives = 549/758 (72%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG--GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LKIGEG     Y+YSTNNY GRQ WE+DPN G+PEE+   ++AR  F + R K   +
Sbjct  1     MWRLKIGEGSEDDKYLYSTNNYVGRQTWEFDPNYGSPEEKAQVDEARLNFWQNRYKVKPS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GD+  +MQ ++E      +IP V++ + E+++YE  +  V++A     ALQA DGHWPA
Sbjct  61    -GDVLWQMQFLREKGFKQ-TIPQVKIEDGEDISYEKASVTVKRAAHYFAALQASDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++ +YI+G ++ +  + H++E++RYLY HQNEDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVMCVYITGHLNQVFPAPHREEILRYLYCHQNEDGGWGLHIEGHSTMFC  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +AL+Y+ +R+LGE  D    +A +R R WIL HG  T +PSWGK +LS+LGV+EW G NP
Sbjct  179   TALSYICMRILGEGPDGGVNNACSRARKWILDHGSVTHMPSWGKTWLSILGVFEWSGSNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+  P+T L+  +R E++ +PYD 
Sbjct  239   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVAPMTPLISQLREELYDQPYDH  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I+W   R  C  ED YYPH  +QD++W++L  CTEP++ RWPFNKIRE A+   + H+ Y
Sbjct  299   INWPKVRHCCAPEDIYYPHPLVQDLIWDSLYICTEPLLTRWPFNKIREKALATTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  WAEDP+ D  K HLAR+PD+LW+AEDGM MQ+FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWAEDPDGDYFKKHLARIPDYLWVAEDGMKMQSFGSQEW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  F  QAL+++ + +E G  LK+ H ++K SQ+K+NP GDFKSMYRH SKG+W FSDQD
Sbjct  419   DTGFGLQALLATDLTDELGPTLKRGHEFVKASQVKDNPSGDFKSMYRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LL   MSPEI G+K + + LY++V++ L LQS ++GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLFSMMSPEIVGKKFEPERLYDSVNLLLSLQS-KNGGLAAWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               Q +LE+LNP+E F DIV++ E+VE T S +  L  F   YP +R KE+   I  AA+Y
Sbjct  538   GAQEWLELLNPTEFFQDIVIEHEYVECTASAIQGLVLFSKLYPAHRKKEINAFIVNAAKY  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q  DGSWYG WG+CF YG+ FAL GL AAG++Y N  A+RK   F L  Q  +GGW
Sbjct  598   LEDIQIPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYNNCAAVRKGVDFLLKSQLDDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  KY   EG+RSN+VQT+WA +GL+++ Q ERDPTPLHRAAKL+IN+Q E G
Sbjct  658   GESYLSCPLKKYTQIEGSRSNLVQTAWATMGLIHSGQVERDPTPLHRAAKLIINSQEEKG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
              FPQQ+ITG +MKNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  718   GFPQQEITGVFMKNCMLHYAAYRNLYPLWALAEYRKRV  755



>sp|Q2XPU7.1|LUPS_RICCO RecName: Full=Lupeol synthase [Ricinus communis]
 gb|ABB76766.1| lupeol synthase [Ricinus communis]
Length=769

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/758 (56%), Positives = 548/758 (72%), Gaps = 10/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW++KI EGG  PYIYSTNN+ GRQIW +DPNAGTPEEQ   E+AR+ F K R Q  P++
Sbjct  1     MWRIKIAEGGNNPYIYSTNNFQGRQIWVFDPNAGTPEEQAEVEEARQNFWKNRFQVKPNS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  ++Q ++E       IP V++ + EE+  E    A+R++V L  ALQA DGHW A
Sbjct  61    --DLLWQLQFLREKNFKQ-KIPKVKVEDGEEITSEIAAAALRRSVHLFSALQASDGHWCA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN G LFF PPL+ A+YI+G ++ + + EH+KE++RY+Y HQNEDGGWG++I+GHSTM  
Sbjct  118   ENGGLLFFLPPLVFAVYITGHLNTVFSPEHRKEILRYIYCHQNEDGGWGIHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + LNY+ +R+LGE  D    +A  RGR WIL HGGAT I SWGK +LS+LGVYEWDG NP
Sbjct  178   TVLNYICMRILGEARDGGIENACERGRKWILDHGGATGISSWGKTWLSILGVYEWDGTNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW FPS FP HPAKM+ YCR TYMPMSYLY KR+ GP+T L+L IR EI+ +PY++
Sbjct  238   MPPEFWAFPSSFPLHPAKMFCYCRITYMPMSYLYGKRFVGPITPLILQIREEIYNEPYNK  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I WN+ R  C KED Y+PH  IQ +LW+AL   +EP+  RWPFNK+RE A++  + H+ Y
Sbjct  298   IKWNSVRHLCAKEDNYFPHPTIQKLLWDALYTFSEPLFSRWPFNKLREKALKITMDHIHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
                 SRYITIG +EK L M+  W EDP+ +  K HLAR+ D++W+ EDG+ MQ+FGSQ W
Sbjct  358   EDHNSRYITIGCVEKPLCMLACWIEDPHGEAFKKHLARIADYIWVGEDGIKMQSFGSQTW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D + A QALI+S +  E G  LK+ H + K SQ  ENP GDF+ M+RH SKGAW FSD+D
Sbjct  418   DTSLALQALIASDLSHEIGPTLKQGHVFTKNSQATENPSGDFRKMFRHISKGAWTFSDKD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
              GW VSDCTAE++KC LL   M PEI GEK++ + +Y++V++ L LQS ++GGF  WEP 
Sbjct  478   QGWQVSDCTAESLKCCLLFSMMPPEIVGEKMEPEKVYDSVNVILSLQS-QNGGFTAWEPA  536

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 ++E LNP E   D+VV+ E+VE T S + AL  FK  YP +R KE+   I  AA++
Sbjct  537   RAGSWMEWLNPVEFMEDLVVEHEYVECTSSAIQALVLFKKLYPRHRNKEIENCIINAAQF  596

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             +E  Q+ DGSWYG WGICF YGT FAL GL AAGR+YEN  AIRK   F L  Q  +GGW
Sbjct  597   IENIQEPDGSWYGNWGICFSYGTWFALKGLAAAGRTYENCSAIRKGVDFLLKSQRDDGGW  656

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
              E   SCP   Y+PFEGNRSN+VQT+WAM+GL+Y  QA+RDP PLHRAAKLLIN+Q + G
Sbjct  657   AESYLSCPKKVYVPFEGNRSNLVQTAWAMMGLIYGGQAKRDPMPLHRAAKLLINSQTDLG  716

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DFPQQ++TG++M+NCMLHYA  R+ FP+ AL+EYR+ V
Sbjct  717   DFPQQELTGAFMRNCMLHYALFRNTFPIWALAEYRRHV  754



>ref|XP_006364889.1| PREDICTED: delta-amyrin synthase-like [Solanum tuberosum]
Length=760

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/763 (55%), Positives = 544/763 (71%), Gaps = 9/763 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHTC  2410
             MWKL I +G   Y+YSTNNY GRQ WE+DPN+GT EE    EKAR+ F     K  P++ 
Sbjct  1     MWKLTIAQGQDAYLYSTNNYVGRQTWEFDPNSGTAEELAEIEKARQQFWNNHYKIKPNS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  RMQ ++E       I  V++ E EE+++E  T A+R+AV    ALQA DGHWPAE
Sbjct  60    -DLLWRMQFLREKNFKQ-RIGAVKVEEGEEISHEIATIALRRAVHFFSALQATDGHWPAE  117

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             ++GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  118   SAGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  177

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+YV +R+LGE  D    +A AR R WIL HG   AIPSWGK +LS+LG +EW G NP+
Sbjct  178   ALSYVCMRILGEGPDGGVNNACARARKWILDHGSVIAIPSWGKTWLSILGAFEWIGTNPM  237

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCRT YMPMSYLY KR+ GP+T L+L +R E++ +PYD+I
Sbjct  238   PPEFWILPSFLPVHPAKMWCYCRTVYMPMSYLYGKRFVGPITPLILQLREELYDQPYDEI  297

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +W   R  C KED YYPH  +QD++W++L  CTEP++ RWPFNK+R  A+   + H+ Y 
Sbjct  298   NWKKVRHVCAKEDLYYPHPLVQDLMWDSLYICTEPLLTRWPFNKLRNKALEVTMKHIHYE  357

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYIT+G +EK L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQ  GSQ+WD
Sbjct  358   DENSRYITMGCVEKVLSMLACWVEDPNGDHFKKHLARIPDYLWVAEDGMKMQGCGSQSWD  417

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             A+ A QAL++S M +E  D L+K H ++KQSQ+K+NP GDFK MYRH SKG+WAF+DQDH
Sbjct  418   ASLAIQALLASEMNDEISDTLRKGHDFIKQSQVKDNPSGDFKGMYRHISKGSWAFADQDH  477

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAEA+ C LL   M PE+ GE +D   LY++V++ L LQS ++GG A WEP  
Sbjct  478   GWQVSDCTAEALTCCLLFSTMPPELVGEAMDPVRLYDSVNVILSLQS-KNGGLAGWEPAG  536

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                YLE+LNP+E F DIV++ EHVE T S + AL  FK  YP +R  EV   I    +Y+
Sbjct  537   AAEYLELLNPTEFFEDIVIEHEHVECTSSAIQALVRFKKIYPGHRTTEVDNFINNGVKYI  596

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q+ DGSWYG WG+CF+Y + FAL GL A G SY N  A+RK   F L  Q  +GGWG
Sbjct  597   EDVQKPDGSWYGNWGVCFIYASWFALGGLAAVGLSYRNCAAVRKGVEFLLRTQRSDGGWG  656

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP   Y   E   SN+VQT+WA++GL+++ Q +RDP PLHRAAKLLIN+QMEDGD
Sbjct  657   ESYRSCPDKVYRELETEHSNLVQTAWALMGLIHSGQVDRDPRPLHRAAKLLINSQMEDGD  716

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS*SH  313
             FPQQ+I G +++NCM+HYAS+R+ FPL  L+EYR+ V +   H
Sbjct  717   FPQQEIIGVFLRNCMMHYASYRNIFPLWGLAEYRRNVLVPLKH  759



>ref|XP_007135871.1| hypothetical protein PHAVU_010G165100g [Phaseolus vulgaris]
 gb|ESW07865.1| hypothetical protein PHAVU_010G165100g [Phaseolus vulgaris]
Length=763

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/758 (56%), Positives = 559/758 (74%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LK+ +GG  PYI+STNN+ GRQIWEYDP AG+ EE+   E+AR  F + R +    C
Sbjct  1     MWRLKVADGGEDPYIFSTNNFVGRQIWEYDPEAGSSEERAEVEEARNNFYRNRFE-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  R Q+++E+     +I  V++ + EE+ YE ++ AVR+      ALQ  DGHWPA+
Sbjct  60    GDLLWRFQVLRENNFKQ-TIASVKIEDGEEITYEKVSAAVRRGAYHLSALQTSDGHWPAQ  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GP+FF PPL+  +YI+G ++ +   EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPMFFLPPLVFCIYITGHLESVFPEEHRKEILRYIYYHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             ALNY+ +R+LGE      D+A AR R WI  HGG T IPSWGK +LS+LGV++W G NP+
Sbjct  179   ALNYICMRILGEGPNGGHDNACARARKWIQDHGGVTHIPSWGKTWLSILGVFDWCGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+  +PY+++
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKV  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W   R  C KED YYPH  IQD++W++L   TEP++ RWPFNK +RE A++  + H+ Y
Sbjct  299   NWKKARHQCAKEDLYYPHPLIQDLIWDSLYIFTEPLLTRWPFNKLVREKALQVTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLARVPD+LW++EDGMTMQ+FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARVPDYLWMSEDGMTMQSFGSQEW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA FA QAL+++ +V+E G  L K H+++K+SQ+++NP GDFK M+RH SKG+W FSDQD
Sbjct  419   DAGFAVQALLAANLVDEIGPALGKGHYFIKESQVRDNPSGDFKGMHRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LLL  +  EI GEK++ + LY++V++ L LQS + GG + WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSTLPQEIVGEKMEPERLYDSVNVLLSLQS-KKGGLSAWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               Q +LE+LNP+E FADIVV+ E+VE TGS + AL  FK  YP +R KE+   I+ A  +
Sbjct  538   GAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKMYPGHRKKEIENFISNAVRF  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q ADGSWYG WG+CF YG+ FAL GL AAG++Y N  AIRKA  F L++Q ++GGW
Sbjct  598   LENTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTYTNCAAIRKAVRFLLTRQREDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   S P   Y+P EG RSNVV T+WA++GL++  QA+RDPTPLHRAAKLLIN+Q+E+G
Sbjct  658   GESYLSSPKKIYVPLEGGRSNVVHTAWALMGLIHAGQADRDPTPLHRAAKLLINSQLEEG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             D+PQQ+ITG +MKNCMLHY  +R  +P+ AL+EYR+RV
Sbjct  718   DWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV  755



>emb|CBI18406.3| unnamed protein product [Vitis vinifera]
Length=910

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/755 (56%), Positives = 550/755 (73%), Gaps = 10/755 (1%)
 Frame = -3

Query  2589  KMWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPH  2416
             KMW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   E AR+ F K R Q  P 
Sbjct  141   KMWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAARENFWKNRFQVKPS  200

Query  2415  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2236
             +  DL  RMQ ++E      +IP V++ + EE+  E  TTAVR+      ALQA DGHWP
Sbjct  201   S--DLLWRMQFLREKNFKQ-TIPQVKVGDGEEIAEETATTAVRRGAHFFSALQASDGHWP  257

Query  2235  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  2056
             AE+SGPLFF PPL++ LYI+G +D +   E++KE++RYLY HQNEDGGWGL+I+ HS M 
Sbjct  258   AEHSGPLFFLPPLVMCLYITGHLDTVFPGEYRKEILRYLYCHQNEDGGWGLHIEEHSIMF  317

Query  2055  GSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              + L+YV +R+LGE  D    +A ARGR WIL  GG T+IP+WGKI+LS+ G+++W G N
Sbjct  318   CTTLSYVCMRILGEGRDGGRDNACARGRKWILNRGGVTSIPTWGKIWLSIFGLFDWSGSN  377

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEF LFPSH P +PAK+W Y R  +MPMSYLY KR+ GP+T LVL +R E+ ++PY+
Sbjct  378   PMPPEFSLFPSHLPMNPAKIWCYSRLIFMPMSYLYGKRFVGPITPLVLELREELFLQPYN  437

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
             +I+W   R  C KED YYPH  IQD++W++L  CTEP++ RWPFNK+R+ A+   + H+ 
Sbjct  438   EINWKKVRHLCAKEDLYYPHPLIQDMMWDSLYICTEPLLTRWPFNKLRKKALEVTMKHIH  497

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDPN D  K HLAR+PD++W+ EDG+ MQTFGSQ 
Sbjct  498   YEDENSRYITIGCVEKVLCMLSCWVEDPNGDYFKKHLARIPDYIWVGEDGIKMQTFGSQE  557

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD + A QAL++  M  E G  LKK H +LK+SQ+K+NP GDFKSMYRH SKG+W FSD+
Sbjct  558   WDTSLALQALLACNMTNEIGPTLKKGHEFLKESQVKDNPSGDFKSMYRHISKGSWTFSDK  617

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LL   M+PEI G K++   L+++V+I L LQS E+GG   WEP
Sbjct  618   DHGWQVSDCTAEGLKCCLLFSMMAPEIVGMKIEPGRLFDSVNILLSLQS-ENGGIVGWEP  676

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LE+LNPSE+F D+V++ E+VE T S + AL  FK  YP++R +E+   I  A +
Sbjct  677   AGASEWLELLNPSEMFEDLVIEHEYVECTASAIQALVLFKKLYPEHRTEEIDNFITNATK  736

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             Y+E QQ  DGSWYG WG+CF+Y + +AL GL AAG++Y N  AI +A  F L  Q  +GG
Sbjct  737   YIEDQQMPDGSWYGKWGVCFIYSSWWALGGLAAAGKTYHNCLAIGRAVEFLLKSQRDDGG  796

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SC   KY P EGN+SN+VQT WA++GL+ + QAERDPTPLHRAAKLLIN+QMED
Sbjct  797   WGESYISCRDKKYTPLEGNKSNLVQTGWALMGLLSSGQAERDPTPLHRAAKLLINSQMED  856

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEY  343
             GDFPQQ+ITG++M NCMLH A +R+ FPL AL+EY
Sbjct  857   GDFPQQEITGAFMNNCMLHCADYRNIFPLWALAEY  891



>ref|XP_006374734.1| hypothetical protein POPTR_0014s00350g [Populus trichocarpa]
 gb|ERP52531.1| hypothetical protein POPTR_0014s00350g [Populus trichocarpa]
Length=762

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/758 (56%), Positives = 553/758 (73%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EG    Y+YSTN + GRQ WEYDP  G+PEE+   E+AR  F   R +     
Sbjct  1     MWRLKIAEGSSNDYLYSTNKFVGRQTWEYDPEGGSPEERAEVEEARLNFYNNRYE-VKPS  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  RMQ +KE      +I  V++ E EE+ YE  TT +++AV    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLKEKNFKQ-TIAQVKIEEGEEITYEKATTTLKRAVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFF PPL++ LYI+G +D I ++EH++E++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCLYITGHLDSIFSAEHRREILRYIYYHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              L+Y+ +R+LGE      D+A AR R WI +HG  T IPSWGK +LS+LGV++W G NP+
Sbjct  179   VLSYICMRILGEGPNGGQDNACARARKWIHEHGTVTHIPSWGKTWLSILGVFDWSGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWL P+  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PY+QI
Sbjct  239   PPEFWLLPTFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAEPYNQI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W  TR  C  ED YYPH  IQD++W++L   TEP + RWPFNK +R+ A+   + H+ Y
Sbjct  299   NWKKTRHLCAAEDLYYPHPLIQDLIWDSLYVFTEPFLTRWPFNKLVRKKALEVTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDP+    K HLAR+PD+LW+AEDGM MQ+FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWVEDPDGISFKKHLARIPDYLWVAEDGMKMQSFGSQQW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  FA QAL++S   +E GD LK+ H ++K+SQ+K+NP GDFKSMYRH SKG+W FSDQD
Sbjct  419   DTGFAIQALLASNFTDEIGDVLKRGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LL   M PEI G+K++ + L+++V+I L LQS E+GG A WEP 
Sbjct  479   HGWQVSDCTAEGMKCCLLFSMMPPEIVGQKLEPERLFDSVNILLSLQS-ENGGLAAWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+   I  A  Y
Sbjct  538   GAHKWLELLNPTEFFADIVIEHEYVECTASAIQALVLFKKLYPGHRKKEIDNFITNAVRY  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE+ Q  +G WYG WG+CF YGT FAL GL A+G++Y+N  A++K  +F L+ Q  +GGW
Sbjct  598   LESIQTPEGGWYGNWGVCFTYGTWFALGGLAASGKTYDNCTAMQKGLNFLLNIQKDDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  KYIP EGNRSN+V T+WAM+GL+Y  Q +RD TPLHRAAKL+IN+Q+EDG
Sbjct  658   GESYFSCPNKKYIPLEGNRSNLVHTAWAMMGLIYAGQMDRDITPLHRAAKLIINSQLEDG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DFPQQ+ITG +MKNCMLHYA++R+ +P+ +L+EYR+RV
Sbjct  718   DFPQQEITGVFMKNCMLHYAAYRNIYPMWSLAEYRRRV  755



>ref|XP_010429766.1| PREDICTED: amyrin synthase LUP2-like isoform X2 [Camelina sativa]
Length=761

 Score =   911 bits (2355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/762 (54%), Positives = 559/762 (73%), Gaps = 10/762 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGP--YIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LKIGEG G   Y++S+NN+ GRQ WE+DP AGTPEE+ A E+AR+ +   R +    
Sbjct  1     MWRLKIGEGNGEDRYLFSSNNFVGRQTWEFDPKAGTPEERAAVEEARRKYVDNRSR-VKG  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             C DL  RMQ ++E++ + + IPPV++ + E + +   T A+R+ V    ALQA DGHWP 
Sbjct  60    CSDLLWRMQFLREAKFEQV-IPPVKIHDGEAITHGNATDALRRGVSFFSALQASDGHWPG  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +GPLFF PPL+  LYI+G ++ I  +EH+KE++R++Y HQNEDGGWGL+I+  S M  
Sbjct  119   EITGPLFFLPPLVFCLYITGHLEEIFDAEHRKEMLRHIYCHQNEDGGWGLHIESKSMMFC  178

Query  2052  SALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ LRLLGE+     D+A  R R+WIL  GG T IPSWGKI+LS+LG+Y+W G NP
Sbjct  179   TALNYICLRLLGEDPNGGRDNACKRARDWILDRGGVTYIPSWGKIWLSILGIYDWSGTNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPE WL PS  P H  K+W  CR  YMPMSYLY KR+ GP+T L+L +R E+H++PY+ 
Sbjct  239   MPPEIWLLPSFLPIHLGKVWCCCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPYES  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+WN TR    KED Y+PH  +QD++W+AL    EP + RWP NK +R+ A+R+ + H+ 
Sbjct  299   INWNKTRRLYAKEDMYFPHPLVQDLVWDALYLFVEPFLTRWPLNKLVRDKALRRAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E S YITIG +EK L M+  W E+PN D  K HLAR+PD++W+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QA+++S + +E GD LKK H Y+K+SQI+ENP GD++SMYRH SKGAW  SD+
Sbjct  419   WDTGFAVQAILASDLSDETGDVLKKGHDYIKKSQIRENPSGDYESMYRHISKGAWTLSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAEA KC LLL  M  E+ G+K+D + L+++V++ L LQS ++GG   WEP
Sbjct  479   DHGWQVSDCTAEAFKCCLLLSMMPAEVVGQKMDPEQLFDSVNLMLSLQS-DNGGMTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  ++E+LNP+E  A++V + E+VE T S++ AL  FK  YPDY+ +E++ SI KA +
Sbjct  538   ACAYEWIELLNPTEFLANLVAEREYVECTSSVMQALVLFKQLYPDYKTQEISRSIEKAVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             +LE +Q+ DGSWYG WG+CF+Y T FAL GL AAG++Y+NS+AIRK   F L+ Q  +GG
Sbjct  598   FLENEQRPDGSWYGSWGVCFIYATWFALGGLAAAGKTYQNSQAIRKGVEFLLTIQKDDGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +YIP +G  SN+VQT+WA +GL+   QAERDP PLHRAAKL+IN+QME+
Sbjct  658   WGESYLSCPEQRYIPSDGKSSNLVQTAWATMGLISAGQAERDPIPLHRAAKLIINSQMEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             GDFPQQ+I G++MKNCMLHYA++R+ FPL AL+EYRK  +++
Sbjct  718   GDFPQQEIVGTFMKNCMLHYATYRNTFPLWALAEYRKAAFVT  759



>ref|XP_009379199.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=761

 Score =   911 bits (2354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/758 (56%), Positives = 559/758 (74%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLK+ +GG  PYIYSTNN+ GRQI+E+DP AGT EE+   E+AR  F   R +   + 
Sbjct  1     MWKLKVADGGNDPYIYSTNNFVGRQIFEFDPEAGTTEERAEVEEARLHFYNNRHQVKPS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  RMQ ++E      +IPPV++ + EE+ +E  T ++R+++ L  ALQ    H PAE
Sbjct  60    GDLLWRMQFLREKNFKQ-TIPPVKIEDGEEITHEKATASLRRSIHLFSALQVSCAHGPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQN+DGGWG +I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCVYITGHLNTVFHAEHRKEILRYIYYHQNQDGGWGFHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE +D    +A AR R WIL HG  T IPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGSDGGQDNACARARKWILDHGSVTHIPSWGKTWLSILGVFEWSGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PYD+I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDKI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W   R  C KED YYPH +IQD LW++L  CTEP++ RWP NK IR+ A+   + H+ Y
Sbjct  299   NWKGVRHYCAKEDIYYPHPWIQDFLWDSLYICTEPLLTRWPLNKLIRKRALEVAMEHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG++EK+L MM  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ W
Sbjct  359   EDENSRYITIGSVEKALCMMACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQMW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA FA QAL++S + +E    L + H ++K+SQ+K+NP GDFKSM+RH SKG+W FSDQD
Sbjct  419   DAGFAIQALLASNLTDEIAPTLARGHDFVKKSQVKDNPSGDFKSMHRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW +SDCTAE +KC LLL  M PE+ GEK++ + LYEAV++ +YLQS ++GG  VWE  
Sbjct  479   HGWQLSDCTAEGLKCCLLLSMMPPELVGEKMEPEWLYEAVNVLIYLQS-KNGGLGVWERA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LEMLNP+E F DIV++ E++E T + + A+  FK  YP +R KE    I  AA+Y
Sbjct  538   GAAKWLEMLNPTEFFIDIVLEHEYLECTAAAIQAMVLFKKFYPGHRKKETDQFITNAAQY  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             +E  Q  DGSWYG WG+CF YGT FAL GLTAAG+++ N E IRKA  F L+ QN+ GGW
Sbjct  598   VENTQMEDGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCEVIRKAVSFLLTMQNENGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  +Y+P EGNRSN+VQT+WAM+GL+Y  QAERDP PLHRAAKL+IN+Q+E+G
Sbjct  658   GESYLSCPKREYVPLEGNRSNLVQTAWAMMGLIYAGQAERDPAPLHRAAKLIINSQLENG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DFPQQ+I G +  NCMLHY ++R+ FPL AL+EYRK V
Sbjct  718   DFPQQEIAGVFKMNCMLHYPTYRNIFPLWALAEYRKCV  755



>gb|AFF27505.1| beta-amyrin synthase [Barbarea vulgaris]
 gb|AFF27506.1| beta-amyrin synthase [Barbarea vulgaris]
Length=762

 Score =   911 bits (2354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/765 (54%), Positives = 554/765 (72%), Gaps = 10/765 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LK+GEG G  PY++S+NN+ GRQ WE+DP AGT EE+ A E+AR+ F   R +    
Sbjct  1     MWRLKLGEGNGDDPYLFSSNNFVGRQTWEFDPKAGTLEERAAVEEARRSFLVNRSR-VKA  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             C DL  RMQ +KE++ + + IPPV++ + +++ YE  T ++R+ V    ALQA DGHWP 
Sbjct  60    CSDLLWRMQFLKEAKFEQV-IPPVKIEDAKDITYENATDSLRRGVSFFSALQASDGHWPG  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +GPLFF PPL+  LYI+G ++ I   EH+KE++R++Y HQNEDGGWGL+++  S M  
Sbjct  119   EIAGPLFFLPPLVFCLYITGHLEEIFDEEHRKEMLRHVYCHQNEDGGWGLHVESKSIMFC  178

Query  2052  SALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + LNY+ LR+LGE      D+A  R R WIL  GG T IPSWGKI+LS+LG+Y+W G NP
Sbjct  179   TVLNYICLRMLGEGPNGGRDNACKRARQWILDRGGVTYIPSWGKIWLSILGIYDWSGTNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPE WL PS  P H AK   YCR  YMPMSYLY KR+ GP+T L+L +R E+H++PY+ 
Sbjct  239   MPPEIWLLPSFVPIHLAKTLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPYEA  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+WN TR    KED Y+PH  +QD++W+ L    EP++  WP NK +RE A+R  + H+ 
Sbjct  299   INWNKTRRLYAKEDMYFPHPLVQDLIWDTLHIFVEPLLTHWPLNKLVREKALRLAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E S YITIG +EK L M+  W +DPN D  K HLAR+PD++W+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIDDPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQQ  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QA+I+S +  E GD LK+ H Y+K+SQI+ENP GDFKSMYRH SKGAW  SD+
Sbjct  419   WDTGFAVQAIIASDLSSETGDVLKRGHDYIKKSQIRENPSGDFKSMYRHISKGAWTLSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAEA+KC LLL  M  E+ G K+D + LY++V++ L LQS  +GG   WEP
Sbjct  479   DHGWQVSDCTAEALKCCLLLSMMPAEVVGHKMDPEQLYDSVNLLLSLQSA-NGGVTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  + E+LNP+E  A++V + E+VE T S+V AL  F+  YPD++ K+++ +I KA +
Sbjct  538   VRAYAWTELLNPTEFLANLVAEREYVECTSSVVQALVLFQQLYPDHKTKKISRAIEKAVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             +LE +Q+ DGSWYG WG+CF+Y T FAL GL AAG++Y+ S+A+RK   F L+ Q  +GG
Sbjct  598   FLENEQKPDGSWYGNWGVCFIYATWFALGGLAAAGKTYKTSQAMRKGVEFLLTTQKDDGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +YIP EGNRSN+VQT+WA++GL++  QAERDP PLHRAAKL+IN+QME+
Sbjct  658   WGESYLSCPEQRYIPLEGNRSNLVQTAWAIMGLIHAGQAERDPIPLHRAAKLIINSQMEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS*SH  313
             GDFPQQ+I G +M+NC+LHYA+ R+ FPL AL+EYRK  +++  H
Sbjct  718   GDFPQQEIVGVFMRNCLLHYATFRNTFPLWALAEYRKAAFVTHKH  762



>ref|XP_010429765.1| PREDICTED: amyrin synthase LUP2-like isoform X1 [Camelina sativa]
Length=771

 Score =   910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/757 (55%), Positives = 556/757 (73%), Gaps = 10/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGP--YIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LKIGEG G   Y++S+NN+ GRQ WE+DP AGTPEE+ A E+AR+ +   R +    
Sbjct  1     MWRLKIGEGNGEDRYLFSSNNFVGRQTWEFDPKAGTPEERAAVEEARRKYVDNRSR-VKG  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             C DL  RMQ ++E++ + + IPPV++ + E + +   T A+R+ V    ALQA DGHWP 
Sbjct  60    CSDLLWRMQFLREAKFEQV-IPPVKIHDGEAITHGNATDALRRGVSFFSALQASDGHWPG  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +GPLFF PPL+  LYI+G ++ I  +EH+KE++R++Y HQNEDGGWGL+I+  S M  
Sbjct  119   EITGPLFFLPPLVFCLYITGHLEEIFDAEHRKEMLRHIYCHQNEDGGWGLHIESKSMMFC  178

Query  2052  SALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ LRLLGE+     D+A  R R+WIL  GG T IPSWGKI+LS+LG+Y+W G NP
Sbjct  179   TALNYICLRLLGEDPNGGRDNACKRARDWILDRGGVTYIPSWGKIWLSILGIYDWSGTNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPE WL PS  P H  K+W  CR  YMPMSYLY KR+ GP+T L+L +R E+H++PY+ 
Sbjct  239   MPPEIWLLPSFLPIHLGKVWCCCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPYES  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+WN TR    KED Y+PH  +QD++W+AL    EP + RWP NK +R+ A+R+ + H+ 
Sbjct  299   INWNKTRRLYAKEDMYFPHPLVQDLVWDALYLFVEPFLTRWPLNKLVRDKALRRAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E S YITIG +EK L M+  W E+PN D  K HLAR+PD++W+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QA+++S + +E GD LKK H Y+K+SQI+ENP GD++SMYRH SKGAW  SD+
Sbjct  419   WDTGFAVQAILASDLSDETGDVLKKGHDYIKKSQIRENPSGDYESMYRHISKGAWTLSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAEA KC LLL  M  E+ G+K+D + L+++V++ L LQS ++GG   WEP
Sbjct  479   DHGWQVSDCTAEAFKCCLLLSMMPAEVVGQKMDPEQLFDSVNLMLSLQS-DNGGMTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  ++E+LNP+E  A++V + E+VE T S++ AL  FK  YPDY+ +E++ SI KA +
Sbjct  538   ACAYEWIELLNPTEFLANLVAEREYVECTSSVMQALVLFKQLYPDYKTQEISRSIEKAVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             +LE +Q+ DGSWYG WG+CF+Y T FAL GL AAG++Y+NS+AIRK   F L+ Q  +GG
Sbjct  598   FLENEQRPDGSWYGSWGVCFIYATWFALGGLAAAGKTYQNSQAIRKGVEFLLTIQKDDGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +YIP +G  SN+VQT+WA +GL+   QAERDP PLHRAAKL+IN+QME+
Sbjct  658   WGESYLSCPEQRYIPSDGKSSNLVQTAWATMGLISAGQAERDPIPLHRAAKLIINSQMEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             GDFPQQ+I G++MKNCMLHYA++R+ FPL AL+EYRK
Sbjct  718   GDFPQQEIVGTFMKNCMLHYATYRNTFPLWALAEYRK  754



>ref|XP_010417511.1| PREDICTED: amyrin synthase LUP2-like isoform X2 [Camelina sativa]
Length=764

 Score =   910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/762 (55%), Positives = 556/762 (73%), Gaps = 10/762 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LKIGEG G  PY++S+NN+ GRQ WE+DP  GTPEE+ A E AR+ F   R +    
Sbjct  1     MWRLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKTGTPEERAAVEGARRKFVDNRSR-VKG  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             C DL  RMQ +KE++ + + IPPV++ +   + +   T A+R+ V    ALQA DGHWP 
Sbjct  60    CSDLLWRMQFLKEAKFEQV-IPPVKIDDGVGITHGNATDALRRGVSFFSALQASDGHWPG  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +GPLFF PPL+  LYI+G ++ I  +EH+KE++R++Y HQNEDGGWGL+I+  S M  
Sbjct  119   EITGPLFFLPPLVFCLYITGHLEEIFDAEHRKEMLRHIYCHQNEDGGWGLHIESKSMMFC  178

Query  2052  SALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ LRLLGE      D+A  R R+WIL  GG T IPSWGKI+LS++G+Y+W G NP
Sbjct  179   TALNYICLRLLGEGPNGGRDNACKRARDWILDRGGVTYIPSWGKIWLSIIGIYDWSGTNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPE WL PS  P H  K+  YCR  YMPMSYLY KR+ GP+T L+L +R E+H++PY+ 
Sbjct  239   MPPEIWLLPSFLPIHLGKVLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPYES  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+WN TR    KED Y+PH  +QD++W+AL    EP + RWP NK +RE A+R+ + H+ 
Sbjct  299   INWNKTRRLYAKEDMYFPHPLVQDLVWDALYLFVEPFLTRWPLNKLVRERALRRAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E S YITIG +EK L M+  W E+PN D  K HLAR+PD++W+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QA+++S + +E GD LKK H Y+K+SQ++ENP GD++SMYRH SKGAW  SD+
Sbjct  419   WDTGFAVQAILASDLSDETGDVLKKGHDYIKKSQVRENPSGDYESMYRHISKGAWTLSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAEA KC LLL  M  E+ G+K+D + L+++V++ L  QS ++GG   WEP
Sbjct  479   DHGWQVSDCTAEAFKCCLLLSMMPAEVVGQKMDPEQLFDSVNLMLSFQS-DNGGMTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  ++E+LNP+E  A++V + E+VE T S++ AL  FK  YPD++ KE++ SI KA +
Sbjct  538   ARAYEWIELLNPTEFLANLVAEREYVECTSSVMQALVLFKQLYPDHKTKEISRSIEKAVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             +LE +Q+ DGSWYG WG+CF+Y T FAL GL AAG++Y+NS+AIRK   F L+ Q  +GG
Sbjct  598   FLENEQRPDGSWYGNWGVCFIYATWFALGGLAAAGKTYQNSQAIRKGVEFLLTIQKDDGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +YIP EG RSN+VQTSWA++GL+   QAERDP PLHRAAKL+IN+QME+
Sbjct  658   WGESYLSCPEQRYIPSEGKRSNLVQTSWAIMGLISAGQAERDPKPLHRAAKLIINSQMEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             GDFPQQ+I G +MKNCM+HYA++R+ FPL AL+EYRK  +++
Sbjct  718   GDFPQQEIVGVFMKNCMIHYATYRNTFPLWALAEYRKAAFVT  759



>ref|XP_010052732.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010052734.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010052735.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010052736.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 gb|KCW76806.1| hypothetical protein EUGRSUZ_D01163 [Eucalyptus grandis]
Length=761

 Score =   910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/759 (56%), Positives = 553/759 (73%), Gaps = 12/759 (2%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQ--KGPH  2416
             MW+LKI     G  +YSTNN+AGRQIW +DP AGT EE    E AR+ F   R   K  H
Sbjct  1     MWRLKIAAAEDGASLYSTNNFAGRQIWTFDPEAGTMEECAEVEAARQHFYHHRHHVKPSH  60

Query  2415  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2236
                DL  RMQ ++E +    +IPPVR+ + EE++ + ++TA+R+AV    ALQA DGHWP
Sbjct  61    ---DLLWRMQFLREKQFKQ-TIPPVRVEDGEEISEDKVSTALRRAVHFFSALQASDGHWP  116

Query  2235  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  2056
             AEN+GPLFF PPL++ +YI+G ++ + T EH+KE++RY+YNHQNEDGGWGL+I+GHSTM 
Sbjct  117   AENAGPLFFLPPLVMCVYITGHLNAVFTVEHRKEILRYIYNHQNEDGGWGLHIEGHSTMF  176

Query  2055  GSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              + L+Y+ +R+LGE  D    DA  R R WI  HGG T IPSWGK +LS+LGV++W G  
Sbjct  177   CTVLSYICMRILGEGPDGGREDACTRARKWIHDHGGVTYIPSWGKTWLSILGVFDWSGSK  236

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFW+ PS  P HPAK+W YCR  YMPMSYLY K++ GP+T LV  +R E+H +PY+
Sbjct  237   PMPPEFWMLPSFLPMHPAKIWCYCRLVYMPMSYLYGKKFVGPITPLVQQLREELHTQPYN  296

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
              I W   R  C KED YYPH  ++D++W++L   TEP +  WPF K+RE A++  + H+ 
Sbjct  297   MICWRKVRHLCAKEDLYYPHFLVKDLMWDSLYIFTEPFLNCWPFKKLREKALQVTMKHIH  356

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIGA+EK L ++  W EDP+ D  K HLAR+PD+LW+AEDGM MQ+FGSQ 
Sbjct  357   YEDENSRYITIGAVEKVLCILACWVEDPDGDSFKKHLARIPDYLWVAEDGMKMQSFGSQE  416

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S M EE    L + H ++K+SQ+K+NP G+FKSM+RH SKG+W FSDQ
Sbjct  417   WDTGFAIQALLASNMTEEIAPVLARGHDFIKKSQVKDNPSGNFKSMHRHISKGSWTFSDQ  476

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE++KC LL   M P+I GEK++ + LY+AV++ L LQS ++GG A WEP
Sbjct  477   DHGWQVSDCTAESLKCCLLFSMMPPDIVGEKMEPEKLYDAVNVLLSLQS-KNGGLAAWEP  535

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP+E   DIV++ E+VE T S + ALA F+  YP +R +E+   I+ A +
Sbjct  536   AGAQEWLELLNPTEFLEDIVIEHEYVECTSSAIHALALFRRFYPRHREEEIEDFISNAVQ  595

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG WG+CF YG+ FAL GL A+G++Y+N  A+RK   F L  Q Q+GG
Sbjct  596   YLENAQNPDGSWYGDWGVCFTYGSWFALGGLAASGKTYDNCAAMRKGVAFLLRAQLQDGG  655

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SC   +YIP EGNRSN+VQT+WA++GL++  QAERDPTPLHRAAKLLIN+Q ED
Sbjct  656   WGESYLSCLKKEYIPLEGNRSNLVQTAWAVMGLIHAGQAERDPTPLHRAAKLLINSQTED  715

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GD+PQQ+ITG++ KNCMLHYA++R+  PL AL+EYR+RV
Sbjct  716   GDYPQQEITGAFKKNCMLHYAAYRNIHPLWALAEYRRRV  754



>ref|XP_002269328.2| PREDICTED: beta-Amyrin Synthase 1-like [Vitis vinifera]
Length=773

 Score =   909 bits (2349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/758 (56%), Positives = 550/758 (73%), Gaps = 14/758 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   E AR+ F K R Q  P +
Sbjct  1     MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAARENFWKNRFQVKPSS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E      +IP V++ + EE+ YE  T AVR+      ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-TIPQVKVGDGEEITYETATAAVRRGAHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+G L+F PPL++ LYI+G ++ +   E++KE++RYLY HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGALYFLPPLVMCLYITGHLETVFPREYRKEILRYLYCHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + L+Y+ +R+LGE  D    +A ARGR WIL  GG T+IPSWGK +LS+ G+++W G NP
Sbjct  178   TTLSYICMRILGEGRDGGRDNACARGRKWILDRGGVTSIPSWGKTWLSIFGLFDWSGSNP  237

Query  1884  IPPEFWLFPSHFPF----HPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVK  1717
             +PPEFWLFPS  P     + AKMW YCR  YMPMSYLY KR+ GP+T LVL +R E+ ++
Sbjct  238   MPPEFWLFPSRLPIIQSINAAKMWCYCRLVYMPMSYLYGKRFVGPITPLVLELRKELFLQ  297

Query  1716  PYDQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIM  1537
             PY++I+W   R  C KED YYPH  IQD++W++L  CTEP++ RWPFNK+R+ A+   + 
Sbjct  298   PYNEINWKKVRHLCAKEDLYYPHPLIQDLMWDSLYICTEPLLTRWPFNKLRQKALEVTMK  357

Query  1536  HMRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFG  1357
             H+ Y  E SRYITIG +EK L M+  W EDP+ D  K HLAR+PD++W+ EDG+ MQ+FG
Sbjct  358   HIHYEDENSRYITIGCVEKVLCMLSCWVEDPDGDYFKKHLARIPDYIWVGEDGIKMQSFG  417

Query  1356  SQNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAF  1177
             SQ WD  FA QAL++  M +E G  LKK H ++K+SQ+K+NP GDFKSMYRH SKG+W F
Sbjct  418   SQEWDTGFALQALLACNMTDEIGPTLKKGHEFVKESQVKDNPSGDFKSMYRHISKGSWTF  477

Query  1176  SDQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAV  997
             SDQDHGW VSDCTAE +KC LL   M+PEI G K++ + L+++V+I L LQS ++GG   
Sbjct  478   SDQDHGWQVSDCTAEGLKCCLLFSMMAPEIVGTKMEPERLFDSVNILLSLQS-KNGGIVG  536

Query  996   WEPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAK  817
             WEP     +LE+LNP+E+F D+V++ E+VE T S + AL  FK  YP +R +E+   I  
Sbjct  537   WEPAGASEWLELLNPTEMFEDLVIEHEYVECTASAIQALVLFKKLYPRHRTEEIDNFITN  596

Query  816   AAEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQ  637
             A +Y+E QQ  DGSWYG WG+CF YG+ FAL GL AAGR+Y N  AI  A  F L  Q  
Sbjct  597   ATKYIEDQQMPDGSWYGNWGVCFTYGSWFALGGLAAAGRTYHNCLAIGSAVEFLLKSQRD  656

Query  636   EGGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQ  457
             +GGWGE   SC   K+ P +GN+SN+VQT WA++GL+ + QAERDPTPLHRAAKLLIN+Q
Sbjct  657   DGGWGESYISCQEKKHTPLKGNKSNLVQTGWALMGLLSSGQAERDPTPLHRAAKLLINSQ  716

Query  456   MEDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEY  343
             MEDGDFPQQ+ITG+++KNCM HYA +R+ FPL AL+EY
Sbjct  717   MEDGDFPQQEITGAFLKNCMSHYADYRNIFPLWALAEY  754



>ref|XP_002271333.1| PREDICTED: beta-Amyrin Synthase 1 isoform X1 [Vitis vinifera]
 ref|XP_010655244.1| PREDICTED: beta-Amyrin Synthase 1 isoform X1 [Vitis vinifera]
 ref|XP_010655245.1| PREDICTED: beta-Amyrin Synthase 1 isoform X1 [Vitis vinifera]
 ref|XP_010655246.1| PREDICTED: beta-Amyrin Synthase 1 isoform X1 [Vitis vinifera]
Length=769

 Score =   909 bits (2348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/754 (56%), Positives = 549/754 (73%), Gaps = 10/754 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   E AR+ F K R Q  P +
Sbjct  1     MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAARENFWKNRFQVKPSS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E      +IP V++ + EE+  E  TTAVR+      ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-TIPQVKVGDGEEIAEETATTAVRRGAHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E+SGPLFF PPL++ LYI+G +D +   E++KE++RYLY HQNEDGGWGL+I+ HS M  
Sbjct  118   EHSGPLFFLPPLVMCLYITGHLDTVFPGEYRKEILRYLYCHQNEDGGWGLHIEEHSIMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + L+YV +R+LGE  D    +A ARGR WIL  GG T+IP+WGKI+LS+ G+++W G NP
Sbjct  178   TTLSYVCMRILGEGRDGGRDNACARGRKWILNRGGVTSIPTWGKIWLSIFGLFDWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEF LFPSH P +PAK+W Y R  +MPMSYLY KR+ GP+T LVL +R E+ ++PY++
Sbjct  238   MPPEFSLFPSHLPMNPAKIWCYSRLIFMPMSYLYGKRFVGPITPLVLELREELFLQPYNE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I+W   R  C KED YYPH  IQD++W++L  CTEP++ RWPFNK+R+ A+   + H+ Y
Sbjct  298   INWKKVRHLCAKEDLYYPHPLIQDMMWDSLYICTEPLLTRWPFNKLRKKALEVTMKHIHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLAR+PD++W+ EDG+ MQTFGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLSCWVEDPNGDYFKKHLARIPDYIWVGEDGIKMQTFGSQEW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D + A QAL++  M  E G  LKK H +LK+SQ+K+NP GDFKSMYRH SKG+W FSD+D
Sbjct  418   DTSLALQALLACNMTNEIGPTLKKGHEFLKESQVKDNPSGDFKSMYRHISKGSWTFSDKD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LL   M+PEI G K++   L+++V+I L LQS E+GG   WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSMMAPEIVGMKIEPGRLFDSVNILLSLQS-ENGGIVGWEPA  536

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LE+LNPSE+F D+V++ E+VE T S + AL  FK  YP++R +E+   I  A +Y
Sbjct  537   GASEWLELLNPSEMFEDLVIEHEYVECTASAIQALVLFKKLYPEHRTEEIDNFITNATKY  596

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             +E QQ  DGSWYG WG+CF+Y + +AL GL AAG++Y N  AI +A  F L  Q  +GGW
Sbjct  597   IEDQQMPDGSWYGKWGVCFIYSSWWALGGLAAAGKTYHNCLAIGRAVEFLLKSQRDDGGW  656

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SC   KY P EGN+SN+VQT WA++GL+ + QAERDPTPLHRAAKLLIN+QMEDG
Sbjct  657   GESYISCRDKKYTPLEGNKSNLVQTGWALMGLLSSGQAERDPTPLHRAAKLLINSQMEDG  716

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEY  343
             DFPQQ+ITG++M NCMLH A +R+ FPL AL+EY
Sbjct  717   DFPQQEITGAFMNNCMLHCADYRNIFPLWALAEY  750



>ref|XP_011031247.1| PREDICTED: beta-amyrin synthase [Populus euphratica]
 ref|XP_011031248.1| PREDICTED: beta-amyrin synthase [Populus euphratica]
Length=760

 Score =   908 bits (2347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/758 (56%), Positives = 551/758 (73%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EG     +YSTNN+ GRQ WEYDP+ G+PEE+   E+AR  F   R       
Sbjct  1     MWRLKIAEGVSSNELYSTNNFVGRQTWEYDPHGGSPEERAEVEEARLSFYNNRYH-VKPS  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  RMQ +KE       IP V + + EE+ YE  T A+++AV    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLKEKNFKQ-KIPQVIIEDGEEITYEKATNALKRAVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFF PPL++ LYI+G +D + + EH++E++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCLYITGHLDSVFSVEHRREILRYIYYHQNEDGGWGLHIEGHSTMFST  178

Query  2049  ALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              L+Y+ +R+LGE      D+A AR R WI  HG AT IPSWGK +LS+LGV++W G NP+
Sbjct  179   VLSYICMRILGEGPSGGQDNACARARKWIHDHGTATHIPSWGKTWLSILGVFDWSGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWL PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T LVL +R E+  +PYDQ+
Sbjct  239   PPEFWLLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPVTPLVLQLREELFAEPYDQV  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W  TR  C  ED YYPH  IQD++W++L   TEP + RWPF+K +R+ A+   + H+ Y
Sbjct  299   NWRKTRHLCAAEDLYYPHPLIQDLVWDSLYVFTEPFLTRWPFHKLVRKKALEVTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDP+ D  K HLAR+PD+LW+AEDGM MQ+FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWVEDPDGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  FA QAL++S   +E  D LK+ H ++K+SQ+K+NP GDFKSMYRH SKG+W FSDQD
Sbjct  419   DTGFAIQALLASNFTDEIRDVLKRGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LLL  M PEI GE+++ + L+++V++ L LQS E+GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSMMPPEIVGEQLEPERLFDSVNVLLSLQS-ENGGLAAWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               Q +LE+LNP+E FADIVV+ E+VE T S + AL+ FK+ YP +R KE+   +  A  Y
Sbjct  538   GAQKWLELLNPTEFFADIVVEHEYVECTASAIQALSLFKNLYPGHRKKEIDNFVTNAVRY  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE+ Q  +G WYG WG+CF YG+ FAL GL AAG++Y    A+R+  +F LS Q  +GGW
Sbjct  598   LESIQTPEGGWYGNWGVCFTYGSWFALGGLAAAGKTYSTCAAMRQGVNFLLSIQKNDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  KY+P EGNRSN+V T+WAM+GL++  Q +RD  PLHRAAKL+IN+Q+EDG
Sbjct  658   GESYLSCPKKKYVPLEGNRSNLVHTAWAMMGLIHAGQMDRDSAPLHRAAKLIINSQLEDG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EY++RV
Sbjct  718   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYQRRV  755



>ref|XP_009347735.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=760

 Score =   908 bits (2347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/759 (57%), Positives = 556/759 (73%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MWKLK+ +GG  PYIYSTNN+ GRQI+E+DP AGT EE+   E+AR  F   R Q  P++
Sbjct  1     MWKLKVADGGNAPYIYSTNNFVGRQIFEFDPEAGTTEERAEVEEARLHFYNNRYQVKPNS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E      +I  V++ + EE+ YE    A+R++V    ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-TIHLVKVEDGEEITYEKAIVALRRSVHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++  YI+G ++ I  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCTYITGHLNTIFLAEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ +R+LGE  D    +A AR R WI  HG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TALNYICMRILGEGPDGGQDNACARARKWIHDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKM+ Y R  YMPMSYLY KR+ GP+T L+L +R E++ +PYD+
Sbjct  238   MPPEFWILPSFLPMHPAKMFCYSRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W   R  C K D YYPH +IQD LW++L  CTEP++ RWPFNK IR+ A+   + H+ 
Sbjct  298   INWKGVRHHCAKVDIYYPHPWIQDFLWDSLYVCTEPLLTRWPFNKLIRKRALEVTMEHVH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQ  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  F  QAL++S + +E    L + H ++K+SQ+K+NP GDFKSMYRH SKG+W FSDQ
Sbjct  418   WDTGFVIQALLASNLTDEIAPTLARGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LLL  M PEI GEK++ + LY+AV++ + L S ++GG   WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMMPPEIVGEKMEPERLYDAVNVLISLPS-KNGGLPAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LEM NP+E FADIVV+ E+VE T S + AL  FK  YP +R +E+   I  AA 
Sbjct  537   AGAAEWLEMFNPTEFFADIVVEHEYVECTSSAIQALVLFKKLYPGHRKEEIDQFITAAAL  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q ADGSWYG WG+CF YGT FAL GLTAAG+++ N  AIRKA  F L+ Q + GG
Sbjct  597   YLENVQMADGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCAAIRKAISFLLAIQKENGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +Y+P EGNRSN+V T+WAM+GL++  QAERDPTPLHRAAKL+IN+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIHVGQAERDPTPLHRAAKLIINSQMEN  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG++MKNCMLHYA++R+ +PL AL+EY +RV
Sbjct  717   GDFPQQEITGAFMKNCMLHYAAYRNIYPLWALAEYCRRV  755



>ref|XP_010063688.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW70933.1| hypothetical protein EUGRSUZ_F04050 [Eucalyptus grandis]
Length=761

 Score =   908 bits (2347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/757 (55%), Positives = 544/757 (72%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLKI EG   PY+YSTNNY GRQ WE+DP AG  EE+   E   + F   R +    C
Sbjct  1     MWKLKIAEGEDDPYLYSTNNYVGRQTWEFDPKAGNAEERAEVEATCQHFYDHRHQ-VKAC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  RMQ ++E +    +I PVR+ + EE+ Y+  +TA+R+ V    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLREKQFKQ-TISPVRVEDGEEITYDKASTALRRTVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPL+F PPL++ +YI+G ++ +  +EH+KE++ YLYNHQN DGGWG +I+GHSTM  +
Sbjct  119   IAGPLYFLPPLVMCVYITGHLNAVFPAEHRKEILHYLYNHQNGDGGWGFHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE  D    +A  R R WIL  GG T IPSWGK +LS+ G+++W G NP+
Sbjct  179   ALSYICMRILGEGPDGGQDNACTRARKWILDRGGVTYIPSWGKTWLSIFGLFDWSGTNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T LV  +R E+H +PYD I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLVQQLREELHTQPYDTI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
              W      C KED YYPH  +QD++W++L    EP++ RWPFNK+RE A++  + H+ Y 
Sbjct  299   CWRKVCHLCAKEDLYYPHPLVQDLIWDSLYIFAEPLLNRWPFNKLREKALQVTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDP+ D  K HLAR+PD+LW+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPDSDYFKKHLARIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
               FA QAL++S M EE    L + H ++K+SQ+K+NP GDFKSM+RH +KG+W FSDQDH
Sbjct  419   TGFAIQALLASNMTEEIAPVLARGHDFIKKSQVKDNPSGDFKSMHRHITKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE ++C LL   M PEI GEK++ + LY+AV+I L LQS ++GG   WEP  
Sbjct  479   GWQVSDCTAEGLRCCLLFSMMPPEIVGEKMEPEKLYDAVNILLSLQS-KNGGLPAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE+LNP+E F DIV++ E+VE T S + AL   +  YP +R KE+A  I+ + +YL
Sbjct  538   APAWLELLNPTEFFEDIVIEHEYVECTSSAIQALVLLRKLYPGHRKKEIADFISNSVKYL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q+ DGSWYG WG+CF YG+ FAL GL AAG++Y N  A+R+   F L  Q Q+GGWG
Sbjct  598   ENVQKPDGSWYGCWGVCFTYGSWFALGGLAAAGKTYSNCTAMREGVAFLLRTQLQDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP  +Y+P EGNRSN+VQT+WAM+GL++  QAERDPTPLH AAKLLIN+QMEDGD
Sbjct  658   ESYLSCPKKEYVPLEGNRSNLVQTAWAMMGLIHAGQAERDPTPLHHAAKLLINSQMEDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             +PQQ+ITG + KNCMLHY ++R+ +PL AL+EY +RV
Sbjct  718   YPQQEITGVFNKNCMLHYPNYRNIYPLWALAEYCRRV  754



>dbj|BAA86930.1| lupeol synthase [Olea europaea]
Length=758

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/757 (55%), Positives = 548/757 (72%), Gaps = 9/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI +G GP++ +TNN+ GRQ WE+DP AGTP+E+   E+ R+ F K R +   +  
Sbjct  1     MWKLKIADGTGPWLTTTNNHIGRQHWEFDPEAGTPDERVEVERLREEFKKNRFRTKQS-A  59

Query  2406  DLFMRMQMIKESEVDVLSIPP-VRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             DL MRMQ++KE++   + IPP ++++E E +  EA+ T +R+A+     +QA DGHWPAE
Sbjct  60    DLLMRMQLVKENQR--VQIPPAIKIKETEGITEEAVITTLRRAISFYSTIQAHDGHWPAE  117

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             ++GPLFF PPL++ALY++G+I+++L+ EH+KE+ RY+YNHQNEDGGWG++I+GHSTM GS
Sbjct  118   SAGPLFFLPPLVLALYVTGAINVVLSREHQKEITRYIYNHQNEDGGWGIHIEGHSTMFGS  177

Query  2049  ALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              L+Y+ LRLLGE  +D    A+ARGR WIL HGGA  IPSWGK +L+VLGVYEWDGCNP+
Sbjct  178   VLSYITLRLLGEGQEDGEDKAVARGRKWILDHGGAVGIPSWGKFWLTVLGVYEWDGCNPM  237

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWL P+  P HP KM  YCR  YMPMSYLY KR+ GP+T LVLS+R EI+ +PY  I
Sbjct  238   PPEFWLLPNFSPIHPGKMLCYCRLVYMPMSYLYGKRFVGPITGLVLSLRQEIYTEPYHGI  297

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +WN  R  C KED YYPH   QD+LW  L +  EP++ RWPF+K+RE A++  + H+ Y 
Sbjct  298   NWNRARNTCAKEDLYYPHPLAQDMLWGFLHHFAEPVLTRWPFSKLREKALKVAMEHVHYE  357

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
                SRY+ IG +EK L ++  W EDPN +  K H+AR+PD+ W+AEDG+ MQ+FG Q WD
Sbjct  358   DMNSRYLCIGCVEKVLCLIACWVEDPNSEAYKRHIARIPDYFWVAEDGLKMQSFGCQMWD  417

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             A FA QA++SS + EEYG  L KAH ++K SQ++ENP GDF  MYRH SKGAW FS QDH
Sbjct  418   AAFAIQAILSSNLAEEYGPTLMKAHNFVKASQVQENPSGDFNEMYRHTSKGAWTFSMQDH  477

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +K  LL  QM  E+ G +++   LY+AV++ L LQS  SGGF  WEP  
Sbjct  478   GWQVSDCTAEGLKAALLFSQMPIELVGAEIETGHLYDAVNVILTLQSA-SGGFPAWEPQK  536

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE LNP+E F D++++ ++VE T S V AL  FK  +P +R KE+A  I+KA +Y+
Sbjct  537   AYRWLEKLNPTEFFEDVLIERDYVECTSSAVQALKLFKQLHPGHRRKEIASCISKAIQYI  596

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSW G WGICF YGT FA+ GL A G++Y NS  +R+A  F LSKQ  +GGW 
Sbjct  597   EATQNPDGSWDGSWGICFTYGTWFAVEGLVACGKNYHNSPTLRRACEFLLSKQLPDGGWS  656

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   S     Y   EGNRSN+VQTSWA+L L+   Q E DP P+HR  KLL+N+QMEDGD
Sbjct  657   ESYLSSSNKVYTNLEGNRSNLVQTSWALLSLIKAGQVEIDPGPIHRGIKLLVNSQMEDGD  716

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQ++ITG++MKNC L+Y+S+R+ FP+ AL EYR+R+
Sbjct  717   FPQEEITGAFMKNCTLNYSSYRNIFPIWALGEYRRRI  753



>ref|XP_010669609.1| PREDICTED: lupeol synthase-like [Beta vulgaris subsp. vulgaris]
Length=762

 Score =   907 bits (2345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/755 (55%), Positives = 548/755 (73%), Gaps = 9/755 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI +G  P++ STNN+ GRQ WE+DP AGTPEE+   EK R+ F K R K   +  
Sbjct  1     MWKLKIAQGEDPWLVSTNNHVGRQHWEFDPVAGTPEERAEVEKVREEFKKNRLKKKQS-D  59

Query  2406  DLFMRMQMIKESEVDVLSIPP-VRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             DL MRMQ+ +E+    L++P  + L+E+E++  +A+   V++A+     +QA DGHWPAE
Sbjct  60    DLLMRMQLRREN--PSLAMPQGITLKEKEDITEKAVNMTVKRAINFFSTIQAHDGHWPAE  117

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             ++GPLFF PPL+IAL+I+G+ + IL+ +H+KE+ RY+YNHQNEDGGWGL+I+GHSTM GS
Sbjct  118   SAGPLFFLPPLVIALHITGATNTILSPQHQKEIKRYIYNHQNEDGGWGLHIEGHSTMFGS  177

Query  2049  ALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              ++Y+ALRLLGE  DD    A+ RGR WIL HGGAT IPSWGK +L+VLGVYEWDGCNP+
Sbjct  178   IISYIALRLLGEGPDDGEANAVTRGRQWILDHGGATGIPSWGKFWLTVLGVYEWDGCNPM  237

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWL P   P HP KM  YCR  YMPMSYLY KR+ GP+T+L+LS+R E++++PY++I
Sbjct  238   PPEFWLLPKISPMHPGKMLCYCRLVYMPMSYLYGKRFVGPITSLILSLRRELYIQPYNEI  297

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +WNN R +C KED YYPH  +QD++W  L + TEPI+ RWPF+K+RE +M+  + H+ Y 
Sbjct  298   NWNNARNSCAKEDLYYPHPLMQDMVWGFLHHFTEPILNRWPFSKLREKSMKIAMEHVHYE  357

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
                SRY+ IG +EK L ++  W ED N +  K HLAR+PD+ WLAEDGM MQ+FGSQ WD
Sbjct  358   DVASRYLCIGCVEKVLCLLACWVEDSNSEAYKRHLARIPDYFWLAEDGMKMQSFGSQMWD  417

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             A F  QA+ +SG+++EY   LKKAH ++K SQ+KENP G+FK MYRH SKGAW FS QDH
Sbjct  418   AAFGIQAIFASGLIQEYAPTLKKAHDFVKASQVKENPSGNFKEMYRHISKGAWTFSIQDH  477

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +K  LL   M  E  GEK+D +CLY+AV++ L LQS E+GGF  WEP  
Sbjct  478   GWQVSDCTAEGLKTALLYSSMPTEFVGEKMDAECLYDAVNVTLSLQS-ENGGFPAWEPQR  536

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                ++E  NP+E F D++++ E+VE T S +  L  FK  YP +R KE+ M IAK  +Y+
Sbjct  537   AFRWIEKFNPTEFFEDVLIEREYVECTSSAIQGLTLFKELYPGHRKKEIEMCIAKGLDYI  596

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WGIC+ YGT F +  L A  +++ NS A+RKA HF +SKQ  +GGWG
Sbjct  597   EETQNPDGSWYGCWGICYTYGTWFGVEALVACRKNFYNSLALRKACHFLISKQLPDGGWG  656

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   S P   Y   EGN+SN+VQTSWA+L LM       DPTP+ R  ++LIN+QMEDGD
Sbjct  657   ENYLSSPNKVYTNLEGNKSNLVQTSWALLSLMKAGFGHVDPTPIERGIRVLINSQMEDGD  716

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             FPQQ+ITG +MKNC L+Y+S+R+ FP+ AL EYR+
Sbjct  717   FPQQEITGVFMKNCTLNYSSYRNIFPIWALGEYRR  751



>ref|XP_009379200.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=756

 Score =   907 bits (2345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/759 (57%), Positives = 557/759 (73%), Gaps = 16/759 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MWKL++ +GG  PYIYSTNN+ GRQI E+DP AGT EE+   E+AR  F   R Q  P  
Sbjct  1     MWKLRVADGGSDPYIYSTNNFVGRQISEFDPEAGTTEERAEVEEARLHFYNNRYQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GDL  RMQ ++E      +IPPV++ + EE+++E +T ++R++V    ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLREKNFKQ-TIPPVKVEDREEISHEKVTASLRRSVHFLSALQATDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++  YI+G ++ I  ++H+KE++RY+Y HQN+DGGWGL+I+GHS M  
Sbjct  118   ENAGPLFFLPPLVMCTYITGHLNTIFHAKHRKEILRYIYYHQNQDGGWGLHIEGHSIMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ +R+LGEE D    +A  R R WIL HG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TALNYICMRILGEEPDGGQDNACTRARKWILDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PYD+
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDK  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+       C KED Y+PH +IQD LW+ L  CTEP++ RWPFNK IRE A+   + H+ 
Sbjct  298   IN-----HYCAKEDIYFPHPWIQDFLWDCLYICTEPLLTRWPFNKLIRERALEVTMKHIH  352

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  WAEDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ 
Sbjct  353   YEDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQL  412

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++  + +E    L + H ++K+SQ+K+NP GDFKSM+RH SKG+W FSDQ
Sbjct  413   WDTGFAVQALLACNLTDEVAPTLARGHDFIKKSQVKDNPSGDFKSMHRHISKGSWTFSDQ  472

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSD TA+ +KC LLL  M PE+ GEK++ + LY+AV + + LQS ++GG A WEP
Sbjct  473   DHGWQVSDSTADGLKCCLLLSMMPPEMVGEKMEPERLYDAVHVIISLQS-KNGGLAAWEP  531

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LE+LNP+E FADIVV+ E+VE T S + AL  FK  YP +R KE+   I  AA+
Sbjct  532   AGAAEWLELLNPAEFFADIVVEHEYVECTSSAIQALVLFKKLYPGHRKKEIDQFITNAAQ  591

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE    ADGSWYG WG+CF YGT FAL GLTAAG+++ N   IRKA  F L+ Q + GG
Sbjct  592   YLENTLMADGSWYGNWGVCFTYGTWFALGGLTAAGKTFNNCAVIRKAISFLLTIQKENGG  651

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +Y+P EGNRSN+V T+WAM+GL++  QAERDPTPLHRAAKL+IN++ME+
Sbjct  652   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIHAGQAERDPTPLHRAAKLIINSKMEN  711

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG  MKNCMLHYA++R+  PL AL+EYRKRV
Sbjct  712   GDFPQQEITGVIMKNCMLHYAAYRNIHPLWALAEYRKRV  750



>emb|CBI18382.3| unnamed protein product [Vitis vinifera]
Length=885

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/769 (55%), Positives = 551/769 (72%), Gaps = 22/769 (3%)
 Frame = -3

Query  2595  IRKMWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKG  2422
             + KMW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   E AR+ F K R Q  
Sbjct  102   LEKMWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAARENFWKNRFQVK  161

Query  2421  PHTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGH  2242
             P +  DL  RMQ ++E      +IP V++ + EE+ YE  T AVR+      ALQA DGH
Sbjct  162   PSS--DLLWRMQFLREKNFKQ-TIPQVKVGDGEEITYETATAAVRRGAHFFSALQASDGH  218

Query  2241  WPAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHST  2062
             WPAEN+G L+F PPL++ LYI+G ++ +   E++KE++RYLY HQNEDGGWGL+I+GHST
Sbjct  219   WPAENAGALYFLPPLVMCLYITGHLETVFPREYRKEILRYLYCHQNEDGGWGLHIEGHST  278

Query  2061  MIGSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDG  1894
             M  + L+Y+ +R+LGE  D    +A ARGR WIL  GG T+IPSWGK +LS+ G+++W G
Sbjct  279   MFCTTLSYICMRILGEGRDGGRDNACARGRKWILDRGGVTSIPSWGKTWLSIFGLFDWSG  338

Query  1893  CNPIPPEFWLFPSHFPF------------HPAKMWNYCRTTYMPMSYLYAKRYHGPLTNL  1750
              NP+PPEFWLFPS  P               AKMW YCR  YMPMSYLY KR+ GP+T L
Sbjct  339   SNPMPPEFWLFPSRLPIIQVTHEYLKIQPGDAKMWCYCRLVYMPMSYLYGKRFVGPITPL  398

Query  1749  VLSIRNEIHVKPYDQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK  1570
             VL +R E+ ++PY++I+W   R  C KED YYPH  IQD++W++L  CTEP++ RWPFNK
Sbjct  399   VLELRKELFLQPYNEINWKKVRHLCAKEDLYYPHPLIQDLMWDSLYICTEPLLTRWPFNK  458

Query  1569  IREMAMRKVIMHMRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWL  1390
             +R+ A+   + H+ Y  E SRYITIG +EK L M+  W EDP+ D  K HLAR+PD++W+
Sbjct  459   LRQKALEVTMKHIHYEDENSRYITIGCVEKVLCMLSCWVEDPDGDYFKKHLARIPDYIWV  518

Query  1389  AEDGMTMQTFGSQNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSM  1210
              EDG+ MQ+FGSQ WD  FA QAL++  M +E G  LKK H ++K+SQ+K+NP GDFKSM
Sbjct  519   GEDGIKMQSFGSQEWDTGFALQALLACNMTDEIGPTLKKGHEFVKESQVKDNPSGDFKSM  578

Query  1209  YRHFSKGAWAFSDQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLY  1030
             YRH SKG+W FSDQDHGW VSDCTAE +KC LL   M+PEI G K++ + L+++V+I L 
Sbjct  579   YRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMAPEIVGTKMEPERLFDSVNILLS  638

Query  1029  LQSPESGGFAVWEPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDY  850
             LQS ++GG   WEP     +LE+LNP+E+F D+V++ E+VE T S + AL  FK  YP +
Sbjct  639   LQS-KNGGIVGWEPAGASEWLELLNPTEMFEDLVIEHEYVECTASAIQALVLFKKLYPRH  697

Query  849   RAKEVAMSIAKAAEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRK  670
             R +E+   I  A +Y+E QQ  DGSWYG WG+CF YG+ FAL GL AAGR+Y N  AI  
Sbjct  698   RTEEIDNFITNATKYIEDQQMPDGSWYGNWGVCFTYGSWFALGGLAAAGRTYHNCLAIGS  757

Query  669   AAHFFLSKQNQEGGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPL  490
             A  F L  Q  +GGWGE   SC   K+ P +GN+SN+VQT WA++GL+ + QAERDPTPL
Sbjct  758   AVEFLLKSQRDDGGWGESYISCQEKKHTPLKGNKSNLVQTGWALMGLLSSGQAERDPTPL  817

Query  489   HRAAKLLINAQMEDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEY  343
             HRAAKLLIN+QMEDGDFPQQ+ITG+++KNCM HYA +R+ FPL AL+EY
Sbjct  818   HRAAKLLINSQMEDGDFPQQEITGAFLKNCMSHYADYRNIFPLWALAEY  866


 Score =   114 bits (284),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 79/227 (35%), Positives = 124/227 (55%), Gaps = 19/227 (8%)
 Frame = -3

Query  1275  KAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGWVVSDCTAEAIKCLLLLGQMS  1096
             K H ++K+SQ+++NP GDF+SMYR+  KG+W F D+DHGW VS+CT +++KC  LL  M 
Sbjct  2     KGHDFIKKSQVRDNPSGDFRSMYRYIFKGSWTFLDRDHGWQVSNCTTKSLKC-CLLSVMP  60

Query  1095  PEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQPYLEMLNPSELFADIVVQG-  919
             PEI GEK++ + LY++V + L LQS ++GG +  E      +LE     +++   V  G 
Sbjct  61    PEIVGEKIEPERLYDSVKLLLSLQS-KNGGLSARESAGASKWLE-----KMWRLKVADGG  114

Query  918   --EHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE-YLETQQQADGSWYGYWGICF  748
                ++ +T + V     ++ D PDY   E    +  A E + + + Q   S    W + F
Sbjct  115   NDPYIYSTNNFVGR-QIWEFD-PDYGTPEERAEVEAARENFWKNRFQVKPSSDLLWRMQF  172

Query  747   LYGTCFA-LLGLTAAGR----SYEN-SEAIRKAAHFFLSKQNQEGGW  625
             L    F   +     G     +YE  + A+R+ AHFF + Q  +G W
Sbjct  173   LREKNFKQTIPQVKVGDGEEITYETATAAVRRGAHFFSALQASDGHW  219



>ref|NP_001234597.1| delta-amyrin synthase [Solanum lycopersicum]
 sp|E7DN64.1|DAMS_SOLLC RecName: Full=Delta-amyrin synthase; AltName: Full=Alpha-amyrin 
synthase; AltName: Full=Beta-amyrin synthase; AltName: Full=Triterpenoid 
synthase 2; Short=SlTTS2 [Solanum lycopersicum]
 gb|ADU52575.1| multifunctional triterpenoid synthase [Solanum lycopersicum]
Length=763

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/764 (55%), Positives = 546/764 (71%), Gaps = 10/764 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHT  2413
             MWKLKI +G    Y+YSTNNY GRQIWE+DPNAGT EEQ   E+AR+ +   R K  P++
Sbjct  1     MWKLKIAKGQDDRYLYSTNNYIGRQIWEFDPNAGTIEEQAKIEEARQHYWNNRYKVKPNS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E       I  V++ E EE+++E  T A+ +AV    ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-RIRAVKVEEGEEISHEIATVALHRAVHFFSALQATDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E++GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ESAGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +A++Y+ +R+LGE      ++A AR R WIL HG   AIPSWGK +LS+LG +EW G NP
Sbjct  178   TAMSYICMRILGEGPEGGVNNACARARKWILDHGSVIAIPSWGKTWLSILGAFEWIGTNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCRT YMPMSYLY KR+ GP+T L+L +R E++ + YD+
Sbjct  238   MPPEFWILPSFLPVHPAKMWCYCRTVYMPMSYLYGKRFVGPITPLILKLREELYDQTYDE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I+W   R  C KED YYPH F+QD++W++L  CTEP++ RWPFNK+R  A+   + H+ Y
Sbjct  298   INWKKVRHVCAKEDLYYPHPFVQDLMWDSLYICTEPLLTRWPFNKLRNKALEVTMKHIHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYIT+G +EK L M+  W EDPN D  K HLAR+PDFLW+AEDGM MQ  GSQ+W
Sbjct  358   EDENSRYITMGCVEKVLSMLACWVEDPNGDHFKKHLARIPDFLWVAEDGMKMQGCGSQSW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA+ A QAL++S M +E  D LK  H ++KQSQ+K+NP GDFK MYRH SKG+WAF+DQD
Sbjct  418   DASLAIQALLASEMNDEISDTLKNGHDFIKQSQVKDNPSGDFKVMYRHISKGSWAFADQD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
              GW VSDCTAEA+KC LL   M PEI GE +D   LY++V++ L LQS ++GG + WEP 
Sbjct  478   LGWQVSDCTAEALKCCLLFSTMPPEIVGEAMDPVRLYDSVNVILSLQS-KNGGLSAWEPA  536

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 YLE+LNP+E F DIV++ EHVE T S + AL  FK  YP +R  EV   I    +Y
Sbjct  537   GAPEYLELLNPTEFFEDIVIEHEHVECTSSAIQALVRFKKLYPGHRTTEVDNFINNGVKY  596

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             +E  Q+ DGSWYG WG+CF+Y + FAL GL A G SY N  A+RK+  F L  Q  +GGW
Sbjct  597   IEDVQEPDGSWYGNWGVCFIYASWFALGGLAAVGLSYSNCAAVRKSVEFLLRTQRSDGGW  656

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP   Y   E   SN+VQT+WA++GL+++ Q ERDP PLHRAAKLLIN QMEDG
Sbjct  657   GESYRSCPDKVYRELETEHSNLVQTAWALMGLIHSGQVERDPRPLHRAAKLLINFQMEDG  716

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS*SH  313
             DFPQQ+ITG +++NCM+HYA +R+ FPL  L+EYR+ V +   H
Sbjct  717   DFPQQEITGVFLRNCMMHYALYRNIFPLWGLAEYRRNVLVPLKH  760



>gb|ABL07607.1| beta-amyrin synthase [Polygala tenuifolia]
Length=762

 Score =   907 bits (2343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/758 (55%), Positives = 552/758 (73%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LK+GEG   PY++STN+Y GRQ WE+DP+AGTPEE+   E AR+ F   R +    C
Sbjct  1     MWRLKVGEGKNDPYLFSTNDYTGRQTWEFDPDAGTPEERAEVEAARQAFYDNRFQF-KNC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  R Q +++      +IP V++ + +++ YE  T  VR+A      LQ+  GHWPA+
Sbjct  60    GDLLWRFQFLRDKNFKQ-TIPKVKVEDGQQITYEMATDTVRRAAHHLGGLQSSHGHWPAQ  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPLFF PPL+  LYI+G ++ +   EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPLFFMPPLVFCLYITGHLNTVFPEEHRKEILRYIYYHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE      ++A  R R WIL HGG T IPSWGK +LSVLG+++W G NP+
Sbjct  179   ALSYICMRMLGEGPEGGLNNACVRARKWILDHGGVTHIPSWGKTWLSVLGIFDWSGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+  +R E+  +P+++I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLIKQLREELFTQPFEEI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W   R  C  ED YYPH ++QD++W+ L  C+EP++ RWPFNK IRE A++  + H+ Y
Sbjct  299   NWKKARHQCASEDIYYPHPWVQDLIWDTLYICSEPLLTRWPFNKLIREKALQVTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLARVPD+LWL+EDGM +Q+FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWVEDPNGDAYKKHLARVPDYLWLSEDGMCVQSFGSQEW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA FA QAL+++ +V+E    L K H ++K+SQ+K+NP GDFKSM+RH SKG+W FSDQD
Sbjct  419   DAGFAVQALLAANLVDEIAPVLAKGHDFIKKSQVKDNPSGDFKSMHRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +K  L +  + PEI GEK++ + L+++V++   LQS + GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKVCLQMSLLPPEIVGEKMEPERLFDSVNVLFSLQS-KKGGLAAWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               Q +LE+LNP+E FADIVV+ E+VE TGS + AL  FK  YP +R KE+   I  A  +
Sbjct  538   GAQEWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIDNFIINAVRF  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q ADGSWYG WG+CF YG+ FAL GL AAG+++ N  AIRKA HF L+ Q ++GGW
Sbjct  598   LEDTQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTFSNCAAIRKAVHFLLTTQKEDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   S P   Y+P E +RSNVVQT+WAM+GL++  QA+RDPTPLHRAAKLLINAQ+E+G
Sbjct  658   GESYLSSPKKIYVPLEISRSNVVQTAWAMMGLIHAGQADRDPTPLHRAAKLLINAQLENG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             D+PQQ++TG +MKNCMLHY  +R+ +P+ AL+EY++RV
Sbjct  718   DWPQQEVTGVFMKNCMLHYPMYRNIYPMWALAEYKRRV  755



>gb|AAC17080.1| Strong similarity to lupeol synthase gb|U49919 and cycloartenol 
synthase gb|U02555 from A. thaliana (the third gene with 
similar homology) [Arabidopsis thaliana]
Length=1565

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/759 (56%), Positives = 550/759 (72%), Gaps = 10/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLKI  G    PY++STNN+ GRQ WE+DP+AGT EE  A E+AR+ F   R +    
Sbjct  1     MWKLKIANGNKEEPYLFSTNNFLGRQTWEFDPDAGTVEELAAVEEARRKFYDDRFR-VKA  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ +KE + + + IPP ++ +   +  E  T A+RK V    ALQA DGHWPA
Sbjct  60    SSDLIWRMQFLKEKKFEQV-IPPAKVEDANNITSEIATNALRKGVNFLSALQASDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL+  LY++G +  I T +H++E++RY+Y HQNEDGGWGL+I+G+STM  
Sbjct  119   ENAGPLFFLPPLVFCLYVTGHLHEIFTQDHRREVLRYIYCHQNEDGGWGLHIEGNSTMFC  178

Query  2052  SALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + LNY+ +R+LGE  +     A  R R+WIL HGGAT IPSWGK +LS+LGV++W G NP
Sbjct  179   TTLNYICMRILGEGPNGGPGNACKRARDWILDHGGATYIPSWGKTWLSILGVFDWSGSNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP++ L+L +R EI+++PY +
Sbjct  239   MPPEFWILPSFLPIHPAKMWCYCRLVYMPMSYLYGKRFVGPISPLILQLREEIYLQPYAK  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHMR  1528
             I+WN  R  C KED Y PH  IQDV+WN L   TEP +  WPFNK+ RE A+   + H+ 
Sbjct  299   INWNRARHLCAKEDAYCPHPQIQDVIWNCLYIFTEPFLACWPFNKLLREKALGVAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK+L M+  W EDPN    K HL R+ D+LW+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSRYITIGCVEKALCMLACWVEDPNGIHFKKHLLRISDYLWIAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD+ FA QAL++S +V E  D L++ + +LK SQ++ENP GDF +MYRH SKG+W FSD+
Sbjct  419   WDSGFALQALVASNLVNEIPDVLRRGYDFLKNSQVRENPSGDFTNMYRHISKGSWTFSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW  SDCTAE+ KC LLL  + P+I G K+D + LYEAV I L LQS ++GG   WEP
Sbjct  479   DHGWQASDCTAESFKCCLLLSMIPPDIVGPKMDPEQLYEAVTILLSLQS-KNGGVTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP+E+FADIVV+ E+ E T S + AL  FK  YP++R +E+  SI KA +
Sbjct  538   ARGQEWLELLNPTEVFADIVVEHEYNECTSSAIQALILFKQLYPNHRTEEINTSIKKAVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             Y+E+ Q  DGSWYG WG+CF Y T F L GL AAG++Y N  A+RK  HF L+ Q   GG
Sbjct  598   YIESIQMLDGSWYGSWGVCFTYSTWFGLGGLAAAGKTYNNCLAMRKGVHFLLTTQKDNGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +YIP EG RSN+VQTSWAM+GL++  QAERDP+PLHRAAKLLIN+Q+E+
Sbjct  658   WGESYLSCPKKRYIPSEGERSNLVQTSWAMMGLLHAGQAERDPSPLHRAAKLLINSQLEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG++MKNC+LHYA++R+ FP+ AL+EYR+RV
Sbjct  718   GDFPQQEITGAFMKNCLLHYAAYRNIFPVWALAEYRRRV  756


 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/793 (52%), Positives = 551/793 (69%), Gaps = 36/793 (5%)
 Frame = -3

Query  2607  FSVNIRKMWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQ  2434
             +  +I  MW+LKIGEG G  PY+++TNN+AGRQ WE+DP+ G+PEE+ +  +AR+ F   
Sbjct  772   YVAHIFVMWRLKIGEGNGDDPYLFTTNNFAGRQTWEFDPDGGSPEERHSVVEARRIFYDN  831

Query  2433  RQKGPHTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQA  2254
             R        DL  RMQ ++E + +   I PV++ + E+V +E  T+A+R+ +    ALQA
Sbjct  832   RFH-VKASSDLLWRMQFLREKKFEQ-RIAPVKVEDSEKVTFETATSALRRGIHFFSALQA  889

Query  2253  KDGHWPAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYID  2074
              DGHWPAEN+GPLFF PPL+  LYI+G +D + TSEH+KE++RY+Y HQ EDGGWGL+I+
Sbjct  890   SDGHWPAENAGPLFFLPPLVFCLYITGHLDEVFTSEHRKEILRYIYCHQKEDGGWGLHIE  949

Query  2073  GHSTMIGSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVY  1906
             GHSTM  + LNY+ +R+LGE  D    +A  R R WIL HGG T IPSWGK +LS+LGV+
Sbjct  950   GHSTMFCTTLNYICMRILGESPDGGHDNACGRAREWILSHGGVTYIPSWGKTWLSILGVF  1009

Query  1905  EWDGCNPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEI  1726
             +W G NP+PPEFW+ PS FP HPAKMW+YCR  Y+PMSYLY KR+ GP+T+L+L +R E+
Sbjct  1010  DWSGSNPMPPEFWILPSFFPVHPAKMWSYCRMVYLPMSYLYGKRFVGPITSLILQLRKEL  1069

Query  1725  HVKPYDQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMR  1549
             +++PY++I+W   R  C KEDTYYP   +Q+++W++L    EP + RWPFNK+ RE A++
Sbjct  1070  YLQPYEEINWMKVRHLCAKEDTYYPRPLVQELVWDSLYIFAEPFLARWPFNKLLREKALQ  1129

Query  1548  KVIMHMRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTM  1369
               + H+ Y  E SRYITIG +EK L M+  W EDPN D  K HL+R+ D+LW+AEDGM M
Sbjct  1130  LAMKHIHYEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLSRISDYLWMAEDGMKM  1189

Query  1368  QTFGSQNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKG  1189
             Q+FGSQ WD  FA QAL++S +  E  D L++ H ++K SQ+ ENP GD+KSMYRH SKG
Sbjct  1190  QSFGSQLWDTGFAMQALLASNLSSEISDVLRRGHEFIKNSQVGENPSGDYKSMYRHISKG  1249

Query  1188  AWAFSDQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQ-----  1024
             AW FSD+DHGW VSDCTA  +KC LL   ++P+I G K D + L+++V+I L LQ     
Sbjct  1250  AWTFSDRDHGWQVSDCTAHGLKCCLLFSMLAPDIVGPKQDPERLHDSVNILLSLQVSIIR  1309

Query  1023  ----------------------SPESGGFAVWEPPIPQPYLEMLNPSELFADIVVQGEHV  910
                                     ++GG   WEP     +LE+LNP+E+F+DIV++ E+ 
Sbjct  1310  HRIEPTSSKKHPFSGRDSFTCLQSKNGGMTAWEPAGAPKWLELLNPTEMFSDIVIEHEYS  1369

Query  909   ETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLETQQQADGSWYGYWGICFLYGTCF  730
             E T S + AL+ FK  YPD+R  E+   I KAAEYLE  Q  DGSWYG WGICF YGT F
Sbjct  1370  ECTSSAIQALSLFKQLYPDHRTTEITAFIKKAAEYLENMQTRDGSWYGNWGICFTYGTWF  1429

Query  729   ALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGECLESCPTMKYIPFEGNRSNVVQT  550
             AL GL AAG+++ + EAIRK   F L+ Q   GGWGE   SC    YI   G  SNVVQT
Sbjct  1430  ALAGLAAAGKTFNDCEAIRKGVQFLLAAQKDNGGWGESYLSCSKKIYIAQVGEISNVVQT  1489

Query  549   SWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFPQQDITGSYMKNCMLHYASHRSY  370
             +WA++GL+++ QAERDP PLHRAAKL+IN+Q+E GDFPQQ  TG ++KNC LHYA++R+ 
Sbjct  1490  AWALMGLIHSGQAERDPIPLHRAAKLIINSQLESGDFPQQQATGVFLKNCTLHYAAYRNI  1549

Query  369   FPLMALSEYRKRV  331
              PL AL+EYR RV
Sbjct  1550  HPLWALAEYRARV  1562



>ref|NP_683508.1| camelliol C synthase 1 [Arabidopsis thaliana]
 sp|P0C8Y0.1|LUP3_ARATH RecName: Full=Camelliol C synthase; AltName: Full=Lupeol synthase 
3; Short=AtLUP3 [Arabidopsis thaliana]
 gb|AEE36184.1| camelliol C synthase 1 [Arabidopsis thaliana]
Length=769

 Score =   906 bits (2341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/759 (56%), Positives = 551/759 (73%), Gaps = 10/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLKI  G    PY++STNN+ GRQ WE+DP+AGT EE  A E+AR+ F   R +   +
Sbjct  1     MWKLKIANGNKEEPYLFSTNNFLGRQTWEFDPDAGTVEELAAVEEARRKFYDDRFRVKAS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ +KE + + + IPP ++ +   +  E  T A+RK V    ALQA DGHWPA
Sbjct  61    -SDLIWRMQFLKEKKFEQV-IPPAKVEDANNITSEIATNALRKGVNFLSALQASDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL+  LY++G +  I T +H++E++RY+Y HQNEDGGWGL+I+G+STM  
Sbjct  119   ENAGPLFFLPPLVFCLYVTGHLHEIFTQDHRREVLRYIYCHQNEDGGWGLHIEGNSTMFC  178

Query  2052  SALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + LNY+ +R+LGE  +     A  R R+WIL HGGAT IPSWGK +LS+LGV++W G NP
Sbjct  179   TTLNYICMRILGEGPNGGPGNACKRARDWILDHGGATYIPSWGKTWLSILGVFDWSGSNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP++ L+L +R EI+++PY +
Sbjct  239   MPPEFWILPSFLPIHPAKMWCYCRLVYMPMSYLYGKRFVGPISPLILQLREEIYLQPYAK  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHMR  1528
             I+WN  R  C KED Y PH  IQDV+WN L   TEP +  WPFNK+ RE A+   + H+ 
Sbjct  299   INWNRARHLCAKEDAYCPHPQIQDVIWNCLYIFTEPFLACWPFNKLLREKALGVAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK+L M+  W EDPN    K HL R+ D+LW+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSRYITIGCVEKALCMLACWVEDPNGIHFKKHLLRISDYLWIAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD+ FA QAL++S +V E  D L++ + +LK SQ++ENP GDF +MYRH SKG+W FSD+
Sbjct  419   WDSGFALQALVASNLVNEIPDVLRRGYDFLKNSQVRENPSGDFTNMYRHISKGSWTFSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW  SDCTAE+ KC LLL  + P+I G K+D + LYEAV I L LQS ++GG   WEP
Sbjct  479   DHGWQASDCTAESFKCCLLLSMIPPDIVGPKMDPEQLYEAVTILLSLQS-KNGGVTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP+E+FADIVV+ E+ E T S + AL  FK  YP++R +E+  SI KA +
Sbjct  538   ARGQEWLELLNPTEVFADIVVEHEYNECTSSAIQALILFKQLYPNHRTEEINTSIKKAVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             Y+E+ Q  DGSWYG WG+CF Y T F L GL AAG++Y N  A+RK  HF L+ Q   GG
Sbjct  598   YIESIQMLDGSWYGSWGVCFTYSTWFGLGGLAAAGKTYNNCLAMRKGVHFLLTTQKDNGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +YIP EG RSN+VQTSWAM+GL++  QAERDP+PLHRAAKLLIN+Q+E+
Sbjct  658   WGESYLSCPKKRYIPSEGERSNLVQTSWAMMGLLHAGQAERDPSPLHRAAKLLINSQLEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG++MKNC+LHYA++R+ FP+ AL+EYR+RV
Sbjct  718   GDFPQQEITGAFMKNCLLHYAAYRNIFPVWALAEYRRRV  756



>ref|XP_011006636.1| PREDICTED: beta-amyrin synthase-like [Populus euphratica]
Length=758

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/756 (56%), Positives = 565/756 (75%), Gaps = 7/756 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MW+L++ +G GP+++STNN+ GRQIW++ PN GTPEE    E+AR+ F   R +      
Sbjct  1     MWELEVADGDGPWLFSTNNFVGRQIWKFKPNVGTPEEHARVERAREQFRLNRSRC-KASS  59

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             D+    Q+I+E+++D LSIP VRL + EE+  E   TA+RKA+R   A+QA DGHWPAE 
Sbjct  60    DVLKNFQLIQENQID-LSIPAVRLGDGEEITVEKAETALRKALRFTSAIQASDGHWPAEF  118

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             SGPLF TPPL++ +Y+SGS++ +L+S+HKKE++RY+YNHQNEDGGWG +++GHSTM+G+A
Sbjct  119   SGPLFLTPPLIMVVYLSGSLNTVLSSDHKKEIIRYIYNHQNEDGGWGFHVEGHSTMMGTA  178

Query  2046  LNYVALRLLGEEADDAIA----RGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             LNYVALRLLGE  +        + R WIL HGG T +PSWGK+YLSVLG YEW GCNP+P
Sbjct  179   LNYVALRLLGEGPEGGGDGDLRKARKWILDHGGVTMLPSWGKLYLSVLGTYEWSGCNPVP  238

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEF LFPS  PF P K+W + RT Y PM+YLY K++ GP+T+L+L +R+E++ +PY+++D
Sbjct  239   PEFLLFPSFLPFSPGKLWCHLRTVYTPMAYLYGKKFVGPITDLILQLRDELYNQPYEEVD  298

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             WN  R  C +ED Y   +  ++++++ + Y +E ++R+WPF+K+RE A+++ +  + Y  
Sbjct  299   WNKARHLCLREDLYTSPSLAKNLIFDGVHYLSERVLRQWPFSKLREQALQEAMKLIHYED  358

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             E +RY+T  +IEKSL MM  WAEDP  D  K+HLARVPD LWLAEDGM MQ+ GSQ WDA
Sbjct  359   ENTRYMTHASIEKSLNMMACWAEDPTSDAFKFHLARVPDVLWLAEDGMKMQSIGSQLWDA  418

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
              FATQA+I+S +V+EYG  L++AH +LKQSQI+ N  GDF+ M+RH SKGAW  S +DHG
Sbjct  419   AFATQAVIASKLVDEYGSTLRRAHEFLKQSQIQANASGDFRRMHRHISKGAWTLSIKDHG  478

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCTAEA++ LLLL QM  EI GE +D + LY A+D  L LQS ++GGF+VWEP   
Sbjct  479   WQVSDCTAEALRALLLLSQMPTEIVGEPIDTERLYNAIDFLLSLQS-KNGGFSVWEPARG  537

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
             Q +LE+LNP+E F D++V+ E+VE T S + AL  FK  +P YR KE+  S+AKA+ Y+E
Sbjct  538   QRWLEVLNPTEAFGDMMVETEYVECTASAIQALVLFKRLHPGYRRKEIEASVAKASSYIE  597

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
               Q +DGSWYG WGIC+ YGT FAL GL + G++Y NS  ++KA  F LSKQ+  GGWGE
Sbjct  598   DAQMSDGSWYGNWGICYSYGTYFALKGLASVGKTYRNSTTVQKACEFLLSKQHNSGGWGE  657

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                SC T++Y   EGN+SNVVQT+WAM+GL++  QAERDP PLH+AA+LLIN+QME+G+F
Sbjct  658   SYLSCATLEYTEIEGNKSNVVQTAWAMMGLIHAGQAERDPAPLHQAARLLINSQMENGEF  717

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             PQQ ITG+ +K CMLHYAS ++ FPL AL EY K V
Sbjct  718   PQQQITGASLKTCMLHYASFKNIFPLWALGEYLKCV  753



>ref|XP_010417510.1| PREDICTED: amyrin synthase LUP2-like isoform X1 [Camelina sativa]
Length=764

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/762 (54%), Positives = 554/762 (73%), Gaps = 10/762 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LKIGEG G  PY++S+NN+ GRQ WE+DP  GTPEE+ A E AR+ F   R +    
Sbjct  1     MWRLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKTGTPEERAAVEGARRKFVDNRSR-VKG  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             C DL  RMQ +KE++ + + IPPV++ +   + +   T A+R+ V    ALQA DGHWP 
Sbjct  60    CSDLLWRMQFLKEAKFEQV-IPPVKIDDGVGITHGNATDALRRGVSFFSALQASDGHWPG  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +GPLFF PPL+  LYI+G ++ I  +EH+KE++R++Y HQNEDGGWGL+I+  S M  
Sbjct  119   EITGPLFFLPPLVFCLYITGHLEEIFDAEHRKEMLRHIYCHQNEDGGWGLHIESKSMMFC  178

Query  2052  SALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ LRLLGE      D+A  R R+WIL  GG T IPSWGKI+LS++G+Y+W G NP
Sbjct  179   TALNYICLRLLGEGPNGGRDNACKRARDWILDRGGVTYIPSWGKIWLSIIGIYDWSGTNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPE WL PS  P H  K+  YCR  YMPMSYLY KR+ GP+T L+L +R E+H++PY+ 
Sbjct  239   MPPEIWLLPSFLPIHLGKVLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPYES  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+WN TR    KED Y+PH  +QD++W+AL    EP + RWP NK +RE A+R+ + H+ 
Sbjct  299   INWNKTRRLYAKEDMYFPHPLVQDLVWDALYLFVEPFLTRWPLNKLVRERALRRAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E S YITIG +EK L M+  W E+PN D  K HLAR+PD++W+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QA+++S + +E GD LKK H Y+K+SQ++ENP GD++SMYRH SKGAW  SD+
Sbjct  419   WDTGFAVQAILASDLSDETGDVLKKGHDYIKKSQVRENPSGDYESMYRHISKGAWTLSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAEA KC LLL  M  E+ G+K+D + L+++V++ L  QS ++GG   WEP
Sbjct  479   DHGWQVSDCTAEAFKCCLLLSMMPAEVVGQKMDPEQLFDSVNLMLSFQS-DNGGMTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  ++E+LNP+E  A++V + E+VE T S++ AL  FK  YPD++ KE++ SI KA +
Sbjct  538   ARAYEWIELLNPTEFLANLVAEREYVECTSSVMQALVLFKQLYPDHKTKEISRSIEKAVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             +LE +Q+ DGSWYG WG+CF+Y T FAL GL  AG++Y+NS+AIRK   F L+ Q  +GG
Sbjct  598   FLENEQRPDGSWYGNWGVCFIYATWFALGGLATAGKTYQNSQAIRKGVEFLLTIQKDDGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +YIP EG  SN+VQTSWA++GL+   QAERDP PLHRAAKL+IN+QME+
Sbjct  658   WGESYLSCPEQRYIPSEGKISNLVQTSWAIMGLISAGQAERDPIPLHRAAKLIINSQMEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             GDFPQQ++ G +MKNCMLHYA++R+ FPL AL+EYRK  +++
Sbjct  718   GDFPQQELVGVFMKNCMLHYATYRNTFPLWALAEYRKAAFVT  759



>gb|AIU41743.1| beta-amyrin synthase [Chlorophytum borivilianum]
Length=758

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/757 (56%), Positives = 547/757 (72%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPN-AGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EGG P++ +TNN+ GRQIWE+D N  G+ EE    E AR+ F+  R    H+ 
Sbjct  1     MWRLKIAEGGNPWLRTTNNHVGRQIWEFDSNYQGSHEELLEIENARRNFSDNRFNQKHS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL MR+Q  +E+ +  + IP V+L++ E+V  EA+T  +R+A+     +QA DGHWP +
Sbjct  60    ADLLMRIQFERENPLREV-IPQVKLKDNEDVTEEAVTRTLRRALNYYSVIQAHDGHWPGD  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
               GP+F  P L+I L I+G+++ +L+ EHKKE++RYLYNHQNEDGGWGL+I+G STM GS
Sbjct  119   YGGPMFLMPGLVITLSITGALNAVLSEEHKKEMIRYLYNHQNEDGGWGLHIEGPSTMFGS  178

Query  2049  ALNYVALRLLGE---EADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
              LNYV LRLLGE   E D A+   RNWIL HGGATAI SWGK++LSVLG +EW G NP+P
Sbjct  179   VLNYVTLRLLGEGANEGDGAMENARNWILNHGGATAITSWGKMWLSVLGCFEWSGSNPMP  238

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+  P+T L+L +R E+H +PYDQI+
Sbjct  239   PEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVAPITPLILQLREELHTQPYDQIN  298

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRYG  1522
             W  TR  C  ED YYPH  IQD++W+ +  C EP + RWP NK +R+ A+   + H+ Y 
Sbjct  299   WKKTRHQCAPEDLYYPHPLIQDLMWDCIYICGEPFLTRWPLNKTLRKRALEVTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
               FA QAL+++ +  E  D LKK H ++K+SQ+K+NP  D+++M+RH SKG+W FSDQDH
Sbjct  419   TGFALQALLAANLTNEIADVLKKGHDFVKKSQVKDNPSDDYRAMHRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +KC LL   M PEI GE+ + Q LY+AV++ L LQS ++GG A WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLFSMMPPEIVGEQTEPQRLYDAVNLLLSLQS-KNGGLAAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
              Q +LEMLNP+E FADIV++ E+VE T S + AL  FK  +P +R KE+   I  A +YL
Sbjct  538   AQKWLEMLNPTEFFADIVIEHEYVECTSSAIQALVLFKSLHPGHRTKEIEKFIDNAVQYL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             +  Q  DG WYG WG+CF YGT FAL GL AAG+SY N  A+RKA  F L  Q  +GGWG
Sbjct  598   QDIQDPDGGWYGNWGVCFTYGTWFALGGLAAAGKSYNNCFAMRKAVDFLLRTQRDDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP  KY+P EG R+N+V T+WAM+GL++ +Q  RDPTPLHRAAKL+IN+Q+EDGD
Sbjct  658   ESYLSCPNKKYVPLEGGRTNLVHTAWAMMGLIHAQQMNRDPTPLHRAAKLIINSQLEDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ++ G +M+NCMLHY+++R  FP+ AL+EYR+ V
Sbjct  718   FPQQELMGVFMRNCMLHYSAYRHIFPVWALAEYRRHV  754



>sp|F8WQD0.1|SHS1_ASTTA RecName: Full=Shionone synthase; Short=AtaSHS [Aster tataricus]
 dbj|BAK52535.1| shionone synthase [Aster tataricus]
Length=761

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/757 (55%), Positives = 548/757 (72%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI +GG  PY+YSTNN+ GRQ WE+DPN GTPEE++  E+AR  F   R +     
Sbjct  1     MWRLKIADGGNNPYLYSTNNFIGRQTWEFDPNYGTPEERDEVEQARLHFWNHRHE-IKPS  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GD   RMQ I+E +    +IP V++ ++EE++Y+ +T  +R++V L  AL A DGHWPAE
Sbjct  60    GDTLWRMQFIREKKFKQ-TIPQVKIEDDEEISYDKVTATMRRSVHLLEALLADDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             NSGP FF  PL++ LYI+G ++ +  +EH+KE++RY+Y+HQN+DGGWGL+++GHS M G+
Sbjct  119   NSGPSFFIQPLVMCLYITGHLNSVFPAEHRKEILRYVYSHQNKDGGWGLHMEGHSIMFGT  178

Query  2049  ALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              L+Y+ +RLLGE  D     A  R R WIL HGGA A PSWGK++LS+LGV+EW GCNP+
Sbjct  179   TLSYICMRLLGEGPDGGLNGACTRARKWILDHGGAIANPSWGKVWLSILGVHEWVGCNPL  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWLFPS  P  P KMW+YCR  +MPMSYLY +R+ GP+T LVL +R E++ +PY+ I
Sbjct  239   PPEFWLFPSFLPMSPGKMWSYCRLVFMPMSYLYGRRFVGPITPLVLQLRKELYAQPYNDI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
              W ++R  C KED YYPH  +QD++W++L   TEP++ RWPFNK+R+ A+   + H+ Y 
Sbjct  299   KWKSSRHVCAKEDIYYPHPLLQDLMWDSLYILTEPLLTRWPFNKLRKKALATTMRHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG++EK L M+  W EDPN    K HLAR+PD++W+AEDGM MQTFGSQ WD
Sbjct  359   DENSRYITIGSVEKILCMLACWDEDPNGVCFKKHLARIPDYIWVAEDGMKMQTFGSQVWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             A+   QAL+++ +  +    LKK H ++K SQ+++NP GDFKSMYRH SKG+W FSDQDH
Sbjct  419   ASIGIQALLATELTHDIAPILKKGHEFIKASQVRDNPSGDFKSMYRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW +SDCT   + C LLL  M PE  GEK+D + L +AV++ L LQS E+GG A WEP  
Sbjct  479   GWQLSDCTTIGLTCCLLLSTMPPETVGEKMDPEQLKDAVNVILSLQS-ENGGLAAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LEMLNP E   DIV++ E+VE TG+ + AL  FK  YP +R KEV   +  AA YL
Sbjct  538   SSNWLEMLNPIEFIEDIVIEHEYVECTGTGMEALVLFKKLYPKHRTKEVESFLTNAARYL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             +  Q  DGSWYG WGICF YGT +AL GL A  ++YEN ++IRKA  F L  Q ++GGWG
Sbjct  598   DNTQMPDGSWYGEWGICFTYGTYYALGGLAAIEKTYENCQSIRKAVRFLLKTQGEDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SC    YIP +GNRS VV T+WAMLGLM+++Q ERDP PLHRAAKLLIN+QME+GD
Sbjct  658   ESYRSCAEKIYIPLDGNRSTVVHTAWAMLGLMHSKQEERDPIPLHRAAKLLINSQMENGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQD TG++ KNC+LHY  +R+ + L AL++YRK+V
Sbjct  718   FPQQDTTGAFKKNCLLHYPMYRNIYTLWALAQYRKKV  754



>ref|XP_010429762.1| PREDICTED: amyrin synthase LUP2-like [Camelina sativa]
 ref|XP_010429763.1| PREDICTED: amyrin synthase LUP2-like [Camelina sativa]
Length=761

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/762 (54%), Positives = 555/762 (73%), Gaps = 10/762 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LKIGEG G  PY++S+NN+ GRQ WE+DP  GTPEE+ A E+AR+ +   R +    
Sbjct  1     MWRLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKTGTPEERAAVEEARRKYVDNRSR-VKG  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             C DL  RMQ +KE++ + L IPPVR+ +   + +   T A+R+ V    ALQA DGHWP 
Sbjct  60    CSDLLWRMQFLKEAKFEQL-IPPVRIDDGVGITHGNATDALRRGVSFFSALQASDGHWPG  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +GPLFF PPL+  LYI+G ++ I  +EH+KE++R++Y HQNEDGGWGL+I+  S M  
Sbjct  119   EITGPLFFLPPLVFCLYITGHLEEIFDAEHRKEMLRHIYCHQNEDGGWGLHIESKSMMFC  178

Query  2052  SALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ LRLLGE      D+A  R R+WIL  GG T IPSWGKI+LS++G+Y+W G NP
Sbjct  179   TALNYICLRLLGEGPNGGRDNACKRARDWILDRGGVTYIPSWGKIWLSIIGIYDWSGTNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPE WL PS  P H  K+  YCR  YMPMSYLY KR+ GP+T L+L +R E+H++PY+ 
Sbjct  239   MPPEIWLLPSFLPIHLGKVLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPYES  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+WN TR    KED Y+PH  +QD++W+AL    EP + RWP NK +R+ A+R+ + H+ 
Sbjct  299   INWNKTRRLYAKEDMYFPHPLVQDLVWDALYLFVEPFLTRWPLNKLVRDKALRRAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E S YITIG +EK L M+  W E+PN D  K HLAR+PD++W+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARLPDYMWVAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QA+++S + +E GD LKK H Y+K+SQ++ENP GD++SMYRH SKGAW  SD+
Sbjct  419   WDTGFAVQAILASDLSDETGDVLKKGHDYIKKSQVRENPSGDYESMYRHISKGAWTLSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAEA KC LLL  M  E+ G+K+D + L+++V++ L  QS ++GG   WEP
Sbjct  479   DHGWQVSDCTAEAFKCCLLLSMMPAEVVGQKMDPEQLFDSVNLMLSFQS-DNGGMTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  ++E+LNP+E  A++V + E+VE T S++ AL  FK  YPD++ KE++ SI KA +
Sbjct  538   ARAYEWIELLNPTEFLANLVAEREYVECTSSVMQALVLFKQLYPDHKTKEISRSIEKAVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             +LE +Q+ DGSWYG WG+CF+Y T FAL GL AAG++Y+NS+AIRK   F L+ Q   GG
Sbjct  598   FLENEQRPDGSWYGNWGVCFIYATWFALGGLAAAGKTYQNSQAIRKGVEFLLTIQKDNGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +YIP EG  SN+VQT+WA++GL+   QAERDP PLHRAAKL+IN+QME+
Sbjct  658   WGESYLSCPEQRYIPSEGKSSNLVQTAWAIMGLISAGQAERDPIPLHRAAKLIINSQMEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             GDFPQQ+I G +MKNCM+HYA++R+ FPL AL+EYRK  +++
Sbjct  718   GDFPQQEIVGVFMKNCMIHYATYRNTFPLWALAEYRKAAFVT  759



>ref|XP_010417512.1| PREDICTED: amyrin synthase LUP2-like isoform X3 [Camelina sativa]
Length=764

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/762 (54%), Positives = 552/762 (72%), Gaps = 10/762 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LKIGEG G  PY++S+NN+ GRQ WE+DP  GTPEE+ A E AR+ F   R +    
Sbjct  1     MWRLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKTGTPEERAAVEGARRKFVDNRSR-VKG  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             C DL  RMQ +KE++ + + IPPV++ +   + +   T A+R+ V    ALQA DGHWP 
Sbjct  60    CSDLLWRMQFLKEAKFEQV-IPPVKIDDGVGITHGNATDALRRGVSFFSALQASDGHWPG  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +GPLFF PPL+  LYI+G ++ I  +EH+KE++R++Y HQNEDGGWGL+I+  S M  
Sbjct  119   EITGPLFFLPPLVFCLYITGHLEEIFDAEHRKEMLRHIYCHQNEDGGWGLHIESKSMMFC  178

Query  2052  SALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ LRLLGE      D+A  R R+WIL  GG T IPSWGKI+LS++G+Y+W G NP
Sbjct  179   TALNYICLRLLGEGPNGGRDNACKRARDWILDRGGVTYIPSWGKIWLSIIGIYDWSGTNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPE WL PS  P H  K+  YCR  YMPMSYLY KR+ GP+T L+L +R E+H++PY+ 
Sbjct  239   MPPEIWLLPSFLPIHLGKVLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPYES  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+WN TR    KED Y+PH  +QD++W+AL    EP + RWP NK +RE A+R+ + H+ 
Sbjct  299   INWNKTRRLYAKEDMYFPHPLVQDLVWDALYLFVEPFLTRWPLNKLVRERALRRAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E S YITIG +EK L M+  W E+PN D  K HLAR+PD++W+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QA+++S + +E GD LKK H Y+K+SQ++ENP GD++SMYRH SKGAW  SD+
Sbjct  419   WDTGFAVQAILASDLSDETGDVLKKGHDYIKKSQVRENPSGDYESMYRHISKGAWTLSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAEA KC LLL  M  E+ G+K+D + L ++VD+ L  QS + GG   WEP
Sbjct  479   DHGWQVSDCTAEAFKCCLLLSMMPAEVVGQKMDPEQLNDSVDLMLSFQS-DKGGMTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  ++E+LNP+E  A++V + E+VE T S++ AL  FK  YPD++ KE++ SI KA +
Sbjct  538   VRAYEWIELLNPTEFLANLVAEREYVECTSSVMQALVLFKQLYPDHKTKEISRSIEKAVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             +LE +Q+ DGSWYG WG+CF+Y T FAL GL  AG++Y+NS+AIRK   F L+ Q  +GG
Sbjct  598   FLENEQRPDGSWYGNWGVCFIYATWFALGGLATAGKTYQNSQAIRKGVEFLLTIQKDDGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +YIP EG  SN+VQTSWA++GL+   QAERDP PLHRAAKL+IN+QME+
Sbjct  658   WGESYLSCPEQRYIPSEGKISNLVQTSWAIMGLISAGQAERDPIPLHRAAKLIINSQMEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             GDFPQQ++ G +MKNCMLHYA++R+ FPL AL+EYRK  +++
Sbjct  718   GDFPQQELVGVFMKNCMLHYATYRNTFPLWALAEYRKAAFVT  759



>gb|KFK42270.1| hypothetical protein AALP_AA2G234200 [Arabis alpina]
Length=759

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/759 (55%), Positives = 549/759 (72%), Gaps = 10/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLKI  G    PY++STNN+ GRQ WE+DP+AGTPEE+ A E+AR+ F   R +    
Sbjct  1     MWKLKIANGNKEEPYLFSTNNFLGRQTWEFDPDAGTPEERAAVEEARRKFYDDRFR-VKA  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ + E + + + I PV++ + +++  E  T A+R+ V    ALQA DGHWPA
Sbjct  60    SSDLIWRMQFLNEKKFEQV-IAPVKVEDGKKITSEVATNALRRGVNFLSALQASDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL+  L+++G +  I T EH +E++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVFCLFVTGHLSEIFTKEHCREILRYIYCHQNEDGGWGLHIEGHSTMFC  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ +R+LGE  +    +A  R +NWIL HGGAT IPSWGK +LS+LGV++W G NP
Sbjct  179   TALNYICMRILGESPNGGPGNACERAKNWILGHGGATYIPSWGKTWLSILGVFDWSGSNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW Y R  YMPMSYLY K++ GP++ L+L +R EI+++PY++
Sbjct  239   MPPEFWILPSFLPIHPAKMWCYSRLVYMPMSYLYGKKFVGPISPLILQLREEIYLQPYEK  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHMR  1528
             I+WN  R  C KED YYP   +QDV+W+ L   TEP++  WPFNK+ RE A+   + H+ 
Sbjct  299   INWNRARHLCAKEDAYYPRPLVQDVIWDCLYIFTEPLLTCWPFNKLLREKALVAAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK+L M+  W EDPN    K HL R+ D+LW+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSRYITIGCVEKALCMLACWVEDPNGIHFKKHLLRISDYLWIAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD+ FA QAL+SS +  E  D L++ H   K SQ++ENP GDF SM+RH SKG+W FSD+
Sbjct  419   WDSGFALQALVSSNLSNEIPDVLRRGHDLFKNSQVRENPSGDFTSMHRHMSKGSWTFSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW  SDCTAE +KC +LL  M P+I G K+D + LYE+V I L LQS ++GG   WEP
Sbjct  479   DHGWQASDCTAEGLKCCILLSMMPPDIVGPKMDPEQLYESVTILLSLQS-KNGGVTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP+E+FADIVV+ E+ E T S + AL  FK  YP++R + +   I KA +
Sbjct  538   ARGQEWLELLNPTEVFADIVVEHEYNECTSSAIQALVMFKQLYPNHRTEVINNFIKKAVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             Y+E  Q  DGSWYG WG+CF Y T FAL GL AAG++Y N  A+RK  HF L+ Q   GG
Sbjct  598   YIENIQMLDGSWYGSWGVCFTYSTWFALGGLAAAGKTYTNCLAMRKGVHFLLTTQKDNGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SC   +YIP +G RSN+VQTSWAM+GL++  QAERDPTPLHRAAKLLIN+Q+E+
Sbjct  658   WGESYLSCSKKRYIPSDGERSNLVQTSWAMMGLLHAGQAERDPTPLHRAAKLLINSQLEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG++MKNC+LHYA++R+ FP+ AL+EYR+RV
Sbjct  718   GDFPQQEITGAFMKNCLLHYAAYRNIFPVWALAEYRRRV  756



>gb|AGA17940.1| beta-amyrin synthase [Withania somnifera]
Length=762

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/758 (56%), Positives = 550/758 (73%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLKI +G  GPY+YSTNNY GRQ WE+DPNAGT EE+   E+AR+ F   R K   + 
Sbjct  1     MWKLKIAKGQDGPYLYSTNNYIGRQTWEFDPNAGTAEERAEIEEARQQFWNNRYKVKPS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  RMQ + E       IP V++ E EE+++E  T A+R+AV    ALQA DGHWPAE
Sbjct  60    SDLLWRMQFLGEKNFKQ-GIPAVKVEEGEEISHEVATNALRRAVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCMYITGHLNSVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE      ++A AR R WIL HG  TAIPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGPYGGKNNACARARKWILDHGSVTAIPSWGKTWLSILGVFEWIGTNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+FPS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PY++I
Sbjct  239   PPEFWIFPSFLPVHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLRVELYDQPYNEI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +W   R  C KED YYPH  +QD++W++L  CTEP++ RWPFNK+R  A++  + H+ Y 
Sbjct  299   NWKKVRHVCAKEDLYYPHPLVQDLMWDSLYICTEPLLTRWPFNKLRNKALQVTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDPN D  K HL+R+PD+LW+AEDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGCVEKVLCMLACWVEDPNGDYFKRHLSRIPDYLWVAEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGD-CLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
               FA QAL+++ M  E  D  L+K H ++KQSQ+K+NP GDFK MYRH SKG+W FSDQD
Sbjct  419   TGFAIQALLATEMNNEIADTTLRKGHDFIKQSQVKDNPSGDFKGMYRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW  SD TA+A++C LL   M  E+ GE ++   LY++V++ L LQS ++GG A WEP 
Sbjct  479   HGWQASDTTAKALRCCLLFSMMPSELVGEAIEPARLYDSVNVILSLQS-KNGGLAAWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 YLE+LNP+E FADIV++ E+VE T S + AL  FK  YP  R KE+  SI  A +Y
Sbjct  538   GASEYLELLNPTEFFADIVIEHEYVECTASSIQALILFKKLYPGKRTKEINNSIHNAVKY  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q  DGSWYG WG+CF YG+ FAL GL AAGRSY N  A+R+   F L  Q  +GGW
Sbjct  598   LEDVQMPDGSWYGNWGVCFTYGSWFALGGLAAAGRSYSNCSAVRRGVEFLLRTQRSDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GEC  SCP   Y   E + SN+VQT+WA++GL+++ Q +RD  PLHRAAKLLIN+QMEDG
Sbjct  658   GECYRSCPDKVYREPETDDSNLVQTAWALMGLIHSGQVDRDLRPLHRAAKLLINSQMEDG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DFPQQ+ITG +MKNCMLHYA++R+ +PL  L+EYRK V
Sbjct  718   DFPQQEITGVFMKNCMLHYAAYRNIYPLWGLAEYRKNV  755



>ref|XP_010245750.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Nelumbo nucifera]
Length=736

 Score =   904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/757 (55%), Positives = 546/757 (72%), Gaps = 35/757 (5%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MW+LKI +GGGPY+YSTNNY GRQ WE++P+ GT EE+   EKAR  FTK R       G
Sbjct  1     MWRLKIAQGGGPYMYSTNNYVGRQTWEFNPDYGTSEERAEVEKARDEFTKNRH-CVKPSG  59

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             D+ +R+Q++KE+   + +IPPVR+ E+EE++YEA T A+++AV+ + ALQA DGHWPAEN
Sbjct  60    DVLLRLQLLKENNF-IQTIPPVRIGEDEEISYEAATAALKRAVQFHSALQASDGHWPAEN  118

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             SG  FF PP+++ LYI+G ++ + T E++KE++RY+YNHQNEDGGWGL+I+GHS M  + 
Sbjct  119   SGCPFFLPPMVMCLYITGDLNKVFTEEYRKEILRYIYNHQNEDGGWGLHIEGHSIMFSTV  178

Query  2046  LNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             LNY+++R+LGE      D A+ R R WI  HGGAT+IPSWGK +LS+ GVYEW+G NP+P
Sbjct  179   LNYISMRILGEGPEGGRDRAVPRARKWIHDHGGATSIPSWGKTWLSIFGVYEWEGSNPMP  238

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEFWL PS FP  P K+W YCR TYMPM YLY KR+ GP+T L+L +R EIH +PY +I 
Sbjct  239   PEFWLLPSFFPLSPEKLWCYCRMTYMPMCYLYGKRFVGPITPLILQLREEIHTQPYHKIK  298

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             W+ TR  C KED YYPH FIQD+LW+ L   TEP++ RWPFNK+RE A+++ + H+ Y  
Sbjct  299   WSRTRHMCAKEDLYYPHPFIQDLLWDTLYILTEPLLTRWPFNKLRERALKQTMKHIHYED  358

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             E SRYITIG +EK L M+  W EDPN D  KYHL R+PD++W+AEDGM MQ++GSQ WD 
Sbjct  359   ENSRYITIGCVEKPLFMLACWVEDPNGDAYKYHLERIPDYIWVAEDGMKMQSYGSQLWDT  418

Query  1338  TFATQALISSGM-VEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             +FA QA+++S +  +E G CLKK H YLK SQ++ENP GDFK M+RH SKG+W FSDQDH
Sbjct  419   SFAIQAIMASNLSFDEIGLCLKKGHDYLKNSQVRENPSGDFKRMFRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW +SDCTAEA+K  L+   M PEI GEK++ +CL++AV++ L LQS ++GG A WEP  
Sbjct  479   GWQISDCTAEALKACLMFSLMPPEIVGEKMEKECLFDAVNVLLSLQS-QNGGLACWEPAR  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
              + +LE+ NP+E F++IV++ E++E T S + AL  FK  YP++R KEV   I+K+  Y+
Sbjct  538   SENWLELFNPTEFFSNIVIEHEYIECTASAIQALVLFKKLYPNHRKKEVESFISKSVHYI  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  +GSWYG WGICF+Y   FAL GL A G++Y+N   +RK   F LS Q    GWG
Sbjct  598   EQIQMPNGSWYGNWGICFIYSAWFALGGLAAVGKTYDNCPTVRKCVDFLLSTQKDSCGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP +                           AERD TPLHRAAKLLIN+QME+GD
Sbjct  658   ESYLSCPNV---------------------------AERDATPLHRAAKLLINSQMENGD  690

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQ++ITG ++KNCM+HYA++R+ FPL AL EYR RV
Sbjct  691   FPQEEITGVFLKNCMIHYAAYRNIFPLWALGEYRARV  727



>gb|AAS83468.1| beta-armyrin synthase [Bupleurum kaoi]
Length=762

 Score =   904 bits (2336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/758 (55%), Positives = 545/758 (72%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG--GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LKI EG     Y+YSTNNY GRQ WE+DPN G+ EE+   ++AR  F + R K   +
Sbjct  1     MWRLKIAEGSEDDKYLYSTNNYVGRQTWEFDPNYGSREEKAQVDEARLNFWQNRYKVKPS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GD+  +MQ ++E      +IP V++ + E+++YE  +  V++A     ALQA DGHWPA
Sbjct  61    -GDVLWQMQFLREKGFKQ-TIPQVKIEDGEDISYEKASVTVKRAAHYFAALQASDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++ +YI+G ++ +  + H++E++RYLY HQNEDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVMCVYITGHLNQVFPAPHREEILRYLYCHQNEDGGWGLHIEGHSTMFC  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +AL+Y+ +R+LGE  D    +A +R R WIL HG  T +PSWGK +LS+LGV+EW G NP
Sbjct  179   TALSYICMRILGEGPDGGVNNACSRARKWILDHGSVTHMPSWGKTWLSILGVFEWSGSNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+  P+T L+L +R E++ +PYD 
Sbjct  239   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVAPMTPLILQLREELYDQPYDH  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I+W   R  C  ED YYPH  +QD++W +L  CTEP++ RWPFNKIRE A+   + H+ Y
Sbjct  299   INWPKVRHCCAPEDIYYPHPLVQDLIWGSLYICTEPLLTRWPFNKIREKALATTMEHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M   WAEDP+ D  K HLAR+PD+LW+AEDGM MQ+FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMPACWAEDPDGDYFKKHLARIPDYLWVAEDGMKMQSFGSQEW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  F  QAL+++ + +E G  LK+   ++K SQ+K+NP GDFKSMYRH SKG+W FSDQD
Sbjct  419   DTGFGLQALLATDLTDELGPTLKRGREFVKASQVKDNPSGDFKSMYRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LL   MSPEI G+K + + LY++V++ L LQS ++GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLFSMMSPEIVGKKFEPERLYDSVNLLLSLQS-KNGGLAAWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               Q +LE+LNP+E F DIV++ E+VE T S + AL  F   YP +R KE+   I  AA+Y
Sbjct  538   GAQEWLELLNPTEFFQDIVIEHEYVECTASAIQALVLFTKLYPAHRKKEINAFIVNAAKY  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q  DGSWYG WG+CF YG+ FAL GL AAG++Y N  A+RK   F L  Q  +GGW
Sbjct  598   LEDIQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYNNCAAVRKGVDFLLKSQLDDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  KY   EG+RSN+VQT+WA +GL+++ Q ERDPTPLHRAAKL+IN+Q E G
Sbjct  658   GESYLSCPLEKYTQIEGSRSNLVQTAWATVGLIHSGQVERDPTPLHRAAKLIINSQEEKG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
              FPQQ+ITG +MKNCMLHYA++R  +PL AL+EYRKRV
Sbjct  718   GFPQQEITGVFMKNCMLHYAAYRDLYPLWALAEYRKRV  755



>ref|XP_009591746.1| PREDICTED: beta-amyrin synthase-like [Nicotiana tomentosiformis]
Length=761

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/757 (56%), Positives = 544/757 (72%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLKI +G  GPY+YSTNNY GRQIW +DPNAG+PEE+   E+AR+ F   R K   + 
Sbjct  1     MWKLKIAQGQDGPYLYSTNNYVGRQIWAFDPNAGSPEERAEIEEARQQFWNNRYKIKPS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  RMQ ++        IP V++ E EE+  E  TT++R+AV    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLRGKTFKQ-KIPAVKVEEGEEITDEVATTSLRRAVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NGGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE  D    +A AR R WIL HG  TAIPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGPDGGVNNACARARKWILDHGSVTAIPSWGKTWLSILGVFEWLGTNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW Y R  YMPMSYLY KR+ GP+T L+L +R E++ +PY +I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYTRMVYMPMSYLYGKRFVGPITPLILQLRGELYDQPYREI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +W   R  C KED +YPH  +QD++W+ L  CTEP++ RWPFNK+R  A+   + H+ Y 
Sbjct  299   NWKKVRHLCAKEDLFYPHPLVQDLMWDILYICTEPLLTRWPFNKLRNKALEVTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW+AEDGM +Q  GSQ WD
Sbjct  359   DESSRYITIGCVEKVLCMLACWVEDPNGDCFKKHLARIPDYLWVAEDGMKLQGLGSQLWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
               FA QAL++S M +E  D L+K H ++K+SQ+KENP GDF+ MYRH SKG+W FSDQDH
Sbjct  419   TAFAIQALLASEMNDEISDTLRKGHDFIKKSQVKENPSGDFRGMYRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAEA+ C LL   M  E+ GE ++   LY+AV++ L LQS ++GG +VWEP  
Sbjct  479   GWGVSDCTAEALTCCLLFSTMPSELVGEAMEPALLYDAVNVILSLQS-KNGGLSVWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                YLE+LNP+E FADIV++ E+VE TGS + AL  FK  YP +R  EV   I  A +Y 
Sbjct  538   ASEYLELLNPTEFFADIVIEHEYVECTGSSIQALVLFKKLYPGHRTNEVDNFIDNAVKYF  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WG+CF+Y + FAL GL AAG+SY N  A+RK   F L  Q  +GGWG
Sbjct  598   EDVQMPDGSWYGCWGVCFIYASWFALGGLAAAGKSYSNCAAVRKGVEFLLRTQRSDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP   Y   E + SN+VQT+WA++GL+++ Q +RDP PLHRAA+LLIN+Q+EDGD
Sbjct  658   ESYRSCPDKVYRELETDNSNLVQTAWALMGLIHSGQVDRDPRPLHRAARLLINSQLEDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ++TG +MKNCMLHYA +R+ FPL  L+EYRK V
Sbjct  718   FPQQELTGVFMKNCMLHYALYRNIFPLWGLAEYRKNV  754



>gb|ABK76265.1| beta-amyrin synthase [Vaccaria hispanica]
Length=760

 Score =   903 bits (2333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/760 (56%), Positives = 551/760 (73%), Gaps = 13/760 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LKI EG   PY+YSTNN+ GRQ WE+D + GTPE  +  E+AR+ F K R Q  P  
Sbjct  1     MWRLKIAEGANDPYLYSTNNFVGRQTWEFDTDYGTPEAIKEVEEARQDFYKNRFQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             CGDL  R Q ++E      +IP V+L + EEV YEA T  V++AV    A+QA+DGHWPA
Sbjct  59    CGDLLWRFQFLREKNFKQ-TIPQVKLGDGEEVTYEAATATVKRAVNYLAAIQAEDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +GP FF PPL+  LYI+G ++ +    H++E++R +Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   EIAGPQFFLPPLVFCLYITGHLNSVFNVHHREEILRSIYYHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLG----EEADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ LR+LG    E  D+A  R R WIL HG  T IPSWGK +LS+LG+++W G NP
Sbjct  178   TALNYICLRMLGVGPDEGDDNACPRARKWILDHGSVTHIPSWGKTWLSILGLFDWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P +PAKMW YCR  YMPMSYLY KR+ GP+T L+  +R E+  +PY+ 
Sbjct  238   MPPEFWILPSFMPMYPAKMWCYCRMVYMPMSYLYGKRFVGPITPLIKQLREELFNEPYED  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I W   R  C +ED YYPH  IQD++W++L   TEP++ RWPFN  IR+ A++  + H+ 
Sbjct  298   IKWKKVRHFCAQEDLYYPHPLIQDLMWDSLYLFTEPLLTRWPFNGLIRKKALQVTMDHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRY+TIG +EK L M+  W EDPN    K HLARVPD++W+AEDG+ MQ+FGSQ 
Sbjct  358   YEDENSRYLTIGCVEKVLCMLACWVEDPNGVCYKKHLARVPDYVWIAEDGLKMQSFGSQQ  417

Query  1347  WDATFATQALISSGM-VEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSD  1171
             WD  FA QAL++S + ++E G  LKK H+++K+SQ+K+NP GDFKSM+RH SKG+W FSD
Sbjct  418   WDCGFAVQALLASNLSLDEIGPALKKGHYFIKESQVKDNPSGDFKSMHRHISKGSWTFSD  477

Query  1170  QDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWE  991
             QDHGW VSDCTAE +KC L+L  M PEI GEK+D + LY++V+I L LQS E+GG + WE
Sbjct  478   QDHGWQVSDCTAEGLKCCLVLSTMPPEIVGEKMDPERLYDSVNILLSLQS-ENGGLSAWE  536

Query  990   PPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAA  811
             P   Q +LE+LNP+E FADIV++ E+VE TGS + AL  FK  YP +R KE+   I KA+
Sbjct  537   PAGAQAWLELLNPTEFFADIVIEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFILKAS  596

Query  810   EYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEG  631
             +YLE  Q  +GSWYG WG+CF YGT FAL GLTAAGR++ N  AIRK   F L  Q ++G
Sbjct  597   KYLEDTQYPNGSWYGNWGVCFTYGTWFALGGLTAAGRTFSNCAAIRKGVEFLLKSQKEDG  656

Query  630   GWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQME  451
             GWGE   SCP   ++P EG  SN+ QT+WA++GL+YT Q ERDPTPLHRAAKLLIN+Q+E
Sbjct  657   GWGESYISCPKKDFVPLEGP-SNLTQTAWALMGLIYTRQMERDPTPLHRAAKLLINSQLE  715

Query  450   DGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
              GDFPQQ+ITG +MKNCMLHY  +RS +P+ AL+EYRK V
Sbjct  716   SGDFPQQEITGVFMKNCMLHYPMYRSIYPMWALAEYRKHV  755



>ref|XP_008365649.1| PREDICTED: beta-amyrin synthase [Malus domestica]
Length=761

 Score =   902 bits (2332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/759 (57%), Positives = 553/759 (73%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MWKLK  +GG  PYIYSTNN+ GRQI+E+DP AGT EE+   E+AR  F   R Q  P  
Sbjct  1     MWKLKXADGGNDPYIYSTNNFVGRQIFEFDPEAGTTEERAEVEEARLHFYNNRYQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GD   RMQ ++E      +IPP ++ + EE+ +E  T ++R++V    ALQA DGHWPA
Sbjct  59    SGDFLWRMQFLREXNFKQ-TIPPXKVEDGEEITHEKATASLRRSVHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+ PLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAXPLFFLPPLVMCVYITGHLNTVFHAEHRKEILRYIYYHQNQDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +AL+Y+ +R+LGE  D    +A AR R WIL HG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TALSYICMRILGEGPDGGQDNACARARKWILDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PYD+
Sbjct  238   MPPEFWILPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W   R  C KED YYPH +IQD LW++L  CTEP++ RWPFNK IR+ A+   + H+ 
Sbjct  298   INWKGVRHHCAKEDIYYPHPWIQDFLWDSLYICTEPLLTRWPFNKMIRKRALEVTMKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  WAEDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQ  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S + +E    L + H ++K+SQ+K+NP GDFKSM+RH SKG+  FSDQ
Sbjct  418   WDTGFAIQALLASNLTDEIAPTLARGHDFVKKSQVKDNPSGDFKSMHRHISKGSXTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LLL  M PE+ GEK++ + LY+AV++ + LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMMPPELVGEKMEPERLYDAVNVLISLQS-KNGGLAAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LEMLNP+E FADIVV+ E+VE T S + AL  FK  YP +R KE+   I  AA+
Sbjct  537   AGAAEWLEMLNPTEFFADIVVEHEYVECTSSAIQALVLFKKLYPGHRKKEIDQFITNAAQ  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG WG+ F YGT  AL GLTAAG+++ N   IRKA +F L  Q + GG
Sbjct  597   YLENIQMEDGSWYGNWGVXFTYGTWXALGGLTAAGKTFNNCXVIRKAINFLLXIQKENGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +Y+P EGNR N+V T+WAM+GL+Y  QAERDP PLHRAAKL+ N+QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRXNLVHTAWAMMGLIYAGQAERDPAPLHRAAKLIXNSQMEN  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDF QQ+ITG + KNCMLHYA++R+ +PL AL+EYRK V
Sbjct  717   GDFXQQEITGVFXKNCMLHYAAYRNIYPLWALAEYRKWV  755



>ref|XP_003521100.1| PREDICTED: beta-amyrin synthase-like isoformX1 [Glycine max]
 ref|XP_006576765.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Glycine max]
Length=762

 Score =   902 bits (2332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/758 (56%), Positives = 558/758 (74%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI +GG  PYI+STNN+ GRQ WE+DP AGTPEE+   E AR+ F   R K    C
Sbjct  1     MWRLKIADGGKDPYIFSTNNFVGRQTWEFDPEAGTPEERAQVEAARQNFYNNRFK-VKAC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  R Q+++E      SIP V++ + EE+ YE + + +R+A     ALQ  DGHWPA+
Sbjct  60    GDLLWRFQILREKNFKQ-SIPSVKIEDGEEITYEKVISTLRRAAHHLSALQTSDGHWPAQ  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GPLFF PPL+  +YI+G +D++   E++KE++RY+Y HQNEDGGWGL+I+GHSTM G+
Sbjct  119   IAGPLFFLPPLVFCMYITGHLDLVFPEEYRKEILRYIYYHQNEDGGWGLHIEGHSTMFGT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              LNY+ +R+LGE  +    +A ARG+ WI  HGG T IPSWGK +LS+LGV++W G NP+
Sbjct  179   TLNYICMRILGEGPNGGHENACARGKKWIHDHGGVTHIPSWGKTWLSILGVFDWCGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E+  +PY+++
Sbjct  239   PPEFWIIPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKV  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W   R  C KED YYPH+ IQD++W++L   TEP++  WPFNK IRE A++  + H+ Y
Sbjct  299   NWKKVRHQCAKEDLYYPHSLIQDLVWDSLYMFTEPLLTCWPFNKLIREKALQVTMNHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDP  D  K HLARV D+LW++EDGMTMQ+FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWVEDPQGDAFKKHLARVSDYLWVSEDGMTMQSFGSQEW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA FA QAL+++ +++E G  L K H ++K+SQ+++NP GDFKSMYRH +KG+W FSDQD
Sbjct  419   DAGFAVQALLATKLIDEIGHSLAKGHDFIKKSQVRDNPSGDFKSMYRHITKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LLL ++SPEI GEKV  +  Y++V+I L LQS + GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSKLSPEIVGEKVKPERFYDSVNILLSLQS-KKGGIAAWEPI  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               Q +LE+LNP+E F DIV++ E+VE TGS + AL  F+  YP++R  E+   I  A ++
Sbjct  538   GAQEWLELLNPTEFFEDIVIEHEYVECTGSAIQALVLFQKLYPEHRKTEIKNFIVNAVQF  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q  +GSWYG WG+C+ YG+ FAL GL AAG++Y N  AIRKA  F L+ Q ++GGW
Sbjct  598   LEDTQTTNGSWYGCWGVCYTYGSWFALGGLAAAGKTYTNCNAIRKAVKFLLTTQREDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   S P   YIP EG+RSNVVQT+WA++GL+Y  Q+ERD TPLH+AAKLLIN+Q+E+G
Sbjct  658   GESYLSSPKKIYIPLEGSRSNVVQTAWALMGLIYAGQSERDLTPLHQAAKLLINSQLEEG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             D+PQQ+ITG ++KNCM+HY  +R+ FP+ AL+EYR+RV
Sbjct  718   DWPQQEITGVFLKNCMMHYPMYRNIFPMWALAEYRRRV  755



>ref|XP_006351975.1| PREDICTED: beta-amyrin synthase-like [Solanum tuberosum]
Length=761

 Score =   902 bits (2331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/764 (55%), Positives = 546/764 (71%), Gaps = 10/764 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHT  2413
             MWKLKI +G   PY+YSTNNY GRQ WE+DPNAG  EE    E+AR+ F   R K  P++
Sbjct  1     MWKLKIAKGQDDPYLYSTNNYVGRQTWEFDPNAGMKEEHAEIEEARQHFWNNRYKVKPNS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E       I  V++ E +E+++E  T A+R+AV    ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-RIGAVKVEEGKEISHEIATIALRRAVHFFSALQATDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + L+Y+ +R+LGE  D    +A AR R WIL HG  TAIPSWGK +LS+LG +EW G NP
Sbjct  178   TTLSYICMRILGEGPDGGKNNACARARKWILDHGSVTAIPSWGKTWLSILGAFEWLGTNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             IPPEFW+ PS  P +PAKMW YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PYD+
Sbjct  238   IPPEFWILPSFLPMNPAKMWCYCRMVYMPMSYLYGKRFIGPITPLILQLRVELYNQPYDE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I+W   R  C KED YYPH ++QD++W++L  CTEP++ RWPFNK+R  A+   + H+ Y
Sbjct  298   INWKRVRHLCAKEDLYYPHPWVQDLMWDSLNICTEPLLTRWPFNKLRNKALEVTMKHIHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG + K L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ W
Sbjct  358   EDENSRYITIGCVNKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQAW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D +FA QAL++S M +E  D L+K H ++K SQ+K+NP GDFK MYRH SKG+W FSDQD
Sbjct  418   DTSFAIQALLASEMNDEILDTLRKGHDFIKTSQVKDNPSGDFKGMYRHISKGSWTFSDQD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSD TAEA+KC L    M  E+ GE ++   LY++VD+ L  QS ++GG A WEP 
Sbjct  478   HGWQVSDSTAEALKCCLFFSTMPSELVGEAIEPARLYDSVDVILTFQS-KNGGLAAWEPA  536

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 YLE+LNP+ELFADIV++ E+VE TG+ + AL  FK  YP +R  E+   I  A +Y
Sbjct  537   GASQYLELLNPTELFADIVIEHEYVECTGASIQALVLFKKLYPGHRTTEIDNFIDNAVKY  596

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             L+  Q+ DGSWYG WG+CF Y + FAL GL AAG+SY NS A+RK   F L +Q  +GGW
Sbjct  597   LDDVQKPDGSWYGSWGVCFTYASWFALGGLAAAGKSYSNSAAVRKGVEFLLLRQRSDGGW  656

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP   Y   E   SN+VQT+WA++GL+++ Q +RDP PLH AA+LLIN+QMEDG
Sbjct  657   GESYHSCPDKVYRELETEHSNLVQTAWALMGLIHSGQVDRDPRPLHCAARLLINSQMEDG  716

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS*SH  313
             DFPQQ+ITG  MKNCMLHYA++++ FPL  L+EY K V +   H
Sbjct  717   DFPQQEITGVVMKNCMLHYAAYKNIFPLWGLAEYCKNVQVPLVH  760



>ref|NP_178017.2| lupeol synthase 2 [Arabidopsis thaliana]
 sp|Q8RWT0.1|LUP2_ARATH RecName: Full=Amyrin synthase LUP2; AltName: Full=Alpha-amyrin 
synthase; AltName: Full=Beta-amyrin synthase; AltName: Full=Lupeol 
synthase 2; Short=AtLUP2 [Arabidopsis thaliana]
 gb|AAM14080.1| putative lupeol synthase [Arabidopsis thaliana]
 gb|AAM45087.1| putative lupeol synthase [Arabidopsis thaliana]
 gb|AEE36185.1| lupeol synthase 2 [Arabidopsis thaliana]
Length=763

 Score =   902 bits (2331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/757 (54%), Positives = 547/757 (72%), Gaps = 10/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLKIGEG G  PY++S+NN+ GRQ WE+DP AGTPEE+ A E AR+ +   R +    
Sbjct  1     MWKLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTPEERAAVEDARRNYLDNRPR-VKG  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             C DL  RMQ +KE++ + + IPPV++ + E + Y+  T A+R+AV    ALQ+ DGHWPA
Sbjct  60    CSDLLWRMQFLKEAKFEQV-IPPVKIDDGEGITYKNATDALRRAVSFYSALQSSDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +G LFF PPL+   YI+G ++ I  +EH+KE++R++Y HQNEDGGWGL+I+G S M  
Sbjct  119   EITGTLFFLPPLVFCFYITGHLEKIFDAEHRKEMLRHIYCHQNEDGGWGLHIEGKSVMFC  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + LNY+ LR+LGE  +    +A  R R WIL HGG T IPSWGKI+LS+LG+Y+W G NP
Sbjct  179   TVLNYICLRMLGEGPNGGRNNACKRARQWILDHGGVTYIPSWGKIWLSILGIYDWSGTNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPE WL PS FP H  K   Y R  YMPMSYLY KR+ GPLT L++ +R E+H++PY++
Sbjct  239   MPPEIWLLPSFFPIHLGKTLCYTRMVYMPMSYLYGKRFVGPLTPLIMLLRKELHLQPYEE  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+WN  R  C KED  YPH  +QD+LW+ L    EPI+  WP  K +RE A+R  + H+ 
Sbjct  299   INWNKARRLCAKEDMIYPHPLVQDLLWDTLHNFVEPILTNWPLKKLVREKALRVAMEHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E S YITIG +EK L M+  W E+PN D  K HLAR+PDF+W+AEDG+ MQ+FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDHFKKHLARIPDFMWVAEDGLKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++  + +E  D L+K H ++K+SQ++ENP GDFKSMYRH SKGAW  SD+
Sbjct  419   WDTVFAIQALLACDLSDETDDVLRKGHSFIKKSQVRENPSGDFKSMYRHISKGAWTLSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAEA+KC +LL  M  E+ G+K+D + LY++V++ L LQ  E GG   WEP
Sbjct  479   DHGWQVSDCTAEALKCCMLLSMMPAEVVGQKIDPEQLYDSVNLLLSLQG-EKGGLTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP++ F  ++ + E+VE T +++ AL  FK  YPD+R KE+  SI K  +
Sbjct  538   VRAQEWLELLNPTDFFTCVMAEREYVECTSAVIQALVLFKQLYPDHRTKEIIKSIEKGVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             ++E++Q  DGSW+G WGICF+Y T FAL GL AAG++Y++  A+RK   F L+ Q ++GG
Sbjct  598   FIESKQTPDGSWHGNWGICFIYATWFALSGLAAAGKTYKSCLAVRKGVDFLLAIQEEDGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +YIP EGNRSN+VQT+WAM+GL++  QAERDPTPLHRAAKL+I +Q+E+
Sbjct  658   WGESHLSCPEQRYIPLEGNRSNLVQTAWAMMGLIHAGQAERDPTPLHRAAKLIITSQLEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             GDFPQQ+I G +M  CMLHYA++R+ FPL AL+EYRK
Sbjct  718   GDFPQQEILGVFMNTCMLHYATYRNIFPLWALAEYRK  754



>gb|KFK42272.1| hypothetical protein AALP_AA2G234400 [Arabis alpina]
Length=759

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/759 (55%), Positives = 547/759 (72%), Gaps = 10/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG--GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLKIGE     PY++STNN+AGRQ WE+DP+ G+PEEQ+A  +AR+ F + R +    
Sbjct  1     MWKLKIGERNEDDPYLFSTNNFAGRQTWEFDPHGGSPEEQQAVVEARRSFYENRFR-VKA  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ +KE + + + IPPV++   +++ +E+ T ++R+ V    ALQA DGHWPA
Sbjct  60    SSDLLWRMQFLKEKKFEQV-IPPVKVESSDKITFESATNSLRRGVHFFSALQASDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL+  LYI+G +D I T EH+KE++RY+Y HQ EDGGWG +I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVFCLYITGHLDDIFTLEHRKEILRYIYCHQKEDGGWGFHIEGHSTMFC  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ +R+LGE  D    +A AR R WI  HGG T IPSWGK +LS+LGV++W G NP
Sbjct  179   TALNYICMRILGESPDGGEENACARARKWIHVHGGVTCIPSWGKTWLSILGVFDWSGSNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS FP +PAKMW YCR  Y+PMSYLY KR+ GP+T L+L +R E++++PY +
Sbjct  239   MPPEFWILPSFFPVNPAKMWCYCRMVYLPMSYLYGKRFVGPITPLILQLRKELYLQPYGE  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHMR  1528
             I+W      C KED YYP   +Q+++W++L   TEP + RWP NK+ R+ A++  + H+ 
Sbjct  299   INWKKIHHLCAKEDAYYPRPLVQELIWDSLYIFTEPFLTRWPLNKLLRQRALQVAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S +  E  D L++ H ++K+SQ++ENP GDFKSMYRH SKGAW FSD+
Sbjct  419   WDTGFAMQALLASNLSSEISDVLRRGHEFIKKSQVRENPSGDFKSMYRHISKGAWTFSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTA  +KC LLL  M+P I G K D + LY++V++ L LQS + GG   WEP
Sbjct  479   DHGWQVSDCTAHGLKCCLLLSMMAPNIVGPKTDPERLYDSVNLLLTLQS-KKGGMTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LE+LNP+E+F+DIV++ E+ E T S + AL+ FK  +PD+R  E+   I KA +
Sbjct  538   AGAPEWLELLNPTEMFSDIVIEHEYTECTSSAIQALSLFKQLFPDHRKAEINKFIEKAVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG WGICF+YGT F L GL AAG++Y +  AIRK   F L+ Q   GG
Sbjct  598   YLENMQTPDGSWYGNWGICFMYGTWFGLAGLAAAGKTYNDCVAIRKGVQFLLATQKDNGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SC   +YI  E + +NVVQTSWA++GL+++ QA+RDP PLHRA KL+IN+Q+E+
Sbjct  658   WGESYLSCSEKRYIAEEADITNVVQTSWALMGLIHSGQAKRDPVPLHRAVKLIINSQLEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ  TG +MKNC LHYA++R+  PL AL+EYR RV
Sbjct  718   GDFPQQQSTGVFMKNCTLHYAAYRNIHPLWALAEYRARV  756



>ref|XP_010696136.1| PREDICTED: beta-amyrin synthase-like [Beta vulgaris subsp. vulgaris]
Length=764

 Score =   900 bits (2326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/762 (55%), Positives = 547/762 (72%), Gaps = 11/762 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LK+GEG   PY+YSTNN+ GRQ WE+DPN GTPE  E  E+AR+ F   R K    C
Sbjct  1     MWRLKVGEGANDPYLYSTNNFVGRQTWEFDPNYGTPEAIEEVEQARRNFYDNRFK-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  R+Q ++E      +IP V++ +EEE+ YE  TT +++AV    ALQ++ GHWPAE
Sbjct  60    GDLLWRLQFLREKNFKQ-TIPQVKVGDEEEITYETATTTLKRAVNYFTALQSEHGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +GP FF PPL+  LYI+G ++ +   EH++E++R +Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   IAGPQFFLPPLVFCLYITGHLNSVFGPEHRREILRSIYYHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLG----EEADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             ALNY+ LR+LG    E  D+A  R R WIL HG  T IPSWGK +LS+LG+++W G NP+
Sbjct  179   ALNYICLRMLGIGPDEGDDNACPRARKWILDHGSVTHIPSWGKTWLSILGLFDWSGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+  P+T L+  +R E++ KPY+QI
Sbjct  239   PPEFWIIPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVAPITPLIEQLREELYDKPYEQI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
              W   R  C  ED YYPH  IQD++W+ L   TEP + RWP NK IR+ A+   + H+ Y
Sbjct  299   SWKKVRHLCAPEDLYYPHPLIQDLMWDTLYIFTEPFLTRWPLNKLIRKKALEVTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLARV D++W+AEDG+ MQ+FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWVEDPNGDHFKKHLARVADYIWIAEDGLKMQSFGSQEW  418

Query  1344  DATFATQALISSGM-VEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             D  F+ QAL++S + ++E G  LKK HF++K+SQ+K+NP GDFKSM+RH SKG+W FSDQ
Sbjct  419   DCGFSVQALLASNLSLDEIGPALKKGHFFIKESQVKDNPSGDFKSMHRHISKGSWTFSDQ  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC L+L  M PEI GEK+D + L+++V++ L LQS   GG A WEP
Sbjct  479   DHGWQVSDCTAEGLKCCLILSTMPPEIVGEKMDPERLFDSVNVLLSLQS-NKGGLAAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP+E F DIVV+ E+VE T S + AL  FK  YP +R KE+   I  A +
Sbjct  538   AGAQEWLELLNPTEFFEDIVVEHEYVECTASAIQALVLFKKLYPGHRKKEIENFIINAVK  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             +LE  Q  +G WYG WGICF+YGT FAL GL AAG++Y N  A+RK   F L+ Q ++GG
Sbjct  598   FLENTQYPNGGWYGNWGICFIYGTWFALGGLAAAGKTYYNCGAVRKGVEFLLTTQKEDGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +++P EG +SN+VQT WA++GL++  Q ERD TPL RAAKLLIN+Q+E+
Sbjct  658   WGESYISCPDKEFVPLEG-KSNLVQTGWALMGLLHAGQVERDLTPLRRAAKLLINSQLEN  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             GDFPQQ+ITG +MKNCMLHY  +R+ +PL AL+EYRKRV +S
Sbjct  717   GDFPQQEITGVFMKNCMLHYPMYRNIYPLWALAEYRKRVPLS  758



>ref|XP_009104558.1| PREDICTED: amyrin synthase LUP2-like [Brassica rapa]
Length=767

 Score =   900 bits (2326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/759 (55%), Positives = 547/759 (72%), Gaps = 14/759 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGF--TKQRQKGP  2419
             MWKLKIGEG G  PY+ STNN+ GRQ WE+DP AGTPEE+ A E+AR+ F   + R KG 
Sbjct  1     MWKLKIGEGNGEDPYLSSTNNFVGRQTWEFDPKAGTPEERAAVEEARRSFLVNRYRVKG-  59

Query  2418  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2239
               C DLF RMQ +KE+  + + IPPV++  +E + +E  T A+R+ V    ALQA DGHW
Sbjct  60    --CSDLFWRMQFLKEARFEQV-IPPVKIDGDEAITHENATNALRRGVSFFSALQASDGHW  116

Query  2238  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  2059
             P E +GPLFF PPL+  LYI+G ++ +   EH+KE++R++Y HQNEDGGWGL+++  S M
Sbjct  117   PGEITGPLFFLPPLVFCLYITGHLEKVFDEEHRKEMLRHVYCHQNEDGGWGLHVESKSIM  176

Query  2058  IGSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGC  1891
               +ALNY+ LR+LGE  D    +A  R R WIL  GG T IPSWGKI+LS+LG+Y+W G 
Sbjct  177   FCTALNYICLRILGEGPDGGRDNACKRARQWILDRGGVTYIPSWGKIWLSILGIYDWSGT  236

Query  1890  NPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPY  1711
             NP+PPE WL PS  P H AK   YCR  YMPMSYLY KR+ GP+T L+L +R+E+ ++PY
Sbjct  237   NPMPPEIWLLPSFLPIHLAKTLCYCRMVYMPMSYLYGKRFVGPITPLILQLRDELLLQPY  296

Query  1710  DQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMH  1534
             + I+WN TR    KED Y+PH ++QD++W+AL    EP + RWP NK +RE A R  + H
Sbjct  297   EAINWNKTRRLYAKEDMYFPHPWVQDLVWDALNVFVEPFLTRWPLNKLVREKACRLAMKH  356

Query  1533  MRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGS  1354
             + Y  E S YITIG +EK L M+  W ++P+ D  K HLAR+PD++W+AEDGM MQ+FGS
Sbjct  357   IHYEDENSHYITIGCVEKVLCMLACWIDNPHEDYFKKHLARIPDYMWVAEDGMKMQSFGS  416

Query  1353  QNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFS  1174
             Q WD  FA QA+++S  ++E  + LKK H Y+K SQ++ENP GDFKSMYRH SKGAW  S
Sbjct  417   QLWDTGFAVQAILASDFLDETSNVLKKGHDYIKLSQVRENPSGDFKSMYRHISKGAWTLS  476

Query  1173  DQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVW  994
             D+DHGW VSDCTAEA+KC LLL  M  E+ G+++D + +Y++V++ L  QS E GG   W
Sbjct  477   DRDHGWQVSDCTAEALKCCLLLSTMPSEVVGQQLDPEQIYDSVNLLLSFQS-EKGGVTAW  535

Query  993   EPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKA  814
             EP     ++E LNP+E  A++V + E+VE T S++ AL  F   YPD+R KE++ SI KA
Sbjct  536   EPVRAYEWIEFLNPTEFLANLVAEREYVECTSSVIQALVLFNQLYPDHRTKEISRSIEKA  595

Query  813   AEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQE  634
               YLE +Q+ DGSWYG WG+CF+Y T FAL GL AAG++YE S A+RK   F L  Q  +
Sbjct  596   VHYLENEQKPDGSWYGNWGVCFIYATWFALGGLAAAGKTYEKSLAMRKGVEFLLRTQKDD  655

Query  633   GGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQM  454
             GGWGE   SCP  +YIP EG +SN+VQT+WAMLGL++  QA RDP PLHRAAKL+IN+QM
Sbjct  656   GGWGESYLSCPEERYIPSEGKQSNLVQTAWAMLGLIHAGQAGRDPIPLHRAAKLIINSQM  715

Query  453   EDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             EDGDFPQQ+I G +MKNC++HYA++R+ FPL AL+EYRK
Sbjct  716   EDGDFPQQEIVGVFMKNCLIHYATYRNTFPLWALAEYRK  754



>ref|XP_002310349.1| beta-Amyrin synthase family protein [Populus trichocarpa]
 gb|EEE90799.1| beta-Amyrin synthase family protein [Populus trichocarpa]
Length=760

 Score =   900 bits (2326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/758 (56%), Positives = 548/758 (72%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EG     +YSTN + GRQ WEYDP+ G+PEE+   E+AR  F   R       
Sbjct  1     MWRLKIAEGVSSNELYSTNKFVGRQTWEYDPHGGSPEERAEVEEARLSFYNNRYH-VKPS  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  RMQ +KE       IP V + + EE+ YE  T A+++AV    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLKEKNFKQ-KIPQVIIEDGEEITYEKATNALKRAVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLFF PPL++ LYI+G +D + + EH++E++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NAGPLFFLPPLVMCLYITGHLDSVFSVEHRREILRYIYYHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              L+Y+ +R+LGE      D+A AR R WI  HG AT IPSWGK +LS+LGV++W G NP+
Sbjct  179   VLSYICMRILGEGPSGGQDNACARARKWIHDHGTATHIPSWGKTWLSILGVFDWSGSNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWL PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T LVL +R E+  +PY Q+
Sbjct  239   PPEFWLLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPVTPLVLQLREELFAEPYGQV  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W  TR  C  ED YYPH  IQD++W++L   TEP + RWPF+K +R+ A+   + H+ Y
Sbjct  299   NWRKTRHLCAAEDLYYPHPLIQDLVWDSLYVFTEPFLTRWPFHKLVRKKALEVTMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDP+ D  K HLAR+PD+LW+AEDGM MQ+FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLACWVEDPDGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  FA QAL++S   +E  D LK+ H ++K+SQ+K+NP GDFKSMYRH SKG+W FSDQD
Sbjct  419   DTGFAIQALLASNFTDEIIDVLKRGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LL   M PEI GE+++ + L+++V++ L LQS E+GG A WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLFSMMPPEIVGEQLEPERLFDSVNVLLSLQS-ENGGLAAWEPA  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               Q +LE+LNP+E FADIVV+ E+VE T S + AL  FK+ YP +R KE+   +  AA Y
Sbjct  538   GAQKWLELLNPTEFFADIVVEHEYVECTASAIQALLLFKNLYPGHRKKEIDNFVTNAARY  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE+ Q  +G WYG WG+CF YGT FAL GL AAG++Y    A+R+  +F L+ Q  +GGW
Sbjct  598   LESIQTPEGGWYGNWGVCFTYGTWFALGGLAAAGKTYSTCTAMRQGVNFLLNIQKDDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  KY+P EGNRSN+V T+WAM+GL++  Q +RD  PLHRAAKL+IN+Q+EDG
Sbjct  658   GESYLSCPKKKYVPLEGNRSNLVHTAWAMMGLIHAGQMDRDSAPLHRAAKLIINSQLEDG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DFPQQ+ITG +MKNCMLHYA++R+ +PL AL+EY++RV
Sbjct  718   DFPQQEITGVFMKNCMLHYAAYRNIYPLWALAEYQRRV  755



>ref|XP_006300770.1| hypothetical protein CARUB_v10019849mg [Capsella rubella]
 gb|EOA33668.1| hypothetical protein CARUB_v10019849mg [Capsella rubella]
Length=763

 Score =   900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/767 (54%), Positives = 556/767 (72%), Gaps = 14/767 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQ--RQKGP  2419
             MW+LKIGEG G  PY++S+NN+ GRQ WE+DP AGTPEE+   E++R+ F     R KG 
Sbjct  1     MWRLKIGEGNGENPYLFSSNNFVGRQTWEFDPKAGTPEERAVVEESRRNFVDNHSRVKG-  59

Query  2418  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2239
               C DL  RMQ + E++ + + IPPV++ + E + ++  T A+R+ V L  ALQA DGHW
Sbjct  60    --CSDLLWRMQFLGEAKFEQV-IPPVKIDDGEGITHDNATDALRRGVSLFSALQASDGHW  116

Query  2238  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  2059
             P E +GPLFF PPL+  LYI+G ++ +  +EH+KE++R++Y HQNEDGGWGL+I+ +S M
Sbjct  117   PGEITGPLFFLPPLVFCLYITGHLNKVFDAEHRKEMLRHIYCHQNEDGGWGLHIESNSMM  176

Query  2058  IGSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGC  1891
               + LNY+ LRLLGE  D    +A  R + WIL  GGAT IPSWGKI+LS+LG+Y+W G 
Sbjct  177   FCTVLNYICLRLLGEGPDGGRDNACKRAKQWILDRGGATYIPSWGKIWLSILGIYDWSGT  236

Query  1890  NPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPY  1711
             NP+PPE WL PS FP H  K+  YCR  YMPMSYLY KR+ GP+T L+L +R E+H++PY
Sbjct  237   NPMPPEIWLLPSFFPIHLGKVLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPY  296

Query  1710  DQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMH  1534
             + I+WN TR    KED Y+PH  +QD++W+AL    EP + RWP NK +RE A+R  + H
Sbjct  297   ESINWNKTRRLYAKEDMYFPHPLVQDLVWDALYVFVEPFLTRWPLNKLVREKALRLAMKH  356

Query  1533  MRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGS  1354
             + Y  E S YITIG +EK L M+  W EDPN D  K HLAR+PD++W+AEDGM MQ+FGS
Sbjct  357   IHYEDENSHYITIGCVEKVLCMLACWIEDPNGDYFKKHLARIPDYMWIAEDGMKMQSFGS  416

Query  1353  QNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFS  1174
             Q WD  FA QA+++S +  E G+ LKK H Y+K+SQ++ENP GDFK MYRH SKGAW  S
Sbjct  417   QLWDTGFAVQAILASDLSLETGNVLKKGHDYIKKSQVRENPSGDFKGMYRHKSKGAWTLS  476

Query  1173  DQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVW  994
             D+DHGW VSDCTAEA+KC LLL  M  E+ G+++D + LY++VD+ L  QS ++GG   W
Sbjct  477   DRDHGWQVSDCTAEALKCCLLLSMMPAEVVGQQMDPEQLYDSVDLLLSFQS-DNGGVTAW  535

Query  993   EPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKA  814
             EP     ++E+LNP+E  A++V + E+VE T S++ AL  FK  YP ++ KE++ SI KA
Sbjct  536   EPVRAYEWIELLNPTEFLANLVAEREYVECTSSVMQALVLFKQLYPGHKTKEISRSIEKA  595

Query  813   AEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQE  634
              ++L+ +Q+ DGSWYG WG+CF+Y T FAL GL AAG++Y+NS+AIRK   F L+ Q  +
Sbjct  596   VQFLDNEQRPDGSWYGNWGVCFIYATWFALGGLAAAGKTYQNSQAIRKGVEFLLTTQKDD  655

Query  633   GGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQM  454
             GGWGE   SCP  +YI   G  SN+VQT+WA++GL+   QAERDP PLHRAAKL+IN+QM
Sbjct  656   GGWGESYLSCPEQRYISTGGKSSNLVQTAWAIMGLINAGQAERDPIPLHRAAKLIINSQM  715

Query  453   EDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS*SH  313
             E+GDFPQQ+I G +MKNC++HYA++R+ FPL AL+EYRK  +++  H
Sbjct  716   ENGDFPQQEIVGVFMKNCLIHYATYRNTFPLWALAEYRKAAFVTHQH  762



>emb|CDY57947.1| BnaA07g38460D [Brassica napus]
Length=767

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/759 (55%), Positives = 547/759 (72%), Gaps = 14/759 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGF--TKQRQKGP  2419
             MWKLKIGEG G  PY+ STNN+ GRQ WE+DP AGTPEE+ A E+AR+ F   + R KG 
Sbjct  1     MWKLKIGEGNGEDPYLSSTNNFVGRQTWEFDPKAGTPEERAAVEEARRSFLVNRYRVKG-  59

Query  2418  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2239
               C DLF RMQ +KE+  + + IPPV++  +E + +E  T A+R+ V    ALQA DGHW
Sbjct  60    --CSDLFWRMQFLKEARFEQV-IPPVKIDGDEAITHENATNALRRGVSFFSALQASDGHW  116

Query  2238  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  2059
             P E +GPLFF PPL+  LYI+G ++ +   EH+KE++R++Y HQNEDGGWGL+++  S M
Sbjct  117   PGEITGPLFFLPPLVFCLYITGHLEKVFDEEHRKEMLRHVYCHQNEDGGWGLHVESKSIM  176

Query  2058  IGSALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGC  1891
               +ALNY+ LR+LGE      D+A  R R WIL  GG T IPSWGKI+LS+LG+Y+W G 
Sbjct  177   FCTALNYICLRILGEGPNGGRDNACKRARQWILDRGGVTYIPSWGKIWLSILGIYDWSGT  236

Query  1890  NPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPY  1711
             NP+PPE WL PS  P H AK   YCR  YMPMSYLY KR+ GP+T L+L +R+E+ ++PY
Sbjct  237   NPMPPEIWLLPSFLPIHLAKTLCYCRMVYMPMSYLYGKRFVGPITPLILQLRDELLLQPY  296

Query  1710  DQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMH  1534
             + I+WN TR    KED Y+PH ++QD++W+AL    EP + RWP NK +RE A R  + H
Sbjct  297   EAINWNKTRRLYAKEDMYFPHPWVQDLVWDALNVFVEPFLTRWPLNKLVREKACRLAMKH  356

Query  1533  MRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGS  1354
             + Y  E S YITIG +EK L M+  W ++P+ D  K HLAR+PD++W+AEDGM MQ+FGS
Sbjct  357   IHYEDENSHYITIGCVEKVLCMLACWIDNPHGDYFKKHLARIPDYMWVAEDGMKMQSFGS  416

Query  1353  QNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFS  1174
             Q WD  FA QA+++S +++E  + LKK H Y+K SQ++ENP GDFKSMYRH SKGAW  S
Sbjct  417   QLWDTGFAVQAILASDLLDETSNVLKKGHDYIKLSQVRENPSGDFKSMYRHISKGAWTLS  476

Query  1173  DQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVW  994
             D+DHGW VSDCTAEA+KC LLL  M  E+ G+++D + +Y++V++ L  QS E GG   W
Sbjct  477   DRDHGWQVSDCTAEALKCCLLLSTMPSEVVGQQLDPEQIYDSVNLLLSFQS-EKGGVTAW  535

Query  993   EPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKA  814
             EP     ++E LNP+E  A++V + E+VE T S++ AL  F   YPD+R KE++ SI KA
Sbjct  536   EPVRAYEWIEFLNPTEFLANLVAEREYVECTSSVIQALVLFNQLYPDHRTKEISRSIEKA  595

Query  813   AEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQE  634
               YLE +Q+ DGSWYG WG+CF+Y T FAL GL AAG++YE S A+RK   F L  Q  +
Sbjct  596   VHYLENEQKPDGSWYGNWGVCFIYATWFALGGLAAAGKTYEKSLAMRKGVEFLLRTQKDD  655

Query  633   GGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQM  454
             GGWGE   SCP  +YIP EG +SN+VQT+WAMLGL++  QA  DP PLHRAAKL+IN+QM
Sbjct  656   GGWGESYLSCPEERYIPSEGKQSNLVQTAWAMLGLIHAGQAGSDPIPLHRAAKLIINSQM  715

Query  453   EDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             EDGDFPQQ+I G +MKNC++HYA++R+ FPL AL+EYRK
Sbjct  716   EDGDFPQQEIVGVFMKNCLIHYATYRNTFPLWALAEYRK  754



>ref|XP_010048520.1| PREDICTED: LOW QUALITY PROTEIN: lupeol synthase-like [Eucalyptus 
grandis]
Length=755

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/756 (55%), Positives = 540/756 (71%), Gaps = 8/756 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI EGG P++ S NN+ GRQ WE+DP+AGTPEE+   E+ R  FT+ R +   +  
Sbjct  1     MWKLKIAEGG-PWLTSVNNHVGRQHWEFDPDAGTPEERAEVERVRDEFTRNRFRIKQS-A  58

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             DL MRMQ+ KE+    +  PPV++ E E+V  EA TT +R+A+    ++QA DGHWPAEN
Sbjct  59    DLLMRMQLTKENPSGPIP-PPVKVEEGEDVTEEAATTTLRRAISFYSSIQAHDGHWPAEN  117

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +GPLFF PP++ AL I+G+++ I + EHKKE+ RY+YNHQNEDGGWG +I+GHSTM GSA
Sbjct  118   AGPLFFFPPMVFALSITGAMNAIFSPEHKKEIKRYIYNHQNEDGGWGFHIEGHSTMFGSA  177

Query  2046  LNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             L+Y+ALRLLGE  DD    A+ARGR WIL HGG    PSWGK +L+VLGVYEW GCNP+P
Sbjct  178   LSYIALRLLGEGPDDGEDGAMARGRKWILDHGGLVGTPSWGKFWLAVLGVYEWAGCNPLP  237

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEFWL P  FP HP  M  YCR  YMPMSYLY +R+ GP+T L+LS+R E++ +PY++I+
Sbjct  238   PEFWLLPRKFPIHPGNMLCYCRLVYMPMSYLYGRRFVGPVTGLILSLRXELYTEPYNEIN  297

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             WN  R    KED YYPH  +QD+LW  L + TEP+++RWP + +RE A++  I H+ Y  
Sbjct  298   WNRARSTVAKEDLYYPHPLVQDMLWGFLHHVTEPVLKRWPLSMMREKALKVAIKHVHYED  357

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             E SRY+TIG +EK L M+  W EDPN +  K HLAR+PD+ W+AEDG+ MQTFG Q WDA
Sbjct  358   ENSRYLTIGCVEKVLCMVACWVEDPNSEAYKRHLARIPDYYWIAEDGLKMQTFGCQMWDA  417

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
              FA QA++S  + EEY   L+K H ++K SQ+++NP GDFK+MYRH SKGAW F+ QDHG
Sbjct  418   AFAIQAIMSGNLTEEYATTLRKGHDFVKASQVQDNPSGDFKAMYRHISKGAWTFAMQDHG  477

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCTAE +K  LL  QMSP++ GEK++ +  Y+AV++ L LQS  +GGF  WEP   
Sbjct  478   WQVSDCTAEGLKTALLFSQMSPDLVGEKMETERFYDAVNVILSLQS-SNGGFPAWEPQRA  536

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
               +LE  NP+E F + +++ E+VE T S +  L  FK  +P +R KE+   IA+A +Y+E
Sbjct  537   YAWLEKFNPTEFFEETLIEREYVECTSSAIQGLVLFKKLHPKHRRKEIDSCIARAIDYIE  596

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
               Q  DGSWYG WGIC+ YGT FA+ GL A G+SY N   +RKA  F LSKQ   GGWGE
Sbjct  597   HTQLPDGSWYGCWGICYTYGTWFAVEGLAACGKSYRNCTTVRKACEFLLSKQLPCGGWGE  656

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                S     Y   EGNR N+VQT+WA+L L+   QAE D TP+HR  K+LIN+QM+DGDF
Sbjct  657   SYLSSQNKVYTNLEGNRPNLVQTAWALLSLIDAGQAEIDATPIHRGVKVLINSQMDDGDF  716

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             PQQ+ITG +M+NC L+Y+S R+ FP+ AL EYR+RV
Sbjct  717   PQQEITGVFMRNCTLNYSSFRNIFPIWALGEYRRRV  752



>gb|AAX14716.1| beta-amyrin synthase [Aster sedifolius]
Length=761

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/757 (55%), Positives = 543/757 (72%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW++ I +GG  PY++STNNY GRQIWE+DPN GTPEE    E+AR  F   R K   T 
Sbjct  1     MWRMNIAKGGNDPYLFSTNNYVGRQIWEFDPNYGTPEELAEVEQARAEFWNNRHK-VKTS  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              D+  RMQ ++E      +IP V++ + EE+  E     +R+AV L  ALQA DGHWPAE
Sbjct  60    SDVLWRMQFLREKGFKQ-TIPQVKIEDGEEITDEKAKITLRRAVNLFSALQADDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GP +F  PL++ LY++G ++ + T E++KE++RY+Y HQNEDGGWG +I+GHS M  +
Sbjct  119   NAGPQYFMQPLVMCLYVTGHLNSVFTEEYRKEILRYMYCHQNEDGGWGFHIEGHSIMFCT  178

Query  2049  ALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              L+Y+ +RLLGE  D     A A+ R WIL HG ATA PSWGK +LS+LG+ EW G NP+
Sbjct  179   TLSYICMRLLGEGPDGGLNGACAKARKWILDHGTATANPSWGKTWLSILGLCEWSGTNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +RNEI ++PY +I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILELRNEIFLQPYHEI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +W + R    KED YYPH  +QD++W++L   TEP++ RWPFNK+RE A+R  + H+ Y 
Sbjct  299   NWKSIRHVVAKEDIYYPHPLLQDLMWDSLYIFTEPLLNRWPFNKLREKALRTTMNHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG++EK+L M+  W EDPN    K HLARVPD+LW+ EDGM MQ+FGSQ WD
Sbjct  359   DENSRYITIGSVEKALCMLSCWVEDPNGICFKKHLARVPDYLWVGEDGMKMQSFGSQEWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             A FA QAL+++ + EE G  LKK H ++K SQ+K+NP GDFKSM+RH SKG+W FSDQDH
Sbjct  419   AGFAIQALLATDLTEEIGSTLKKGHEFIKASQVKDNPSGDFKSMHRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +KC LL   M PEI GE +  + L +AV++ L LQS ++GG + WEP  
Sbjct  479   GWQVSDCTAEGLKCCLLFSNMPPEIVGEHMKPEQLKDAVNVILSLQS-KNGGLSAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE LNP+E FADIV++ E+VE T + + AL  FK  YP +R KE+   +  A  YL
Sbjct  538   SSDWLEYLNPTEFFADIVIEHEYVECTSASMQALVLFKKLYPGHRRKEIENFLPNACRYL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q   GSWYG WG+CF YGT FAL GLT+ G++YEN  AIRK   F L  Q ++GGWG
Sbjct  598   ENIQMPGGSWYGNWGVCFTYGTWFALGGLTSIGKTYENCPAIRKGVKFLLETQLKDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E  +S P  KY+P EG RSN+V T+WA++GL+++ Q ERDPTPLHRAAKL+IN+Q+E+GD
Sbjct  658   ESYKSSPEKKYVPLEGGRSNLVHTAWALMGLIHSRQEERDPTPLHRAAKLIINSQLENGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+I G +MKNCMLHYA +R  +P+ AL++YRK V
Sbjct  718   FPQQEIAGVFMKNCMLHYALYRDIYPMWALADYRKHV  754



>gb|AAG41762.1|AF099968_1 pentacyclic triterpene synthase [synthetic construct]
Length=763

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/757 (54%), Positives = 548/757 (72%), Gaps = 10/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLKIGEG G  PY++S+NN+ GRQ WE+DP AGTPEE+ A E AR+ +   R +    
Sbjct  1     MWKLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTPEERAAVEDARRNYLDNRPR-VKG  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             C DL  RMQ +KE++ + + IPPV++ + E + Y+  T A+R+AV    ALQ+ DGHWPA
Sbjct  60    CSDLLWRMQFLKEAKFEQV-IPPVKIDDGEGITYKNATDALRRAVSFYSALQSSDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +G LFF PPL+   YI+G ++ I  +EH+KE++R++Y HQNEDGGWGL+I+G S M  
Sbjct  119   EITGTLFFLPPLVFCFYITGHLEKIFDAEHRKEMLRHIYCHQNEDGGWGLHIEGKSVMFC  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + LNY+ LR+LGE  +    +A  R R WIL HGG T IPSWGKI+LS+LG+Y+W G NP
Sbjct  179   TVLNYICLRMLGEGPNGGRNNACKRARQWILDHGGVTYIPSWGKIWLSILGIYDWSGTNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPE WL PS FP H  K   Y R  YMPMSYLY KR+ GPLT L++ +R E+H++PY++
Sbjct  239   MPPEIWLLPSFFPIHLGKTLCYTRMVYMPMSYLYGKRFVGPLTPLIMLLRKELHLQPYEE  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+WN  R  C KED  YPH  +QD+LW+ L    EPI+  WP  K +RE A+R  + H+ 
Sbjct  299   INWNKARRLCAKEDMIYPHPLVQDLLWDTLHNFVEPILTNWPLKKLVREKALRVAMEHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E S YITIG +EK L M+  W E+PN D  K HLAR+PDF+W+AEDG+ MQ+FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDHFKKHLARIPDFMWVAEDGLKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++  + +E  D L+K H ++K+SQ++ENP GDFKSMYRH SKGAW  SD+
Sbjct  419   WDTVFAIQALLACDLSDETDDVLRKGHSFIKKSQVRENPSGDFKSMYRHISKGAWTLSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAEA+KC +LL  M  E+ G+K+D +  Y++V++ L LQ  E GG   WEP
Sbjct  479   DHGWQVSDCTAEALKCCMLLSMMPAEVVGQKIDPEQSYDSVNLLLSLQG-EKGGLTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
               PQ +LE+LNP++ F  ++ + E+VE T +++ AL  FK  YPD+R KE+  SI K  +
Sbjct  538   VRPQEWLELLNPTDFFTCVMAEREYVECTSAVIQALVLFKRLYPDHRTKEIIKSIEKGVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             ++E++Q  DGSW+G WGICF+Y T FAL GL AAG++Y++  A+RK   F L+ Q ++GG
Sbjct  598   FIESKQTPDGSWHGNWGICFIYATWFALSGLAAAGKTYKSCLAVRKGVDFLLAIQEEDGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +YIP EG+RSN+VQT+W M+GL++  QAERDPTPLHRAAKL+I++Q+E+
Sbjct  658   WGESHLSCPGQRYIPLEGDRSNLVQTAWGMMGLIHAGQAERDPTPLHRAAKLVISSQLEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             GDFP+Q+I G +MK CMLHYA++R+ FPL AL+EYRK
Sbjct  718   GDFPRQEILGVFMKTCMLHYATYRNIFPLWALAEYRK  754



>ref|XP_002887124.1| ATLUP2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63383.1| ATLUP2 [Arabidopsis lyrata subsp. lyrata]
Length=759

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/763 (54%), Positives = 549/763 (72%), Gaps = 14/763 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGF--TKQRQKGP  2419
             MW+LKIGEG G  PY++S+NN+ GRQ WE+DP AGT EE+   E AR+ F     R KG 
Sbjct  1     MWRLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTIEERATVEVARRSFLVNHSRVKG-  59

Query  2418  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2239
               C DL  RMQ +KE++ + + IPPV++ + E + +E  T A+R+ V    ALQA DGHW
Sbjct  60    --CSDLLWRMQFLKEAKFEQV-IPPVKIDDAEGITHENATDALRRGVSFFSALQASDGHW  116

Query  2238  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  2059
             P E +GPLFF PPL+  LYI+G ++ I   EH+KE++R++Y HQNEDGGWGL+I+  S M
Sbjct  117   PGEITGPLFFLPPLVFCLYITGHLEKIFDEEHRKEMLRHVYCHQNEDGGWGLHIESKSIM  176

Query  2058  IGSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGC  1891
               + LNY+ LR+LGE  +    +A  R R WIL  GG T IPSWGKI+LS+LG+Y+W G 
Sbjct  177   FCTVLNYICLRMLGEGPNGGRENACKRARQWILDRGGVTYIPSWGKIWLSILGIYDWSGT  236

Query  1890  NPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPY  1711
             NP+PPE WL PS  P H AK   YCR  YMPMSYLY KR+ GP+T L+L +R E+H++PY
Sbjct  237   NPMPPEIWLLPSFLPIHLAKTLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELHLEPY  296

Query  1710  DQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMH  1534
             + I+WN TR    KED Y+PH  +QD++W+AL    EP + RWP NK +RE A+R  + H
Sbjct  297   EAINWNKTRRLYAKEDMYFPHPLVQDLIWDALYLFVEPFLTRWPLNKLVREKALRLAMKH  356

Query  1533  MRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGS  1354
             + Y  E S YITIG +EK L M+  W E+PN D  K HLAR+PD++W+AEDGM MQ+FGS
Sbjct  357   IHYEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGS  416

Query  1353  QNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFS  1174
             Q WD  FA QA+++  +  E GD LK+ H Y+K+SQ++ENP GDFKSMYRH SKGAW  S
Sbjct  417   QLWDTGFAVQAILACDLSGETGDVLKRGHDYIKKSQVRENPSGDFKSMYRHISKGAWTLS  476

Query  1173  DQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVW  994
             D+DHGW VSDCTAEA+KC LLL  M  E+ G K+D + +Y++V++ L  QS ++GG   W
Sbjct  477   DRDHGWQVSDCTAEALKCCLLLSMMPAEVVGHKIDPEQIYDSVNLLLSFQS-DNGGVTAW  535

Query  993   EPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKA  814
             EP     ++E+LNP+E  A++VV+ E+VE T +++ AL  FK  YPD++ KE+  SI KA
Sbjct  536   EPVRAYKWIELLNPTEFLANLVVEREYVECTSAVIQALVLFKKLYPDHKTKEITRSIEKA  595

Query  813   AEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQE  634
               +LE +Q++DGSWYG WG+CF+YGT FAL GL AAG +Y+ S+A+RK   F L  Q  +
Sbjct  596   VHFLENEQRSDGSWYGNWGVCFIYGTWFALGGLAAAGETYKTSQAMRKGVEFLLRTQKDD  655

Query  633   GGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQM  454
             GGWGE   SCP  +YIP EG RSN+VQT+WA++GL++  QAERDP  LHRAAKL+IN+QM
Sbjct  656   GGWGESYLSCPEQRYIPLEGKRSNLVQTAWALMGLIHAGQAERDPITLHRAAKLIINSQM  715

Query  453   EDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWI  325
             E+GDFPQQ+I G +M+NC++HYA++R+ FPL AL+EYRK  ++
Sbjct  716   ENGDFPQQEIVGVFMRNCLIHYATYRNTFPLWALAEYRKAAFL  758



>ref|XP_010252186.1| PREDICTED: lupeol synthase-like [Nelumbo nucifera]
 ref|XP_010252187.1| PREDICTED: lupeol synthase-like [Nelumbo nucifera]
Length=755

 Score =   897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/756 (54%), Positives = 547/756 (72%), Gaps = 8/756 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI EGG P++ + NN+ GRQ WE+DP AGTPEE+   E+ R+ F K R +      
Sbjct  1     MWKLKIAEGG-PWLKTVNNHVGRQHWEFDPEAGTPEERAEVERVREEFRKNRFRQKQN-S  58

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             DL MRMQ+ KE+  + L++PPV++++ EE+  EA+TT +R+A+    ++QA DGHWP E 
Sbjct  59    DLLMRMQLTKENP-NKLNLPPVKVKDNEEITEEAVTTTLRRAISFYSSIQAHDGHWPGEI  117

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +GP+FF PPL+IALYI+G+++ +L+ EH+KE+ RYLYN QN+DGGWGL+++GHSTM  S 
Sbjct  118   AGPIFFLPPLVIALYITGALNTVLSPEHQKEIRRYLYNTQNKDGGWGLHVEGHSTMFSSV  177

Query  2046  LNYVALRLLGEEADDA----IARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             ++Y+ALRLLGE  DD     +AR R WIL HGGA  IPSWGK +++VLGVYEW G NP P
Sbjct  178   VSYIALRLLGEGPDDGEDMGMARVRKWILDHGGAVGIPSWGKFWVTVLGVYEWAGFNPTP  237

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEFWL P  FP HP KM  YCR  YMPMSYLY K++ GP+T+LVLS+R E++ KPY +ID
Sbjct  238   PEFWLLPKCFPIHPGKMLCYCRLVYMPMSYLYGKKFVGPITSLVLSLRQELYTKPYHEID  297

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             WN  R    KED YYPH  +QD+LW  L    EPI+ RWPF+ +RE A++  + H+ Y  
Sbjct  298   WNKARNTVAKEDLYYPHPLVQDMLWAFLYKVGEPILTRWPFSMLREKALKVAMEHVHYED  357

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             + SRY TIG +EK + ++  W EDPN +  K HLAR+PD+LW+AEDG+ MQ+FG Q WDA
Sbjct  358   KNSRYYTIGCVEKVICLLACWVEDPNSEAYKLHLARIPDYLWVAEDGIKMQSFGCQMWDA  417

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
              FA QA++SS ++EE+   L+KAH ++K SQ+KENP GDF  MYRH SKG W FS  DHG
Sbjct  418   GFAIQAILSSNLIEEFSPTLRKAHDFVKSSQVKENPSGDFSKMYRHISKGGWTFSTADHG  477

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCT+E +K  LL  Q+S EI GE+++++ +Y+AVD+ L LQS  +GGF  WEP   
Sbjct  478   WQVSDCTSEGLKVCLLFSQISSEIVGEQLEIERMYDAVDVILSLQS-SNGGFPAWEPQRA  536

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
               +LE+ NP+E F D +++ E+VE T S++ ALA FK  +P+YR KE+   I++A +Y+E
Sbjct  537   FRWLELFNPTEFFEDTLIETEYVECTSSVIQALALFKKLHPEYRKKEIEHCISRAIDYIE  596

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
               Q++DGSWYG WGICF YGT FA+  L A G++Y NS  I+KA  F LSKQ   GGWGE
Sbjct  597   KTQKSDGSWYGCWGICFTYGTWFAVEALVACGKNYYNSPHIQKACAFLLSKQLPSGGWGE  656

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                S     Y   EGNRSN+VQT+WAML L+   QAE DPTPLHR  ++LIN QME+GDF
Sbjct  657   SYLSATNKVYTNIEGNRSNLVQTAWAMLSLIDAGQAEIDPTPLHRGMRVLINTQMENGDF  716

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             PQQ+ITG +M+NC L YA +R+ FP+ A+++YR++V
Sbjct  717   PQQEITGVFMRNCTLQYAQYRNIFPIWAIAQYRRKV  752



>ref|XP_006377610.1| putative oxidosqualene cyclase family protein [Populus trichocarpa]
 gb|ERP55407.1| putative oxidosqualene cyclase family protein [Populus trichocarpa]
Length=755

 Score =   896 bits (2316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/756 (56%), Positives = 557/756 (74%), Gaps = 10/756 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKL++ +G GP+++STNN+ GRQIW++ P+ GTPEE    E AR+ F   R +      
Sbjct  1     MWKLEVADGDGPWLFSTNNFVGRQIWKFKPHVGTPEEHARVEIAREQFRSNRSRC-KASS  59

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             D+    Q+I+E+++D LSIPPVRL + EE+  E   TA+RKA+R   A QA DGHWPAE 
Sbjct  60    DVLKNFQLIQENQID-LSIPPVRLGDGEEITVEKAETALRKALRFTSATQASDGHWPAEF  118

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             SGPLF TPPL++ +Y+SGS++ +L+S+HKKE++RY+YNHQNEDGGWG +++GHSTM+G+A
Sbjct  119   SGPLFLTPPLIMVVYLSGSLNTVLSSDHKKEIIRYIYNHQNEDGGWGFHVEGHSTMMGTA  178

Query  2046  LNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             LNYVALRLLGE      D A+   R WIL HGG T +PSWGK+YLSVLG YEW GCNP+P
Sbjct  179   LNYVALRLLGEGPEGGRDGALTEARKWILDHGGVTMLPSWGKLYLSVLGTYEWSGCNPVP  238

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEF LFPS  PF P K+W + RT Y PM+YLY K++ GP+T+L+L +R+E++ +PY+++D
Sbjct  239   PEFLLFPSFLPFSPGKLWCHLRTVYTPMAYLYGKKFVGPITDLILQLRDELYNQPYEEVD  298

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             WN  R  C KED Y   +  ++++++ + Y +E ++R WPF+K+RE A+++ +  + Y  
Sbjct  299   WNKARHLCLKEDLYTSPSLAKNLIFDGVHYLSERVLRHWPFSKLREQALQEAMKLIHYED  358

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             E +RY+T  +IEKSL MM  WAEDP  D  K+HLARVPD LWLAEDGM MQ+ GSQ WDA
Sbjct  359   ENTRYMTHASIEKSLNMMACWAEDPTSDAFKFHLARVPDVLWLAEDGMKMQSIGSQLWDA  418

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
              FATQA+I+S +V+EYG  L++AH +LKQSQI+ N  GDF+ M+RH SKGAW  S +DHG
Sbjct  419   AFATQAVIASKLVDEYGSTLRRAHEFLKQSQIQANASGDFRRMHRHISKGAWTLSIKDHG  478

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCTAEA++ LLLL QM  EI GE +  + LY A+D  L LQS ++GGF+VWEP   
Sbjct  479   WQVSDCTAEALRALLLLSQMPSEIVGETIHTERLYNAIDFLLSLQS-KNGGFSVWEPARG  537

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
             Q +LE+LNP+E F D++V+ E+VE T S + AL  FK  +P YR+KE+  S+AKA+ Y+E
Sbjct  538   QRWLEVLNPTEAFGDMMVETEYVECTASAIQALVLFKRLHPGYRSKEIEASVAKASSYIE  597

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
               Q +DGSWYG WGIC+ YGT FAL GL + G++  NS  +RKA  F LSKQ+  GGWGE
Sbjct  598   DAQMSDGSWYGNWGICYTYGTYFALKGLASVGKTCRNSTTVRKACEFLLSKQHNSGGWGE  657

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                SC   +Y   E  +SNVVQT+WAM+GL++  QA  DP PLH+AA+LLIN+QME+G+F
Sbjct  658   SYLSCANSEYTEIE--KSNVVQTAWAMMGLIHAGQAS-DPAPLHQAARLLINSQMENGEF  714

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             PQQ ITG+ +K CMLHYAS ++  PL AL EYRK V
Sbjct  715   PQQQITGASLKTCMLHYASFKNILPLWALGEYRKCV  750



>ref|XP_010531947.1| PREDICTED: camelliol C synthase-like isoform X1 [Tarenaya hassleriana]
Length=762

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/760 (55%), Positives = 550/760 (72%), Gaps = 11/760 (1%)
 Frame = -3

Query  2586  MWKLKIGEG---GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2416
             MWKLKIGEG      Y+YSTNN+ GRQ WE+DP+A +PEE  A E++R+ F K R +   
Sbjct  1     MWKLKIGEGRKEDTDYLYSTNNFLGRQTWEFDPDAASPEELVAVEESRRNFFKNRSR-VK  59

Query  2415  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2236
                DL  RMQ +KE + + L IPPV++ + E++ +E +T A+R+ VRL  ALQ+ DGHWP
Sbjct  60    ASSDLLWRMQFLKEKKFEQL-IPPVKVGDAEKITHETLTNALRRGVRLFSALQSDDGHWP  118

Query  2235  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  2056
             AEN+GPLFF PPL+  LYI+G +D + T+EH+KE +RY+Y HQNEDGGWGL+I+GHSTM 
Sbjct  119   AENAGPLFFLPPLVFCLYITGYLDEVFTAEHRKEALRYIYCHQNEDGGWGLHIEGHSTMF  178

Query  2055  GSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              +ALNY+ +R+LGE  D    +A  R R WIL HGG T IPSWGK +LS+LGV++W G N
Sbjct  179   CTALNYICMRILGEGPDGGRENACRRARQWILGHGGVTYIPSWGKAWLSILGVFDWSGSN  238

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFW+ PS  P HPAKM   CR  YMP+SYLY KR+   +T L+L +R E++++PY+
Sbjct  239   PMPPEFWILPSFLPIHPAKMLCNCRMVYMPLSYLYGKRFAAQITPLILQLREELYLQPYE  298

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHM  1531
              I+WN  R  C K D YYPH  IQD++W+ L    EP + RWPFNK+ RE A++  + H+
Sbjct  299   TINWNKARHLCAKVDLYYPHPLIQDLIWDCLHTLMEPFLTRWPFNKLLREKALKVAMEHI  358

Query  1530  RYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQ  1351
              Y  E SRYIT+G +EK+L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ
Sbjct  359   HYEDENSRYITLGCVEKALCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQ  418

Query  1350  NWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSD  1171
              WD  FA QAL++S +  E  D LK+ H ++K SQ+ ENP  DFKSMYRH SKGAW FSD
Sbjct  419   LWDTGFAIQALLASNLSNEISDVLKRGHNFIKMSQVTENPSDDFKSMYRHISKGAWTFSD  478

Query  1170  QDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWE  991
             +DHGW VSDCTA+ +KC L+L  M P++ G K+D + LY++V+I L LQS ++GG   WE
Sbjct  479   RDHGWQVSDCTADGLKCCLMLSTMPPDMVGPKMDPERLYDSVNIILSLQS-KNGGVTAWE  537

Query  990   PPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAA  811
             P     +LE+ NP+E FAD +++ ++ E T S + AL  F+  YPD+R KE+   I KA 
Sbjct  538   PARAYGWLELFNPTEFFADTLIEYQYAECTSSAIQALVLFRKLYPDHRTKEINTFIEKAV  597

Query  810   EYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEG  631
             EY++  Q  +GSWYG WG+CF YGT FAL GL AAG++Y+N    RK  HF L+ Q   G
Sbjct  598   EYIQRMQMPNGSWYGSWGVCFTYGTWFALAGLAAAGKTYDNCLVTRKGVHFLLTTQKDNG  657

Query  630   GWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQME  451
             GWGE   SCP  +Y+  +G +SN+VQTSWAM+GL+++ Q ERDP PLHRAAKL+IN+Q+E
Sbjct  658   GWGESYLSCPEKRYVQLDGEKSNLVQTSWAMMGLLHSGQGERDPEPLHRAAKLIINSQLE  717

Query  450   DGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
              GDFPQ +ITG++MKNCMLHY+++R+ FPL AL+EYR+RV
Sbjct  718   SGDFPQHEITGAFMKNCMLHYSAYRNTFPLWALAEYRRRV  757



>ref|XP_010472735.1| PREDICTED: amyrin synthase LUP2 isoform X2 [Camelina sativa]
Length=760

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/767 (54%), Positives = 554/767 (72%), Gaps = 17/767 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LKIGEG G  PY++S+NN+ GRQ WE+DP AGTPEE+ A E+AR+ F   R +    
Sbjct  1     MWRLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTPEERAAVEEARRKFVDNRSR-VKG  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             C DL  RMQ +KE++ + + IPPV++ + E + ++  T A+R+ V    ALQA DGHWP 
Sbjct  60    CSDLLWRMQFLKEAKFEQV-IPPVKIDDGEGITHQNATDALRRGVSFFSALQASDGHWPG  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +GPLFF PPL+  LYI+G ++ +  +EH+KE++R++Y HQNEDGGWGL+I+  S M  
Sbjct  119   EITGPLFFLPPLVFCLYITGHLEKVFDAEHRKEMLRHIYCHQNEDGGWGLHIESKSMMFC  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ LRLLGE  D    +A  R R+WIL  GG T IPSWGKI+LS+LG+Y+W G NP
Sbjct  179   TALNYICLRLLGEGPDGGRDNACKRARDWILDRGGVTYIPSWGKIWLSILGIYDWSGTNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPE WL PS  P H  K+  YCR  YMPMSYLY KR+ GP+T L+L +R E+H++PY  
Sbjct  239   MPPEIWLLPSFLPIHLGKVLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELHLQPYKS  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+WN +R    KED Y+PH  +QD++W+AL    EP + RWP NK +RE A+R+ + H+ 
Sbjct  299   INWNKSRRLYAKEDMYFPHPLVQDLVWDALYVFVEPFLTRWPLNKLVREKALRRAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E S YITIG +EK L M+  W E+PN D  K HLAR+PD++W+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQS--QIKENPKGDFKSMYRHFSKGAWAFS  1174
             WD  FA QA+++S + +E G C+     +L Q   QI+ENP GD++SMYRH SKGAW  S
Sbjct  419   WDTGFAVQAILASDLSDETGGCV-----FLNQRTLQIRENPSGDYESMYRHISKGAWTLS  473

Query  1173  DQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVW  994
             D+DHGW VSDCTAEA KC LLL  M  E+ G+K+D + LY++V++ L  QS + GG   W
Sbjct  474   DRDHGWQVSDCTAEAFKCCLLLSMMPAEVVGQKMDPEQLYDSVNLLLSFQS-DKGGMTAW  532

Query  993   EPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKA  814
             EP     ++E+LNP+E  A++VV+ E+VE T S++ AL  FK  YPD++ KE++ SI KA
Sbjct  533   EPVRAYEWIELLNPTEFLANLVVEREYVECTSSVMKALVLFKQLYPDHKTKEISRSIEKA  592

Query  813   AEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQE  634
              ++LE +Q+ DGSWYG+WG+CF+Y T F L GL AAG++Y+NS+AIRK   F L+ Q  +
Sbjct  593   VQFLENEQRPDGSWYGFWGVCFIYATWFGLGGLAAAGKTYQNSQAIRKGVEFLLTTQKDD  652

Query  633   GGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQM  454
             GGWGE   SCP  +YIP EG  SN+VQT+WA++GL+   QAERDP PLHRAAKL+IN+QM
Sbjct  653   GGWGESYLSCPEQRYIPSEGKSSNLVQTAWAIMGLINAGQAERDPIPLHRAAKLIINSQM  712

Query  453   EDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS*SH  313
             E+GDFPQQ+I G +MKNC+ HYA++R+ FPL AL+EYRK V+++  H
Sbjct  713   ENGDFPQQEIVGVFMKNCLTHYATYRNTFPLWALAEYRKAVFVTHQH  759



>ref|XP_007023363.1| Terpenoid cyclases family protein [Theobroma cacao]
 gb|EOY25985.1| Terpenoid cyclases family protein [Theobroma cacao]
Length=1130

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/758 (55%), Positives = 551/758 (73%), Gaps = 8/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKIGEGG  PY+YSTNNY GRQ WE+DPNAGTP+E+   E+ R+ +   R K     
Sbjct  1     MWRLKIGEGGNDPYLYSTNNYLGRQTWEFDPNAGTPKERAEVEEVRQNYYNNR-KHVQPS  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  ++Q ++E      +IP  ++ + EE+ +EA T AVR++V    ALQ+KDGHWPAE
Sbjct  60    SDLLWQIQFLREKNFKQ-TIPQPKVEDGEEITFEATTAAVRRSVHFFSALQSKDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GP+F+ PPL+++LYI+G +  I  +EH+KE++RY+Y HQNEDGGWGLYI GHSTM  +
Sbjct  119   NAGPMFYFPPLVMSLYITGHLHTIFFAEHRKEILRYIYCHQNEDGGWGLYIGGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             ALNY+ +RLLGE  D    +A  R R WIL  GG T IPSWGK +LS+LGVYEW GC+PI
Sbjct  179   ALNYICMRLLGEGPDGGLNNACERSRKWILDRGGVTTIPSWGKTWLSILGVYEWSGCHPI  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWL PS+FP HPAKM+ YCR TYMPMSYLY +++ GP+T L++ +R E+H++PY++I
Sbjct  239   PPEFWLLPSYFPIHPAKMFCYCRLTYMPMSYLYGRKFVGPITPLIVQLREELHIEPYNEI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +W+  R  C KED +YPHT +Q  LW++L   TEP++  WPFNK+RE A++  + H+ Y 
Sbjct  299   NWSKKRHLCAKEDLHYPHTMLQIFLWDSLYIFTEPLLNCWPFNKLREKALKVTMNHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E S+YITIG +EK L M+  W EDPN    K HLAR+ D++W+ EDG+ MQ+FGSQ WD
Sbjct  359   DESSQYITIGCVEKPLCMLACWVEDPNGVYFKKHLARIADYVWVGEDGIKMQSFGSQVWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             A+   QAL++S + +E G  L K H +LK SQ+++NP  DFK M+RH SKG+W FSD+DH
Sbjct  419   ASLTLQALLASQLFDEIGPILMKGHNFLKNSQVRDNPPSDFKRMFRHISKGSWTFSDRDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE++KC L    M PE+ GEK++++  Y++V++ L LQS E+GG + WEP  
Sbjct  479   GWQVSDCTAESLKCCLYFAMMPPEMVGEKMELKQFYDSVNVILSLQS-ENGGLSAWEPTG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                + E LNP E   D+V + E+VE T S + AL  F+  YP+++ +E+A  I+KAA++L
Sbjct  538   GGFWWEWLNPVEFLEDLVKEYEYVECTSSSIQALVLFQKLYPEHKKREIANFISKAAQFL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WGICF+YGT F L GL AAG++Y N  AIRK   F L  Q ++GGWG
Sbjct  598   EEIQYPDGSWYGNWGICFIYGTWFGLQGLKAAGKTYNNCLAIRKGVDFLLKTQREDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP   YIP EGNR+N+VQT+ A++GL+   QAERDPTPLHRAAKLLIN+Q+ +GD
Sbjct  658   ESYLSCPKRVYIPSEGNRTNLVQTALALMGLIIGGQAERDPTPLHRAAKLLINSQLPNGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVW  328
             FPQQ++ G +M+NCMLHYA +R+ FPL AL+EY K  W
Sbjct  718   FPQQELAGVFMRNCMLHYALYRNVFPLWALAEYCKHFW  755



>ref|XP_007023364.1| Beta-Amyrin Synthase [Theobroma cacao]
 gb|EOY25986.1| Beta-Amyrin Synthase [Theobroma cacao]
Length=761

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/757 (55%), Positives = 544/757 (72%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+L IGEGG  PYIYSTNNY GRQ WE+DPNAGTPEE+   E+ R+ +   R K     
Sbjct  1     MWRLTIGEGGNNPYIYSTNNYLGRQTWEFDPNAGTPEERAEVEEVRQNYYNNR-KHVRPS  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  ++Q +KE      +IPPV++++ EE+  E  T A+R+ V L  ALQA DGHWPAE
Sbjct  60    SDLLWQIQSLKEKNFKQ-TIPPVKIKDGEEITCETATAALRRGVHLLSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             NSGP+F+ PPL +ALYI+G ID + ++EH+KE++RY+Y HQNEDGGWGL+I+GHS M  +
Sbjct  119   NSGPMFYFPPLAMALYITGHIDTVFSAEHRKEILRYIYCHQNEDGGWGLHIEGHSIMFST  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             ALNY+ +RLLGE  D    +A  R R WIL  GG T IPSWGK +LS+LG+++W GC+P+
Sbjct  179   ALNYICMRLLGEGPDGGQDNACKRARKWILDRGGVTTIPSWGKTWLSILGLFDWSGCHPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS+FP HPAKMW YCR TY+PMSYLY K++ GP+T L+L +R E+H++PY +I
Sbjct  239   PPEFWVLPSYFPIHPAKMWCYCRITYLPMSYLYGKKFVGPITPLILQLREELHIEPYHKI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +W   R  C +ED YYPHT +Q +LWN+L   TEP++ RWP NK+RE A++K + H+ Y 
Sbjct  299   NWRQKRHLCAEEDLYYPHTVLQMLLWNSLSTFTEPLLSRWPLNKLREKALQKTMDHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W E+P  D  K HLAR+ D+LW+ EDGM MQ+FGSQ WD
Sbjct  359   DECSRYITIGGVEKPLCMLACWLENPTGDYFKKHLARIADYLWVGEDGMKMQSFGSQVWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             ++FA QAL++S +  +    L K H +LK SQ+K+NP GDFK M+RH SKG+W FSDQDH
Sbjct  419   SSFALQALLASDLTNDIRPTLMKGHDFLKHSQVKDNPPGDFKRMFRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE++KC L   +M PE  GEK++ +  Y+AV++ + LQS ++GGF+ WEP  
Sbjct  479   GWQVSDCTAESLKCCLYFSKMPPETVGEKMEPEKFYDAVNVIISLQS-QNGGFSGWEPAT  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                ++E LNP E   D V++ E+ E T S + AL  F   YP +R KE    IAKA  +L
Sbjct  538   AGLWMEWLNPVEFLDDNVIEHEYTECTASAIQALVLFTESYPGHRGKETEKCIAKAVLFL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q+ DGSWYG WGICF YGT FAL GL AAG++Y N  A+RK   F L  Q  +GGWG
Sbjct  598   ENVQKPDGSWYGSWGICFTYGTWFALGGLAAAGKNYNNCLAVRKGLDFLLETQTDDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP   Y P EGNRSN+V T+ A++GL++  QA+RDP PLHRAAKLLIN+Q+ DGD
Sbjct  658   ESYLSCPKEVYTPLEGNRSNLVHTAMALMGLIHGGQAKRDPNPLHRAAKLLINSQLPDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ++ G +M NCMLHYAS+R+ FP  AL+EYRK V
Sbjct  718   FPQQEMMGVFMSNCMLHYASYRNTFPTWALAEYRKHV  754



>dbj|BAE53430.1| lupeol synthase [Lotus japonicus]
Length=755

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/757 (55%), Positives = 546/757 (72%), Gaps = 10/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLK+ EGG   + S +N+ GRQ W +DPNAGTP+E E  E+ R+ FTK R     +  
Sbjct  1     MWKLKVAEGGKGLV-SVSNFIGRQHWVFDPNAGTPQEHEEIERMRQEFTKNRFSIKQS-A  58

Query  2406  DLFMRMQMIKESEVDVLSIPP-VRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             DL MRMQ+ KE+      IPP V+LR+ E+V  EA+ T +R+++    ++QA DGHWPAE
Sbjct  59    DLLMRMQLRKENPCG--PIPPAVKLRDVEKVTAEALITTIRRSITFYSSIQAHDGHWPAE  116

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             ++GPLFF  PL++ALYI+GS+D +L  +HKKE++RYLYNHQNEDGGWG +I+GHSTM GS
Sbjct  117   SAGPLFFVQPLVMALYITGSLDDVLGPQHKKEIIRYLYNHQNEDGGWGFHIEGHSTMFGS  176

Query  2049  ALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ALR+LG+  +D    A+ARGR WIL HGG  AIPSWGK +++VLGVYEW GCNP+
Sbjct  177   ALSYIALRVLGQSLEDGEDMAVARGRKWILDHGGLVAIPSWGKFWVTVLGVYEWSGCNPL  236

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWL P  FP HP KM  YCR  YMPMSYLY K++ GP+T LV S+R E++ +PYD++
Sbjct  237   PPEFWLLPKIFPIHPGKMLCYCRLVYMPMSYLYGKKFVGPITALVRSLRKELYNEPYDRV  296

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             DWN  R    KED YYPH  IQD+LW  L +  E ++  WPF+ +R+ A+   I H+RY 
Sbjct  297   DWNKARNTVAKEDLYYPHPLIQDMLWGFLHHVGERVLNTWPFSMLRQKAIEVAINHVRYE  356

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E +RY+ IG++EK L ++  W EDPN +  K HLAR+PD+ WLAEDG+ +Q+FG Q WD
Sbjct  357   DETTRYLCIGSVEKVLYLIARWVEDPNSEAYKLHLARIPDYFWLAEDGLKIQSFGCQMWD  416

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             A FA QA++S  + EEYG  LKKAH ++K SQ++ENP GDFK+MYRH SKGAW FS  DH
Sbjct  417   AAFAIQAILSGNVSEEYGPTLKKAHHFVKASQVRENPSGDFKAMYRHISKGAWTFSMHDH  476

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +K  LLL +MS ++ G K++ +  Y+AV++ L LQS  +GGF  WEP  
Sbjct  477   GWQVSDCTAEGLKVALLLSEMSDDLVGAKMETEQFYDAVNVILSLQS-SNGGFPAWEPQR  535

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE  NP+E F + +++ E+VE TGS + ALA F+  YP +R KE+   I+KA  Y+
Sbjct  536   AYQWLEKFNPTEFFEETLIEREYVECTGSAMQALALFRKLYPKHRRKEIDRCISKAIRYI  595

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WGIC+ YGT FA+ GLTA G++++NS  +R+A  F LSKQ   GGWG
Sbjct  596   ENTQNPDGSWYGCWGICYTYGTWFAVEGLTACGKNFQNSVTLRRACKFLLSKQLPNGGWG  655

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   S     Y   EG R+N+VQ+SWA+L LM   QAE DPTP+HR  +LLIN+QM+DGD
Sbjct  656   ESYLSSQDKVYTNIEGKRANLVQSSWALLSLMRAGQAEIDPTPIHRGIRLLINSQMDDGD  715

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+ITG +M+NC L+Y+S+R+ FP+ AL EYR+RV
Sbjct  716   FPQQEITGVFMRNCTLNYSSYRNIFPIWALGEYRRRV  752



>ref|XP_003521102.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Glycine max]
 ref|XP_006576766.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Glycine max]
Length=762

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/758 (54%), Positives = 547/758 (72%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI +GG  PYI+STNN+ GRQ WE+DP AGTPEE+   E AR+ F   R K    C
Sbjct  1     MWRLKIADGGKDPYIFSTNNFVGRQTWEFDPEAGTPEERAQVEAARQNFYNNRFKF-KAC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  R Q+++E+     +I  V++ + EE+ YE +T  + +A    CALQ  DGHWPA+
Sbjct  60    GDLLWRFQILRENNFKE-TISSVKIEDGEEITYEKVTATMTRAAHYLCALQTSDGHWPAQ  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              +G +FF PPL+  +YI+G +D +   E+KKE++RY+Y HQNEDGGWGL+I+GHS M  +
Sbjct  119   IAGAMFFVPPLVFCMYITGHLDSVFPEEYKKEILRYMYYHQNEDGGWGLHIEGHSNMFCT  178

Query  2049  ALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             ALNY+ +R+LGE      D+A AR R WI  HGG T IPSWGK +LS+LGVY+W G  P+
Sbjct  179   ALNYICMRVLGEGPNGGHDNACARARKWIHDHGGVTHIPSWGKTWLSILGVYDWYGSKPV  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HP+K+W YCR TY+PMSYLY KR+ GP+T L+L +R E+  +PY+++
Sbjct  239   PPEFWVLPSFLPMHPSKIWCYCRLTYLPMSYLYGKRFVGPITPLILQLREELFTQPYEKV  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W   R  C KED Y+PH+ IQD++W++L    EP++ RWPFNK +RE A++  + H+ Y
Sbjct  299   NWKKARNQCAKEDRYHPHSLIQDLVWDSLYIFIEPLLTRWPFNKLVREKALQVTMKHILY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK+L M+  W EDPN D  K HLARVPD+LW++EDGM MQ+FGSQ W
Sbjct  359   EDENSRYITIGCVEKALYMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMAMQSFGSQGW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA+   QAL+++ ++EE G  L KAH ++K++Q+K++P GDFKSMYRH SKG+W FSDQD
Sbjct  419   DASLVIQALLATNLMEEIGPTLAKAHDFIKKTQVKDDPLGDFKSMYRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
              GW VSDCTAE + C LLL  +  EI GEK++ Q LY++V+I L LQS   GG A WEP 
Sbjct  479   QGWQVSDCTAETLNCCLLLSILPSEIVGEKMEPQRLYDSVNILLSLQS-RKGGLAAWEPS  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
               Q +LE+LNP+E   +IVV+ ++ E TGS + AL  FK  YP +R KE+  SIA A ++
Sbjct  538   GTQEWLEILNPTEFLGNIVVEHDYAECTGSAIQALVLFKKLYPRHREKEIKNSIANAVQF  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q A+GSWYG WG+C++YGT FAL GL AAG++Y N  AIRK   F LS Q ++GGW
Sbjct  598   LEDTQTANGSWYGSWGVCYIYGTWFALRGLAAAGKTYTNCAAIRKGVKFLLSTQKEDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP   Y+P EG+RS VV T+WA+LGL+   QAERD T LHRAAKLLIN+Q+++G
Sbjct  658   GESYLSCPKQIYVPLEGSRSTVVHTAWALLGLILAGQAERDTTSLHRAAKLLINSQLKEG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             D+PQQ++TG + + CMLHY  +R+ +P+ AL+EYR+ V
Sbjct  718   DWPQQELTGVFNRTCMLHYPMYRNIYPMWALAEYRRLV  755



>gb|ACO24697.1| beta-amyrin synthase [Gentiana straminea]
Length=755

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/758 (56%), Positives = 550/758 (73%), Gaps = 10/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGF-TKQRQKGPHT  2413
             MW+LKIGEGG  P +YSTNNY GRQIWEYD NAG  EE+E  E+AR+ F   +R   P +
Sbjct  1     MWRLKIGEGGNDPNLYSTNNYVGRQIWEYDRNAGIAEEREEVEEARRNFWNNRRHVKPSS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               D+  R+Q ++E      SIP V++ + +E+N++  TTA+R+AV L  ALQ+ DGHWPA
Sbjct  61    --DILWRLQFLREKNFKQ-SIPAVKVDDGQEINHQMATTALRRAVHLLSALQSSDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+G LFF PPL+I LYI+G ++ I  +EH  E++RYLY HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGSLFFLPPLIICLYITGHLNNIFPTEHTHEILRYLYCHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ +R+LGE  D    +A AR R WIL HG  TAIPS GK +LS+LG+Y+W G NP
Sbjct  178   TALNYICMRILGEGPDGGKENACARARKWILDHGSVTAIPSLGKAWLSILGLYDWSGTNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPE W  PS    HP KM  YCR  YMPMSYLY KR+   +T L+  +R E+H +PY+Q
Sbjct  238   MPPEIWSLPSSLSIHPGKMGCYCRMVYMPMSYLYGKRFVCRITPLISELREELHCEPYNQ  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I W   R  C KED YYPH  IQD++W+    CTEP+   WP NK+R  A+   + H+ Y
Sbjct  298   IRWKRYRHVCAKEDLYYPHPLIQDLIWDFFYICTEPLFTHWPVNKLRAKALDATMKHIHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYIT+G++EK L M+  W EDPN D  + HLAR+PD++W+AEDGM MQ+FGSQ W
Sbjct  358   EDENSRYITVGSVEKVLCMLACWVEDPNGDYFQKHLARIPDYIWVAEDGMKMQSFGSQLW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  FA QAL++S M EE  D L+K H ++K SQ+KENP GDFKSMYRH SKG+W FSDQD
Sbjct  418   DICFAIQALLASDMTEEITDTLRKGHDFIKNSQVKENPSGDFKSMYRHMSKGSWTFSDQD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LLL  M  EI GE+++++ +Y+AV+I L LQS ++GG   WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLLSTMPQEIVGERIELERIYDAVNILLSLQS-KNGGLPGWEPV  536

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LE+LNP++ FAD+V++ EH E T S + AL  FK  YP++  KE+   I  A+ Y
Sbjct  537   RASDWLELLNPTDSFADLVIEHEHAECTASAIDALVLFKKLYPNHMTKEIESFITNASNY  596

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE  Q  DGSWYG WG+CF+YGT FAL GL A+G++Y N + +RKA +F L+ Q ++GGW
Sbjct  597   LEDVQMPDGSWYGNWGVCFIYGTWFALRGLAASGKTYNNCQVVRKAVNFLLTTQQKDGGW  656

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP MKYIP EGNRSN+V T+WAM+GL+++ QA+RDPTPLH AAKLLIN+Q+E+G
Sbjct  657   GESYRSCPEMKYIPLEGNRSNLVHTAWAMMGLIHSGQAKRDPTPLHCAAKLLINSQLENG  716

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DFPQQ+I G + KN MLH+AS+RS +PL AL+EYRK+V
Sbjct  717   DFPQQEIAGVFFKNGMLHFASYRSIYPLWALAEYRKQV  754



>ref|XP_002889222.1| hypothetical protein ARALYDRAFT_316793 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65481.1| hypothetical protein ARALYDRAFT_316793 [Arabidopsis lyrata subsp. 
lyrata]
Length=1556

 Score =   894 bits (2310),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/759 (56%), Positives = 547/759 (72%), Gaps = 10/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLKI  G    PY++STNN+ GRQ WE+DP+AG  EE  A E+AR+ +   R +    
Sbjct  1     MWKLKIANGNKEEPYLFSTNNFLGRQTWEFDPDAGIAEELAAVEEARRKYFDDRFQ-VKA  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ +KE + + + IPPV++ +  ++  E  T A+R+ V    ALQA DGHWPA
Sbjct  60    SSDLIWRMQFLKEKKFEQV-IPPVKVEDANKITSEIATNALRRGVNFLSALQATDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL+  L+++G +  I T EH++E++RY+Y HQNEDGGWGL+I+G STM  
Sbjct  119   ENAGPLFFLPPLVFCLFVTGHLHEIFTQEHRREILRYIYCHQNEDGGWGLHIEGDSTMFC  178

Query  2052  SALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + LNY+ +R+LGE       +A  R R+WIL HGGAT IPSWGK +LS+LGV++W G NP
Sbjct  179   TTLNYICMRILGESPFGGPGNACRRARDWILDHGGATYIPSWGKTWLSILGVFDWSGSNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP++ L+L +R EI+++PY +
Sbjct  239   MPPEFWILPSFLPIHPAKMWCYCRLVYMPMSYLYGKRFVGPISPLILQLREEIYLQPYAK  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHMR  1528
             I+WN  R  C KED Y PH  IQDV+W+ L   TEP +  WPFNK+ RE A+   + H+ 
Sbjct  299   INWNRARHLCAKEDAYCPHPQIQDVIWDCLYIFTEPFLTCWPFNKLLREKALGVAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK+L M+  W EDPN    K HL R+ D+LW+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSRYITIGCVEKALCMLACWVEDPNGSHFKKHLLRISDYLWIAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD+ FA QAL++S +  E  D L++ + +LK SQ++ENP GDF +M+RH SKG+W FSD+
Sbjct  419   WDSGFALQALVASDLANEIPDVLRRGYDFLKNSQVRENPSGDFTNMFRHISKGSWTFSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW  SDCTAE  KC LLL  M P+I G K+D + LYEAV I L LQS ++GG   WEP
Sbjct  479   DHGWQASDCTAEGFKCCLLLSMMPPDIVGPKMDPEQLYEAVTILLSLQS-KNGGVTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP+E+FADIVV+ E+ E T S + AL  FK  YP++R  E+  SI KA +
Sbjct  538   ARGQEWLELLNPTEVFADIVVEHEYNECTSSAIQALILFKQLYPNHRTAEINTSIKKAVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             Y+E+ Q  DGSWYG WG+CF Y T F L GL AAG++Y N  A+RK  HF L+ Q   GG
Sbjct  598   YIESIQMHDGSWYGSWGVCFTYSTWFGLGGLAAAGKTYNNCLAMRKGVHFLLTTQKDNGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +YIP EG+RSN+VQTSWAM+GL++  QAERDP PLHRAAKLLIN+Q+E+
Sbjct  658   WGESYLSCPKKRYIPSEGDRSNLVQTSWAMMGLLHAGQAERDPAPLHRAAKLLINSQLEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG++MKNC+LHYA++R+ FP+ AL+EYR+RV
Sbjct  718   GDFPQQEITGAFMKNCLLHYAAYRNIFPVWALAEYRRRV  756


 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/782 (53%), Positives = 542/782 (69%), Gaps = 32/782 (4%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LKIGEG G  PY+++TNN+ GRQ WE+DP+AG+PEE+ A  +AR+ F   R      
Sbjct  774   MWRLKIGEGSGDDPYLFTTNNFVGRQTWEFDPDAGSPEERYAVVEARQSFYDNRFH-VKA  832

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ +KE + + + I PV++   E+V +E  T A+R+ V    ALQA DGHWPA
Sbjct  833   SSDLLWRMQFLKEKKFEQV-IAPVKVEGSEKVTFETATNALRRGVHFFSALQASDGHWPA  891

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL+  LYI+G +D + T EH+KE++RY+Y HQ EDGGWGL+I+GHSTM  
Sbjct  892   ENAGPLFFLPPLVFCLYITGHLDEVFTLEHRKEILRYIYCHQKEDGGWGLHIEGHSTMFC  951

Query  2052  SALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ +R+LGE      ++A  R R WIL HGG T IPSWGK +LS+LGV++W G NP
Sbjct  952   TALNYICMRILGESPVGGHENACRRAREWILSHGGVTYIPSWGKTWLSILGVFDWSGSNP  1011

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS FP HPAKMW YCR  Y+PMSYLY KR+ GP+T+L+L +R E++++PY++
Sbjct  1012  MPPEFWILPSFFPVHPAKMWCYCRMVYLPMSYLYGKRFVGPITSLILQLRKELYLQPYEE  1071

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W   R  C KEDTYYP   +Q+++W++L    EP + RWPFNK +R+ A++  + H+ 
Sbjct  1072  INWMKVRHLCAKEDTYYPRPLVQELIWDSLYIFAEPFLGRWPFNKFLRQKALQVTMKHIH  1131

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDPN +  K HLAR+ D+LW+AEDGM MQ+FGSQ 
Sbjct  1132  YEDENSRYITIGCVEKVLCMLACWVEDPNGNYFKKHLARISDYLWVAEDGMKMQSFGSQL  1191

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S +  E  D L++ H ++K SQ+ ENP GDF+SMYRH SKGAW FSD+
Sbjct  1192  WDTGFALQALLASNLSSEISDVLRRGHEFIKDSQVGENPSGDFRSMYRHISKGAWTFSDR  1251

Query  1167  DHGWVVSDCTAEAIKC--------LLLLGQMSPEIAG---EKVDVQCLYEAVDICLYLQ-  1024
             DHGW VSDCTA+ +K         L LL  +     G    K D + LY++V+I L LQ 
Sbjct  1252  DHGWQVSDCTADGLKVIQPFKPNTLTLLPAVLDAGTGYCCPKQDPERLYDSVNILLTLQV  1311

Query  1023  -----------SPESGGFAVWEPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALA  877
                          ++GG + WEP     +LE+LNP+ELF+DIV++ E+ E T S + AL+
Sbjct  1312  SIIGRDSFTCFQSKNGGVSAWEPAGAPEWLELLNPTELFSDIVIEHEYSECTSSAIQALS  1371

Query  876   AFKHDYPDYRAKEVAMSIAKAAEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRS  697
              FK  +P +R  E+   I KA  YLE+ Q  DGSWYG WGICF YGT FAL GLTAAG++
Sbjct  1372  LFKQLFPHHRTTEITTFINKAVHYLESMQTPDGSWYGNWGICFTYGTWFALAGLTAAGKT  1431

Query  696   YENSEAIRKAAHFFLSKQNQEGGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTE  517
             Y + EAIRK   F L  Q   GGWGE   SC    YI  EG  SNVVQT+WA++GL+++ 
Sbjct  1432  YNDCEAIRKGVQFLLGAQKDNGGWGESYLSCSKKIYIAKEGEMSNVVQTAWALMGLIHSG  1491

Query  516   QAERDPTPLHRAAKLLINAQMEDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             QAERDP PLHR AKL+IN+Q+E GDFPQQ  TG ++KNC LHYAS+R+  PL AL+EYR 
Sbjct  1492  QAERDPVPLHRGAKLIINSQLESGDFPQQQATGVFLKNCTLHYASYRNIHPLWALAEYRA  1551

Query  336   RV  331
             RV
Sbjct  1552  RV  1553



>sp|B9X0J1.1|STBOS_STERE RecName: Full=Baccharis oxide synthase; Short=StrBOS [Stevia 
rebaudiana]
 dbj|BAH23676.1| baccharis oxide synthase [Stevia rebaudiana]
Length=761

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/757 (55%), Positives = 548/757 (72%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI +G   PY+YSTNN+ GRQ WE+DPN GT EE++  E+AR+ F   R +   T 
Sbjct  1     MWRLKIADGNNNPYLYSTNNFVGRQTWEFDPNYGTQEERDEVEQARQHFWNNRHQFKAT-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GD+  RMQ I+E      +IP V++ + EE++Y+ +T  +R++V L  ALQA DGHWPAE
Sbjct  60    GDVLWRMQFIREKRFKQ-TIPQVKIEDGEEISYDKVTATLRRSVHLLAALQADDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GP+FF  PL+I LYI+G +D +   EHKKE++RYLY  QNEDGGWGL+I+G S M G+
Sbjct  119   NTGPMFFIQPLVICLYITGHLDRVFPKEHKKEILRYLYTQQNEDGGWGLHIEGQSIMFGT  178

Query  2049  ALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              ++YV +RLLGE  D     A  + R WIL HG   A PSWGKIYL++LGV+EW+GCNP+
Sbjct  179   IMSYVCMRLLGEGPDGGLNGACTKARKWILDHGSVLASPSWGKIYLTILGVHEWEGCNPL  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS FP HPAKMW YCR  YMPMSYLY +R+ GP+T LVL +R E++ + Y+ I
Sbjct  239   PPEFWILPSIFPMHPAKMWCYCRLIYMPMSYLYGRRFVGPITPLVLQLREELYSQSYNDI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
              W +TR    KED +YPH ++QD++W+ L   TEP++ RWPF+K+RE A++  I H+ Y 
Sbjct  299   KWKSTRHLVVKEDLHYPHPWLQDLMWDGLYIFTEPLLTRWPFSKLREKALKTTINHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIGA+EKSL M+  W EDP+    K HLAR+PD++W++EDG+ MQ+FGSQ WD
Sbjct  359   DENSRYITIGAVEKSLCMLACWDEDPDGVCFKKHLARIPDYIWVSEDGLKMQSFGSQLWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             A+ A QAL+++ +  +    L+K H ++K SQ+K+NP GDFKSMYRH +KG+W FSDQDH
Sbjct  419   ASLAIQALLATDLNHDIEPILRKGHDFIKASQVKDNPSGDFKSMYRHITKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW  SDCT E +KC LLL +MS EI GEK+  +  Y+AV++ L LQ  ++GG A WEP  
Sbjct  479   GWQTSDCTTEGLKCCLLLSKMSAEIVGEKMQPEQFYDAVNLILSLQC-KNGGEAGWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE LNPSELF DIV++ + VE T + + AL  FK  YP +R +E+   +  A  YL
Sbjct  538   ESNWLEFLNPSELFEDIVLEHDSVECTATGMQALVIFKKLYPKHRREEIEKFLKDACGYL  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WGICF YGTCFAL G+ A G++YEN EAIR+A +F L+ Q  +GGWG
Sbjct  598   EKVQMQDGSWYGEWGICFTYGTCFALGGMEAIGKTYENCEAIRRAVNFLLTTQRNDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   S P  KY+P EGNRSN+VQT+ A++GL+ ++Q ERDPTPLHRAAKLLIN+QME+GD
Sbjct  658   ESYRSSPKKKYVPLEGNRSNLVQTACALMGLIRSKQEERDPTPLHRAAKLLINSQMENGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQ++  G + KNC+LHY  +R+ + L AL EYRK+V
Sbjct  718   FPQEETGGVFKKNCLLHYPMYRNIYTLWALGEYRKKV  754



>ref|XP_004507562.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Cicer arietinum]
Length=762

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/759 (55%), Positives = 551/759 (73%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LKI +GG  PYI+STN + GRQIWEYD  AGT EE+E  ++AR  F   R Q  P  
Sbjct  1     MWRLKIADGGKDPYIFSTNEFVGRQIWEYDSEAGTKEEREQVQQARLNFYNNRFQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             C DL  R Q+++E+     +I  V++ + EE+ YE  T+A+R+      ALQ  DGHWPA
Sbjct  59    CADLLWRFQILRENNFKQ-TIDSVKIEDGEEITYEKATSALRRGTHHLAALQTTDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             + +GPLFF PPL+  +YI+G +D+I + EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   QIAGPLFFLPPLVFCVYITGHLDLIFSKEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ +R+LG+      D+A AR R WI  HGG T I SWGKI+LS+LGV++W G NP
Sbjct  178   TALNYICMRILGKGPNGGEDNACARARKWIHDHGGVTYISSWGKIWLSILGVFDWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR+ YMPMSYLY KR+ GP+T L+L +R E+H +PY++
Sbjct  238   MPPEFWMLPSFLPIHPAKMWCYCRSVYMPMSYLYGKRFVGPITPLILQLREELHTQPYEK  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W+ +R  C KED Y PHT + D++ ++L   TEP++  WP NK +RE A+   + H+ 
Sbjct  298   INWSKSRHLCAKEDLYSPHTLMYDLICDSLYIFTEPLLTHWPLNKLVREKALEVTMKHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW++EDGMTMQ+FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARIPDYLWISEDGMTMQSFGSQA  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WDA FA QAL+++ ++EE G  L K H ++K+SQ+++NP GDFKSMYRH  KG+W FSDQ
Sbjct  418   WDAIFAVQALLATDLIEEIGSVLLKGHNFIKKSQVRDNPSGDFKSMYRHICKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW ++D TAE +KC LLL  + PEI GEK++ + LY++++I L  QS ++GG   WEP
Sbjct  478   DHGWQITDGTAEGLKCCLLLSMLPPEIVGEKLEPERLYDSINILLSFQS-KNGGLPAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LE+LNP E   DIVV+ E+VE TGS + AL  FK  YP +R +E+   IA A  
Sbjct  537   TTAPKWLELLNPLEFCEDIVVEHEYVECTGSAIQALVLFKKLYPGHRKEEIDNFIANAVR  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             ++E  Q ++GSWYG WG+CF+YGT FAL GL AAG++Y N  AIRKA  F L+ Q ++GG
Sbjct  597   FIEDTQTSNGSWYGNWGVCFIYGTWFALGGLAAAGKTYTNCSAIRKAVQFLLTIQREDGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   S P   Y+P EG+RSNVVQT+WA+LGL++  QAERD TPLHRAAKLLIN+Q+E+
Sbjct  657   WGESYLSNPKKIYVPLEGSRSNVVQTAWALLGLIHVGQAERDLTPLHRAAKLLINSQLEE  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             G++PQQ+ITG +MKNC LHY  +R  +PL AL+EYRK V
Sbjct  717   GNWPQQEITGVFMKNCFLHYPMYRDIYPLWALAEYRKCV  755



>ref|XP_011031246.1| PREDICTED: beta-amyrin synthase-like [Populus euphratica]
Length=759

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/755 (55%), Positives = 539/755 (71%), Gaps = 6/755 (1%)
 Frame = -3

Query  2586  MWKLKIGE-GGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI E G  PYI++TN+YAGRQIWEYDPNAGTPEE+E  E+AR+ FTK R K   + 
Sbjct  1     MWRLKIAEKGNSPYIFTTNDYAGRQIWEYDPNAGTPEEREQVEEARRNFTKSRSKVKPS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  + Q+++E      +IP VR+ E EEV YE  TTA+R++     ALQA DGHWPAE
Sbjct  60    ADLLWQYQILREKNFKQ-TIPAVRVEEGEEVTYEKTTTALRRSASFYSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             NSG LFF PP +   YI+G ++ +   E++KE+ RY+YNHQNEDGGWGL+I+ HS M  +
Sbjct  119   NSGVLFFLPPFVFCFYITGHLNTMFPPEYRKEIFRYIYNHQNEDGGWGLHIESHSNMFCT  178

Query  2049  ALNYVALRLLGEEADD-AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPPE  1873
             A +Y+ LR+LG   D+ A ARGR WIL  GG T+IPSWGK +LS+LG++EW GCNP+PPE
Sbjct  179   AFSYICLRMLGVGPDEEACARGRKWILDRGGVTSIPSWGKTWLSILGLFEWSGCNPMPPE  238

Query  1872  FWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDWN  1693
             FW+ P+  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+LS+R E++++PY+ + W 
Sbjct  239   FWILPTTLPVHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILSLREELYLQPYESVKWK  298

Query  1692  NTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRYGAE  1516
               R  C +ED YYPH+ IQD LW++L   +EP++ RWPFN+ IR+ A+   + H+ Y  E
Sbjct  299   QVRHLCAEEDLYYPHSLIQDFLWDSLYLMSEPLLTRWPFNQLIRKKALEVTMKHIHYEDE  358

Query  1515  ESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDAT  1336
              SRYITIG +EK L M+  W EDP+    K HLARVPDFLW+ EDGM +Q+FGSQ WDAT
Sbjct  359   NSRYITIGCVEKVLCMLSCWVEDPDGVAFKRHLARVPDFLWVGEDGMKVQSFGSQLWDAT  418

Query  1335  FATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGW  1156
             F  QAL +S + EE    L KA  ++K+ Q+ +NP GDF  MYRH SKG+W FSDQDHGW
Sbjct  419   FGFQALHTSELGEEIKPTLAKAFDFIKKCQVVDNPAGDFVGMYRHISKGSWTFSDQDHGW  478

Query  1155  VVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQ  976
              +SDCTAEA+KC+L    +  E  GEKVD Q ++EAV+I L LQ P  GG A WEP   +
Sbjct  479   QLSDCTAEALKCVLFAQMLPTEYIGEKVDPQMIFEAVNIILSLQGPR-GGLAGWEPIRGE  537

Query  975   PYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLET  796
              +LE LNP E   +IV++ ++VE T S +     F   YP +R KE+   IA+A +YLE 
Sbjct  538   MWLEKLNPMEFLENIVIEHDYVECTSSAIHGFVMFMKMYPGHRKKEIETFIARAVDYLEM  597

Query  795   QQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGEC  616
              Q  DGSWYG WG+CF+Y T FAL+GL AAG+SY N++A+R+   F L  Q+ +GGWGE 
Sbjct  598   IQMPDGSWYGNWGVCFIYSTWFALVGLAAAGKSYYNNQAMRRGVDFLLRAQSPDGGWGES  657

Query  615   LESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFP  436
               SCP   Y P EG RS  VQT+WAMLGL+++ QA+RDPTPLHR AKLLIN+Q EDG +P
Sbjct  658   YLSCPNKIYTPLEGKRSTYVQTAWAMLGLIHSGQADRDPTPLHRGAKLLINSQAEDGSYP  717

Query  435   QQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             QQ+ITG +  NCMLHY ++++ FPL AL+EYRK V
Sbjct  718   QQEITGVFKNNCMLHYPTYKNVFPLWALAEYRKNV  752



>ref|XP_011009936.1| PREDICTED: beta-amyrin synthase-like isoform X3 [Populus euphratica]
Length=728

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/725 (57%), Positives = 538/725 (74%), Gaps = 7/725 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKL++ EG GP+++STN + GRQIW ++PNA TPEEQ   E AR+ F   R       G
Sbjct  1     MWKLEVAEGDGPWLFSTNKFVGRQIWRFEPNAWTPEEQAQVEMAREKFRLNRFY-TKASG  59

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             D+    Q+IKE+++D L IPPVRL   EE++ E + TA+RKAVR   A+QA DGHWPAE 
Sbjct  60    DVLKNFQLIKENQID-LRIPPVRLGNGEEISREKVETALRKAVRFTSAIQASDGHWPAEF  118

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             SGPLF  PPL++ LY+S S+D +L++EHKKE++RY+YNHQNEDGGWG +I+ HSTM+G+A
Sbjct  119   SGPLFLMPPLIMVLYLSRSLDTVLSTEHKKEIIRYIYNHQNEDGGWGFHIESHSTMLGTA  178

Query  2046  LNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             LNYVALRLLGE      D A  + R W+L HGGAT IP+WGK+YLSVLG YEW GCNP+P
Sbjct  179   LNYVALRLLGEGPEGGRDGAATKARKWVLDHGGATMIPAWGKVYLSVLGTYEWSGCNPVP  238

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEF LFPS  PF P K+W + RT Y PMSYLY K++ GP+T+L+L +R E++++PY++ID
Sbjct  239   PEFLLFPSFLPFSPGKVWCHLRTVYTPMSYLYGKKFVGPITDLILQLRRELYIQPYEEID  298

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             WN  R  C KED Y   +  Q++L + + Y +E ++++WPF+K+RE A+++ I H+ Y  
Sbjct  299   WNKARHLCLKEDLYTSRSIAQNLLLDGVHYLSERLLKQWPFSKLREQALQEAIKHIHYED  358

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             E +RY+T  +IEKSL MM  WAEDP  D  K+HLARVPD LWLAEDGM  Q+ GSQ WDA
Sbjct  359   ESTRYMTHASIEKSLNMMACWAEDPTSDAFKFHLARVPDILWLAEDGMKTQSIGSQLWDA  418

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
              FATQA+I+S +V+EYG  L+KAH +LK SQI+EN  GDF+SMYRH SKGAW  S +DHG
Sbjct  419   AFATQAIIASNLVDEYGSTLRKAHEFLKLSQIQENAYGDFRSMYRHISKGAWTLSVKDHG  478

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCTAEA++ LLLL QM  EI GE +D + L+ A+D  L LQS ++GGF+VWEP   
Sbjct  479   WQVSDCTAEALRALLLLSQMPAEIVGETIDTERLHNAIDFLLSLQS-KNGGFSVWEPARG  537

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
             Q +LE+LNP++ F D++V+ E+VE T S +  L  FK  +P YR KE+ +S+A A+ Y+E
Sbjct  538   QRWLEVLNPTQAFGDVMVETEYVECTASAIQVLVLFKSLHPGYRRKEIEVSVANASSYIE  597

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
               Q +DGSWYG WGIC+ YGT FAL GL + G++Y NS  +RKA  F LSKQ+  GGWGE
Sbjct  598   DAQMSDGSWYGNWGICYTYGTYFALKGLASVGKTYRNSRTVRKACEFLLSKQHNSGGWGE  657

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                SC   KY   EGN+SNVVQT+WAM+GL+Y  QAE+DP PLH+AA+LLIN+QME+G+F
Sbjct  658   SYLSCANSKYTETEGNKSNVVQTAWAMMGLIYAGQAEKDPAPLHQAARLLINSQMENGEF  717

Query  438   PQQDI  424
             PQQD 
Sbjct  718   PQQDF  722



>ref|XP_006301366.1| hypothetical protein CARUB_v10021777mg [Capsella rubella]
 gb|EOA34264.1| hypothetical protein CARUB_v10021777mg [Capsella rubella]
Length=761

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/762 (53%), Positives = 552/762 (72%), Gaps = 11/762 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG---PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2416
             MW+LKIGEG G   PY++S+NN+ GRQ WE++P AGTPEE+ A E+AR+ F   R +   
Sbjct  1     MWRLKIGEGNGEEDPYLFSSNNFVGRQTWEFNPKAGTPEERAAVEEARRKFLDNRSR-VK  59

Query  2415  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2236
              C D   RMQ +KE++ + + IPPV++ + E V++E  T A+R+ V    ALQA DGHWP
Sbjct  60    GCSDFLWRMQFLKEAKFEQV-IPPVKIDDGEGVSHENATDALRRGVSFFSALQASDGHWP  118

Query  2235  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  2056
              E SGPLFF PPL+  LYI+G +D +  ++H+KE++RY+Y HQNEDGGWGL+I+G S M 
Sbjct  119   GEFSGPLFFLPPLVFCLYITGHLDKVFDADHRKEMLRYIYCHQNEDGGWGLHIEGKSVMF  178

Query  2055  GSALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              +ALNY+ LR+LGE      D+A  R R WIL  GG T IPSWGK++LS+LG+Y+W G N
Sbjct  179   CTALNYICLRMLGEGPDGGQDNACKRARQWILDRGGVTYIPSWGKMWLSILGIYDWSGTN  238

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPE WL PS  P H  K   Y R  YMP+SYLY KR+ GPLT L++ +R E+H++PY+
Sbjct  239   PMPPEIWLLPSFLPLHIGKFLCYTRMVYMPVSYLYGKRFVGPLTPLIMLLRGELHLQPYE  298

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHM  1531
             +I+WN  R    KED +YPH  +QD++W+ L    EP++ RWP NK +RE A+   + H+
Sbjct  299   KINWNKARRLYAKEDMFYPHPLVQDLIWDTLHIFVEPLLTRWPLNKLVREKALCVAMEHI  358

Query  1530  RYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQ  1351
              Y  E S YITIG +EK L M+  W E PN D  K HLAR+PDF+W+AEDG+ MQ+FGSQ
Sbjct  359   HYEDENSHYITIGCVEKVLCMLACWIEHPNGDHFKKHLARIPDFMWVAEDGLKMQSFGSQ  418

Query  1350  NWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSD  1171
              W+  FA QA+++S + +E  D L+K H Y+K+SQ++ENP GD+KSMYRH SKGAW  SD
Sbjct  419   LWETGFAMQAILASDLCDETDDVLRKGHSYIKKSQVRENPSGDYKSMYRHISKGAWTLSD  478

Query  1170  QDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWE  991
             +DHGW VSDCTAEA KC +LL  M  E+ G+K+D + LY++V++ L LQS  +GG   WE
Sbjct  479   RDHGWQVSDCTAEAFKCCMLLSMMPAEVVGQKLDPEYLYDSVNLLLSLQS-GNGGLTAWE  537

Query  990   PPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAA  811
             P     +LE+LNP+++FAD++ + E+VE T +++ AL  FK  YPD+R +E+ MSI K  
Sbjct  538   PVRAHEWLELLNPTDIFADVMAEREYVECTSAVIQALVLFKKLYPDHRTEEIIMSIEKGV  597

Query  810   EYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEG  631
             ++LE++Q  DGSWYG WGICF+Y T FAL GL A G++Y++  A+RK   F L+ Q ++G
Sbjct  598   QFLESKQMPDGSWYGNWGICFIYATWFALSGLAAVGKTYKSCLAMRKGVDFLLTIQKEDG  657

Query  630   GWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQME  451
             GWGE   SCP  +YIP EG++SN+VQT+WAM+GL++  QAERDP PLHRAAKL+I +Q+E
Sbjct  658   GWGESYLSCPEQRYIPLEGSKSNLVQTAWAMMGLIHAGQAERDPIPLHRAAKLIITSQLE  717

Query  450   DGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWI  325
             +GDFPQQ+I G++M  C+LHYA++R+ FPL AL+EYRK  +I
Sbjct  718   NGDFPQQEIVGAFMNTCLLHYATYRNTFPLWALAEYRKVAFI  759



>ref|XP_006409183.1| hypothetical protein EUTSA_v10022563mg [Eutrema salsugineum]
 gb|ESQ50636.1| hypothetical protein EUTSA_v10022563mg [Eutrema salsugineum]
Length=771

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/757 (54%), Positives = 548/757 (72%), Gaps = 10/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLK GEG G  PY++S+NN+ GRQIWE+DP AGTPEE+ A E+AR+ F   R +    
Sbjct  1     MWKLKTGEGNGEDPYLFSSNNFTGRQIWEFDPKAGTPEERAAVEEARRSFYDNRSR-VKA  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ +KE++ + + IPPV+  + E + Y   T A+R+ V    ALQ+ DGHWPA
Sbjct  60    SSDLLWRMQFLKEAKFEQV-IPPVKFDDGESITYVKTTNALRRGVAFFSALQSSDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +GPLFF PPL+  LYI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+  S M  
Sbjct  119   EIAGPLFFLPPLVFCLYITGHLEEVFDAEHRKEILRYIYCHQNEDGGWGLHIESKSVMFS  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ LR+LG   D    ++  R R WIL HGG T IPSWGK++LS+LG+Y+W G NP
Sbjct  179   TALNYICLRMLGVGLDGGRENSCKRAREWILNHGGVTYIPSWGKVWLSILGIYDWSGTNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPE WL PS  P H  K+  Y R  YMPMSYLY KR+ GP+T L++ +R E+H++PY++
Sbjct  239   MPPEMWLLPSFLPLHLGKLLCYTRMVYMPMSYLYGKRFVGPVTPLIMQLREELHLQPYEE  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+WN  R  C KEDTYYPH  +QD++W+ L    EP + RWP NK +RE A+R  + H+ 
Sbjct  299   INWNKARRLCGKEDTYYPHPLVQDLIWDTLHMFVEPFLTRWPLNKLVREKALRVAMNHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E S YITIG IEK L M+  W E+P  D  K HL+R+ D++W+AEDG+ MQ+FGSQ 
Sbjct  359   YEDENSHYITIGCIEKVLCMLACWVENPVGDHFKKHLSRLSDYMWVAEDGLKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             W+  FA QAL++S + +E  + L++ H Y+K+SQ++ENP GDFK+M+RH SKGAW FSD+
Sbjct  419   WETGFAIQALLASDLGDETYEVLRRGHTYIKRSQVRENPSGDFKTMHRHISKGAWTFSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAEA+KC +LL  M  ++ G+K+D + LY++V++ L LQS E+GG   WEP
Sbjct  479   DHGWQVSDCTAEALKCCMLLSMMPADLVGQKIDPEHLYDSVNLLLSLQS-ENGGLTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LE+LNP++ FA+++V+GE VE T +++ A   FK  YPD+R KEV  SI KA +
Sbjct  538   ASAPEWLELLNPTDFFANVMVEGECVECTSAVIQAFVMFKQLYPDHREKEVIKSIKKAVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             ++E++Q  DGSWYG WGICF+YGT FAL GL A G++Y N  +I     F L+ QN++GG
Sbjct  598   FIESKQMPDGSWYGNWGICFIYGTWFALSGLAAIGKTYNNCLSICNGVDFLLTIQNEDGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +YIP E N SN+VQT+WAM+GL++  QAERD  PLHRAAK +I +QME+
Sbjct  658   WGESYLSCPEQRYIPLERNGSNIVQTAWAMMGLIHGGQAERDFIPLHRAAKFIITSQMEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             GDFPQQ++TG++M NCMLHYA++R+ FPL AL+EYRK
Sbjct  718   GDFPQQEMTGAFMNNCMLHYATYRNTFPLWALAEYRK  754



>ref|NP_178016.2| beta-amyrin synthase [Arabidopsis thaliana]
 sp|B6EXY6.2|LUP4_ARATH RecName: Full=Beta-amyrin synthase; Short=AtBAS; AltName: Full=Lupeol 
synthase 4; Short=AtLUP4 [Arabidopsis thaliana]
 gb|AEE36183.1| beta-amyrin synthase [Arabidopsis thaliana]
Length=759

 Score =   891 bits (2303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/759 (55%), Positives = 549/759 (72%), Gaps = 10/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LKIGEG G  PY+++TNN+AGRQ WE+DP+ G+PEE+ +  +AR+ F   R      
Sbjct  1     MWRLKIGEGNGDDPYLFTTNNFAGRQTWEFDPDGGSPEERHSVVEARRIFYDNRFH-VKA  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E + +   I PV++ + E+V +E  T+A+R+ +    ALQA DGHWPA
Sbjct  60    SSDLLWRMQFLREKKFEQ-RIAPVKVEDSEKVTFETATSALRRGIHFFSALQASDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL+  LYI+G +D + TSEH+KE++RY+Y HQ EDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVFCLYITGHLDEVFTSEHRKEILRYIYCHQKEDGGWGLHIEGHSTMFC  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + LNY+ +R+LGE  D    +A  R R WIL HGG T IPSWGK +LS+LGV++W G NP
Sbjct  179   TTLNYICMRILGESPDGGHDNACGRAREWILSHGGVTYIPSWGKTWLSILGVFDWSGSNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS FP HPAKMW+YCR  Y+PMSYLY KR+ GP+T+L+L +R E++++PY++
Sbjct  239   MPPEFWILPSFFPVHPAKMWSYCRMVYLPMSYLYGKRFVGPITSLILQLRKELYLQPYEE  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHMR  1528
             I+W   R  C KEDTYYP   +Q+++W++L    EP + RWPFNK+ RE A++  + H+ 
Sbjct  299   INWMKVRHLCAKEDTYYPRPLVQELVWDSLYIFAEPFLARWPFNKLLREKALQLAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDPN D  K HL+R+ D+LW+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLSRISDYLWMAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S +  E  D L++ H ++K SQ+ ENP GD+KSMYRH SKGAW FSD+
Sbjct  419   WDTGFAMQALLASNLSSEISDVLRRGHEFIKNSQVGENPSGDYKSMYRHISKGAWTFSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTA  +KC LL   ++P+I G K D + L+++V+I L LQS ++GG   WEP
Sbjct  479   DHGWQVSDCTAHGLKCCLLFSMLAPDIVGPKQDPERLHDSVNILLSLQS-KNGGMTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LE+LNP+E+F+DIV++ E+ E T S + AL+ FK  YPD+R  E+   I KAAE
Sbjct  538   AGAPKWLELLNPTEMFSDIVIEHEYSECTSSAIQALSLFKQLYPDHRTTEITAFIKKAAE  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG WGICF YGT FAL GL AAG+++ + EAIRK   F L+ Q   GG
Sbjct  598   YLENMQTRDGSWYGNWGICFTYGTWFALAGLAAAGKTFNDCEAIRKGVQFLLAAQKDNGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SC    YI   G  SNVVQT+WA++GL+++ QAERDP PLHRAAKL+IN+Q+E 
Sbjct  658   WGESYLSCSKKIYIAQVGEISNVVQTAWALMGLIHSGQAERDPIPLHRAAKLIINSQLES  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ  TG ++KNC LHYA++R+  PL AL+EYR RV
Sbjct  718   GDFPQQQATGVFLKNCTLHYAAYRNIHPLWALAEYRARV  756



>ref|XP_011009935.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Populus euphratica]
Length=747

 Score =   891 bits (2302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/723 (57%), Positives = 537/723 (74%), Gaps = 7/723 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKL++ EG GP+++STN + GRQIW ++PNA TPEEQ   E AR+ F   R       G
Sbjct  1     MWKLEVAEGDGPWLFSTNKFVGRQIWRFEPNAWTPEEQAQVEMAREKFRLNRFY-TKASG  59

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             D+    Q+IKE+++D L IPPVRL   EE++ E + TA+RKAVR   A+QA DGHWPAE 
Sbjct  60    DVLKNFQLIKENQID-LRIPPVRLGNGEEISREKVETALRKAVRFTSAIQASDGHWPAEF  118

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             SGPLF  PPL++ LY+S S+D +L++EHKKE++RY+YNHQNEDGGWG +I+ HSTM+G+A
Sbjct  119   SGPLFLMPPLIMVLYLSRSLDTVLSTEHKKEIIRYIYNHQNEDGGWGFHIESHSTMLGTA  178

Query  2046  LNYVALRLLGEEA----DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             LNYVALRLLGE      D A  + R W+L HGGAT IP+WGK+YLSVLG YEW GCNP+P
Sbjct  179   LNYVALRLLGEGPEGGRDGAATKARKWVLDHGGATMIPAWGKVYLSVLGTYEWSGCNPVP  238

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEF LFPS  PF P K+W + RT Y PMSYLY K++ GP+T+L+L +R E++++PY++ID
Sbjct  239   PEFLLFPSFLPFSPGKVWCHLRTVYTPMSYLYGKKFVGPITDLILQLRRELYIQPYEEID  298

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             WN  R  C KED Y   +  Q++L + + Y +E ++++WPF+K+RE A+++ I H+ Y  
Sbjct  299   WNKARHLCLKEDLYTSRSIAQNLLLDGVHYLSERLLKQWPFSKLREQALQEAIKHIHYED  358

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             E +RY+T  +IEKSL MM  WAEDP  D  K+HLARVPD LWLAEDGM  Q+ GSQ WDA
Sbjct  359   ESTRYMTHASIEKSLNMMACWAEDPTSDAFKFHLARVPDILWLAEDGMKTQSIGSQLWDA  418

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
              FATQA+I+S +V+EYG  L+KAH +LK SQI+EN  GDF+SMYRH SKGAW  S +DHG
Sbjct  419   AFATQAIIASNLVDEYGSTLRKAHEFLKLSQIQENAYGDFRSMYRHISKGAWTLSVKDHG  478

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCTAEA++ LLLL QM  EI GE +D + L+ A+D  L LQS ++GGF+VWEP   
Sbjct  479   WQVSDCTAEALRALLLLSQMPAEIVGETIDTERLHNAIDFLLSLQS-KNGGFSVWEPARG  537

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
             Q +LE+LNP++ F D++V+ E+VE T S +  L  FK  +P YR KE+ +S+A A+ Y+E
Sbjct  538   QRWLEVLNPTQAFGDVMVETEYVECTASAIQVLVLFKSLHPGYRRKEIEVSVANASSYIE  597

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
               Q +DGSWYG WGIC+ YGT FAL GL + G++Y NS  +RKA  F LSKQ+  GGWGE
Sbjct  598   DAQMSDGSWYGNWGICYTYGTYFALKGLASVGKTYRNSRTVRKACEFLLSKQHNSGGWGE  657

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                SC   KY   EGN+SNVVQT+WAM+GL+Y  QAE+DP PLH+AA+LLIN+QME+G+F
Sbjct  658   SYLSCANSKYTETEGNKSNVVQTAWAMMGLIYAGQAEKDPAPLHQAARLLINSQMENGEF  717

Query  438   PQQ  430
             PQQ
Sbjct  718   PQQ  720



>emb|CAN77299.1| hypothetical protein VITISV_033299 [Vitis vinifera]
Length=755

 Score =   890 bits (2300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/753 (55%), Positives = 538/753 (71%), Gaps = 22/753 (3%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   + +               
Sbjct  1     MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVKPS---------------  45

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  RMQ ++E      + P V++ + EE+  E  TTAVR+      ALQA DGHWPAE
Sbjct  46    SDLLWRMQFLREKNFKQ-TJPQVKVGDGEEIAXETATTAVRRGAHFFSALQASDGHWPAE  104

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             +SGPLFF PPL++ LYI+G +D +   E++KE++RYLY HQNEDGGWGL+I+ HS M  +
Sbjct  105   HSGPLFFLPPLVMCLYITGHLDTVFPGEYRKEILRYLYCHQNEDGGWGLHIEEHSIMFCT  164

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              L+Y  +R+LGE  D    +A ARGR WIL  GG T+IP+WGKI+LS+ G+++W G NP+
Sbjct  165   TLSYXCMRILGEGRDGGRDNACARGRKWILBRGGVTSIPTWGKIWLSIFGLFDWSGSNPM  224

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEF LFPSH P +PAK+W Y R  +MPMSYLY KR+ GP+T LVL +R E+ ++PY++I
Sbjct  225   PPEFSLFPSHLPMNPAKIWCYSRLIFMPMSYLYGKRFVGPITPLVLELREELFLQPYNEI  284

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +W   R  C KED YYPH  IQD++W++L  CTEP++ RWPFNK+R+ A+   + H+ Y 
Sbjct  285   NWKKVRHLCAKEDLYYPHPLIQDMMWDSLYICTEPLLTRWPFNKLRKKALEVTMKHIHYE  344

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDPN D  K HLAR+PD++W  EDG+ MQTFGSQ WD
Sbjct  345   DENSRYITIGCVEKVLCMLSCWVEDPNGDYFKKHLARIPDYIWAGEDGIKMQTFGSQEWD  404

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
              + A QAL++  M  E G  LKK H +LK+SQ+K+NP GDFKSMYRH SKG+W FSD+DH
Sbjct  405   TSLALQALLACNMTNEIGPTLKKGHEFLKESQVKDNPSGDFKSMYRHISKGSWTFSDKDH  464

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +KC LL   M+PEI G K++   L+++V+I L LQS E+GG   WEP  
Sbjct  465   GWQVSDCTAEGLKCCLLFSMMAPEIVGMKIEPGRLFDSVNILLSLQS-ENGGIVGWEPAG  523

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE+LNPSE+F D+V++ E+VE T S + AL  FK  YP++R +E+   I  A +Y+
Sbjct  524   ASEWLELLNPSEMFEDLVIEHEYVECTASAIQALVLFKKLYPEHRTEEIDNFITNATKYI  583

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E QQ  DGSWYG WG+CF+Y + +AL GL AAG++Y N  AI +A  F L  Q  +GGWG
Sbjct  584   EDQQMPDGSWYGKWGVCFIYSSWWALGGLAAAGKTYHNCLAIGRAVEFLLKSQRDDGGWG  643

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SC   KY P EGN+SN+VQT WA++GL+ + QAERDPTPLHRAAKLLIN+QMEDGD
Sbjct  644   ESYISCRDKKYTPLEGNKSNLVQTGWALMGLLSSGQAERDPTPLHRAAKLLINSQMEDGD  703

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEY  343
             FPQQ+ITG++M NCMLH A +R+ FPL AL+EY
Sbjct  704   FPQQEITGAFMNNCMLHCADYRNIFPLWALAEY  736



>ref|XP_009779991.1| PREDICTED: beta-amyrin synthase-like [Nicotiana sylvestris]
Length=761

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/757 (56%), Positives = 538/757 (71%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLKI +G  GPY+YSTNNY GRQIW +DPNAG+PEE+   E+AR+ F   R K   + 
Sbjct  1     MWKLKIAQGQDGPYLYSTNNYVGRQIWAFDPNAGSPEERAEIEEARQHFWNNRYKIKPS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             GDL  RMQ + E       IP V++ E EE+  E  TTA+R+AV    ALQA DGHWPAE
Sbjct  60    GDLLWRMQFLGEKNFKQ-KIPAVKVEEGEEITDEVATTALRRAVHFFSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N GPLFF PPL+I +YI+G ++++  +EH++E++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NGGPLFFLPPLVICMYITGHLNIVFPAEHRREILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ +R+LGE  D    +A  R R WIL HG  T IPSWGK +LS+LGV+EW G NP+
Sbjct  179   ALSYICMRILGEGPDGGENNACGRARKWILDHGSVTVIPSWGKTWLSILGVFEWLGTNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS  P HPAKMW Y R  YMPMSYLY KR+ GP+T LVL +R E++ +PY +I
Sbjct  239   PPEFWILPSFLPMHPAKMWCYTRMVYMPMSYLYGKRFVGPITPLVLQLREELYDQPYREI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +W   R  C KED YYPH  +QD++W++L  CTEP++ RWPFNK+R  A+   + H+ Y 
Sbjct  299   NWKKVRHLCAKEDLYYPHPLVQDLMWDSLYICTEPLLTRWPFNKLRNKALEVTMKHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W E+P  D  K HLAR+PD+ W+AEDGM MQ  GSQ WD
Sbjct  359   DESSRYITIGCVEKVLCMLACWVENPKGDCFKKHLARIPDYFWVAEDGMKMQGLGSQLWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
              TFA QAL++S M  E  D L+K H ++K+SQ+K+NP GDF+ MYRH SKG+W FSDQDH
Sbjct  419   TTFAIQALLASEMNHEISDTLRKGHDFIKKSQVKDNPSGDFRGMYRHISKGSWTFSDQDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAEA+ C LL   M  E+ G+ +D   LY+AV++ L LQS ++GG +VWEP  
Sbjct  479   GWGVSDCTAEALTCCLLFSTMPSELVGDAMDPAGLYDAVNVILSLQS-KNGGLSVWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                YLE+LNP E FADIV++ E+VE TGS + AL  F   YP +R KEV   I  A +Y 
Sbjct  538   ASEYLELLNPIEFFADIVIEHEYVECTGSSIQALVLFNKLYPGHRTKEVDNFIDNAVKYF  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WG+CF+Y + FAL GL AAG+SY N  A+RK   F L  Q  +GGWG
Sbjct  598   EDVQMPDGSWYGCWGVCFIYASWFALGGLAAAGKSYSNCAAVRKGVEFLLRTQRSDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SC    Y   E + SN+VQT+WA++GL+++ Q +RDP PLHRAA+LLIN+Q+EDGD
Sbjct  658   ESYRSCLDKVYRELETDNSNLVQTAWALMGLIHSGQVDRDPRPLHRAARLLINSQLEDGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ++TG  MKNCMLHYA +R+ FP+  L+EY K V
Sbjct  718   FPQQEMTGVSMKNCMLHYALYRNIFPMWGLAEYCKNV  754



>gb|KFK42271.1| hypothetical protein AALP_AA2G234300 [Arabis alpina]
Length=759

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/759 (55%), Positives = 547/759 (72%), Gaps = 10/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LKIGEG G  PY++STNN+AGRQ WE+DP+ G+ EE+ +  +AR+ F + R +    
Sbjct  1     MWRLKIGEGNGNDPYLFSTNNFAGRQTWEFDPDGGSSEERNSVVEARRSFYENRFR-VKA  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               D+  RMQ +KE + + + IPP ++   +++ +E+ T A+R+ V    ALQA DGHWPA
Sbjct  60    SSDVLWRMQFLKEKKFEQV-IPPGKVESSDKITFESATNALRRGVHFFSALQATDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL+  LYI+G +D I TSEH+KE++RY+Y HQ EDGGWG +I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVFCLYITGHLDEIFTSEHRKEILRYIYCHQKEDGGWGFHIEGHSTMFC  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ +R+LGE  D    +A AR R WI  HGG T IPSWGK +LS+LGV++W G NP
Sbjct  179   TALNYICMRILGESPDGGEENACARARKWIHVHGGVTCIPSWGKTWLSILGVFDWSGSNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS FP HPAKMW  CR  Y+PMSYLY KR+ GP+T L+L +R E++++PY++
Sbjct  239   MPPEFWILPSFFPVHPAKMWCNCRMVYLPMSYLYGKRFVGPITPLILQLRKELYLQPYEE  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHMR  1528
             I W      C KED YYP   +Q+++W++L   TEP++ RWPFNK+ R+ A+   + H+ 
Sbjct  299   ISWKKIHHLCAKEDAYYPRPLVQELIWDSLYIFTEPLLTRWPFNKLLRQKALHVAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYIT+G ++K L M+  W EDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSRYITMGCVQKVLCMLACWVEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA +AL++S +  E  D L++ H ++K SQ++ENP G+FKSMYRH SKGAW FSD+
Sbjct  419   WDTGFAMEALLASNLSSEISDVLRRGHEFIKNSQVRENPSGNFKSMYRHISKGAWTFSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTA  +KC LL   M+P+I G K D + LY++V++ L LQS ++GG   WEP
Sbjct  479   DHGWQVSDCTAHGLKCCLLFSMMAPDIVGPKTDPERLYDSVNLLLILQS-KNGGVTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LE+LNP+E+FADIV++ E+ E T S + AL+ FK  +PD+R KE+   I KA +
Sbjct  538   AGAPEWLELLNPTEMFADIVIEHEYTECTSSAIQALSLFKQLFPDHRKKEITNFIKKAVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG WGICF YGT FAL GL AAG++Y +  AIRK  HF LS Q   GG
Sbjct  598   YLENMQTPDGSWYGNWGICFTYGTWFALAGLAAAGKTYNDCAAIRKGVHFLLSTQKDNGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SC   +YI  EG +SN+VQT+WA++GL++  QAERDP PLHRAAKL+IN+Q++ 
Sbjct  658   WGESYLSCSEKRYIAEEGEKSNLVQTAWALMGLIHAGQAERDPVPLHRAAKLIINSQLDT  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ  TG +MKNC LHYA +R   PL AL+EYR RV
Sbjct  718   GDFPQQQATGVFMKNCTLHYAQYRIIHPLWALAEYRARV  756



>gb|AAC17070.1| Strong similarity to lupeol synthase gb|U49919 from A. thaliana 
(second gene in a series of three with similar homologies) 
[Arabidopsis thaliana]
Length=795

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/789 (52%), Positives = 548/789 (69%), Gaps = 42/789 (5%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLKIGEG G  PY++S+NN+ GRQ WE+DP AGTPEE+ A E AR+ +   R +    
Sbjct  1     MWKLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTPEERAAVEDARRNYLDNRPR-VKG  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             C DL  RMQ +KE++ + + IPPV++ + E + Y+  T A+R+AV    ALQ+ DGHWPA
Sbjct  60    CSDLLWRMQFLKEAKFEQV-IPPVKIDDGEGITYKNATDALRRAVSFYSALQSSDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +G LFF PPL+   YI+G ++ I  +EH+KE++R++Y HQNEDGGWGL+I+G S M  
Sbjct  119   EITGTLFFLPPLVFCFYITGHLEKIFDAEHRKEMLRHIYCHQNEDGGWGLHIEGKSVMFC  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + LNY+ LR+LGE  +    +A  R R WIL HGG T IPSWGKI+LS+LG+Y+W G NP
Sbjct  179   TVLNYICLRMLGEGPNGGRNNACKRARQWILDHGGVTYIPSWGKIWLSILGIYDWSGTNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPE WL PS FP H  K   Y R  YMPMSYLY KR+ GPLT L++ +R E+H++PY++
Sbjct  239   MPPEIWLLPSFFPIHLGKTLCYTRMVYMPMSYLYGKRFVGPLTPLIMLLRKELHLQPYEE  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+WN  R  C KED  YPH  +QD+LW+ L    EPI+  WP  K +RE A+R  + H+ 
Sbjct  299   INWNKARRLCAKEDMIYPHPLVQDLLWDTLHNFVEPILTNWPLKKLVREKALRVAMEHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E S YITIG +EK L M+  W E+PN D  K HLAR+PDF+W+AEDG+ MQ+FGSQ 
Sbjct  359   YEDENSHYITIGCVEKVLCMLACWIENPNGDHFKKHLARIPDFMWVAEDGLKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++  + +E  D L+K H ++K+SQ++ENP GDFKSMYRH SKGAW  SD+
Sbjct  419   WDTVFAIQALLACDLSDETDDVLRKGHSFIKKSQVRENPSGDFKSMYRHISKGAWTLSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAEA+KC +LL  M  E+ G+K+D + LY++V++ L LQ  E GG   WEP
Sbjct  479   DHGWQVSDCTAEALKCCMLLSMMPAEVVGQKIDPEQLYDSVNLLLSLQG-EKGGLTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP++ F  ++ + E+VE T +++ AL  FK  YPD+R KE+  SI K  +
Sbjct  538   VRAQEWLELLNPTDFFTCVMAEREYVECTSAVIQALVLFKQLYPDHRTKEIIKSIEKGVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             ++E++Q  DGSW+G WGICF+Y T FAL GL AAG++Y++  A+RK   F L+ Q ++GG
Sbjct  598   FIESKQTPDGSWHGNWGICFIYATWFALSGLAAAGKTYKSCLAVRKGVDFLLAIQEEDGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYT------------------------  520
             WGE   SCP  +YIP EGNRSN+VQT+WAM+GL++                         
Sbjct  658   WGESHLSCPEQRYIPLEGNRSNLVQTAWAMMGLIHAGQVQIFSILDLHLFQVQRNYLETP  717

Query  519   --------EQAERDPTPLHRAAKLLINAQMEDGDFPQQDITGSYMKNCMLHYASHRSYFP  364
                     +QAERDPTPLHRAAKL+I +Q+E+GDFPQQ+I G +M  CMLHYA++R+ FP
Sbjct  718   IVSSAVSIQQAERDPTPLHRAAKLIITSQLENGDFPQQEILGVFMNTCMLHYATYRNIFP  777

Query  363   LMALSEYRK  337
             L AL+EYRK
Sbjct  778   LWALAEYRK  786



>ref|XP_007014712.1| Beta-Amyrin Synthase isoform 1 [Theobroma cacao]
 gb|EOY32331.1| Beta-Amyrin Synthase isoform 1 [Theobroma cacao]
Length=755

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/756 (54%), Positives = 534/756 (71%), Gaps = 8/756 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI E G P++ + N + GRQ WE+DPNAG+PEEQ   E+ R  F K R +   +  
Sbjct  1     MWKLKIAEEG-PWLATVNGHVGRQHWEFDPNAGSPEEQAQVERLRLEFKKNRFRVKQS-S  58

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             DL MRMQ+ KE+   ++  PPV+L  EE V  EA T  +R+A+    +LQA DGHWPAE 
Sbjct  59    DLLMRMQLTKENPCGLIP-PPVKLNHEEVVTEEATTVTLRRAISFYSSLQAHDGHWPAET  117

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +GPLFF PPL++ALY++G ++ IL+ EH+KE++RY+YNHQNEDGGWGL+I+GHSTM G+A
Sbjct  118   AGPLFFLPPLVMALYVTGGLNTILSPEHQKEIIRYIYNHQNEDGGWGLHIEGHSTMFGTA  177

Query  2046  LNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             ++Y+ LRLLGE  +D    A+ARGR WIL HGG   IPSWGK +++VLGVYEW GCNP+P
Sbjct  178   ISYITLRLLGERPEDGEGMAVARGRKWILDHGGLVGIPSWGKFWVTVLGVYEWAGCNPLP  237

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEFWL P   P HP KM  YCR  YMPMSYLY KR+ GP+T L+  +R E++ +PY +I+
Sbjct  238   PEFWLLPKVSPIHPGKMLCYCRLVYMPMSYLYGKRFVGPITGLIRQLRQELYNQPYHEIN  297

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             WN  R    KED YYPH  +QD+ W  L +  EP + RWPF+ +R+ A++  I H+ Y  
Sbjct  298   WNAARNTVAKEDLYYPHPLVQDLTWGFLHHVVEPFLTRWPFSMLRDKALKVAIQHVHYED  357

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             E SRY+ IG +EK L +M  W EDPN +  K HLAR+PD+ W+AEDG+ MQTFG Q WDA
Sbjct  358   ENSRYLCIGCVEKVLCLMACWVEDPNSEAYKRHLARLPDYYWIAEDGLKMQTFGCQMWDA  417

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
              FA QA++SS + +EYG  L+KAH ++K SQ++ENP G+F  MYRH SKG+W FS QDHG
Sbjct  418   AFAIQAIMSSNLSDEYGPTLRKAHDFVKASQVRENPSGNFSGMYRHISKGSWTFSTQDHG  477

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCTAE +KC LL  QMS ++ GEK++ Q  Y+AV++ L LQS  +GGF  WEP   
Sbjct  478   WQVSDCTAEGLKCALLFSQMSNDLVGEKLETQRFYDAVNVILSLQS-NNGGFPAWEPQRA  536

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
               +LE  NP+E F D +++ E+VE T S + ALA F+  +P +R  E+   +A+ A Y+E
Sbjct  537   YGWLEKFNPTEFFEDTLIEREYVECTSSAIQALALFRKLHPKHRRAEIDHCVARGARYIE  596

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
               Q  DGSWYG WGIC+ YG  FA+ GL A GR+Y NS A+RKA  F LSKQ   GGWGE
Sbjct  597   DTQNQDGSWYGCWGICYTYGAWFAVEGLAACGRNYHNSPALRKACEFLLSKQLANGGWGE  656

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                S     Y    GNR+N+V T+WA+L L+   QA+ DPTP+HR  K+LIN+QMEDGDF
Sbjct  657   SYLSSQNKVYTNLPGNRANLVHTAWALLSLIAAGQADVDPTPIHRGIKVLINSQMEDGDF  716

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             PQQ+ITG +M+NC L+Y+S R+ FP+ AL EYR+R+
Sbjct  717   PQQEITGVFMRNCTLNYSSFRNIFPIWALGEYRRRI  752



>ref|XP_009106614.1| PREDICTED: amyrin synthase LUP2 [Brassica rapa]
Length=765

 Score =   888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/759 (55%), Positives = 553/759 (73%), Gaps = 14/759 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGF--TKQRQKGP  2419
             MWKLKIGEG G  PY++S+NN+ GRQ WE+DP AGT EE+ A E+AR+ F   + R KG 
Sbjct  1     MWKLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTAEERAAVEEARRHFLINRSRVKG-  59

Query  2418  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2239
               C DL  RMQ +KE+  +  +IPPV++   E + +E  T A+R+ V    ALQA DGHW
Sbjct  60    --CSDLVWRMQFLKEARFEQ-AIPPVKIDGNESITHEKSTDALRRGVSFFSALQASDGHW  116

Query  2238  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  2059
             P E +GPLFF PPL+  LYI+G ++ +   EH+KE++R++Y HQNEDGGWGL+I+G S M
Sbjct  117   PGEITGPLFFLPPLVFCLYITGHLEKVFDEEHRKEMLRHVYCHQNEDGGWGLHIEGRSIM  176

Query  2058  IGSALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGC  1891
               +ALNY+ LR+LGE  +     A  R R WIL  GG T IPSWGKI+LS+LG+Y+W G 
Sbjct  177   FCTALNYICLRILGEGPNGGGENACKRARQWILDRGGVTYIPSWGKIWLSILGLYDWSGT  236

Query  1890  NPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPY  1711
             NP+PPE WL PS  P H AK   YCR  YMPMSYLY KR+ GP+T L+L +R+E+H++PY
Sbjct  237   NPMPPEIWLLPSFLPIHLAKTLCYCRMVYMPMSYLYGKRFVGPVTPLILQLRDELHLQPY  296

Query  1710  DQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMH  1534
             ++I+WN TR    KED Y+PH  IQD++W+AL    EP++ RWP NK +RE A+R  + H
Sbjct  297   EEINWNKTRRLYAKEDMYFPHPLIQDLVWDALYILVEPVLTRWPLNKLVREKALRLAMKH  356

Query  1533  MRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGS  1354
             + Y  E S YITIG +EK L M+  W E+PN D  K HLAR+PD++W+AEDGM MQ+FGS
Sbjct  357   IHYEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGS  416

Query  1353  QNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFS  1174
             Q WD  FA QA+++S + +E G+ LKK H Y+K+SQ++ENP GDFKSMYRH SKGAW  S
Sbjct  417   QLWDTGFAVQAILASELFDETGNVLKKGHDYIKKSQVRENPSGDFKSMYRHISKGAWTLS  476

Query  1173  DQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVW  994
             D+DHGW VSDCTAEA+KC LLL  M  E+ G+ +D + +Y++V++ L  QS E+GG   W
Sbjct  477   DRDHGWQVSDCTAEALKCCLLLSMMPAEVVGQGIDPEQIYDSVNLLLSFQS-ENGGMTAW  535

Query  993   EPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKA  814
             EP     ++E LNP+E  A++V + E+VE T S++ AL  FK  YPD+R KE++ SI KA
Sbjct  536   EPVRAYEWIEFLNPTEFLANLVAEREYVECTSSVIQALILFKQLYPDHRTKEISRSIEKA  595

Query  813   AEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQE  634
              +++E +Q  DGSWYG WG+CF+YGT FAL+GL AAG++Y+ S A+RK   F L  Q  +
Sbjct  596   VQFIENEQTPDGSWYGNWGVCFIYGTWFALVGLAAAGKTYKTSPAMRKGVEFLLRTQKDD  655

Query  633   GGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQM  454
             GGWGE   SCP   YIP EG RSN+VQT+WA++GL++  QAERDP PLHRAAKL+IN+QM
Sbjct  656   GGWGESYLSCPEKIYIPSEGKRSNLVQTAWAVMGLIHAGQAERDPIPLHRAAKLIINSQM  715

Query  453   EDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             E+GDFPQQ+I G +M+NC++HYA++R+ FPL AL+EYRK
Sbjct  716   ENGDFPQQEIVGVFMRNCLIHYATYRNTFPLWALAEYRK  754



>emb|CDX87419.1| BnaA07g34540D [Brassica napus]
Length=765

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/759 (55%), Positives = 553/759 (73%), Gaps = 14/759 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGF--TKQRQKGP  2419
             MWKLKIGEG G  PY++S+NN+ GRQ WE+DP AGT EE+ A E+AR+ F   + R KG 
Sbjct  1     MWKLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTAEERAAVEEARRHFLINRSRVKG-  59

Query  2418  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2239
               C DL  RMQ +KE+  +  +IPPV++   E + +E  T A+R+ V    ALQA DGHW
Sbjct  60    --CSDLVWRMQFLKEARFEQ-AIPPVKIDGNESITHEKSTDALRRGVSFFSALQASDGHW  116

Query  2238  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  2059
             P E +GPLFF PPL+  LYI+G ++ +   EH+KE++R++Y HQNEDGGWGL+I+G S M
Sbjct  117   PGEITGPLFFLPPLVFCLYITGHLEKVFDEEHRKEMLRHVYCHQNEDGGWGLHIEGRSIM  176

Query  2058  IGSALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGC  1891
               +ALNY+ LR+LGE  +     A  R R WIL  GG T IPSWGKI+LS+LG+Y+W G 
Sbjct  177   FCTALNYICLRILGEGPNGGGENACKRARKWILDRGGVTYIPSWGKIWLSILGLYDWSGT  236

Query  1890  NPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPY  1711
             NP+PPE WL PS  P H AK   YCR  YMPMSYLY KR+ GP+T L+L +R+E+H++PY
Sbjct  237   NPMPPEIWLLPSFLPIHLAKTLCYCRMVYMPMSYLYGKRFVGPVTPLILQLRDELHLQPY  296

Query  1710  DQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMH  1534
             ++I+WN TR    KED Y+PH  IQD++W+AL    EP++ RWP NK +RE A+R  + H
Sbjct  297   EEINWNKTRRLYAKEDMYFPHPLIQDLVWDALYILVEPVLTRWPLNKLVREKALRLAMKH  356

Query  1533  MRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGS  1354
             + Y  E S YITIG +EK L M+  W E+PN D  K HLAR+PD++W+AEDGM MQ+FGS
Sbjct  357   IHYEDENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGS  416

Query  1353  QNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFS  1174
             Q WD  FA QA+++S + +E G+ LKK H Y+K+SQ++ENP GDFKSMYRH SKGAW  S
Sbjct  417   QLWDTGFAVQAILASELFDETGNVLKKGHDYIKKSQVRENPSGDFKSMYRHISKGAWTLS  476

Query  1173  DQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVW  994
             D+DHGW VSDCTAEA+KC LLL  M  E+ G+ +D + +Y++V++ L  QS E+GG   W
Sbjct  477   DRDHGWQVSDCTAEALKCCLLLSMMPAEVVGQGIDPEQIYDSVNLLLSFQS-ENGGMTAW  535

Query  993   EPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKA  814
             EP     ++E LNP+E  A++V + E+VE T S++ AL  FK  YPD+R KE++ SI KA
Sbjct  536   EPVRAYEWIEFLNPTEFLANLVAEREYVECTSSVIQALILFKQLYPDHRTKEISRSIEKA  595

Query  813   AEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQE  634
              +++E +Q  DGSWYG WG+CF+YGT FAL+GL AAG++Y+ S A+RK   F L  Q  +
Sbjct  596   VQFIENEQTPDGSWYGNWGVCFIYGTWFALVGLAAAGKTYKTSPAMRKGVEFLLRTQKDD  655

Query  633   GGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQM  454
             GGWGE   SCP   YIP EG RSN+VQT+WA++GL++  QAERDP PLHRAAKL+IN+QM
Sbjct  656   GGWGESYLSCPKKIYIPSEGKRSNLVQTAWAIIGLIHAGQAERDPIPLHRAAKLIINSQM  715

Query  453   EDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             E+GDFPQQ+I G +M+NC++HYA++R+ FPL AL+EYRK
Sbjct  716   ENGDFPQQEIVGVFMRNCLIHYATYRNTFPLWALAEYRK  754



>dbj|BAE43643.1| putative oxidosqulene cyclase [Euphorbia tirucalli]
Length=766

 Score =   887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/762 (56%), Positives = 545/762 (72%), Gaps = 11/762 (1%)
 Frame = -3

Query  2586  MWKLKIGE-GGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LKI E G  P IYSTNN+ GRQIWEYD NAGTP++    E AR  F   R    P +
Sbjct  1     MWRLKIAEQGNNPNIYSTNNFLGRQIWEYDANAGTPQDIAEVEDARLRFWNNRFHIKPSS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  + Q ++E +     IP VR++E+EEV YEA T A+R+ V L  ALQAKDGHWPA
Sbjct  61    --DLLWQFQFLREKKFKQ-RIPAVRIKEDEEVTYEAATAALRRGVHLFSALQAKDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GP+FF PP++  LYI+  +D +L+ EH  E++RY+Y HQNEDGGWGL+I+GHS M  
Sbjct  118   ENAGPMFFVPPMVFCLYITSQLDNVLSKEHIIEILRYIYCHQNEDGGWGLHIEGHSMMFS  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + LNY+ +R+LGE  +    +A  R R WIL HG ATAI SWGK +LS+LGVYEW+G +P
Sbjct  178   TVLNYICMRILGEGPNGGLENACERARKWILDHGSATAISSWGKTWLSILGVYEWEGSHP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW  P+ FP HPAKM+ YCR TYMPMSYLY K++ GPLT L+L +R EI+ +PY  
Sbjct  238   MPPEFWFLPTMFPIHPAKMFCYCRMTYMPMSYLYGKKFVGPLTPLILQLRQEIYNQPYHT  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I+W + R  C KED YYP T+IQ ++W++L   TEPI+RRWPFNK+RE A++K + H+ Y
Sbjct  298   INWKSIRHLCAKEDNYYPRTWIQKLMWDSLYIFTEPILRRWPFNKLREKALKKTMDHIHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYI IG++EK L M+  W  DPN D  K HLAR+ D++W+ EDG+ +Q+FGSQ W
Sbjct  358   EDENSRYIVIGSVEKPLNMLACWVGDPNGDAFKKHLARIVDYIWVGEDGLKVQSFGSQVW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA+F  QALI+S + +E G  L   H +LK SQ+ ENP GD KSM+RH SKGAW FSD+D
Sbjct  418   DASFGLQALIASNLSDEIGPILNHGHNFLKNSQVTENPYGDHKSMFRHISKGAWTFSDKD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE++KC LL   M  EI GEK++   LY+AV+I L LQS E+GG + WEP 
Sbjct  478   HGWQVSDCTAESLKCCLLFSLMPSEIVGEKLEAGKLYDAVNILLSLQS-ENGGLSGWEPA  536

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                P+LE LNP E   D+VV+ E+VE T S + AL  FK  YP +R KE+   IAKA ++
Sbjct  537   RGSPWLEWLNPVEFLEDLVVEHEYVECTSSSIQALTLFKKLYPGHRTKEIENFIAKAVKF  596

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             +E  Q+ DGSWYG WGICF+YGT F L GL AAG SYEN  AIR+   F L+ Q  +GGW
Sbjct  597   IEEIQKPDGSWYGNWGICFIYGTWFGLGGLAAAGNSYENCIAIRRGVEFLLNSQRVDGGW  656

Query  624   GECLESCPTMKYIPFEGN-RSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
              E   SCP   Y+  +G+ RSN+VQT++A+LGL++  QA+ DPTPLHR  K LIN+Q + 
Sbjct  657   AESYLSCPNKVYVGVDGDGRSNLVQTAFAVLGLIHGGQAKTDPTPLHRGVKFLINSQTQL  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             GDFPQQ++TG++M+NCMLHYA +R+ FPL AL+EYR+ V +S
Sbjct  717   GDFPQQELTGAFMRNCMLHYALYRNIFPLWALAEYRRNVPLS  758



>gb|KHN00954.1| Lupeol synthase [Glycine soja]
Length=755

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/757 (55%), Positives = 543/757 (72%), Gaps = 10/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI EGG   I S N++ GRQ W +DPNAGTP+E+   E+ R  FTK R     +  
Sbjct  1     MWKLKIAEGGKGLI-SVNDFIGRQHWIFDPNAGTPQERAEVERLRHQFTKNRFSIKQS-A  58

Query  2406  DLFMRMQMIKESEVDVLSIPP-VRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             DL MRMQ+ KE++     IPP V++R+ E +  E + T +R+ +    ++QA DGHWPAE
Sbjct  59    DLLMRMQLTKENQCG--PIPPAVKVRDTENITMEDLITTIRRGISFYSSIQAHDGHWPAE  116

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             ++GPLFF  PL++ALYI+GS+D++L  EHKKE+VRYLYNHQNEDGGWG +I+GHS+M GS
Sbjct  117   SAGPLFFLQPLVMALYITGSLDVVLGPEHKKEIVRYLYNHQNEDGGWGFHIEGHSSMFGS  176

Query  2049  ALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ALR+LGE + D    A+ R R WIL HGG  AIPSWGK +++VLGVYEW GCNP+
Sbjct  177   ALSYIALRILGEGSQDGEERAMDRARKWILDHGGLVAIPSWGKFWVTVLGVYEWSGCNPL  236

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWL P   P HP KM  YCR  YMPMSYLY K++ GP+T+L+ S+R E++ +PYDQI
Sbjct  237   PPEFWLLPKCSPIHPGKMLCYCRLVYMPMSYLYGKKFVGPITSLIRSLREEVYNEPYDQI  296

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +WN  R    KED YYPH  IQD+LW  L +  E +M  WPF+ +R+ A+   I H+RY 
Sbjct  297   NWNKARNIVAKEDLYYPHPMIQDMLWGFLHHVGERVMNCWPFSMLRQKALEIAINHVRYE  356

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRY+ IG++EK L ++  W EDPN +  K HLAR+PD+ WLAEDG+ +Q+FG Q WD
Sbjct  357   DENSRYLCIGSVEKVLCLIARWVEDPNSEAYKLHLARIPDYFWLAEDGLKIQSFGCQMWD  416

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             A FA QA+++  + EEYG  L+KAH ++K SQ++ENP GDFK+MYRH SKG+W FS  DH
Sbjct  417   AAFAIQAILACNVSEEYGPTLRKAHSFVKASQVRENPSGDFKAMYRHISKGSWTFSMHDH  476

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +K  LLL +M+ ++ GE+++ + LY+AV++ L LQS  +GGF  WEP  
Sbjct  477   GWQVSDCTAEGLKAALLLSEMATDLVGEEMEAERLYDAVNVILSLQS-SNGGFPAWEPQR  535

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE  NP+E F D +++ E+VE TGS +  LA F+  YP +R KE+   I+ A  Y+
Sbjct  536   AYRWLEKFNPTEFFEDTLIEMEYVECTGSAMQGLALFRKLYPKHRRKEIDHCISNAIHYI  595

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WGIC+ YGT FA++GLTA G++Y NS ++RKA  F LSKQ   GGWG
Sbjct  596   ENTQNPDGSWYGCWGICYTYGTWFAVVGLTACGKNYHNSPSLRKACKFLLSKQLPNGGWG  655

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   S     Y   EGNR+N+VQTSWA+L L+   QAE DPTP+HR  KLLIN+QMEDGD
Sbjct  656   ESYLSSQNKVYTNLEGNRANLVQTSWALLSLIDAGQAEIDPTPIHRGIKLLINSQMEDGD  715

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+ITG +M+NC L+Y+S+R+ FP+ AL EYR RV
Sbjct  716   FPQQEITGVFMRNCTLNYSSYRNIFPIWALGEYRCRV  752



>ref|XP_004251564.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Solanum lycopersicum]
Length=761

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/761 (54%), Positives = 546/761 (72%), Gaps = 10/761 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHT  2413
             MWKLKI +G    Y+YSTNNY GRQIWE+DPNAGT EEQ   E+AR+ +   R K  P++
Sbjct  1     MWKLKIAKGQDDRYLYSTNNYIGRQIWEFDPNAGTIEEQAKIEEARQHYWNNRYKVKPNS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E       I  V++ E EE+++E  T A+R+AV    ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-RIGAVKVEEGEEISHEIATIALRRAVHFFSALQATDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+G LFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ENAGLLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +AL+Y+ +R+LGE  D    +A AR R WIL HG  TAIPS GKI+LS+LG +EW G NP
Sbjct  178   TALSYICMRILGEGPDGGERNACARARKWILDHGSVTAIPSSGKIWLSILGAFEWLGTNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             IPPEF++ PS  P HPAKMW Y R  YMP+SYLY KR+ GP+T L+L +R E++ +PY++
Sbjct  238   IPPEFYILPSFLPMHPAKMWCYSRIFYMPLSYLYGKRFVGPITPLILQLREELYDQPYNE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I+W   R  C KED YYPH  +QD++W+ L +  EP++ RWPFNK+R  A+   + H+ Y
Sbjct  298   INWKRVRHLCAKEDLYYPHPLVQDLMWDTLYFFYEPLLTRWPFNKLRNKALEVTMKHLHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYIT+  + K L M+  W EDPN    K HLARVPD+LW+AEDGM MQ  GSQ+W
Sbjct  358   EDENSRYITVQCVNKVLCMLACWVEDPNGSYFKKHLARVPDYLWVAEDGMKMQNSGSQSW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D +FA QAL++S M +E  D L+K H ++K+SQ+K+NP GDF+ MYRH SKG+W FSDQD
Sbjct  418   DTSFAIQALLASEMNDEISDTLRKGHDFIKKSQVKDNPSGDFRGMYRHISKGSWTFSDQD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             +GW  SD TAEA++C L    M  ++ GE ++   LY++V++ L LQS ++GG A WEP 
Sbjct  478   YGWQSSDTTAEALRCCLFFSTMPSKLVGEAMEPARLYDSVNVILSLQS-KNGGLAAWEPA  536

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 YLE+LNP+E+F D+V++ E+VE TGS + AL  FK  YP +R  E+   I  A +Y
Sbjct  537   GTSKYLELLNPTEIFEDVVIEHEYVECTGSSIQALVHFKKLYPGHRTTEIDNFIDNAVKY  596

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             +E  Q+ DGSWYG+WG+CF Y + FAL GL AAG+SY NS A+RK   F L +Q  +GGW
Sbjct  597   IENVQRPDGSWYGFWGVCFTYASWFALGGLAAAGKSYSNSAAVRKGVDFLLQRQRSDGGW  656

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP   Y   E   SN+VQT+WA++GL+++ QA+RDP PLHRAA+LLIN+QMEDG
Sbjct  657   GESYHSCPDKVYRELETEHSNLVQTAWALMGLIHSGQADRDPKPLHRAARLLINSQMEDG  716

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             DFPQQ+ITG++MKNCMLHYA+ R+ FPL  L+EYRK V +S
Sbjct  717   DFPQQEITGAFMKNCMLHYATFRNIFPLWGLAEYRKNVSVS  757



>gb|KFK40207.1| hypothetical protein AALP_AA3G344300 [Arabis alpina]
Length=763

 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/762 (53%), Positives = 546/762 (72%), Gaps = 10/762 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLK GEG G  PY++S+NN+ GRQ WE+DP AGTPEE+ A E+AR+ F   R +    
Sbjct  1     MWKLKTGEGNGEDPYLFSSNNFVGRQTWEFDPEAGTPEERAAVEEARRSFMDNRSR-VKA  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ +KE++ + + IPPV++ + E + +E  T A+R+ +    ALQA DGHWP 
Sbjct  60    SSDLLWRMQFLKEAKFEQV-IPPVKISDYESITHENATNALRRGIAFFSALQASDGHWPG  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +GPLFF PPL+  L+I+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+  S M  
Sbjct  119   EITGPLFFLPPLVFCLHITGHLEEVFDAEHRKEMLRYIYCHQNEDGGWGLHIESKSVMFS  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ LR+LG   D    +A  R R WIL HGG T IPSWGKI+LS+LG+Y+W G NP
Sbjct  179   TALNYICLRILGVGPDGGRENACKRARQWILNHGGVTYIPSWGKIWLSILGIYDWSGTNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPE WL PS  P H  K   Y R  YMPMSYLY KR+ GP+T L++ +R E+H++PY++
Sbjct  239   MPPEIWLLPSFLPIHLGKTLCYTRMVYMPMSYLYGKRFVGPITPLIMQLREELHLQPYEE  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W   R    KEDTYYPH  +QD++W+ L    EP +  WP NK +RE A+   + H+ 
Sbjct  299   INWKKARRLYAKEDTYYPHPLVQDLIWDTLNMFVEPFLTSWPLNKLVREKALGVAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E + YITIG IEK L M+  W E P+ D  K HL+R+ D++W+AEDG+ +Q FGSQ 
Sbjct  359   YEDESTHYITIGCIEKVLCMLACWIEKPDGDNFKKHLSRISDYIWVAEDGLKIQCFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             W+  FA QALISS + +E  + L++ H Y+KQSQ++ENP GDFKSMYRH SKG+W FSD+
Sbjct  419   WETGFAIQALISSDLCDETYEVLRRGHSYIKQSQVRENPSGDFKSMYRHISKGSWTFSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAEA+KC +LL  M  ++ G+K+D + LY++V + L LQS  +GG   WEP
Sbjct  479   DHGWQVSDCTAEALKCCMLLSMMPSDVVGQKIDPENLYDSVHLLLSLQSA-NGGLTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LE+LNP+E FA+++V+ E+VE T +++ AL  FK  YPD+R KE+  SI KAA+
Sbjct  538   VRGHEWLELLNPTEFFANVMVEREYVECTSAVIQALVIFKQLYPDHRTKEITKSIEKAAQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             ++E++Q  DGSWYG WGICF+YGT FAL GL A G++Y N  ++RK   F L  QN++GG
Sbjct  598   FIESKQMLDGSWYGDWGICFMYGTWFALSGLAAIGKTYNNCLSVRKGVDFLLMIQNEDGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +YIP EGNRSN+VQT+WAM+GL++  QA+RD  P+HRAA+ +I +Q+E+
Sbjct  658   WGESYLSCPEQRYIPLEGNRSNLVQTAWAMMGLIHAGQAKRDLLPIHRAARFIITSQLEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             GDFPQQ+I G++M  CMLHYA++R+ FPL AL+EYRK  +++
Sbjct  718   GDFPQQEIVGAFMNTCMLHYATYRNTFPLWALAEYRKVAFVT  759



>ref|XP_006606308.1| PREDICTED: lupeol synthase-like isoform X1 [Glycine max]
 ref|XP_006606309.1| PREDICTED: lupeol synthase-like isoform X2 [Glycine max]
Length=755

 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/757 (55%), Positives = 543/757 (72%), Gaps = 10/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI EGG   I S N++ GRQ W +DPNAGTP+E+   E+ R  FTK R     +  
Sbjct  1     MWKLKIAEGGKGLI-SVNDFIGRQHWIFDPNAGTPQERAEVERLRHQFTKNRFSIKQS-A  58

Query  2406  DLFMRMQMIKESEVDVLSIPP-VRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             DL MRMQ+ KE++     IPP V++R+ E +  E + T +R+ +    ++QA DGHWPAE
Sbjct  59    DLLMRMQLTKENQCG--PIPPAVKVRDTENITMEDMITTIRRGISFYSSIQAHDGHWPAE  116

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             ++GPLFF  PL++ALYI+GS+D++L  EHKKE+VRYLYNHQNEDGGWG +I+GHS+M GS
Sbjct  117   SAGPLFFLQPLVMALYITGSLDVVLGPEHKKEIVRYLYNHQNEDGGWGFHIEGHSSMFGS  176

Query  2049  ALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             AL+Y+ALR+LGE + D    A+ R R WIL HGG  AIPSWGK +++VLGVYEW GCNP+
Sbjct  177   ALSYIALRILGEGSQDGEERAMDRARKWILDHGGLVAIPSWGKFWVTVLGVYEWSGCNPL  236

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWL P   P HP KM  YCR  YMPMSYLY K++ GP+T+L+ S+R E++ +PYDQI
Sbjct  237   PPEFWLLPKCSPIHPGKMLCYCRLVYMPMSYLYGKKFVGPITSLIRSLREEVYNEPYDQI  296

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +WN  R    KED YYPH  IQD+LW  L +  E +M  WPF+ +R+ A+   I H+RY 
Sbjct  297   NWNKARNIVAKEDLYYPHPMIQDMLWGFLHHVGERVMNCWPFSMLRQKALEIAINHVRYE  356

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRY+ IG++EK L ++  W EDPN +  K HLAR+PD+ WLAEDG+ +Q+FG Q WD
Sbjct  357   DENSRYLCIGSVEKVLCLIARWVEDPNSEAYKLHLARIPDYFWLAEDGLKIQSFGCQMWD  416

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             A FA QA+++  + EEYG  L+KAH ++K SQ++ENP GDFK+MYRH SKG+W FS  DH
Sbjct  417   AAFAIQAILACNVSEEYGPTLRKAHSFVKASQVRENPSGDFKAMYRHISKGSWTFSMHDH  476

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE +K  LLL +M+ ++ GE+++ + LY+AV++ L LQS  +GGF  WEP  
Sbjct  477   GWQVSDCTAEGLKAALLLSEMATDLVGEEMEAERLYDAVNVILSLQS-SNGGFPAWEPQR  535

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE  NP+E F D +++ E+VE TGS +  LA F+  YP +R KE+   I+ A  Y+
Sbjct  536   AYRWLEKFNPTEFFEDTLIEMEYVECTGSAMQGLALFRKLYPKHRRKEIDHCISNAIHYI  595

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WGIC+ YGT FA++GLTA G++Y NS ++RKA  F LSKQ   GGWG
Sbjct  596   ENTQNPDGSWYGCWGICYTYGTWFAVVGLTACGKNYHNSPSLRKACKFLLSKQLPNGGWG  655

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   S     Y   EGNR+N+VQTSWA+L L+   QAE DPTP+HR  KLLIN+QMEDGD
Sbjct  656   ESYLSSQNKVYTNLEGNRANLVQTSWALLSLIDAGQAEIDPTPIHRGIKLLINSQMEDGD  715

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+ITG +M+NC L+Y+S+R+ FP+ AL EYR RV
Sbjct  716   FPQQEITGVFMRNCTLNYSSYRNIFPIWALGEYRCRV  752



>ref|XP_003530475.1| PREDICTED: lupeol synthase isoform 1 [Glycine max]
Length=763

 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/757 (55%), Positives = 545/757 (72%), Gaps = 8/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI EGG   I S NN+ GRQ WE+DPNAGTP+E+   E+ R+ + K R     + G
Sbjct  1     MWKLKIAEGGDGLI-SVNNFIGRQHWEFDPNAGTPQERAQVERVREEYKKNRFCIKQS-G  58

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             DL MRMQ+ KE+    + +  V +++ E V  EA+ T +RKA+    ++QA DGHWPAE+
Sbjct  59    DLLMRMQLTKENTCGPI-LARVNVKDTENVTEEALITTMRKAINFYSSIQAHDGHWPAES  117

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +GPLFF  PL++ALYI+GS++ +L  EH+KE++RYLYNHQNEDGGWGL+I+ HSTM GSA
Sbjct  118   AGPLFFLQPLVMALYITGSLNDVLGPEHQKEIIRYLYNHQNEDGGWGLHIESHSTMFGSA  177

Query  2046  LNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             L+Y+ALR+LGE  +D    A+ARGR WIL HGG  AIPSWGK +++VLGVYEW GCNP+P
Sbjct  178   LSYIALRILGEGPEDGEDRAMARGRKWILDHGGLEAIPSWGKFWVTVLGVYEWSGCNPLP  237

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PE WL P + P HP KM  YCR  YMPMSYL+ KR+ GP+T L++S+R E++ +PYDQID
Sbjct  238   PEIWLLPKYAPIHPGKMLCYCRLVYMPMSYLFGKRFVGPITGLIISLREEMYNQPYDQID  297

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             WNN R    KED YYPH  IQD+LW +L +  EP++  WPF+ +RE A+   I H+RY  
Sbjct  298   WNNARSTVAKEDLYYPHPLIQDMLWASLHHVAEPLLNCWPFSMLREKALEVAIDHIRYED  357

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             E S Y+ IG++EK L ++  W EDPN +  K HLAR+PD+ WLAEDG+ +Q+ GSQ WDA
Sbjct  358   ENSGYLCIGSVEKVLCLIARWVEDPNSEAYKLHLARIPDYFWLAEDGLKIQSLGSQLWDA  417

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
             T A QA+IS  + EEYG  L+KAH ++K SQ+ ENP G+FK+M+RH SKGAW FS QD G
Sbjct  418   TLAIQAIISCDLSEEYGPTLRKAHHFVKASQVLENPSGNFKAMHRHISKGAWTFSMQDQG  477

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCTAE +K  LLL QMSP++ GEK++ +  Y+AVD+ L LQS  +GGF  WEP   
Sbjct  478   WQVSDCTAEGLKAALLLSQMSPDLIGEKMEDERFYDAVDVILSLQSG-NGGFPAWEPQRA  536

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
               +LE  NP+E+F D +++ E+VE T S +  LA F+  YP +R KEV + I+KA  Y+E
Sbjct  537   YRWLEKFNPTEIFKDTLIEMEYVECTSSALQGLALFRKLYPKHRRKEVDLCISKAIRYIE  596

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
               Q  DGSW+G WGIC+ YGT F++ GLT  G++Y NS A+RKA  F LSKQ   GGWGE
Sbjct  597   KTQNPDGSWFGCWGICYTYGTLFSVKGLTDCGKNYRNSPALRKACKFLLSKQLPNGGWGE  656

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                S     Y   +GNR+N+VQTSWA++ L+   Q E DPTP+ R  +LLIN+QMEDGDF
Sbjct  657   SYLSSQNKVYTNLKGNRANLVQTSWALMSLIDAGQVEIDPTPVERGIRLLINSQMEDGDF  716

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVW  328
             PQQ+ITG +M+NC L+Y+S+R+ F + AL EYR+RV+
Sbjct  717   PQQEITGVFMRNCTLNYSSYRNIFLIWALGEYRRRVF  753



>emb|CDP08328.1| unnamed protein product [Coffea canephora]
Length=801

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/800 (51%), Positives = 559/800 (70%), Gaps = 52/800 (7%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHTC  2410
             MWKLK+ EG GP+++STNN+ GRQIWE+DP+ GTPEE+   EKAR  + K R Q  P   
Sbjct  1     MWKLKVAEGHGPWLFSTNNFLGRQIWEFDPDLGTPEERAQVEKARTDYRKNRFQAKP--S  58

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              D+  +MQ+IKE++ D LS+P +R    E +  E +T+A+RKAVR   A+QA+DGHWPAE
Sbjct  59    ADILKQMQLIKENQAD-LSLPNIRFERVEGITGEMVTSALRKAVRFTSAVQAQDGHWPAE  117

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              SGPLF+ PPL + LY SG+++++L++EHKKE++RY+YNHQNEDGGWG +I+ HSTM GS
Sbjct  118   MSGPLFYLPPLTMLLYTSGTMNVVLSAEHKKEIMRYIYNHQNEDGGWGFHIEDHSTMFGS  177

Query  2049  ALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             A NYVALRLLGE  D    +A+++ RNWIL HGG T IPSWGK+  S++G+Y+W GCNPI
Sbjct  178   ANNYVALRLLGENVDGPNGNALSKARNWILNHGGLTMIPSWGKMGFSLIGLYDWSGCNPI  237

Query  1881  PPEFWLFPSHFPFHPA------------------------------KMWNYCRTTYMPMS  1792
             PPE +L PS  P HP                                +W Y R TYMP++
Sbjct  238   PPELFLLPSCLPIHPGTNYLYCKYLPTFSRILQVSLAAKILARSLRNLWCYLRETYMPLA  297

Query  1791  YLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQ  1612
             YLY ++Y GP+T+L+LS+RNE++ +PYD I+WN TR +C K+D   P  F+QD +W+ L 
Sbjct  298   YLYGRKYVGPITDLILSLRNELYNEPYDTINWNATRHSCLKDDLTSPQPFMQDTVWDILH  357

Query  1611  YCTEPIMRRWPFNKIREMAMRKVIMHMRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDE  1432
             +  EP+++ WPF+K+RE A+RK++ H+ Y  E SRY+ I  ++K L MM  WAEDPN + 
Sbjct  358   HVGEPVLKLWPFSKLRENALRKLMAHIHYEDENSRYVNIACVQKVLHMMACWAEDPNPNS  417

Query  1431  --LKYHLARVPDFLWLAEDGMTMQTFGSQNWDATFATQALISSGMVEEYGDCLKKAHFYL  1258
                K HLARVPD+LW+AEDGM MQ+ GSQ WD  F TQA+++S +V+E+G  LKKA+ ++
Sbjct  418   TFFKCHLARVPDYLWIAEDGMKMQSMGSQLWDTVFTTQAIVASDLVDEFGTTLKKAYQFI  477

Query  1257  KQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGE  1078
             K+SQI+ENP G+F+SMYRH  KGAW  +D+DHGW VSDCTAEA+K  LLL  MS ++ GE
Sbjct  478   KESQIQENPSGNFRSMYRHPCKGAWMLADRDHGWQVSDCTAEALKASLLLSNMSIDVVGE  537

Query  1077  KVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQPYLEMLNPSELFADIVVQGE------  916
              ++V+ LYEAVD  L LQ  ++GGF +WEP     + E  NP++LF +  V+ +      
Sbjct  538   MIEVERLYEAVDFILSLQG-KTGGFTIWEPATLPKWFEFFNPTQLFQNATVEYDDYKSKK  596

Query  915   -----HVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLETQQQADGSWYGYWGIC  751
                  +VE T S+V AL  F + +P YR K+V  SI  A +++E  Q  DGSW+G+W IC
Sbjct  597   KKKNLYVECTSSVVQALVLFNNSFPMYRQKDVKASIKSATQFIEKTQNPDGSWFGFWAIC  656

Query  750   FLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGECLESCPTMKYIPFEGN  571
             + Y +  AL  L A G++Y NSE ++KA  F LSKQ + GGWGE   SC   +Y  F+G 
Sbjct  657   YTYASWLALGALAACGKTYSNSETVQKACQFLLSKQQESGGWGESYHSCIKKEYTNFDGE  716

Query  570   RSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFPQQDITGSYMKNCMLH  391
              S++VQTSWA++ L++  QA+RDP PLH+AA LL+N+QM+DG FPQQ++TG+ M NC+LH
Sbjct  717   TSHLVQTSWALMALIHAGQAKRDPIPLHKAAMLLVNSQMDDGSFPQQEMTGASMGNCILH  776

Query  390   YASHRSYFPLMALSEYRKRV  331
             YA+HR+ FPL AL+EYRK V
Sbjct  777   YAAHRNIFPLWALAEYRKNV  796



>dbj|BAG82628.1| beta-amyrin synthase [Arabidopsis thaliana]
Length=759

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/759 (55%), Positives = 547/759 (72%), Gaps = 10/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LKIGEG G  PY+++TNN+AGRQ WE+DP+ G+PEE+ +  +AR+ F   R      
Sbjct  1     MWRLKIGEGNGDDPYLFTTNNFAGRQTWEFDPDGGSPEERHSVVEARRIFYDNRFH-VKA  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E + +   I PV++ + E+V +E  T+A+R+ +    ALQA DGHWPA
Sbjct  60    SSDLLWRMQFLREKKFEQ-RIAPVKVEDSEKVTFETATSALRRGIHFFSALQASDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL+  LYI+G +D + TSEH+KE++RY+Y HQ EDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVFCLYITGHLDEVFTSEHRKEILRYIYCHQKEDGGWGLHIEGHSTMFC  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + LNY+ +R+LGE  D    +A  R R WIL HGG T IPSWGK +LS+LGV++W G NP
Sbjct  179   TTLNYICMRILGESPDGGHDNACGRAREWILSHGGVTYIPSWGKTWLSILGVFDWSGSNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS FP HPAKMW+YCR  Y+PMSYLY KR+ GP+T+L+L +R E++++PY++
Sbjct  239   MPPEFWILPSFFPVHPAKMWSYCRMVYLPMSYLYGKRFVGPITSLILQLRKELYLQPYEE  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHMR  1528
             I+W   R  C KEDTYYP   +Q+++W++L    E  + RWPFNK+ RE A++  + H+ 
Sbjct  299   INWMKVRHLCAKEDTYYPRPLVQELVWDSLYIFAELFLARWPFNKLLREKALQLAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDPN D  K HL+R+ D+LW+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLSRISDYLWMAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S +  E  D L++ H ++K SQ+ ENP GD+KSMYRH SKGAW FSD+
Sbjct  419   WDTGFAMQALLASNLSSEISDVLRRGHEFIKNSQVGENPSGDYKSMYRHISKGAWTFSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTA  +KC LL   ++P+I G K D + L+++V+I L LQS ++GG   WEP
Sbjct  479   DHGWQVSDCTAHGLKCCLLFSMLAPDIVGPKQDPERLHDSVNILLSLQS-KNGGMTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  + E+LNP+E+F+DIV++ E+ E T S + AL+ FK  YPD+R  E+   I KAAE
Sbjct  538   AGAPKWSELLNPTEMFSDIVIEHEYSECTSSAIQALSLFKQLYPDHRTTEITAFIKKAAE  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG WGICF YGT FAL GL AAG+++ + EAIRK   F L+ Q   GG
Sbjct  598   YLENMQTRDGSWYGNWGICFTYGTWFALAGLAAAGKTFNDCEAIRKGVQFLLAAQKDNGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SC    YI   G  SNVVQT+WA++GL+++ QAERDP PLHRAAKL+IN+Q+E 
Sbjct  658   WGESYLSCSKKIYIAQVGEISNVVQTAWALMGLIHSGQAERDPIPLHRAAKLIINSQLES  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ  TG ++KNC LHYA++R+  PL AL+EYR RV
Sbjct  718   GDFPQQQATGVFLKNCTLHYAAYRNIHPLWALAEYRARV  756



>ref|XP_006389936.1| hypothetical protein EUTSA_v10018166mg [Eutrema salsugineum]
 gb|ESQ27222.1| hypothetical protein EUTSA_v10018166mg [Eutrema salsugineum]
Length=765

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/761 (53%), Positives = 543/761 (71%), Gaps = 10/761 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LKIGEG G  PY++S+NN+ GRQ WE+DP AGTPEE+ A E+AR+GF   R +    
Sbjct  6     MWRLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTPEERAAVEEARRGFLANRSR-VKG  64

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
             C DL  RMQ +KE++ + + IPPV++   E + YE  T A+R+ V    ALQA DGHWP 
Sbjct  65    CSDLLWRMQFLKEAKFEQV-IPPVKIDGGEGITYEKATNALRRGVSFFSALQASDGHWPG  123

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +GPLFF PPL+  LYI+G ++ +  +EH++E++R++Y HQNEDGGWGL+++  S M  
Sbjct  124   EITGPLFFLPPLVFCLYITGHLEKVFDAEHRREMLRHIYCHQNEDGGWGLHVESKSVMFC  183

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ LR+LGE  +    +A  R R WIL  GG T IPSWGK++LS+LG+Y+W G NP
Sbjct  184   TALNYICLRMLGEGPNGGRENACKRARQWILDRGGVTYIPSWGKVWLSILGIYDWSGTNP  243

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPE W  PS  P H  K   Y R  YMPMSYLY KR+ GPLT L++ +R E+H++PY++
Sbjct  244   MPPEIWFLPSFIPIHLGKTLCYTRMVYMPMSYLYGKRFVGPLTPLIMLLRQELHLQPYEE  303

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+WN  R    KED +YPH  +QD++W+ L    EP +  WP NK +RE A+R  + H+ 
Sbjct  304   INWNKARRLFAKEDMFYPHPLVQDLIWDTLYIFVEPFLTSWPLNKLVREKALRLAMSHIH  363

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E S YITIG +EK L M+  W E+PN +  K HLAR+PD++W+AEDG+ MQ+FGSQ 
Sbjct  364   YEDENSHYITIGCVEKVLCMLACWIENPNGEHFKKHLARIPDYMWVAEDGLKMQSFGSQL  423

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             W+  FA QALI+S + ++  D L+K H Y+K SQ+ ENP GDFKSMYRH SKGAW  SD+
Sbjct  424   WETGFAIQALIASDLCDKTDDVLRKGHSYIKSSQVIENPSGDFKSMYRHISKGAWTLSDR  483

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAEA+KC +LL  M  E+ G+K+D + LY++V++ L LQ  E+GG   WEP
Sbjct  484   DHGWQVSDCTAEAMKCCMLLSMMPAEVVGQKIDPEQLYDSVNLMLSLQG-ENGGLTAWEP  542

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LE LNP+E FA+++ + E+VE T +++ AL  FK  YPD+R KE+  SI KA  
Sbjct  543   VRAHEWLEFLNPTEFFANVMAEREYVECTSAVLQALVLFKQLYPDHRTKEIIKSIEKAVR  602

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             ++E++Q  DGSWYG WGICF+YGT FAL GL AAG++Y++  A+RK   F L  Q + GG
Sbjct  603   FIESKQTPDGSWYGNWGICFIYGTWFALSGLAAAGKTYKSCLAMRKGVDFLLRIQKENGG  662

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +YI  EGN SN+VQT+WAM+GL++  QAERDP PLHRAAK +I +Q+E+
Sbjct  663   WGESHMSCPEQRYIQLEGNGSNLVQTAWAMMGLIHAGQAERDPIPLHRAAKFIITSQLEN  722

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWI  325
             GDFPQQ+I G +M  CM+HYA++R+ FP+ AL+EYRK V++
Sbjct  723   GDFPQQEILGVFMNTCMIHYATYRNTFPIWALAEYRKAVFV  763



>dbj|BAF35580.1| multifunctional triterpene synthase [Kandelia candel]
Length=761

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/755 (54%), Positives = 546/755 (72%), Gaps = 8/755 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG-GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EGG  PYIYSTNN+ GRQ WE++P AGTPEE+   E+AR+ F + R +    C
Sbjct  1     MWRLKIAEGGDNPYIYSTNNFLGRQTWEFEPEAGTPEERAQVEEARQNFWRDRFR-IKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  R Q ++E +   + IP  ++++ EE+  +  TTA+R++V L  ALQA DGHW AE
Sbjct  60    SDLLWRFQFLREKKFKQI-IPQGKVQDGEEITRDIATTALRRSVHLLSALQASDGHWCAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             NSGP+F+ PP++ ALYI+G +  + ++EH KE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NSGPMFYVPPMVFALYITGHLTTVFSAEHCKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              LNY+ +R+LGE      D+A  R R WIL HG ATAI SWGK +L++LGVYEWDGCNP+
Sbjct  179   VLNYICMRILGEGRDGGKDNACERARKWILDHGSATAISSWGKTWLAILGVYEWDGCNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+FP+ FP HPAKM  YCR TY+ MSYLY K++ GP+T L+L +R EI+ +PYD+I
Sbjct  239   PPEFWVFPTFFPIHPAKMLCYCRLTYIAMSYLYGKKFVGPITPLILQLREEIYNEPYDEI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +W+  R  C KED +YPHT  Q +LW+A+   +EP+++RWP++K+R+ A++  I H+ Y 
Sbjct  299   NWSRMRHLCAKEDNHYPHTLTQIILWDAIYLLSEPLLKRWPWSKLRKKALKITIDHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG +EK L M+  W EDPN D  K HLAR+ D++WLAEDGM +Q+FGSQ WD
Sbjct  359   DENSRYITIGCVEKPLNMLACWHEDPNGDAFKKHLARISDYVWLAEDGMKIQSFGSQAWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
              +F  QALI+S ++ E    L+K H ++K SQ+ ENP GDF+ M+RH SKG+W FSD+DH
Sbjct  419   TSFVLQALIASNLLSETAPTLEKGHNFIKDSQVTENPSGDFRRMFRHISKGSWTFSDKDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE++KC LL   M PE+ G K++ Q +Y+AV++ + LQS ++GG + WE   
Sbjct  479   GWQVSDCTAESLKCCLLFSMMPPELVGRKMEPQRVYDAVNVIISLQS-KNGGCSAWEQAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                ++E LNP E   D+V++ E++E T S V AL  FK  YP++R KE+   I  A  ++
Sbjct  538   AGSWMEWLNPVEFLEDLVIEHEYIECTSSSVQALVLFKKLYPEHRRKEIENFIVNAVRFI  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q+ DGSWYG WGICFL+GT F L GL  AG++Y N  A+RK   F L  Q ++ GWG
Sbjct  598   EEIQKPDGSWYGNWGICFLFGTWFGLKGLATAGKTYYNCTAVRKGVEFLLRTQREDSGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP   Y+P EGN+SN++ T+ AM+GL+ + QAERDPTPLHRA KLLIN+Q E GD
Sbjct  658   ESYLSCPKKVYVPLEGNQSNLIHTALAMMGLILSGQAERDPTPLHRALKLLINSQTELGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             FPQQ+I+G +M+NCMLHY+++R  FP+ AL+EY K
Sbjct  718   FPQQEISGCFMRNCMLHYSAYRDIFPMWALAEYCK  752



>ref|XP_002310351.1| hypothetical protein POPTR_0007s15210g [Populus trichocarpa]
 gb|EEE90801.1| hypothetical protein POPTR_0007s15210g [Populus trichocarpa]
Length=759

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/755 (55%), Positives = 535/755 (71%), Gaps = 6/755 (1%)
 Frame = -3

Query  2586  MWKLKIGE-GGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI E G  PYI++TN YAGRQIWEYDPNAGTPEE+E  E+AR+ FTK R K     
Sbjct  1     MWRLKIAEKGNNPYIFTTNEYAGRQIWEYDPNAGTPEEREQVEEARRNFTKNRSK-VKPS  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  + Q+++E      +IP VR+ E EEV YE  TTA++++     ALQA DGHWPAE
Sbjct  60    SDLLWQYQILREKNFKQ-TIPAVRVEEGEEVTYEKTTTAMKRSASFYSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             NSG LFF PP +   YI+G ++ +   E++KE+ RY+YNHQNEDGGWGL+I+ HS M  +
Sbjct  119   NSGVLFFLPPFVFCFYITGHLNTMFPPEYRKEIFRYIYNHQNEDGGWGLHIESHSNMFCT  178

Query  2049  ALNYVALRLLGEEADD-AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPPE  1873
               +Y+ LR+LG   D+ A ARGR WIL  GG T+IPSWGK +LS+LG+++W GCNP+PPE
Sbjct  179   TFSYICLRMLGVGPDEEACARGRKWILDRGGVTSIPSWGKTWLSILGLFDWSGCNPMPPE  238

Query  1872  FWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDWN  1693
             FW+ P+  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+LS+R E++++PY+ + W 
Sbjct  239   FWILPTALPVHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILSLREELYLQPYESVKWK  298

Query  1692  NTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRYGAE  1516
               R  C +ED YYPH+ IQD LW++L   +EP++ RWPFN+ +R+ A+   + H+ Y  E
Sbjct  299   QVRHLCAEEDLYYPHSLIQDFLWDSLYLMSEPLLTRWPFNQLVRKKALEVTMKHIHYEDE  358

Query  1515  ESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDAT  1336
              SRYITIG +EK L M+  W EDP+    K HLARVPD+LW+ EDGM +Q+FGSQ WDAT
Sbjct  359   NSRYITIGCVEKVLCMLSCWVEDPDGVAFKRHLARVPDYLWVGEDGMKVQSFGSQLWDAT  418

Query  1335  FATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGW  1156
             F  QAL +S + EE    L KA  ++K+SQ+ +NP GDF  MYRH SKG+W FSDQDHGW
Sbjct  419   FGFQALYTSELGEEIKPTLAKAFDFIKKSQVVDNPAGDFVGMYRHISKGSWTFSDQDHGW  478

Query  1155  VVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQ  976
              +SDCTAEA+KC+L    +  E  GEK+D Q ++EAV+I L LQ P  GG A WEP   +
Sbjct  479   QLSDCTAEALKCVLFAQMLPTEYIGEKMDPQMIFEAVNIILSLQGPR-GGLAGWEPIRGE  537

Query  975   PYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLET  796
              +LE LNP E   +IV++ ++VE T S +     F   YP +R KE+   IA+A +YLE 
Sbjct  538   MWLEKLNPMEFLENIVIEHDYVECTSSAIHGFVMFMKMYPGHRKKEIETFIARAVDYLEM  597

Query  795   QQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGEC  616
              Q  DGSWYG WG+CF+Y T FAL+GL AAG++Y N++A+R+   F L  Q+ +GGWGE 
Sbjct  598   IQMPDGSWYGNWGVCFIYSTWFALVGLAAAGKTYYNNQAMRRGVDFLLRAQSPDGGWGES  657

Query  615   LESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFP  436
               SCP   Y P E  RS  VQT WAMLGL+++ QA+RDPTPLHR AKLLIN+Q EDG +P
Sbjct  658   YLSCPNKIYTPLEEKRSTYVQTGWAMLGLIHSGQADRDPTPLHRGAKLLINSQAEDGSYP  717

Query  435   QQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             QQ+ITG +  NCMLHY ++++ FPL AL+EYRK V
Sbjct  718   QQEITGVFKNNCMLHYPTYKNVFPLWALAEYRKNV  752



>ref|XP_010429761.1| PREDICTED: beta-amyrin synthase [Camelina sativa]
Length=759

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/759 (55%), Positives = 546/759 (72%), Gaps = 10/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LKIGEG G  PY+++TNN+ GRQ WE+DP+ G+PEE+ A  +AR+ F + R      
Sbjct  1     MWRLKIGEGNGDDPYLFTTNNFVGRQTWEFDPDGGSPEERNAVVEARRSFYENRFH-VKA  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ +KE + + + IPPV++   E++  E  T A+R+ VR   ALQA DGHWPA
Sbjct  60    SSDLLWRMQFLKEKKFEQV-IPPVKVEGSEKITLETATNALRRGVRFLSALQASDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL+  LYI+G +D + TSEH++E++RY+Y HQ EDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVFCLYITGHLDEVFTSEHRREILRYIYCHQKEDGGWGLHIEGHSTMFC  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ +R+LGE  D    +A  R R WIL HGG T IPSWGK +LS+LGV++W G  P
Sbjct  179   TALNYICMRILGESPDGGHENACRRAREWILFHGGVTYIPSWGKTWLSILGVFDWSGSTP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS FP +P KMW YCR  Y+PMSYLY KR+ GP+T L+L +R E++++PY++
Sbjct  239   MPPEFWILPSFFPVNPGKMWCYCRMVYLPMSYLYGKRFVGPITPLILQLRKELYLQPYEE  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHMR  1528
             I+W        KEDTYYP   +Q+++W++L    EP + RWPFNK+ R+ +++  + HM 
Sbjct  299   INWKKVCHLSAKEDTYYPRPLVQELIWDSLSIFVEPFLARWPFNKLLRQKSLQVAMKHMH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  W EDP+    K HLAR+PD+LW+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSRYITIGCVEKVLCMLACWVEDPDGVYFKKHLARIPDYLWVAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S +  E  D L + H ++K SQ++ENP GDFKSMYRH SKGAW FSD+
Sbjct  419   WDTGFAMQALLASNLSSEISDVLMRGHEFIKNSQVRENPSGDFKSMYRHISKGAWTFSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTA+ +KC LL   ++P+I G K D + LY++V+I L LQS ++GG + WE 
Sbjct  479   DHGWQVSDCTADGLKCCLLFSMLAPDIVGPKQDPERLYDSVNILLTLQS-KNGGVSAWEA  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LE+ NP+ELF+DIVV+ E+ E T S + AL+ FK  +PD+R  E+   I+KA  
Sbjct  538   AGAPKWLELFNPTELFSDIVVEHEYCECTSSAIQALSLFKQLFPDHRTTEITTFISKAVH  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG WGICF YGT FAL GL AAG++Y +  A+RK  HF L+ Q   GG
Sbjct  598   YLENMQTPDGSWYGNWGICFTYGTWFALAGLAAAGKTYNDCVAMRKGVHFLLATQKVNGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SC T +YI  EG+ SNVVQT+WA++GL++  QAERDP PLHRAAKL+IN+Q+E 
Sbjct  658   WGESYLSCSTKRYIEQEGDISNVVQTAWALMGLIHAGQAERDPLPLHRAAKLIINSQLES  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ  TG ++KNC LHYA++R+  PL AL+EYR RV
Sbjct  718   GDFPQQQATGVFLKNCTLHYAAYRNIHPLWALAEYRARV  756



>ref|XP_004309763.1| PREDICTED: beta-amyrin synthase-like [Fragaria vesca subsp. vesca]
Length=765

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/762 (54%), Positives = 547/762 (72%), Gaps = 13/762 (2%)
 Frame = -3

Query  2586  MWKLKIGEG---GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2416
             MWKLK+ EG      Y+YSTNN+ GRQ WE+DP+AGT EE+   E AR  F   R +   
Sbjct  1     MWKLKVSEGEKDSSGYLYSTNNFVGRQTWEFDPDAGTAEERAEVEAARLHFHNNRHE-VK  59

Query  2415  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2236
               GDL  RMQ ++E +    +IPPV++ + E + +E  T A+R++V    ALQA DGHWP
Sbjct  60    PSGDLLWRMQFLREKKFKQ-TIPPVKVEDGEVITHEKTTDALRRSVHFLSALQASDGHWP  118

Query  2235  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGH-STM  2059
             AEN+GPLFF PPL++ ++I+G +  + + EH+KE++RY+Y HQNEDGGWGL+I+G  STM
Sbjct  119   AENAGPLFFLPPLVMVMHITGHLKSVFSEEHRKEILRYIYYHQNEDGGWGLHIEGRKSTM  178

Query  2058  IGSALNYVALRLLGEEADD-----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDG  1894
               +AL+Y+ +R+LGE  DD     A  R R WIL HGG T IPSWGK +LS+LG+++W G
Sbjct  179   FSTALSYIFMRILGEGPDDGGQDNACPRARKWILDHGGVTHIPSWGKTWLSILGLFDWSG  238

Query  1893  CNPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKP  1714
              NP+PPEFW+ PS FP HPAK+W YCR TYMPMSYLY KR+ GP+T L++ +R E+  +P
Sbjct  239   SNPMPPEFWILPSFFPMHPAKIWCYCRMTYMPMSYLYGKRFVGPITPLIIQLREELFTQP  298

Query  1713  YDQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIM  1537
             Y +I+W   R  C KED YYPH +IQD+LW++L   TEP++ RWPFNK IRE A++  + 
Sbjct  299   YGEINWKKARHLCAKEDIYYPHPWIQDLLWDSLYIFTEPLLTRWPFNKLIREKALQVTMS  358

Query  1536  HMRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFG  1357
             H+ Y  E SRYIT+G +EK L M+  W EDPN D  K HLAR+ D+LW+AEDGM MQ FG
Sbjct  359   HIHYEDENSRYITMGCVEKVLCMLACWVEDPNGDYFKKHLARIRDYLWVAEDGMKMQGFG  418

Query  1356  SQNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAF  1177
             SQ WD + A QAL++S + +E G  L + H Y+K+SQ+KENP GDFKSMYRH SKG+W F
Sbjct  419   SQQWDTSLAIQALLASNLTDEIGPTLARGHDYIKESQVKENPSGDFKSMYRHISKGSWTF  478

Query  1176  SDQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAV  997
             SDQDHGW +SD TAE +KC LLL  M  EI GEK++ +CLY++V++ L LQS  +GGF  
Sbjct  479   SDQDHGWQISDGTAEGLKCCLLLSMMPSEIVGEKMEPECLYDSVNLLLSLQS-MNGGFPP  537

Query  996   WEPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAK  817
             WEP     +LE+LNP+E  ADI+++ EH E T S++ AL  FK  +P++R +E+  SI+ 
Sbjct  538   WEPARGAEWLELLNPAEFLADIMIEHEHGECTSSVIQALVMFKKLHPEHRKEEIEDSISI  597

Query  816   AAEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQ  637
             A  YLE  Q +DGSWY  WG+CF YGT FAL GL AAG+++    A+R    F L  Q +
Sbjct  598   ALHYLENIQMSDGSWYRDWGVCFTYGTWFALSGLAAAGKTFSTCAAMRNGVSFLLKVQRE  657

Query  636   EGGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQ  457
              GGWGE   SCP   Y+  EGNRSN+VQT+WAM+GL+   QAERDP PLHRAAK +IN+Q
Sbjct  658   NGGWGESYLSCPQETYVHLEGNRSNLVQTAWAMMGLISAGQAERDPAPLHRAAKFIINSQ  717

Query  456   MEDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             +E+GDFPQQ+ITG + KNCM+H+A++R+ +P+ AL+EYR RV
Sbjct  718   LENGDFPQQEITGVFKKNCMMHFAAYRNIYPMWALAEYRNRV  759



>ref|XP_006389937.1| hypothetical protein EUTSA_v10018165mg [Eutrema salsugineum]
 gb|ESQ27223.1| hypothetical protein EUTSA_v10018165mg [Eutrema salsugineum]
Length=765

 Score =   882 bits (2278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/761 (56%), Positives = 545/761 (72%), Gaps = 12/761 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLKI  G    PY++STNN+ GRQ WE+DP+AGT EE+ A E+AR+ F   R +    
Sbjct  1     MWKLKIANGNKEEPYLFSTNNFLGRQTWEFDPDAGTAEERAAVEEARRNFFDDRFR-VKA  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPP--VRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2239
               DL  RMQ +KE + +  SIPP  V++ + +++  EA T A+R+ V    ALQA DGHW
Sbjct  60    SSDLIWRMQFLKEKKFEE-SIPPAPVKVEDAKKITSEAATNALRRGVNFLSALQASDGHW  118

Query  2238  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  2059
             PAEN+GPLFF PPL+  L+++G +  I T EH +E +RY+Y HQNEDGGWGL+I+GHSTM
Sbjct  119   PAENAGPLFFLPPLVFCLFVTGHLQEIFTKEHLRETLRYIYCHQNEDGGWGLHIEGHSTM  178

Query  2058  IGSALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGC  1891
               + LNY+ +RLLGE  +     A  R R WIL HGGAT IPSWGK +LS+LGV++W G 
Sbjct  179   FCTTLNYICVRLLGEGPNGGPGNACERARKWILSHGGATYIPSWGKTWLSILGVFDWSGS  238

Query  1890  NPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPY  1711
             NP+PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP + L+L +R EI+++PY
Sbjct  239   NPMPPEFWILPSFLPIHPAKMWCYCRLVYMPMSYLYGKRFVGPTSPLILQLREEIYLQPY  298

Query  1710  DQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMH  1534
              +I+WN  R  C KED YYP   +QDV+W+ L   +EP +  WPFNK+ RE A+   + H
Sbjct  299   AEINWNRARHLCAKEDAYYPRPLVQDVIWDCLYIFSEPFLTCWPFNKLLREKALGVTMKH  358

Query  1533  MRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGS  1354
             + Y  E SRYITIG +EK+L M+  W EDPN    K HL R+ D+LW+AEDGM MQ+FGS
Sbjct  359   IHYEDENSRYITIGCVEKALCMLACWVEDPNGIYFKKHLLRISDYLWIAEDGMKMQSFGS  418

Query  1353  QNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFS  1174
             Q WD+ FA QAL++S +  E  D L++ + +LK SQ++ENP  DF SM+RH SKG+W FS
Sbjct  419   QLWDSGFALQALVASNLSNEIPDVLRRGYEFLKNSQVRENPSSDFTSMHRHISKGSWTFS  478

Query  1173  DQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVW  994
             D+DHGW  SDCTAE +KC LLL  M P+I G K+D + LYE+V I L LQS ++GG   W
Sbjct  479   DRDHGWQASDCTAEGLKCCLLLSMMPPDIIGPKMDPEQLYESVTILLSLQS-KNGGVTAW  537

Query  993   EPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKA  814
             EP   Q +LE+LNP+E FADIVV+ E+ E T S + AL  FK  YP +R +E+  SI KA
Sbjct  538   EPARGQEWLELLNPTEFFADIVVEHEYNECTSSTIQALVLFKQLYPKHRTEEINSSIKKA  597

Query  813   AEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQE  634
              +Y+E  Q  DGSWYG WG+CF Y T F L GL AAG++Y N  A+RK  HF L+ Q   
Sbjct  598   VQYIENIQMIDGSWYGSWGVCFTYSTWFGLGGLAAAGKTYNNCLAMRKGVHFLLTTQKDN  657

Query  633   GGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQM  454
             GGWGE   SC   +YIP EG RSN+VQTSWAM+GL++  QAERDPTPLHRAAKLLIN+Q+
Sbjct  658   GGWGESYLSCSRKRYIPSEGERSNLVQTSWAMMGLLHAGQAERDPTPLHRAAKLLINSQL  717

Query  453   EDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             E+GDFPQQ+ITG++MKNC+LHYA++R+ FP+ AL+EYR+RV
Sbjct  718   ENGDFPQQEITGAFMKNCLLHYAAYRNIFPVWALAEYRRRV  758



>ref|XP_002305339.1| putative oxidosqualene cyclase family protein [Populus trichocarpa]
 gb|EEE85850.1| putative oxidosqualene cyclase family protein [Populus trichocarpa]
Length=728

 Score =   881 bits (2277),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/723 (57%), Positives = 537/723 (74%), Gaps = 7/723 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MW+L++ EG GP+++STN + GRQIW ++PN  TPEEQ   E AR+ F   R        
Sbjct  1     MWRLEVAEGDGPWLFSTNKFVGRQIWRFEPNVWTPEEQAQVEMAREKFRLNRFY-TKASS  59

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             D+    Q+IKE+++D L IPPVRL   EE++ E + TA+RKAVR   A+QA DGHWPAE 
Sbjct  60    DVLKNFQLIKENQID-LRIPPVRLGNGEEISREKVETALRKAVRFTSAIQASDGHWPAEF  118

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             SGPLF  PPL++ LY+S S+D +L+SEHKKE++RY+YNHQNEDGGWG +I+ HSTM+G+A
Sbjct  119   SGPLFLMPPLIMVLYLSRSLDTVLSSEHKKEIIRYIYNHQNEDGGWGFHIESHSTMLGTA  178

Query  2046  LNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             LNYVALRLLGE  +     A+ + R W+L HGGAT IP+WGK+YLSVLG YEW GCNP+P
Sbjct  179   LNYVALRLLGEGPEGGGDGAVTKARKWVLDHGGATMIPAWGKVYLSVLGTYEWSGCNPVP  238

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEF LFPS  PF P K+W + RT Y PMSYLY K++ GP+T+L+L +R E++++PY++ID
Sbjct  239   PEFLLFPSFLPFSPGKVWCHLRTVYTPMSYLYGKKFVGPITDLILQLRGELYIQPYEEID  298

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             WN  R  C KED Y   +  Q++L + + Y +E ++++WPF+K+RE A+++ I H+ Y  
Sbjct  299   WNKARHLCLKEDLYTSRSIAQNLLLDGVHYLSERLLKQWPFSKLREQALQEAIKHIHYED  358

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             E +RY+T  +IEKSL MM  WAEDP  D  K+HLARVPD LWLAEDGM  Q+ GSQ WDA
Sbjct  359   ESTRYMTHASIEKSLNMMACWAEDPTSDAFKFHLARVPDILWLAEDGMKTQSIGSQLWDA  418

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
              FATQA+I+S +V+EYG  L+KAH +LK SQI+EN  GDF+SMYRH SKGAW  S +DHG
Sbjct  419   AFATQAIIASNLVDEYGSTLRKAHEFLKLSQIQENAYGDFRSMYRHISKGAWTLSVKDHG  478

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCTAEA++ LLLL QM  EI GE +D + L+ A+D  L LQS ++GGF+VWEP   
Sbjct  479   WQVSDCTAEALRALLLLSQMPAEIVGETIDTERLHNAIDFLLSLQS-KNGGFSVWEPARG  537

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
             Q +LE+LNP++ F D++V+ E+VE T S +  L  F+  +P YR+KE+ +S+A A+ Y+E
Sbjct  538   QRWLEVLNPTQAFGDVMVETEYVECTASAIQVLVLFQRLHPGYRSKEIEVSVANASSYIE  597

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
               Q +DGSWYG WGIC+ YGT FAL GL + G++Y NS  +RKA  F LSKQ+  GGWGE
Sbjct  598   DAQMSDGSWYGNWGICYTYGTYFALKGLASVGKTYRNSRTVRKACEFLLSKQHNSGGWGE  657

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                SC   KY   EGN+SNVVQT+WAM+GL+Y  QAE+DP PLH+AA+LLIN+QME+G+F
Sbjct  658   SYLSCANSKYTEIEGNKSNVVQTAWAMMGLIYAGQAEKDPAPLHQAARLLINSQMENGEF  717

Query  438   PQQ  430
             PQQ
Sbjct  718   PQQ  720



>gb|KHG28038.1| Beta-amyrin synthase [Gossypium arboreum]
Length=693

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/692 (58%), Positives = 518/692 (75%), Gaps = 7/692 (1%)
 Frame = -3

Query  2391  MQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAENSGPLF  2212
             MQ +KE      SIP V++ + E++ YE  TT +R+AV    ALQA DGHWPAEN+GPLF
Sbjct  1     MQFLKEKNFKQ-SIPAVKIDDGEQITYEKATTTLRRAVHFFSALQASDGHWPAENAGPLF  59

Query  2211  FTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSALNYVA  2032
             F PPL+ ++YI+G ++ +   EH++E++RY+Y HQNEDGGWGL+I+GHSTM  +AL+Y+ 
Sbjct  60    FLPPLVFSMYITGHLNTVFPEEHRREILRYIYYHQNEDGGWGLHIEGHSTMFCTALSYIC  119

Query  2031  LRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPPEFWL  1864
             +R+LGE  D    +A AR R WIL HG  T +PSWGK +LS+LGV++W GCNP+PPEFWL
Sbjct  120   MRILGEGPDGGLDNACARARKWILDHGSVTHMPSWGKTWLSILGVFDWSGCNPMPPEFWL  179

Query  1863  FPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDWNNTR  1684
              PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+  +R E++++PY++I+W   R
Sbjct  180   LPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITPLIEQLREELYLQPYNEINWKKIR  239

Query  1683  MACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRYGAEESR  1507
               C  ED YYPH  IQD++W++L  CTEP++ RWPFNK IRE A++  + H+ Y  E SR
Sbjct  240   HLCAPEDIYYPHPLIQDLMWDSLYICTEPLLTRWPFNKLIRERALQVTMKHIHYEDENSR  299

Query  1506  YITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDATFAT  1327
             YITIG +EK L M+  WAE+PN D  K HLAR+PD+LW+AEDGM MQ+FGSQ WD  FA 
Sbjct  300   YITIGCVEKVLCMLACWAEEPNSDYFKKHLARIPDYLWVAEDGMKMQSFGSQQWDTGFAI  359

Query  1326  QALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGWVVS  1147
             QAL++S + +E G  LK+ H ++K+SQ+K+NP GDFK M+RH SKG+W FSDQDHGW VS
Sbjct  360   QALLASNLTDEIGPVLKRGHDFIKKSQVKDNPSGDFKQMFRHISKGSWTFSDQDHGWQVS  419

Query  1146  DCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQPYL  967
             DCTAE +KC LL+  + PEI GEK++ Q LY+AV++ L LQS ++GG A WEP   Q +L
Sbjct  420   DCTAEGLKCCLLMSMLPPEIVGEKMEPQQLYDAVNVILSLQS-QNGGLAAWEPAGAQEWL  478

Query  966   EMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLETQQQ  787
             EMLNP+E FADIV++ E++E T S + AL  FK  YP +R KE+   I  A  YLE  Q 
Sbjct  479   EMLNPTEFFADIVIEHEYIECTASSIHALVMFKKLYPGHRKKEIDNFITNAVHYLEDIQM  538

Query  786   ADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGECLES  607
              DGSWYG WG+CF YGT FAL GL AAG++Y N EA+R+   F L+ Q + GGWGE  +S
Sbjct  539   PDGSWYGNWGVCFTYGTWFALGGLAAAGKTYTNCEAMRRGVQFLLTTQRENGGWGESYKS  598

Query  606   CPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFPQQD  427
             CP  +Y+P E  RSN+V T+WAM+GL++  QAERDP PLHRAAKL+IN+Q+EDGDFPQQ+
Sbjct  599   CPEKRYVPLEDGRSNLVHTAWAMMGLIHAGQAERDPRPLHRAAKLIINSQLEDGDFPQQE  658

Query  426   ITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             ITG +MKNCMLHYA++R+ +PL AL+EYRKRV
Sbjct  659   ITGVFMKNCMLHYAAYRNIYPLWALAEYRKRV  690



>ref|XP_009786280.1| PREDICTED: lupeol synthase [Nicotiana sylvestris]
Length=755

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/752 (54%), Positives = 534/752 (71%), Gaps = 4/752 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKIGEG GP++ +TNNY GRQ WE+D  AGTPEE+   EK R+ F K R     +  
Sbjct  1     MWKLKIGEGEGPWLTTTNNYIGRQYWEFDSEAGTPEERTLVEKMRQHFKKNRFTQTQS-A  59

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             DL MRMQ+ KE+    +    V+L E E +  EA+   +++++     +QA DGHWPAE+
Sbjct  60    DLLMRMQLRKENPCGPIP-AAVKLEETENITEEAVKATLKRSISYYSTIQANDGHWPAES  118

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +GPLFF PPL++ALY++G ++ +L+  H+ E+ RY YNHQNEDGGWG +I+GHSTM G+ 
Sbjct  119   AGPLFFLPPLVMALYVTGDMNAVLSPAHQMEIKRYTYNHQNEDGGWGFHIEGHSTMFGTV  178

Query  2046  LNYVALRLLGEEADD-AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPPEF  1870
              NY+ALRLLGE+ +D A+A GR WIL HGGA A PSWGK +L+VLGVYEWDGCNP+PPEF
Sbjct  179   FNYIALRLLGEDGEDKALAIGRKWILDHGGAVATPSWGKFWLAVLGVYEWDGCNPMPPEF  238

Query  1869  WLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDWNN  1690
             WL P+ FP HP KM  Y R  YMPMSYLY KR+ G +T+LV  IR+EIH +PY +IDWN 
Sbjct  239   WLLPTLFPIHPGKMLCYGRLVYMPMSYLYGKRFVGTITSLVQFIRDEIHNQPYHEIDWNK  298

Query  1689  TRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGAEES  1510
              R  C KED YYPH  IQD LW  L +  EP+++RWPF K+RE A+   + H+ Y  E S
Sbjct  299   ARNTCAKEDLYYPHPLIQDTLWGFLHHFAEPVLKRWPFTKLREKALNLAMEHIHYEDENS  358

Query  1509  RYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDATFA  1330
             RYI IG +EK L ++  W EDPN +  K HLAR+PD+ W++EDG+  Q+FG Q WDA F+
Sbjct  359   RYICIGCVEKVLCLIVCWVEDPNSEAYKRHLARLPDYYWISEDGLKFQSFGCQTWDAVFS  418

Query  1329  TQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGWVV  1150
              QA++SS +  E+G  LKKA+ +LK SQ+KENP GD + MYRH SKGAW FS QDHGW V
Sbjct  419   IQAILSSDLAAEFGPILKKANDFLKASQVKENPSGDLRKMYRHISKGAWTFSMQDHGWQV  478

Query  1149  SDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQPY  970
             SDCT+E +KC LL  QM  E+ G+K + + L +AV++ L LQS E+GGF  WEP     +
Sbjct  479   SDCTSEGLKCALLFSQMPTELIGKKFETERLCDAVNVTLSLQS-ENGGFPAWEPQRAYRW  537

Query  969   LEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLETQQ  790
             LE  NP+E F D +++ E+VE T S + AL  +K  +P +R KE+  +I+K  +Y+E+ Q
Sbjct  538   LEKFNPTEFFEDTIIEREYVECTSSAIQALTLYKKWHPRHRRKEIEAAISKGLQYIESTQ  597

Query  789   QADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGECLE  610
              +DGSW G WGIC+ YGT FA+ GL A GR+Y    A++KA  F LSKQ  +GGWGE   
Sbjct  598   NSDGSWTGCWGICYTYGTWFAVDGLIACGRTYPTCHALQKACKFLLSKQLPDGGWGESYL  657

Query  609   SCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFPQQ  430
             S     Y   +G++SN+VQTSWA+L L+   QAE DPTP+HR  +LLIN+QMEDGD+PQQ
Sbjct  658   SNSNKVYTNIKGDQSNLVQTSWALLSLINAGQAEIDPTPIHRGIRLLINSQMEDGDYPQQ  717

Query  429   DITGSYMKNCMLHYASHRSYFPLMALSEYRKR  334
              ITG++MKNC L+Y+S+R+ FP+ AL EYRKR
Sbjct  718   GITGAFMKNCTLNYSSYRNIFPIWALGEYRKR  749



>emb|CAN60556.1| hypothetical protein VITISV_020304 [Vitis vinifera]
Length=758

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/757 (54%), Positives = 540/757 (71%), Gaps = 9/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI EG GP++ + NN+ GRQ WE+DP+AG+P+E+   E+ R+ F K R +   +  
Sbjct  1     MWKLKIAEGKGPWLMTVNNHIGRQHWEFDPDAGSPQERAEVERVREEFKKNRFQFKQS-A  59

Query  2406  DLFMRMQMIKESEVDVLSIPP-VRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             DL MRMQ+ KE+      IP  V+++E E+   EA+TT +R+A+     +QA DGHWPAE
Sbjct  60    DLLMRMQLTKENGCG--PIPAAVKVKETEDATKEAVTTTLRRAISFYSTIQAHDGHWPAE  117

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             ++GPLFF PPL+IALYI G+++ +L+ +H+KE++RY+YNHQNEDGGWG++I GHST+ GS
Sbjct  118   SAGPLFFLPPLVIALYIIGAVNAVLSLQHQKEIIRYIYNHQNEDGGWGIHIAGHSTIFGS  177

Query  2049  ALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             A +Y+ALRLLGE  +     A+ARGR WIL HGGA  IPSWGK +L+VLGVYEW GCNP+
Sbjct  178   AFSYIALRLLGEGPEGGEDGAMARGRKWILDHGGAVGIPSWGKFWLTVLGVYEWSGCNPL  237

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWL P   P HP KM  YCR  YMPMSYLY KR+ G +T LV S+R E++++PY +I
Sbjct  238   PPEFWLLPKISPIHPGKMLCYCRLVYMPMSYLYGKRFVGRITGLVQSLREELYIEPYREI  297

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +WN  R +C KED YYPH   QD+LW  L +  EPI+ RWPF+ +RE A++  + H+ Y 
Sbjct  298   NWNKARNSCAKEDLYYPHPLAQDMLWGFLHHVAEPILXRWPFSIMREKALKVALKHIHYE  357

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRY  IG +EK L ++  W EDPN +  K HLAR+PD+LW+AEDGM MQ+FG Q WD
Sbjct  358   DENSRYYCIGCVEKVLCLLACWVEDPNSEAYKRHLARIPDYLWMAEDGMKMQSFGCQMWD  417

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             A FA QA+ISS +  EYG  L+KAH ++K SQ+++NP G+F  MYRH  KGAW FS QDH
Sbjct  418   AAFAIQAIISSDLAHEYGXTLRKAHDFVKASQVRQNPSGNFTEMYRHTCKGAWTFSTQDH  477

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCT E +K  LL  QMSP++ GEK++ +  Y+AV++ L LQS  +GGF  WEP  
Sbjct  478   GWQVSDCTGEGLKVALLFSQMSPDLVGEKMEKERFYDAVNVILSLQS-SNGGFPAWEPQR  536

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE  NP+E F D++++ E+VE T S +  L  F   +P++R KE+   I++A  Y+
Sbjct  537   AFRWLEKFNPTEFFEDVLIEREYVECTSSAIQGLILFIKLHPEHRRKEIESCISRAIHYI  596

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WGIC+ YGT F + GL A G++Y+NS A+RKA  F LSKQ  +GGWG
Sbjct  597   EDTQNPDGSWYGCWGICYTYGTWFGVEGLVACGKTYQNSPALRKACEFLLSKQLPDGGWG  656

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   S     Y   EGNRSN+V  SWA+L L+   QAE DPTP+HR  ++LIN+QMEDGD
Sbjct  657   ESYLSSTDKVYTNLEGNRSNLVNXSWALLALIEGGQAEIDPTPIHRGMRVLINSQMEDGD  716

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+ITG +MKNC L+Y+S+R+ FP+ AL EY +RV
Sbjct  717   FPQQEITGVFMKNCTLNYSSYRNIFPIWALGEYSRRV  753



>ref|XP_002269060.2| PREDICTED: lupeol synthase isoform X1 [Vitis vinifera]
Length=757

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/757 (54%), Positives = 540/757 (71%), Gaps = 9/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI EG GP++ + NN+ GRQ WE+DP+AG+ +E+   E+ R+ F K R +   +  
Sbjct  4     MWKLKIAEGKGPWLMTVNNHIGRQHWEFDPDAGSSQERAEVERVREEFKKNRFQFKQS-A  62

Query  2406  DLFMRMQMIKESEVDVLSIPP-VRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             DL MRMQ+ KE+      IP  V+++E E+   EA+TT +R+A+     +QA DGHWPAE
Sbjct  63    DLLMRMQLTKENGCG--PIPAAVKVKETEDATKEAVTTTLRRAISFYSTIQAHDGHWPAE  120

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             ++GPLFF PPL++ALYI G+++ +L+ +H+KE++RY+YNHQNEDGGWG++I GHST+ GS
Sbjct  121   SAGPLFFLPPLVLALYIIGAVNAVLSLQHQKEIIRYIYNHQNEDGGWGIHIAGHSTIFGS  180

Query  2049  ALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             A +Y+ALRLLGE  +     A+ARGR WIL HGGA  IPSWGK +L+VLGVYEW GCNP+
Sbjct  181   AFSYIALRLLGEGPEGGEDGAMARGRKWILDHGGAVGIPSWGKFWLTVLGVYEWSGCNPL  240

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWL P   P HP KM  YCR  YMPMSYLY KR+ G +T LV S+R E++++PY +I
Sbjct  241   PPEFWLLPKISPIHPGKMLCYCRLVYMPMSYLYGKRFVGRITGLVQSLREELYIEPYREI  300

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +WN  R +C KED YYPH   QD+LW  L +  EPI+ RWPF+ +RE A++  + H+ Y 
Sbjct  301   NWNKARNSCAKEDLYYPHPLAQDMLWGFLHHVAEPILTRWPFSIMREKALKVALKHIHYE  360

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRY  IG +EK L ++  W EDPN +  K HLAR+PD+LW+AEDGM MQ+FG Q WD
Sbjct  361   DENSRYYCIGCVEKVLCLLACWVEDPNSEAYKRHLARIPDYLWMAEDGMKMQSFGCQMWD  420

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             A FA QA+ISS +  EYG  L+KAH ++K SQ+++NP G+F  MYRH  KGAW FS QDH
Sbjct  421   AAFAIQAIISSDLAHEYGPTLRKAHDFVKASQVRQNPTGNFTEMYRHTCKGAWTFSTQDH  480

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCT E +K  LL  QMSP++ GEK++ +  Y+AV++ L LQS  +GGF  WEP  
Sbjct  481   GWQVSDCTGEGLKVALLFSQMSPDLVGEKMEKERFYDAVNVILSLQS-SNGGFPAWEPQR  539

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE  NP+E F D++++ E+VE T S +  L  F   +P++R KE+   I++A  Y+
Sbjct  540   AFRWLEKFNPTEFFEDVLIEREYVECTSSAIQGLILFIKLHPEHRRKEIESCISRAIHYI  599

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WGIC+ YGT F + GL A G++Y+NS A+RKA  F LSKQ  +GGWG
Sbjct  600   EDTQNPDGSWYGCWGICYTYGTWFGVEGLVACGKTYQNSPALRKACEFLLSKQLPDGGWG  659

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   S     Y   EGNRSN+V TSWA+L L+   QAE DPTP+HR  ++LIN+QMEDGD
Sbjct  660   ESYLSSTNKVYTNLEGNRSNLVNTSWALLALIEGGQAEIDPTPIHRGMRVLINSQMEDGD  719

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+ITG +MKNC L+Y+S+R+ FP+ AL EY +RV
Sbjct  720   FPQQEITGVFMKNCTLNYSSYRNIFPIWALGEYSRRV  756



>ref|XP_009106612.1| PREDICTED: camelliol C synthase [Brassica rapa]
 emb|CDX87420.1| BnaA07g34530D [Brassica napus]
Length=768

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/759 (54%), Positives = 545/759 (72%), Gaps = 10/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLKI +G    PY++STNN+ GRQ WE+DP+AG+ EE+ A ++AR+ F   R +   +
Sbjct  1     MWKLKIAKGNKEEPYLFSTNNFLGRQTWEFDPDAGSSEERAAVDEARRFFFDNRFRVKAS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ +KE +    +IPPV++ + +++  EA + A+R+ V    +LQA DGHWPA
Sbjct  61    -SDLIWRMQFLKEKKFKQ-AIPPVKVEDAKKITSEAASKALRRGVSFLSSLQASDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL+  L+++G +  I T  H++E++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVFCLFVTGHLHEIFTKAHRREILRYIYCHQNEDGGWGLHIEGHSTMFC  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + LNY+ LR+LGE  +    +A  R R WIL HGGAT IPSWGK +LS+LGV++W G NP
Sbjct  179   TTLNYICLRILGEGPNEGPGNACKRAREWILGHGGATYIPSWGKTWLSILGVFDWSGSNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP++ L+L +R EI+++PY +
Sbjct  239   MPPEFWILPSCLPIHPAKMWCYCRLVYMPMSYLYGKRFVGPISPLILQLREEIYLQPYAE  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHMR  1528
             I+WN  R  C +ED YYP   +Q+V+W+ L    EP +  WP NK+ RE A+   + H+ 
Sbjct  299   INWNRARHLCAQEDAYYPRPLVQNVIWDCLYMFAEPFLTCWPLNKLLREKALDVAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK+L M+  W E+PN    K HL RV D+LW+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSRYITIGCVEKALCMLACWVENPNGVHFKKHLLRVSDYLWIAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD+ FA QAL++S +  E  D L++ H + K SQ+++NP  DF SM+RH SKG+W FSD+
Sbjct  419   WDSGFALQALLASNLCSEIPDVLRRGHDFFKYSQVRDNPSSDFNSMHRHISKGSWTFSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW  SDCTAE +KC LLL  M P+I G K+D + LYE+V I L LQS ++GG   WEP
Sbjct  479   DHGWQASDCTAEGLKCCLLLSMMPPDIVGPKMDPEHLYESVTILLSLQS-KNGGVTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP+E FADIVV+ E+ E T S + AL  FK  YPD+R +E+  SI KA +
Sbjct  538   ARGQEWLELLNPTEFFADIVVEHEYNECTSSTIQALILFKQLYPDHRTEEINSSIKKAVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             Y+E  Q  DGSWYG WG+CF Y T FAL GL AAG++Y N  A+RK  HF L+ Q   GG
Sbjct  598   YIENIQMLDGSWYGSWGVCFTYSTWFALGGLAAAGKTYSNCLAMRKGVHFLLTIQKDNGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SC   +YIP EG ++N+VQTSWAM+GL++  QAERDPTPLHRAAKLLIN+Q+E+
Sbjct  658   WGESYLSCSKKRYIPSEGEKTNLVQTSWAMMGLLHAGQAERDPTPLHRAAKLLINSQLEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG++MK C+LHYA++R+ FP+ AL+EY + V
Sbjct  718   GDFPQQEITGAFMKTCLLHYAAYRNIFPVWALAEYSRLV  756



>gb|KEH27290.1| beta-amyrin synthase [Medicago truncatula]
Length=762

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/756 (55%), Positives = 538/756 (71%), Gaps = 8/756 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI EGG   I S NN+ GRQ WE+DPNAGTPEE    E+ R  FTK R     +  
Sbjct  1     MWKLKIAEGGEGLI-SVNNFIGRQHWEFDPNAGTPEEHAEIERLRIQFTKNRFSIKQS-S  58

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             DLFMRMQ+ KE++   +  P V+LREE+ +  EA+ T +++A+    ++QA DGHWPAE+
Sbjct  59    DLFMRMQLKKENQCSPIP-PAVKLREEDIITGEALITTIKRAISFYSSIQAHDGHWPAES  117

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +GPLFF  PL++ALYI+GS+D +L  +HKKE+VRYLYNHQNEDGGWG +I+GHSTM GSA
Sbjct  118   AGPLFFVQPLVMALYITGSLDEVLGPQHKKEIVRYLYNHQNEDGGWGFHIEGHSTMFGSA  177

Query  2046  LNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             L+Y+ALRLLGE  +D    A+ R RNWIL HGG  AIPSWGK +++VLGVYEW GCNP+P
Sbjct  178   LSYIALRLLGEGPEDGEDKAMERCRNWILDHGGLVAIPSWGKFWVTVLGVYEWRGCNPLP  237

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEFW  P   P HP KM  YCR  YMPMSYLY K++ GP+T+L+ S+R E++ +PYDQI+
Sbjct  238   PEFWFLPKFTPIHPGKMLCYCRLVYMPMSYLYGKKFVGPITDLIKSLREELYNQPYDQIN  297

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             WN  R    KED YYPH  IQD+LW  L +  EP +  WPF K+R+ A+   I H+ Y  
Sbjct  298   WNKARNTIAKEDLYYPHPMIQDMLWGFLYHVGEPFLNCWPFTKLRQKALEIAINHVGYED  357

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             E SRY+ IG++EK L ++  W EDPN +  K HLAR+PD+ WLAEDG+ +Q+FG Q WDA
Sbjct  358   ENSRYLCIGSVEKVLCLIARWVEDPNSEAYKLHLARIPDYFWLAEDGLKIQSFGCQMWDA  417

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
              FA QA+++  + EEYG  L KAH +LK SQ+ ENP G+FK+MYRH  KG+W FS  D G
Sbjct  418   AFAIQAILACNVSEEYGPTLWKAHDFLKASQVVENPSGEFKAMYRHICKGSWTFSMHDQG  477

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCTAE +K  LLL +M  ++ GEK++ + LY+AV++ L LQS  +GGF  WEP   
Sbjct  478   WQVSDCTAEGLKAALLLSKMPSDLVGEKLESERLYDAVNVILSLQS-SNGGFPAWEPQNA  536

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
               +LE  NP+E F D +++ E+ E TGS + AL  F   +P +RAKE+   ++KA  Y+E
Sbjct  537   YSWLEKFNPTEFFEDTLIEREYAECTGSAMQALYLFTKLHPTHRAKEIHHCLSKAINYIE  596

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
               Q  DGSWYG WGIC+ YGT FA+ GLTA G++Y NS ++RKA  F LSKQ  +GGWGE
Sbjct  597   NTQNPDGSWYGCWGICYTYGTWFAVEGLTACGKNYHNSPSLRKACQFLLSKQLPDGGWGE  656

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                S     Y   E NR+N+VQTSWA+L L+   QA+ DPTP+HR  KL+IN+QMEDGDF
Sbjct  657   SYLSSQNKVYTNLEDNRANLVQTSWALLSLISAGQADIDPTPIHRGMKLIINSQMEDGDF  716

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             PQQ+ITG +M+NC L+Y+S+R+ FP+ AL EYR +V
Sbjct  717   PQQEITGVFMRNCTLNYSSYRNIFPIWALGEYRHQV  752



>ref|XP_006409184.1| hypothetical protein EUTSA_v10022563mg [Eutrema salsugineum]
 gb|ESQ50637.1| hypothetical protein EUTSA_v10022563mg [Eutrema salsugineum]
Length=794

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/780 (52%), Positives = 548/780 (70%), Gaps = 33/780 (4%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLK GEG G  PY++S+NN+ GRQIWE+DP AGTPEE+ A E+AR+ F   R +    
Sbjct  1     MWKLKTGEGNGEDPYLFSSNNFTGRQIWEFDPKAGTPEERAAVEEARRSFYDNRSR-VKA  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ +KE++ + + IPPV+  + E + Y   T A+R+ V    ALQ+ DGHWPA
Sbjct  60    SSDLLWRMQFLKEAKFEQV-IPPVKFDDGESITYVKTTNALRRGVAFFSALQSSDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E +GPLFF PPL+  LYI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+  S M  
Sbjct  119   EIAGPLFFLPPLVFCLYITGHLEEVFDAEHRKEILRYIYCHQNEDGGWGLHIESKSVMFS  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +ALNY+ LR+LG   D    ++  R R WIL HGG T IPSWGK++LS+LG+Y+W G NP
Sbjct  179   TALNYICLRMLGVGLDGGRENSCKRAREWILNHGGVTYIPSWGKVWLSILGIYDWSGTNP  238

Query  1884  IPPEFWLFPSHFPFH-----------------------PAKMWNYCRTTYMPMSYLYAKR  1774
             +PPE WL PS  P H                         K+  Y R  YMPMSYLY KR
Sbjct  239   MPPEMWLLPSFLPLHLGVFCTFVFVDYCCKFFCLDAKNAGKLLCYTRMVYMPMSYLYGKR  298

Query  1773  YHGPLTNLVLSIRNEIHVKPYDQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPI  1594
             + GP+T L++ +R E+H++PY++I+WN  R  C KEDTYYPH  +QD++W+ L    EP 
Sbjct  299   FVGPVTPLIMQLREELHLQPYEEINWNKARRLCGKEDTYYPHPLVQDLIWDTLHMFVEPF  358

Query  1593  MRRWPFNK-IREMAMRKVIMHMRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHL  1417
             + RWP NK +RE A+R  + H+ Y  E S YITIG IEK L M+  W E+P  D  K HL
Sbjct  359   LTRWPLNKLVREKALRVAMNHIHYEDENSHYITIGCIEKVLCMLACWVENPVGDHFKKHL  418

Query  1416  ARVPDFLWLAEDGMTMQTFGSQNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKE  1237
             +R+ D++W+AEDG+ MQ+FGSQ W+  FA QAL++S + +E  + L++ H Y+K+SQ++E
Sbjct  419   SRLSDYMWVAEDGLKMQSFGSQLWETGFAIQALLASDLGDETYEVLRRGHTYIKRSQVRE  478

Query  1236  NPKGDFKSMYRHFSKGAWAFSDQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCL  1057
             NP GDFK+M+RH SKGAW FSD+DHGW VSDCTAEA+KC +LL  M  ++ G+K+D + L
Sbjct  479   NPSGDFKTMHRHISKGAWTFSDRDHGWQVSDCTAEALKCCMLLSMMPADLVGQKIDPEHL  538

Query  1056  YEAVDICLYLQSPESGGFAVWEPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALA  877
             Y++V++ L LQS E+GG   WEP     +LE+LNP++ FA+++V+GE VE T +++ A  
Sbjct  539   YDSVNLLLSLQS-ENGGLTAWEPASAPEWLELLNPTDFFANVMVEGECVECTSAVIQAFV  597

Query  876   AFKHDYPDYRAKEVAMSIAKAAEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRS  697
              FK  YPD+R KEV  SI KA +++E++Q  DGSWYG WGICF+YGT FAL GL A G++
Sbjct  598   MFKQLYPDHREKEVIKSIKKAVQFIESKQMPDGSWYGNWGICFIYGTWFALSGLAAIGKT  657

Query  696   YENSEAIRKAAHFFLSKQNQEGGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTE  517
             Y N  +I     F L+ QN++GGWGE   SCP  +YIP E N SN+VQT+WAM+GL++  
Sbjct  658   YNNCLSICNGVDFLLTIQNEDGGWGESYLSCPEQRYIPLERNGSNIVQTAWAMMGLIHGG  717

Query  516   QAERDPTPLHRAAKLLINAQMEDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             QAERD  PLHRAAK +I +QME+GDFPQQ++TG++M NCMLHYA++R+ FPL AL+EYRK
Sbjct  718   QAERDFIPLHRAAKFIITSQMENGDFPQQEMTGAFMNNCMLHYATYRNTFPLWALAEYRK  777



>ref|XP_007153005.1| hypothetical protein PHAVU_004G178500g [Phaseolus vulgaris]
 gb|ESW24999.1| hypothetical protein PHAVU_004G178500g [Phaseolus vulgaris]
Length=764

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/756 (55%), Positives = 538/756 (71%), Gaps = 8/756 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKIGEGG   I S NN  GRQ W +DPNAG+ EE+E  E+ R  FT  R     +  
Sbjct  1     MWKLKIGEGGKGVI-SVNNNVGRQHWVFDPNAGSVEEREEVERLRHQFTLNRFSIKQSA-  58

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             DLF+RMQ+ KE+E  V+    V++R+ E V  EA+ T +R+AV    ++Q  DGHWPAE+
Sbjct  59    DLFLRMQLRKENECGVIP-AAVKVRDGENVTTEAVITTIRRAVSFYSSIQGSDGHWPAES  117

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +GPLFF  PL++ALYI+GS+D +L  EHKKE++RYLYNHQNEDGGWG +I+GHSTM GSA
Sbjct  118   AGPLFFLQPLVMALYITGSLDAVLGPEHKKEIIRYLYNHQNEDGGWGFHIEGHSTMFGSA  177

Query  2046  LNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             L+Y+ALR+LGE  +D    A+ RGR WIL HGG   IPSWGK +++VLGVYEW GCNP+P
Sbjct  178   LSYIALRILGEGVEDGMEQAMYRGRKWILDHGGLVGIPSWGKFWVTVLGVYEWSGCNPLP  237

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEFWL P  FP HP KM +YCR  YMPMSYLY KR+ GP+T L+ S+R E++ +PY+ I+
Sbjct  238   PEFWLLPKAFPIHPGKMLSYCRLVYMPMSYLYGKRFVGPITALIRSLREELYNEPYEAIN  297

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             WN  R    KED YYPH  IQD+LW  L +  E ++  WPF+ +RE A+   I H+RY  
Sbjct  298   WNKARNTVAKEDLYYPHPVIQDMLWGFLHHVGERLVNWWPFSMVREKALEIAIEHVRYED  357

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             E SRY+ IG++EK L ++  W EDPN +  K HLAR+PD+ WLAEDG+ +Q+FGSQ WDA
Sbjct  358   ENSRYLCIGSVEKVLCLIARWVEDPNSEAYKLHLARIPDYFWLAEDGLKIQSFGSQMWDA  417

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
              FA QA++S  + EEY   L+KAH ++K SQ+ ENP GDFK+MYRH SKG+W FS  D G
Sbjct  418   AFAIQAILSCDVSEEYWPTLRKAHEFVKASQVAENPSGDFKAMYRHISKGSWTFSMHDQG  477

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCT E +K  LLL +M  ++ GEK+D Q  ++AV++ L LQS  +GGF  WEP   
Sbjct  478   WQVSDCTGEGLKAALLLSEMPADLVGEKMDTQRFFDAVNVILSLQS-SNGGFPAWEPQRA  536

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
               +LE  NP+E F D +++ E+VE TGS V  LA F+  YP +R KE+   I+KA  +LE
Sbjct  537   YRWLEKFNPTEFFEDTLIEMEYVECTGSAVQGLALFRKLYPKHRRKEIDSCISKAIHFLE  596

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
              +Q  DGSWYG WGIC+ YGT F + GL A+GR+Y NS ++RKA  F LSKQ   GGWGE
Sbjct  597   NKQNPDGSWYGCWGICYTYGTWFGVEGLRASGRNYHNSPSLRKACQFLLSKQLPNGGWGE  656

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                S     Y   EGNR+N+VQTSWA+L L+   QAE DPTP+HR  KLLIN+QMEDGDF
Sbjct  657   SYLSSQNKVYTNLEGNRANLVQTSWALLSLIRAGQAEIDPTPIHRGIKLLINSQMEDGDF  716

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             PQQ+ITG +M+NC L+Y+S+R+ FP+ AL EYR++V
Sbjct  717   PQQEITGVFMRNCTLNYSSYRNIFPIWALGEYRRQV  752



>ref|XP_006300769.1| hypothetical protein CARUB_v10019844mg [Capsella rubella]
 gb|EOA33667.1| hypothetical protein CARUB_v10019844mg [Capsella rubella]
Length=769

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/759 (55%), Positives = 546/759 (72%), Gaps = 10/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG--GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLKI  G    PY++STNN+ GRQ WE+DP+AGT EE+ A E+AR+ +   R +    
Sbjct  1     MWKLKIANGNKEDPYLFSTNNFLGRQTWEFDPDAGTEEERAAVEEARRKYFDNRFR-VRA  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  R+Q +K+   +  +IPPV++ +  ++  E  T A+R+ V    ALQA DGHWPA
Sbjct  60    SSDLIWRLQFLKDKSFEQ-TIPPVKVEDANKITSEIATDALRRGVNFLSALQASDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL+  L+++G +  ILT EH++E++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVFCLFVTGHLHEILTKEHRREILRYIYCHQNEDGGWGLHIEGHSTMFC  178

Query  2052  SALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + LNY+ +R+LGE  +     A    R WIL HGGAT IPSWGK +LS+LGV++W G NP
Sbjct  179   TTLNYICMRILGEGPNGGPGNACTLARKWILGHGGATYIPSWGKTWLSILGVFDWSGSNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP+T L+L +R EI+++PY +
Sbjct  239   MPPEFWILPSFLPIHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREEIYLQPYAK  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHMR  1528
             I+WN  R  C KED Y PH  IQDV+W+ L   TEP +  WPFNK+ RE A+   + H+ 
Sbjct  299   INWNRARHLCAKEDAYCPHPQIQDVIWDCLYIFTEPFLTCWPFNKLLREKALGVAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK+L M+  W EDPN    K HL R+ D+LW+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSRYITIGCVEKALCMLSCWVEDPNGIHFKKHLLRISDYLWVAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD+ FA QAL++S +  E  D L++ + + K SQ++ENP GDF +MYRH SKG+W FSD+
Sbjct  419   WDSGFALQALVASNLANEIPDVLRRGYDFFKHSQVRENPSGDFTNMYRHISKGSWTFSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW  SDCTAE +KC LLL  M  +I G K+D + LY++V I L LQS ++GG   WEP
Sbjct  479   DHGWQASDCTAEGLKCCLLLSMMPSDIVGPKMDPEQLYDSVTILLSLQS-KNGGVTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP+E+FADIV++ E+ E T S + AL  FK  YP +R +E+  SI KA +
Sbjct  538   ARGQEWLELLNPTEVFADIVIEHEYNECTSSAIQALILFKQLYPYHRTEEINTSIKKAVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             Y+E+ Q  DGSWYG WG+CF Y T F L GL AAG++Y N  A+RK  HF L+ Q   GG
Sbjct  598   YIESIQMLDGSWYGSWGVCFTYSTWFGLGGLAAAGKTYNNCLAMRKGVHFLLTTQKDNGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +YIP EG RSN+VQTSWAM+GL++  QAERDP PLHRAAKLLIN+Q+E+
Sbjct  658   WGESYLSCPKKRYIPSEGERSNLVQTSWAMMGLLHAGQAERDPAPLHRAAKLLINSQLEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG++MKNC+LHYA++R+ FP+ AL+EYR+RV
Sbjct  718   GDFPQQEITGAFMKNCLLHYAAYRNIFPVWALAEYRRRV  756



>ref|XP_011037652.1| PREDICTED: beta-amyrin synthase-like [Populus euphratica]
Length=760

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/756 (53%), Positives = 541/756 (72%), Gaps = 7/756 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKL++ EG  P++  TN + GRQ+WE+DP+ GTPEE    EKAR+ F++ R +      
Sbjct  1     MWKLEVAEGHDPWLLITNGFVGRQVWEFDPDLGTPEEHAEVEKAREKFSQNRFQ-VKASS  59

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             D+   +Q+IKE+ +D LS+P VRL + EE+  E    A+RKAVR   ALQA+DGHWP+E 
Sbjct  60    DVLKNLQLIKENGID-LSLPSVRLGDREEITCEKAEIALRKAVRFTSALQARDGHWPSEF  118

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             S  LF  P L+IALYI+G+++ IL+SEHK+E+VRY+YNHQNEDGGWG +I+ HS M+ +A
Sbjct  119   SALLFEQPFLVIALYITGTLNTILSSEHKREMVRYIYNHQNEDGGWGFHIESHSMMLCTA  178

Query  2046  LNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             LNYV+LRLLGEE     D A+A+ R WIL HGG T I  WGK +LS +G+YEW GCNP+P
Sbjct  179   LNYVSLRLLGEEPEGGKDGAVAKARKWILDHGGVTMISIWGKYFLSFIGLYEWSGCNPVP  238

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PE  L PS  PF+P   W Y RT Y+P++YLY K++  P+T+LV+ +R E++++PY ++D
Sbjct  239   PECLLLPSFLPFNPGNFWCYFRTVYIPLAYLYGKKFVAPITDLVILLREELYIQPYGEVD  298

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             W   R+ C K+D Y PH+ +++VL   L Y  EP+   WPF+K+RE A+ K +  ++Y  
Sbjct  299   WTKARILCLKKDLYKPHSLVENVLSGVLYYFAEPLSTHWPFSKLREKALAKAMSLIQYED  358

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             E + Y+T G++ KSL M+  WA+DPN D LK HLA VPD+LW+AEDGM +Q  GSQ WD+
Sbjct  359   EHTGYLTNGSVGKSLNMIANWADDPNQDSLKRHLATVPDYLWVAEDGMKVQNMGSQLWDS  418

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
              FATQA+I S + +EYG  L+KA  ++K SQI+ENP GDF+S Y    KGAW  + +D G
Sbjct  419   VFATQAIIESNLTDEYGSTLRKAFNFIKLSQIRENPSGDFQSTYHQICKGAWTLTVKDQG  478

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCTAEA+K LLLL QM  +I G+ ++++ LYEAVD  L LQS E+GGF+ WEP   
Sbjct  479   WQVSDCTAEALKTLLLLSQMPADIVGDTIELEQLYEAVDFLLTLQS-ENGGFSAWEPATS  537

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
               ++EM NP+E F  ++V+ E+VE T S++ ALA F H +P+YR KE+  S+AKAA Y+E
Sbjct  538   PQWMEMFNPTETFGGVMVETEYVECTASVIQALALFSHLHPEYRGKEIETSVAKAAHYVE  597

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
               Q ADGSWYG WGIC+ Y     L+ L A G+++ NSE +RK   F LSKQ + GGWGE
Sbjct  598   NAQMADGSWYGNWGICYTYAAYIVLVALAAVGKTHRNSEVVRKGCDFLLSKQLKSGGWGE  657

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                SC   +Y P +GNRSN+VQT+W M+GL+   QAERD TPLH+AA+LLIN+Q+E G+F
Sbjct  658   SYLSCRNSEYTPLDGNRSNLVQTAWTMVGLIRAGQAERDATPLHQAARLLINSQLESGEF  717

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             PQQ+ITG+ +K  MLHYAS+R+ FPL AL EYRK V
Sbjct  718   PQQEITGASLKTSMLHYASYRNIFPLWALGEYRKHV  753



>ref|XP_010656689.1| PREDICTED: lupeol synthase isoform X2 [Vitis vinifera]
Length=754

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/757 (54%), Positives = 540/757 (71%), Gaps = 9/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI EG GP++ + NN+ GRQ WE+DP+AG+ +E+   E+ R+ F K R +   +  
Sbjct  1     MWKLKIAEGKGPWLMTVNNHIGRQHWEFDPDAGSSQERAEVERVREEFKKNRFQFKQS-A  59

Query  2406  DLFMRMQMIKESEVDVLSIPP-VRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             DL MRMQ+ KE+      IP  V+++E E+   EA+TT +R+A+     +QA DGHWPAE
Sbjct  60    DLLMRMQLTKENGCG--PIPAAVKVKETEDATKEAVTTTLRRAISFYSTIQAHDGHWPAE  117

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             ++GPLFF PPL++ALYI G+++ +L+ +H+KE++RY+YNHQNEDGGWG++I GHST+ GS
Sbjct  118   SAGPLFFLPPLVLALYIIGAVNAVLSLQHQKEIIRYIYNHQNEDGGWGIHIAGHSTIFGS  177

Query  2049  ALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             A +Y+ALRLLGE  +     A+ARGR WIL HGGA  IPSWGK +L+VLGVYEW GCNP+
Sbjct  178   AFSYIALRLLGEGPEGGEDGAMARGRKWILDHGGAVGIPSWGKFWLTVLGVYEWSGCNPL  237

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWL P   P HP KM  YCR  YMPMSYLY KR+ G +T LV S+R E++++PY +I
Sbjct  238   PPEFWLLPKISPIHPGKMLCYCRLVYMPMSYLYGKRFVGRITGLVQSLREELYIEPYREI  297

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +WN  R +C KED YYPH   QD+LW  L +  EPI+ RWPF+ +RE A++  + H+ Y 
Sbjct  298   NWNKARNSCAKEDLYYPHPLAQDMLWGFLHHVAEPILTRWPFSIMREKALKVALKHIHYE  357

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRY  IG +EK L ++  W EDPN +  K HLAR+PD+LW+AEDGM MQ+FG Q WD
Sbjct  358   DENSRYYCIGCVEKVLCLLACWVEDPNSEAYKRHLARIPDYLWMAEDGMKMQSFGCQMWD  417

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             A FA QA+ISS +  EYG  L+KAH ++K SQ+++NP G+F  MYRH  KGAW FS QDH
Sbjct  418   AAFAIQAIISSDLAHEYGPTLRKAHDFVKASQVRQNPTGNFTEMYRHTCKGAWTFSTQDH  477

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCT E +K  LL  QMSP++ GEK++ +  Y+AV++ L LQS  +GGF  WEP  
Sbjct  478   GWQVSDCTGEGLKVALLFSQMSPDLVGEKMEKERFYDAVNVILSLQS-SNGGFPAWEPQR  536

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE  NP+E F D++++ E+VE T S +  L  F   +P++R KE+   I++A  Y+
Sbjct  537   AFRWLEKFNPTEFFEDVLIEREYVECTSSAIQGLILFIKLHPEHRRKEIESCISRAIHYI  596

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WGIC+ YGT F + GL A G++Y+NS A+RKA  F LSKQ  +GGWG
Sbjct  597   EDTQNPDGSWYGCWGICYTYGTWFGVEGLVACGKTYQNSPALRKACEFLLSKQLPDGGWG  656

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   S     Y   EGNRSN+V TSWA+L L+   QAE DPTP+HR  ++LIN+QMEDGD
Sbjct  657   ESYLSSTNKVYTNLEGNRSNLVNTSWALLALIEGGQAEIDPTPIHRGMRVLINSQMEDGD  716

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+ITG +MKNC L+Y+S+R+ FP+ AL EY +RV
Sbjct  717   FPQQEITGVFMKNCTLNYSSYRNIFPIWALGEYSRRV  753



>emb|CBI24038.3| unnamed protein product [Vitis vinifera]
Length=801

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/757 (54%), Positives = 540/757 (71%), Gaps = 9/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI EG GP++ + NN+ GRQ WE+DP+AG+ +E+   E+ R+ F K R +   +  
Sbjct  48    MWKLKIAEGKGPWLMTVNNHIGRQHWEFDPDAGSSQERAEVERVREEFKKNRFQFKQS-A  106

Query  2406  DLFMRMQMIKESEVDVLSIPP-VRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             DL MRMQ+ KE+      IP  V+++E E+   EA+TT +R+A+     +QA DGHWPAE
Sbjct  107   DLLMRMQLTKENGCG--PIPAAVKVKETEDATKEAVTTTLRRAISFYSTIQAHDGHWPAE  164

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             ++GPLFF PPL++ALYI G+++ +L+ +H+KE++RY+YNHQNEDGGWG++I GHST+ GS
Sbjct  165   SAGPLFFLPPLVLALYIIGAVNAVLSLQHQKEIIRYIYNHQNEDGGWGIHIAGHSTIFGS  224

Query  2049  ALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             A +Y+ALRLLGE  +     A+ARGR WIL HGGA  IPSWGK +L+VLGVYEW GCNP+
Sbjct  225   AFSYIALRLLGEGPEGGEDGAMARGRKWILDHGGAVGIPSWGKFWLTVLGVYEWSGCNPL  284

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWL P   P HP KM  YCR  YMPMSYLY KR+ G +T LV S+R E++++PY +I
Sbjct  285   PPEFWLLPKISPIHPGKMLCYCRLVYMPMSYLYGKRFVGRITGLVQSLREELYIEPYREI  344

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +WN  R +C KED YYPH   QD+LW  L +  EPI+ RWPF+ +RE A++  + H+ Y 
Sbjct  345   NWNKARNSCAKEDLYYPHPLAQDMLWGFLHHVAEPILTRWPFSIMREKALKVALKHIHYE  404

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRY  IG +EK L ++  W EDPN +  K HLAR+PD+LW+AEDGM MQ+FG Q WD
Sbjct  405   DENSRYYCIGCVEKVLCLLACWVEDPNSEAYKRHLARIPDYLWMAEDGMKMQSFGCQMWD  464

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             A FA QA+ISS +  EYG  L+KAH ++K SQ+++NP G+F  MYRH  KGAW FS QDH
Sbjct  465   AAFAIQAIISSDLAHEYGPTLRKAHDFVKASQVRQNPTGNFTEMYRHTCKGAWTFSTQDH  524

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCT E +K  LL  QMSP++ GEK++ +  Y+AV++ L LQS  +GGF  WEP  
Sbjct  525   GWQVSDCTGEGLKVALLFSQMSPDLVGEKMEKERFYDAVNVILSLQS-SNGGFPAWEPQR  583

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE  NP+E F D++++ E+VE T S +  L  F   +P++R KE+   I++A  Y+
Sbjct  584   AFRWLEKFNPTEFFEDVLIEREYVECTSSAIQGLILFIKLHPEHRRKEIESCISRAIHYI  643

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WGIC+ YGT F + GL A G++Y+NS A+RKA  F LSKQ  +GGWG
Sbjct  644   EDTQNPDGSWYGCWGICYTYGTWFGVEGLVACGKTYQNSPALRKACEFLLSKQLPDGGWG  703

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   S     Y   EGNRSN+V TSWA+L L+   QAE DPTP+HR  ++LIN+QMEDGD
Sbjct  704   ESYLSSTNKVYTNLEGNRSNLVNTSWALLALIEGGQAEIDPTPIHRGMRVLINSQMEDGD  763

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+ITG +MKNC L+Y+S+R+ FP+ AL EY +RV
Sbjct  764   FPQQEITGVFMKNCTLNYSSYRNIFPIWALGEYSRRV  800



>ref|XP_010472731.1| PREDICTED: camelliol C synthase-like isoform X1 [Camelina sativa]
Length=768

 Score =   877 bits (2266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/760 (54%), Positives = 545/760 (72%), Gaps = 13/760 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLKI  G    P++ STNN+ GRQ WE+DP+AGT +E+ A E+AR+ +          
Sbjct  1     MWKLKIASGNTEEPFLSSTNNFLGRQTWEFDPDAGTEDERAAVEEARRKYXXXXXXXXXX  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREE-EEVNYEAITTAVRKAVRLNCALQAKDGHWP  2236
                   R+Q +KE   +  +IPPV+  E+  ++  E  T A+R+ V    ALQA DGHWP
Sbjct  61    ---XIWRLQFLKEKSFEQ-AIPPVKKVEDANKITSEIATNALRRGVNFLSALQASDGHWP  116

Query  2235  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  2056
             AEN+GPLFF PPL+  L+++G +  ILT+EH++E++RY+Y HQNEDGGWGL+I+GHSTM 
Sbjct  117   AENAGPLFFLPPLVFCLFVTGHLHEILTTEHRREILRYIYCHQNEDGGWGLHIEGHSTMF  176

Query  2055  GSALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              + LNY+ +R+LGE  +     A  R R WIL HGGAT IPSWGK +LS+LGV++W G N
Sbjct  177   CTTLNYICMRILGEGPNGGPGNACTRARKWILGHGGATYIPSWGKTWLSILGVFDWSGSN  236

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFW+ PS  P HP+KMW YCR  YMPMSYLY KR+ GP++ L+L +R EI+++PY 
Sbjct  237   PMPPEFWILPSCLPIHPSKMWCYCRLVYMPMSYLYGKRFVGPISPLILQLREEIYLQPYA  296

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHM  1531
             +I+WN  R  C KED Y PH  IQDV+W+ L   TEP +  WPFNK+ RE ++   + H+
Sbjct  297   KINWNRARHLCAKEDAYCPHPQIQDVIWDCLYIFTEPFLTCWPFNKLLREKSLGVAMKHI  356

Query  1530  RYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQ  1351
              Y  E SRYITIG +EK+L M+  W EDPN    K HL R+ D+LW+AEDGM MQ+FGSQ
Sbjct  357   HYEDENSRYITIGCVEKALCMLACWVEDPNGIHFKKHLLRISDYLWIAEDGMKMQSFGSQ  416

Query  1350  NWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSD  1171
              WD+ FA QAL++S + +E  D L++ + +LK SQ++ENP G++ +MYRH SKG+W FSD
Sbjct  417   LWDSGFALQALVASNLADEIPDVLRRGYDFLKISQVRENPSGEYTNMYRHISKGSWTFSD  476

Query  1170  QDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWE  991
             +DHGW  SDCTAE +KC LLL  M P+I G K+D + LYE+V I L LQS ++GG   WE
Sbjct  477   RDHGWQASDCTAEGLKCCLLLSMMPPDIVGPKMDPEQLYESVAILLSLQS-KNGGVTAWE  535

Query  990   PPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAA  811
             P   Q +LE+LNP+E+FAD+V++ E+ E T S + AL  FK  YP +R +E+   I KA 
Sbjct  536   PARGQEWLELLNPTEVFADVVIEHEYNECTSSAIQALILFKQLYPYHRTEEINTFIKKAV  595

Query  810   EYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEG  631
             +Y+E+ Q  DGSWYG WG+CF Y T F L GL AAG++Y N  A+RK  HF L+ Q   G
Sbjct  596   QYIESIQMLDGSWYGSWGVCFTYSTWFGLGGLAAAGKTYNNCLAMRKGVHFLLTTQKDNG  655

Query  630   GWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQME  451
             GWGE   SCP  +YIP E  RSN+VQTSWAM+GL++  QAERDPTPLHRAAKLLIN+Q+E
Sbjct  656   GWGESYLSCPKKRYIPSEEERSNLVQTSWAMMGLLHAGQAERDPTPLHRAAKLLINSQLE  715

Query  450   DGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             +GDFPQQ+ITG++MKNC+LHYA++R+ FP+ AL+EYR+RV
Sbjct  716   NGDFPQQEITGAFMKNCLLHYAAYRNIFPVWALAEYRRRV  755



>ref|XP_010539602.1| PREDICTED: camelliol C synthase-like isoform X5 [Tarenaya hassleriana]
Length=770

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/767 (53%), Positives = 543/767 (71%), Gaps = 13/767 (2%)
 Frame = -3

Query  2607  FSVNIRKMWKLKIGEGGG---PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTK  2437
             F  N  +MW+LKIGEG     PY+YSTN++ GRQ WE+DP+AGTPEE+ A E+ R+ F +
Sbjct  5     FLSNTIRMWRLKIGEGNSKEDPYLYSTNDFVGRQTWEFDPDAGTPEERAAVEETRRSFYE  64

Query  2436  QRQKGPHTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQ  2257
              R +      DL  R+  ++E E     IPPV++ + +++  E +T A+R+ +R   ALQ
Sbjct  65    NRYR-VKASSDLLCRIYFLEEFEQ---LIPPVKVEDNDDIPPETLTNALRRGIRFFSALQ  120

Query  2256  AKDGHWPAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYI  2077
             A DGHWPAEN+GPLF  PPL+  LYI+G +D I ++EH+K+ + Y+Y HQNEDGGWGL+I
Sbjct  121   ADDGHWPAENAGPLFPLPPLVFCLYITGVLDEIFSAEHRKQALWYIYCHQNEDGGWGLHI  180

Query  2076  DGHSTMIGSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGV  1909
             +GHSTM  + LNY+ +R+LGE  D    +A  R R WIL HGG T IPSWGK +L++LGV
Sbjct  181   EGHSTMFCTTLNYICMRILGEGPDGGRENACTRARQWILDHGGVTYIPSWGKAWLAILGV  240

Query  1908  YEWDGCNPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNE  1729
             ++W G NP+PPEFW+ PS  P HPA M  Y R  YMP+SYLY KR+  P+T L+L +R E
Sbjct  241   FDWSGSNPMPPEFWILPSFLPIHPANMMCYSRMVYMPLSYLYGKRFVAPITPLILKLRKE  300

Query  1728  IHVKPYDQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAM  1552
             +++ PY+ I+WN  R  C KED YY H  IQD++W+ L    EP + RWPFNK+ RE A+
Sbjct  301   MYLHPYETINWNKVRHLCAKEDLYYLHPLIQDLIWDCLYVIVEPFLTRWPFNKLLREKAL  360

Query  1551  RKVIMHMRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMT  1372
             +  + H+ Y  E SRYITIG++EK+L M+  W EDP+ D  K HLAR+PD+LW+AEDGM 
Sbjct  361   KVAMKHIHYEDENSRYITIGSVEKALCMLACWVEDPHGDYFKKHLARIPDYLWVAEDGMK  420

Query  1371  MQTFGSQNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSK  1192
             MQ   SQ WD   A QAL++S + +E  + L++ H +LK+SQ+ ENP GDFKSMYRH S+
Sbjct  421   MQGLASQLWDTGLAIQALLASNLSDEISNVLRRGHDFLKKSQVAENPSGDFKSMYRHISR  480

Query  1191  GAWAFSDQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPES  1012
             GAW FS++DHGW VSDCTAE +KC LLL  M P++ G K++   LY+AV+I L LQS E+
Sbjct  481   GAWTFSERDHGWQVSDCTAEGLKCCLLLSMMPPDVVGPKLNPGPLYDAVNIILSLQS-EN  539

Query  1011  GGFAVWEPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVA  832
             GG   WEP     +LE+ NPSE F + +++ ++ E T S + AL  F+  YPD+RA+E+ 
Sbjct  540   GGVTPWEPARAYGWLELFNPSEFFVNNLIEYQYCECTSSAIQALVLFRQLYPDHRAEEIN  599

Query  831   MSIAKAAEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFL  652
               + KA EY+E  Q  DGSWYG WG+CF YGT FAL GL  AG++Y N  A+RK   F L
Sbjct  600   NFLEKAVEYIENVQMPDGSWYGSWGVCFTYGTWFALAGLAEAGKTYGNCLAMRKGVRFLL  659

Query  651   SKQNQEGGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKL  472
               Q   GGWGE   SCP  +YIP EG RSN+VQT+WA++GL++  QAERDPTPLH A KL
Sbjct  660   ETQKDNGGWGESYLSCPKKRYIPTEGERSNLVQTAWAVMGLLHAGQAERDPTPLHPAVKL  719

Query  471   LINAQMEDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             +IN+Q+E+GDFPQQ+ITG+ M++CM+HYA++R+ FPL ALS+YR+ V
Sbjct  720   IINSQLENGDFPQQEITGAVMRSCMMHYAAYRNTFPLWALSQYRRLV  766



>ref|XP_006468107.1| PREDICTED: beta-amyrin synthase-like [Citrus sinensis]
Length=763

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/760 (53%), Positives = 543/760 (71%), Gaps = 11/760 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG---GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2416
             MW LKIG+ G    PYI+STNN+ GRQ+W +DP+AG+PEE    E+AR  + K R    +
Sbjct  1     MWTLKIGDHGTQKDPYIFSTNNFDGRQLWVFDPDAGSPEEIAEVEEARFNYFKNRFNVKN  60

Query  2415  TCGDLFMRMQMIKESEVDVLSIPPVRLREE-EEVNYEAITTAVRKAVRLNCALQAKDGHW  2239
                +L  ++Q+++E + +  +IP V++ +  E++ +E  TTA+R+AV +  ALQ+  GHW
Sbjct  61    A-SELIWQIQILREKKFEQ-TIPQVKIGDHGEKITHEIATTALRRAVHIFSALQSSHGHW  118

Query  2238  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  2059
             PA+NSGPLF+  P +I LYI+G ++++ +SEH+KE++RY YNHQNEDGGWGL+++GHSTM
Sbjct  119   PADNSGPLFYNTPFIICLYITGYLNIVFSSEHRKEMLRYTYNHQNEDGGWGLHVEGHSTM  178

Query  2058  IGSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGC  1891
              G+  NY+ +RLLGE  D    +A AR R WIL  GGAT IPSWGK +LS+LGVY+W GC
Sbjct  179   FGTVFNYICMRLLGEGPDGGENNACARARKWILDRGGATGIPSWGKTWLSILGVYDWSGC  238

Query  1890  NPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPY  1711
             NP+PPEFW FPS  P  P K+  YCR TYMPMSYLY KR+ GP+T L+L +R EI+ +PY
Sbjct  239   NPMPPEFWKFPSFLPISPGKLLCYCRLTYMPMSYLYGKRFVGPITPLILQLREEIYTQPY  298

Query  1710  DQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHM  1531
               I W+  R  C KED+++PHT +Q++LW+ L    EP++ RWP N++RE ++   + H+
Sbjct  299   RDIHWSKMRHFCAKEDSFFPHTSVQNLLWDTLYNVVEPVLNRWPLNQLREKSLEIAMNHI  358

Query  1530  RYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQ  1351
              Y  E SRY+TIG IEK L M+  W EDPN D  K HL+R+ ++LW+ EDGM +Q+FGSQ
Sbjct  359   HYEDEASRYMTIGCIEKPLNMLSCWVEDPNSDYFKKHLSRISEYLWVGEDGMKVQSFGSQ  418

Query  1350  NWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSD  1171
              WD   A QAL++  +  E G  L KAH +LK+SQ+ +NP GDFK M+RH SKG W FS+
Sbjct  419   TWDCAIAVQALLACSLTGEIGPILMKAHDFLKKSQVTDNPPGDFKRMFRHISKGGWTFSN  478

Query  1170  QDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWE  991
             +DHGW VSDCTAEA+ C L    M PEI GEK++ +  Y+AV+  L LQS E+GG   WE
Sbjct  479   KDHGWPVSDCTAEALLCCLHFSMMRPEIVGEKMEPERFYDAVNYILSLQS-ETGGVPAWE  537

Query  990   PPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAA  811
             P     +LE+LNP E   +++++ + VE T S + A+  FK  YP +RAKEV   IAKA 
Sbjct  538   PTGAPSWLELLNPIEFLDEVIIEHDKVECTASALKAMTLFKKLYPKHRAKEVKNVIAKAT  597

Query  810   EYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEG  631
             +++E  Q++DGSWYG WGICF Y   FA+ GL AA ++Y N  AIRKA  F L  Q ++G
Sbjct  598   KFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAKKTYSNCLAIRKATDFLLKIQCEDG  657

Query  630   GWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQME  451
             GWGE   SCP  KYIP +GNRSN+VQT+WAM+ L++  Q ERDPTPLHRAAKLLIN+Q+E
Sbjct  658   GWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMSLIHAGQMERDPTPLHRAAKLLINSQLE  717

Query  450   DGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DGDFPQQ++TG +M+NCMLHY  +R+ FP+ AL+EYR R+
Sbjct  718   DGDFPQQELTGVFMENCMLHYPIYRNIFPMWALAEYRSRL  757



>emb|CDX88493.1| BnaC06g39370D [Brassica napus]
Length=778

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/757 (54%), Positives = 543/757 (72%), Gaps = 10/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG--PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MWKLKI +G    PY++STNN+ GRQ WE+DP+AGT EE+ A ++AR+ F   R +   +
Sbjct  1     MWKLKIAKGSKEEPYLFSTNNFLGRQTWEFDPDAGTSEERAAVDEARRFFFDNRFRVKAS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ +KE +    +IP V++ + +++  E  + A+R+ V    +LQA DGHWPA
Sbjct  61    -SDLIWRMQFLKEKKFKQ-AIPSVKVEDAKKLTSETASNALRRGVSFLSSLQASDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL+  L+++G +  I T EH++E++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  119   ENAGPLFFLPPLVFCLFVTGHLHEIFTKEHRREILRYIYCHQNEDGGWGLHIEGHSTMFC  178

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + LNY+ LR+LGE  +    +A  R R WIL HGGAT IPSWGK +LS+LGV++W G NP
Sbjct  179   TTLNYICLRILGEGPNEGPGNACKRAREWILGHGGATYIPSWGKTWLSILGVFDWSGSNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCR  YMPMSYLY KR+ GP++ L+L +R EI+++PY +
Sbjct  239   MPPEFWILPSCLPIHPAKMWCYCRLVYMPMSYLYGKRFVGPISPLILKLREEIYLQPYAE  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHMR  1528
             I+WN  R  C KED YYP   +Q+V+W+ L    EP +  WP NK+ RE A+   + H+ 
Sbjct  299   INWNKARHLCAKEDAYYPRPLVQNVIWDCLYMFAEPFLTCWPLNKLLREKALDVAMKHIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK+L M+  W E+PN    K HL RV D+LW+AEDGM MQ+FGSQ 
Sbjct  359   YEDENSRYITIGCVEKALCMLACWVENPNGVHFKKHLLRVSDYLWIAEDGMKMQSFGSQL  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD+ FA QAL++S +  E  + L++ H + K SQ+++NP  DF SM+RH SKG+W FSD+
Sbjct  419   WDSGFALQALLASNLCSEIPEVLRRGHDFFKDSQVRDNPSSDFNSMHRHISKGSWTFSDR  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW  SDCTAE +KC LLL  M P+I G K+D + LYE+V I L LQS ++GG   WEP
Sbjct  479   DHGWQASDCTAEGLKCCLLLSMMPPDIVGPKMDPEQLYESVIILLSLQS-KNGGVTAWEP  537

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                Q +LE+LNP+E FADIVV+ E+ E T S + AL  FK  YPD+R +E+  SI KA +
Sbjct  538   ARGQEWLELLNPTEFFADIVVEHEYNECTSSTIQALILFKQLYPDHRTEEINSSIKKAVQ  597

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             Y+E  Q  DGSWYG WG+CF Y T FAL GL AAG++Y N  A+RK  HF L+ Q   GG
Sbjct  598   YIENIQMLDGSWYGSWGVCFTYSTWFALGGLAAAGKTYSNCLAMRKGVHFLLTIQKDNGG  657

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SC   +YIP EG ++N+VQTSWAM+GL++  QAERDPTPLHRAAKLLIN+Q+E+
Sbjct  658   WGESYLSCSKKRYIPSEGEKTNLVQTSWAMMGLLHAGQAERDPTPLHRAAKLLINSQLEN  717

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             GDFPQQ+ITG++MK C+LHYA++R+ FP+ AL+EY +
Sbjct  718   GDFPQQEITGAFMKTCLLHYAAYRNIFPVWALAEYSR  754



>ref|XP_006450022.1| hypothetical protein CICLE_v10013952mg [Citrus clementina]
 gb|ESR63262.1| hypothetical protein CICLE_v10013952mg [Citrus clementina]
Length=761

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/759 (53%), Positives = 531/759 (70%), Gaps = 9/759 (1%)
 Frame = -3

Query  2586  MWKLKI--GEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LKI  G+   PY+++TNN+ GRQIWE+DPNAG+PEE    E+AR+ F K R      
Sbjct  1     MWRLKIAVGDKNSPYMFTTNNFVGRQIWEFDPNAGSPEELAEVEEARQSFYKNRHN-VKP  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GDL  R+Q ++E       IP V++++ E + YE  TTA+++A     A+QA DGHWPA
Sbjct  60    AGDLLWRLQFLREKNFKP-RIPQVKVKDGEAITYETATTAMKRAAHYFSAIQASDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GP++F PP +  LYI+G ++ + T EH++E++RYLYNHQ+EDGGWG++++  S+M G
Sbjct  119   ENAGPMYFLPPFVFCLYITGHLNTVFTVEHRREILRYLYNHQHEDGGWGVHVEAPSSMFG  178

Query  2052  SALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +  +Y+ +RLLG   +D    A AR R WI  HGG T IPSWGK +LS+LG++EW G NP
Sbjct  179   TVFSYLCMRLLGLGPNDGENNACARARKWIRDHGGVTYIPSWGKNWLSILGIFEWSGTNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HP+KMW YCR  YMP+SYLY KR+ GP+T L+  +R E+H +PY++
Sbjct  239   MPPEFWILPSFVPLHPSKMWCYCRLVYMPVSYLYGKRFVGPITPLIQQLREELHTQPYNE  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W   R  C KED YYPH F+Q++LW+ L   +EP++ RWP NK IR+ A+++ +  + 
Sbjct  299   INWRKVRHLCSKEDLYYPHPFVQELLWDTLYLASEPLLTRWPLNKLIRQKALKETMKFIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y    SRYITIG +EK L M+  W EDPN    K HL R+ D++WL EDGM +QTFGSQ 
Sbjct  359   YEDHNSRYITIGCVEKPLCMLACWVEDPNGIAFKKHLNRIADYIWLGEDGMKVQTFGSQT  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD     QAL++  + +E    L K H YLK++QI++NP GD+K  +RHFSKGAW FSDQ
Sbjct  419   WDTALGLQALMACNIADEVESVLGKGHDYLKKAQIRDNPVGDYKGNFRHFSKGAWTFSDQ  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC+L L  M PEI GEK++ + LY+AV+  L LQ  ++GG AVWE 
Sbjct  479   DHGWQVSDCTAEGLKCVLQLSLMPPEIVGEKMEPERLYDAVNFLLSLQDEKTGGLAVWER  538

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                   LE LNP E   D++V+  +VE T S + A   FK  YP +R KE+   I KA  
Sbjct  539   AGASLLLEWLNPVEFLEDLIVEHTYVECTASAIEAFMLFKKLYPHHRKKEIENFIVKAVH  598

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             Y+E +Q ADGSWYG WGICF+YGTCFAL GL  AG++Y N  AIR+A  F L+ Q+ +GG
Sbjct  599   YIEDEQTADGSWYGNWGICFIYGTCFALGGLQVAGKTYNNCLAIRRAVDFLLNAQSDDGG  658

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE  +SCP   Y P EG RS VV T+ A+L L+   QA+RDPTP+HR  KLLIN+Q+E+
Sbjct  659   WGESYKSCPNKIYTPLEGKRSTVVHTALAVLSLISAGQADRDPTPIHRGVKLLINSQLEN  718

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+I G +M+NCMLHYA +R+ FPL AL+EYRKRV
Sbjct  719   GDFPQQEIMGVFMRNCMLHYAEYRNIFPLRALAEYRKRV  757



>sp|A8CDT3.1|LUPS_BRUGY RecName: Full=Lupeol synthase; Short=BgLUS [Bruguiera gymnorhiza]
 dbj|BAF80444.1| lupeol synthase [Bruguiera gymnorhiza]
Length=761

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/755 (55%), Positives = 536/755 (71%), Gaps = 8/755 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI EGG  PYIYSTNN+ GRQ WE+DP AGTPEE+   E+AR+ F + R       
Sbjct  1     MWRLKIAEGGNNPYIYSTNNFVGRQTWEFDPEAGTPEERAQVEEARENFWRDRFL-IKPS  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  R Q + E +     IP V++++ EE+  E  TTA+R++V L  ALQA DGHW AE
Sbjct  60    SDLLWRFQFLSEKKFKQ-RIPQVKVQDGEEITREIATTALRRSVHLVSALQASDGHWCAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             NSGP+FF PP++ +LYI+G ++ + ++EH KE++RY+Y H NEDGGWGL+I+GHS M  +
Sbjct  119   NSGPMFFVPPMVFSLYITGHLNAVFSAEHCKEILRYIYCHPNEDGGWGLHIEGHSAMFST  178

Query  2049  ALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              LNY  L  LGE      D+A  R R  IL HG ATAI SWGK +L++LGVYEWDGCNP+
Sbjct  179   VLNYNWLGKLGEGRDGGKDNACERARRRILDHGSATAISSWGKTWLAILGVYEWDGCNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW FP+ FP HPA+M  YCR TYM MSYLY K++ GP+T L+L +R EI+ +PYDQI
Sbjct  239   PPEFWAFPTFFPIHPARMLCYCRLTYMAMSYLYGKKFVGPITPLILQLREEIYNEPYDQI  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +W+  R  C KED YY HT  Q +LW+A+    EP+++RWPFNK+RE A++  + H+ Y 
Sbjct  299   NWSRMRHLCAKEDNYYAHTLTQIILWDAIYMLGEPLLKRWPFNKLREKALKITMDHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E S+YITIG++EK L M+  W EDPN D  K HLAR+PD++WL EDG+ +Q+FGSQ WD
Sbjct  359   DENSQYITIGSVEKPLLMLACWHEDPNGDAFKKHLARIPDYVWLGEDGIKIQSFGSQVWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
              +F  QALI+S +  E G  L+K H ++K SQ+ +NP GDF+ M+RH SKG+W FSD+DH
Sbjct  419   TSFVLQALIASNLPSETGPTLEKGHNFIKNSQVTQNPSGDFRRMFRHISKGSWTFSDKDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE++KC LL   M PE+ GEK+  Q +Y+AV++ + LQS ++GG + WEP  
Sbjct  479   GWQVSDCTAESLKCCLLFSMMPPELVGEKMGPQRMYDAVNVIISLQS-KNGGCSAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                ++E LNP E  AD+V++ E+VE T S + AL  FK  YP++R KE+ + I  A  + 
Sbjct  538   AGSWMEWLNPVEFLADLVIEHEYVECTSSSLQALVLFKKLYPEHRRKEIEIFILNAVRFT  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  QQ DGSWYG WGICFL GT F L GL AAG++Y N  A+RK   F L  Q  +GGWG
Sbjct  598   EEIQQPDGSWYGNWGICFLSGTWFGLKGLAAAGKTYYNCTAVRKGVEFLLQTQRDDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP   Y+P EGNRSN+VQT+ AM+GL+   Q ERDPTPLHRAAKLLIN+Q E GD
Sbjct  658   ESYLSCPKKIYVPLEGNRSNLVQTALAMMGLILGGQGERDPTPLHRAAKLLINSQTELGD  717

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRK  337
             FPQQ+++G +M+NCMLHY+ +R  FP  AL+EY K
Sbjct  718   FPQQELSGCFMRNCMLHYSEYRDIFPTWALAEYCK  752



>ref|XP_011034490.1| PREDICTED: lupeol synthase-like isoform X1 [Populus euphratica]
Length=759

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/757 (55%), Positives = 545/757 (72%), Gaps = 10/757 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW++KI EGG  P+IYSTNN+ GRQIWE+DP+AGT EE+   E+AR+ F + R +     
Sbjct  1     MWRIKIAEGGNDPHIYSTNNFLGRQIWEFDPDAGTLEERAEVEEARQNFWRNRNE-VKPS  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  + Q ++E +     IP VR+ + E+++YE  T+A+R++V L  ALQA DGHW AE
Sbjct  60    SDLLWKFQFLREKKFKQ-RIPRVRIEDGEDISYEKATSALRRSVHLFSALQASDGHWCAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             NSGP+F+ PPL+ +LYI+G ++ I ++EHKKE++RY+Y HQNEDGGWGL+I+GHSTM  +
Sbjct  119   NSGPMFYFPPLVFSLYITGHLNAIFSAEHKKEILRYIYCHQNEDGGWGLHIEGHSTMFCT  178

Query  2049  ALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              LNY+ +R+LGE      D A  R R WIL HG A AI SWGK +L++LGVYEW GCNP+
Sbjct  179   VLNYICMRMLGEGRDGGKDKACERARKWILDHGSAIAISSWGKTWLAILGVYEWAGCNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW  PS  P HP  + +YCR TY+PM+YLY KR+ GP+T L+L IR EI+ +PY+++
Sbjct  239   PPEFWFLPSTSPIHPGNLLDYCRLTYLPMAYLYGKRFVGPITPLILQIREEIYNEPYEKL  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +W   R  C KED YYPHT IQ + W+A+    EP++ RWPFNK+RE A+   + H+ Y 
Sbjct  299   NWRRVRHLCAKEDNYYPHTSIQILFWDAIYTFGEPLLTRWPFNKLREKALNITMDHIHYE  358

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRYITIG IEK L M+  W EDPN D  + HLAR+ D++WL EDG+ MQ+FGSQ WD
Sbjct  359   DESSRYITIGCIEKPLDMLACWVEDPNGDYFRRHLARIKDYVWLGEDGIKMQSFGSQVWD  418

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
              + A QALI+S + +E G  LK+ H ++K SQ+ ENP GDF+ M+RH SKG+W FSD+DH
Sbjct  419   TSLALQALIASNLSDETGPALKEGHSFIKNSQVTENPPGDFRRMFRHISKGSWTFSDKDH  478

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCTAE++KC LL   M PEI GEK++ Q L+++V+I L LQS ++GG + WEP  
Sbjct  479   GWQVSDCTAESMKCCLLFSTMPPEIVGEKMEPQKLFDSVNILLSLQS-KNGGVSAWEPAG  537

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE LNP E   D+VV+ E+VE T S + AL  FK  YP +R KE+  SI    +++
Sbjct  538   SGLWLEWLNPVEFLEDLVVEHEYVECTSSTIQALVLFKKLYPGHRTKEIQNSIINGVKFI  597

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q+ DGSWYG WGICF+YGTCFAL GL AAG++Y N  A+RK   F L  Q  +GGWG
Sbjct  598   EELQKPDGSWYGNWGICFIYGTCFALGGLAAAGKTYSNCLAVRKGVDFLLGSQRDDGGWG  657

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   SCP  +Y+P   N SN+VQT+ AM+GL++  QA+RDP PLHRAAKLLIN+Q E GD
Sbjct  658   ESYLSCPKKEYVPL--NHSNLVQTAMAMMGLIHGGQADRDPAPLHRAAKLLINSQTELGD  715

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+I G +M+NCMLHY+++RS FP+ AL+EYR+ V
Sbjct  716   FPQQEIGGVFMRNCMLHYSAYRSIFPIWALAEYRRHV  752



>gb|KEH18380.1| beta-amyrin synthase [Medicago truncatula]
Length=762

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/758 (53%), Positives = 541/758 (71%), Gaps = 9/758 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI +GG  PYI+STNN+ GRQ WE+DPNAGT EE+   EKAR+ F   R K    C
Sbjct  1     MWRLKIADGGNDPYIFSTNNFLGRQTWEFDPNAGTSEERAQVEKARQHFYNNRFK-VKPC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  R Q+++E      +I  V++ + EE+  E +TT +R+AV    ALQA DGHWP+ 
Sbjct  60    SDLLWRFQILREIFFKQ-TIASVKIEDGEEITEEKVTTTLRRAVNHISALQASDGHWPSL  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLF+ PPL+  +Y+ G +D +   E++KE++RY+Y HQNEDGGWGL+++GHS M  +
Sbjct  119   NAGPLFYFPPLVFCMYVIGHLDSVFPKEYRKEILRYIYCHQNEDGGWGLHVEGHSIMFCT  178

Query  2049  ALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              LNY+ +R+LGE      ++A A+ R WI  HGG T +PSWGK +LS+LG+++W   NP+
Sbjct  179   VLNYICMRILGEGPNGGKENACAKARKWIHDHGGVTYVPSWGKFWLSILGIFDWRASNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS    HPA+M  YCR  YMPMSYLY KR+ GP+T L L +R E+  +PY+++
Sbjct  239   PPEFWMLPSFLLKHPARMLCYCRLVYMPMSYLYGKRFVGPITPLTLKLREELLTEPYEKV  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRY  1525
             +W   R  C KED YYPH  IQD++W++L    EP++  WP NK IRE A++  + H+ Y
Sbjct  299   NWQKVRHLCAKEDLYYPHPLIQDLIWDSLYIFMEPLLTHWPLNKLIREKALQVAMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLAR+PD+LW+AEDGMT+ +FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCMLSCWVEDPNGDAFKKHLARLPDYLWVAEDGMTLHSFGSQTW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA+   QAL+++ ++E+ G  L K H ++K SQ+++NP GDF+SMYRH SKG+W FSDQD
Sbjct  419   DASLIIQALLATNLIEDIGPTLAKGHKFIKNSQVRDNPSGDFESMYRHISKGSWTFSDQD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LLL  +SPEI GEK++ + LY++V+I   LQ  + GG   WEP 
Sbjct  479   HGWQVSDCTAEGLKCCLLLSMLSPEIVGEKMEPERLYDSVNIMFSLQG-KKGGLPAWEPS  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LE+LNP E   +IVV+ E+VE T S + A+  FK  YP++R +EV   IAKA ++
Sbjct  538   KALEWLELLNPIEFLEEIVVEREYVECTSSSIQAMVLFKKLYPEHRKEEVENFIAKAVKF  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE +Q +DGSWYG WGICF YG+ FAL GLTAAG++YEN  AIRKA  F L+ Q ++GGW
Sbjct  598   LEDKQTSDGSWYGNWGICFTYGSWFALGGLTAAGKTYENCAAIRKAVKFLLTIQREDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SC    Y+P EG++SN+VQT+WA++ L++  QAERDPTPLHRA KL+IN Q E+G
Sbjct  658   GESHLSCSKKIYVPLEGSQSNIVQTAWALMALIHAGQAERDPTPLHRAVKLIINLQQEEG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             D+PQQ++T  +MKNCMLHYA  R  FP+ AL+EYRK +
Sbjct  718   DWPQQELTAVFMKNCMLHYAMFRDIFPMWALAEYRKGI  755



>ref|XP_006468116.1| PREDICTED: beta-amyrin synthase-like [Citrus sinensis]
Length=761

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/759 (52%), Positives = 531/759 (70%), Gaps = 9/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEG--GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHT  2413
             MW+LK+ EG    PY+++TNN+ GRQIWE+DP AG+PEE    E+AR+ F K R      
Sbjct  1     MWRLKVAEGDKNSPYMFTTNNFVGRQIWEFDPKAGSPEELAEVEEARQKFYKNRHN-VKP  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GDL  R+Q ++E       IP V++++ + + YE  TTA+++A     A+QA DGHWPA
Sbjct  60    AGDLLWRLQFLREKNFKQ-RIPQVKVKDGDAITYETATTAMKRAAHYFSAIQASDGHWPA  118

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GP++F PP +  LYI+G ++ + T EH++E++RYLYNHQ+EDGGWG++++  S+M G
Sbjct  119   ENAGPMYFLPPFVFCLYITGHLNTVFTVEHRREILRYLYNHQHEDGGWGVHVEAPSSMFG  178

Query  2052  SALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +  +Y+ +RLLG   +D    A AR R WI  HGG T IPSWGK +LS+LG++EW G NP
Sbjct  179   TVFSYLCMRLLGLGPNDGENNACARARKWIRDHGGVTYIPSWGKNWLSILGIFEWSGTNP  238

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HP+KMW YCR  YMP+SYLY KR+ GP+T L+  +R E+H +PY++
Sbjct  239   MPPEFWILPSFVPLHPSKMWCYCRLVYMPVSYLYGKRFVGPITPLIQQLREELHTQPYNE  298

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W   R  C KED YYPH F+Q++LW+ L   +EP++ RWP NK IR+ A+++ +  + 
Sbjct  299   INWRKVRHLCAKEDLYYPHPFVQELLWDTLYLASEPLLTRWPLNKLIRQKALKETMKFIH  358

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y    SRYITIG +EK L M+  W EDPN    K HL R+ D++WL EDGM +QTFGSQ 
Sbjct  359   YEDHNSRYITIGCVEKPLCMLACWVEDPNGIAFKKHLNRIADYIWLGEDGMKVQTFGSQT  418

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD     QAL++  + +E    L K H YLK++QI++NP GD+K  +RHFSKGAW FSDQ
Sbjct  419   WDTALGLQALMACNIADEVESVLGKGHDYLKKAQIRDNPVGDYKGNFRHFSKGAWTFSDQ  478

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC+L L  M PEI GEK++ + LY+AV+  L LQ  ++GG AVWE 
Sbjct  479   DHGWQVSDCTAEGLKCVLQLSLMPPEIVGEKMEPERLYDAVNFLLSLQDEKTGGLAVWER  538

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                   LE LNP E   D++V+  +VE T S + A   FK  YP +R KE+   I KA +
Sbjct  539   AGASLLLEWLNPVEFLEDLIVEHTYVECTASAIEAFTLFKKLYPHHRKKEIENFIVKAVQ  598

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             Y+E +Q ADGSWYG WGICF+YGTCFAL GL  AG++Y N  AIR+A  F L+ Q+ +GG
Sbjct  599   YIEDEQTADGSWYGNWGICFIYGTCFALGGLQVAGKTYNNCLAIRRAVDFLLNAQSDDGG  658

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE  +SCP   Y P EG RS VV T+ A+L L+   QA+RDPTP+HR  KLLIN+Q+E+
Sbjct  659   WGESYKSCPNKIYTPLEGKRSTVVHTALAVLSLISAGQADRDPTPIHRGVKLLINSQLEN  718

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+I G +M+NCMLHYA +R+ FPL AL+EYRKRV
Sbjct  719   GDFPQQEIMGVFMRNCMLHYAEYRNIFPLRALAEYRKRV  757



>ref|XP_006353758.1| PREDICTED: lupeol synthase-like [Solanum tuberosum]
Length=755

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/755 (54%), Positives = 538/755 (71%), Gaps = 4/755 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLK  +G G ++ S+NNY GRQ WEYD   GT +E+   ++ R+ FTK R     +  
Sbjct  1     MWKLKTAQGEGLWLTSSNNYIGRQHWEYDEEGGTLQERALVDEMRQNFTKNRFLHKQS-A  59

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             DL MRMQ+ KE+    +    V+L E E+V  EA+   +R+++     +QA DGHWPAE+
Sbjct  60    DLLMRMQLRKENGCGAIG-GRVKLEESEDVTEEAVKIRLRRSISYYSTIQAHDGHWPAES  118

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +GPLFF PPL++ALY++G ++++L+  H+ E+ RY YNHQNEDGGWG +I+GHSTM G+ 
Sbjct  119   AGPLFFLPPLVMALYVTGDMNVVLSPAHQMEIKRYTYNHQNEDGGWGFHIEGHSTMFGTV  178

Query  2046  LNYVALRLLGEEA-DDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPPEF  1870
              NYVALRLLGE+  ++A+A+GR WIL H GA A PSWGK +L+VLGVYEWDGCNP+PPEF
Sbjct  179   FNYVALRLLGEDCENNALAKGRKWILDHAGAVATPSWGKFWLAVLGVYEWDGCNPMPPEF  238

Query  1869  WLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDWNN  1690
             W+ P+ FP HP KM  Y R  YMPMSYLY KR+ G +T+LV SIR+EI+++PY Q DWN 
Sbjct  239   WIMPTLFPIHPGKMLCYARLVYMPMSYLYGKRFVGRITSLVQSIRDEIYIQPYHQTDWNK  298

Query  1689  TRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGAEES  1510
              R  C KED YYPH  IQD LW  L +  EP+++RWPFNK+RE A++  + H+ Y  + S
Sbjct  299   ARNTCAKEDLYYPHPLIQDTLWGFLHHFAEPMLKRWPFNKLREKALKVAMEHIHYEDQTS  358

Query  1509  RYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDATFA  1330
             RYI IG +EK L +M  W EDPN +  K+HLAR+PD+ W++EDG+  Q+FG Q WDA F+
Sbjct  359   RYICIGCVEKVLCLMACWVEDPNSEAYKHHLARLPDYYWISEDGLKFQSFGCQTWDAVFS  418

Query  1329  TQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGWVV  1150
              QA++SS + EE+G  LKKA+ +LK SQ++ENP GDFK MYRH SKG W FS QDHGW V
Sbjct  419   IQAILSSDVAEEFGPTLKKANNFLKASQVRENPSGDFKKMYRHISKGGWPFSMQDHGWQV  478

Query  1149  SDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQPY  970
             SDCT+E +KC LL  QM  ++ GEK D + LY+AV++ L LQS E+GGF  WEP     +
Sbjct  479   SDCTSEGLKCALLFSQMPTQLVGEKFDAERLYDAVNVILSLQS-ENGGFPAWEPQRAYRW  537

Query  969   LEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLETQQ  790
             LE  NP+E F D +++ E+VE T S + AL+ FK  +P +R KE+ ++I K  +Y+E  Q
Sbjct  538   LEKFNPTEFFEDTIIEREYVECTSSSIQALSLFKKLHPGHRRKEIDVAITKGLQYIENTQ  597

Query  789   QADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGECLE  610
               DGSW G WGIC+ YGT FA+ GL A GR+Y  S A++KA  F LSKQ  +GGWGE   
Sbjct  598   NPDGSWTGCWGICYTYGTWFAVDGLIACGRTYSTSHALQKACKFLLSKQLLDGGWGESYL  657

Query  609   SCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFPQQ  430
             S     Y   EG++SN+VQTSWA+L L+   Q E DP+P+H   +LLIN+QMEDGD+PQQ
Sbjct  658   SNSNKVYTNIEGDKSNLVQTSWALLALINAGQGEIDPSPIHCGIRLLINSQMEDGDYPQQ  717

Query  429   DITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWI  325
              +TG++MKNC L+YAS+R+ FP+ AL++Y KR+ I
Sbjct  718   GVTGAFMKNCTLNYASYRNIFPIWALAQYHKRLLI  752



>ref|XP_006374737.1| hypothetical protein POPTR_0014s00370g [Populus trichocarpa]
 gb|ERP52534.1| hypothetical protein POPTR_0014s00370g [Populus trichocarpa]
Length=759

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/754 (54%), Positives = 535/754 (71%), Gaps = 6/754 (1%)
 Frame = -3

Query  2586  MWKLKIGE-GGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI E G  PYI+STN++ GRQIW YDPNAGTPEE+E  E+AR+ FT+ R +   + 
Sbjct  1     MWRLKIAEKGSNPYIFSTNDFVGRQIWAYDPNAGTPEEREQVEEARRNFTRNRSEVKPS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  + Q+++E      +IP VR+ + EEV YE  TTA+R++     ALQA DGHWPAE
Sbjct  60    SDLLWQYQILREKNFKQ-TIPAVRVEDGEEVTYEKTTTALRRSANFLSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             NSG LFF PP +   YI+G ++ +   E++KE+ RY+YNHQNEDGGWGL+I+ HS M  +
Sbjct  119   NSGVLFFLPPFVFCFYITGHLNTMFPPEYRKEIFRYIYNHQNEDGGWGLHIESHSNMFCT  178

Query  2049  ALNYVALRLLGEEADD-AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPPE  1873
               +Y+ LR+LG   D+ A ARGR WIL  GG T+IPSWGK +LS+LG+++W GCNP+PPE
Sbjct  179   TFSYICLRMLGVAPDEEACARGRKWILDRGGVTSIPSWGKTWLSILGLFDWLGCNPMPPE  238

Query  1872  FWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDWN  1693
             FW+ PS  P HPAKMW Y R  YMPMSYLY KR+ GP+T L+LS+R E++++PY+ ++W 
Sbjct  239   FWIIPSTLPIHPAKMWCYTRLVYMPMSYLYGKRFVGPITPLILSLREELYLQPYESVNWK  298

Query  1692  NTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRYGAE  1516
             + R  C KED YYPHT IQD LW++L   +EP++ RWPFN+ IR+ A+   + H+ Y  E
Sbjct  299   HVRHLCAKEDLYYPHTLIQDFLWDSLYLMSEPLLTRWPFNQLIRKKALEVTMKHIHYEDE  358

Query  1515  ESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDAT  1336
              SRYITIG IEK L M+  W EDP+    K HLARVPDFLW+ EDGM +QTFGSQ WDAT
Sbjct  359   SSRYITIGCIEKVLCMLSCWVEDPDGVAFKRHLARVPDFLWVGEDGMKVQTFGSQLWDAT  418

Query  1335  FATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGW  1156
             F  QAL SS + EE    L KA  ++K+ Q+ +NP GDF+ MYRH S+G+W FSDQDHGW
Sbjct  419   FGFQALYSSDLGEEIKPTLAKAFDFIKKCQVVDNPAGDFRGMYRHISRGSWTFSDQDHGW  478

Query  1155  VVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQ  976
              VSDCTAEA+KC+L    +  E  GEK+D + ++EAV+I L LQ P  GG + WE    +
Sbjct  479   QVSDCTAEALKCVLFAQMLPSEYVGEKLDPRMIFEAVNIILSLQGPR-GGLSGWETIRGE  537

Query  975   PYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLET  796
              +LE LNP E   +IV++ ++ E T S +     F   YP +R KE+  SIA+A EYL+ 
Sbjct  538   MWLEKLNPLEFAENIVIEHDYTECTSSAIQVFVMFMKMYPGHRKKEIETSIARAVEYLKM  597

Query  795   QQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGEC  616
              Q  DGSWYG WG+CF+Y T +AL+GL AAG++Y N++A+R+   F L  Q+ +GGWGE 
Sbjct  598   IQMPDGSWYGNWGVCFIYSTWYALVGLAAAGKTYYNNQAMRRGVDFLLRVQSPDGGWGES  657

Query  615   LESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFP  436
               SCP   Y   E NRS  VQ++WAMLGL++  QA+RDPTPLHRAAKLLIN+Q EDG +P
Sbjct  658   YLSCPNKIYTSLEENRSTYVQSAWAMLGLIHAGQADRDPTPLHRAAKLLINSQAEDGSYP  717

Query  435   QQDITGSYMKNCMLHYASHRSYFPLMALSEYRKR  334
             QQ+ITG +  NCMLHY  H++ FPL AL+EYRK+
Sbjct  718   QQEITGVFKNNCMLHYPIHKNVFPLWALAEYRKK  751



>ref|XP_004243674.1| PREDICTED: lupeol synthase isoform X1 [Solanum lycopersicum]
Length=756

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/754 (54%), Positives = 539/754 (71%), Gaps = 5/754 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLK  +G G ++ S+NNY GRQ WEYD   GT +E+   ++ R+ FTK R     +  
Sbjct  1     MWKLKTAQGEGLWLTSSNNYIGRQHWEYDEEGGTLQERAIVDEMRQNFTKNRFLHKQS-S  59

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             DL MRMQ+ KE+    +    V+L E E+V  EA+   +RK++     +QA DGHWPAE+
Sbjct  60    DLLMRMQVRKENGCVEIG-GEVKLEESEDVREEAVKIRLRKSISYYSTIQAHDGHWPAES  118

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +GPLFF PPL++ALY++G ++++L+  H+ E+ RY YNHQNEDGGWG +I+GHSTM G+ 
Sbjct  119   AGPLFFLPPLVMALYVTGDMNVVLSPAHQMEIKRYTYNHQNEDGGWGFHIEGHSTMFGTV  178

Query  2046  LNYVALRLLGE--EADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPPE  1873
              NYVALRLLGE  E ++A+ +GR WIL H GA A PSWGK +L+VLGVYEWDGCNP+PPE
Sbjct  179   FNYVALRLLGEYCENNNALDKGRKWILHHTGAIATPSWGKFWLAVLGVYEWDGCNPMPPE  238

Query  1872  FWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDWN  1693
             FW+ P+ FP HP KM  Y R  YMPMSYLY KR+ G +T+LV +IR+EI+++PY QIDWN
Sbjct  239   FWIMPTLFPIHPGKMLCYARLVYMPMSYLYGKRFVGRITSLVQTIRDEIYIQPYHQIDWN  298

Query  1692  NTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGAEE  1513
               R  C KED YYPH FIQD LW  L +  EP+++RWPFNK+RE A++  + H+ Y  + 
Sbjct  299   KARNTCAKEDLYYPHPFIQDTLWGFLHHFAEPMLKRWPFNKLREKALKVAMEHIHYEDQT  358

Query  1512  SRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDATF  1333
             SRYI IG +EK L +M  W EDPN +  K HLAR+PD+ W++EDG+  Q+FG Q WDA F
Sbjct  359   SRYICIGCVEKVLCLMACWVEDPNSEAYKRHLARLPDYYWISEDGLKFQSFGCQTWDAVF  418

Query  1332  ATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGWV  1153
             + QA++SS + EE+G  LKKA+ +LK SQ++ENP GDFK MYRH SKG W FS QDHGW 
Sbjct  419   SIQAILSSDVAEEFGPTLKKANNFLKASQVRENPSGDFKKMYRHISKGGWPFSMQDHGWQ  478

Query  1152  VSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQP  973
             VSDCT+E +KC LL  QM  ++ GEK+DV+ LY+AV++ L LQS E+GGF  WEP     
Sbjct  479   VSDCTSEGLKCALLFSQMPTQLVGEKLDVERLYDAVNVILSLQS-ENGGFPAWEPQHAYR  537

Query  972   YLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLETQ  793
             +LE  NP+E F D +++ E+VE T S + AL+ FK  +P +R KE+ ++I K  +Y+E  
Sbjct  538   WLEKFNPTEFFEDTIIEREYVECTSSSIQALSLFKKLHPGHRRKEIDVAITKGLQYIENT  597

Query  792   QQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGECL  613
             Q  DGSW G WGIC+ YGT FA+ GL A GR+Y  S A++KA  F LSKQ  +GGWGE  
Sbjct  598   QNPDGSWTGCWGICYTYGTWFAVDGLIACGRTYSTSHALQKACQFLLSKQLLDGGWGESY  657

Query  612   ESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFPQ  433
              S     Y   EG++SN+VQTSWA+L L+   Q E DP+P+H   +LL+N+QMEDGD+PQ
Sbjct  658   LSNSNKVYTNIEGDKSNLVQTSWALLALINAGQGEIDPSPIHCGIRLLMNSQMEDGDYPQ  717

Query  432   QDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             Q +TG++MKNC L+YAS+R+ FP+ AL++Y KR+
Sbjct  718   QGVTGAFMKNCTLNYASYRNIFPIWALAQYHKRL  751



>dbj|BAA86932.1| lupeol synthase [Taraxacum officinale]
Length=758

 Score =   874 bits (2259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/759 (54%), Positives = 536/759 (71%), Gaps = 11/759 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGP-YIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLKI EGG   ++ +TNN+ GRQ W++DP+AGT EE+   EK R  F   R +   + 
Sbjct  1     MWKLKIAEGGDDEWLTTTNNHVGRQHWQFDPDAGTEEERAEIEKIRLNFKLNRFQFKQS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIP-PVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              DL MR Q+ KE+ ++   IP  ++L E EEV  +A+TT +++A+     +QA DGHWPA
Sbjct  60    ADLLMRTQLRKENPIN--KIPDAIKLNETEEVTNDAVTTTLKRAISFYSTIQAHDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E++GPLFF PPL+IALY++G+++ ILT  H+ E+ RY+YNHQNEDGGWGL+I+GHST+ G
Sbjct  118   ESAGPLFFLPPLVIALYVTGAMNDILTPAHQLEIKRYIYNHQNEDGGWGLHIEGHSTIFG  177

Query  2052  SALNYVALRLLGEEADD-----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
             S L+Y+ LRLLGEEAD      A+ +GR WIL HGGA  IPSWGK +L++LGVYEW GCN
Sbjct  178   SVLSYITLRLLGEEADSVAEDMALVKGRKWILDHGGAVGIPSWGKFWLTILGVYEWGGCN  237

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPEFWL P  FP HP KM  YCR  YMPMSYLY KR+ G +T LV  +R E++  PYD
Sbjct  238   PMPPEFWLMPKFFPIHPGKMLCYCRLVYMPMSYLYGKRFVGKITELVRDLRQELYTDPYD  297

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMR  1528
             +I+WN  R  C KED YYPH F+QD++W  L    EP++   P + +RE A++  + H+ 
Sbjct  298   EINWNKARNTCAKEDLYYPHPFVQDMVWGVLHNVVEPVLTSRPISTLREKALKVAMDHVH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  + SRY+ IG +EK L ++  W EDPN D  K HLAR+PD+ W+AEDGM MQ+FG Q 
Sbjct  358   YEDKSSRYLCIGCVEKVLCLIATWVEDPNGDAYKRHLARIPDYFWVAEDGMKMQSFGCQM  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WDA FA QA+ SS + EEYG  LKKAH ++K SQ+++NP GDF  MYRH SKGAW FS Q
Sbjct  418   WDAAFAIQAIFSSNLTEEYGPTLKKAHEFVKASQVRDNPPGDFSKMYRHTSKGAWTFSIQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +K  LL  QM+P++ GEKV+ + LY+AV++ L LQS E+GGF  WEP
Sbjct  478   DHGWQVSDCTAEGLKVSLLYSQMNPKLVGEKVETEHLYDAVNVILSLQS-ENGGFPAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LE  NP+E F D++++ E+VE T S +  L  FK  +P +R KE+   I++A +
Sbjct  537   QRAYAWLEKFNPTEFFEDVLIEREYVECTSSAIQGLTLFKKLHPGHRTKEIEHCISRAVK  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             Y+E  Q++DGSWYG WGIC+ YGT FA+  L A G++Y N  A++KA  F LSKQ  +GG
Sbjct  597   YVEDTQESDGSWYGCWGICYTYGTWFAVDALVACGKNYHNCPALQKACKFLLSKQLPDGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   S     Y   EGNRSN+V TSWA++ L+   QAE DPTP+    +LLIN+QME+
Sbjct  657   WGESYLSSSNKVYTNLEGNRSNLVHTSWALISLIKAGQAEIDPTPISNGVRLLINSQMEE  716

Query  447   GDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             GDFPQQ+ITG +MKNC L+Y+S R+ FP+ AL EYR+ V
Sbjct  717   GDFPQQEITGVFMKNCNLNYSSFRNIFPIWALGEYRRIV  755



>emb|CAN65909.1| hypothetical protein VITISV_001242 [Vitis vinifera]
Length=729

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/758 (54%), Positives = 530/758 (70%), Gaps = 38/758 (5%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   E AR+ F K R Q  P  
Sbjct  1     MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAARENFWKNRYQVKPS-  59

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GDL  RMQ ++E      +IP V++ + EE+ YE  T AVR+      ALQA DGHWPA
Sbjct  60    -GDLLWRMQFLREKNFKQ-TIPQVKVGDGEEITYETATAAVRRGAHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPL+F PPL++ LYI+G +D +   E++KE++RYLY HQNEDGGWG +I+GHSTM  
Sbjct  118   ENAGPLYFLPPLVMCLYITGHLDTVFPGEYRKEILRYLYCHQNEDGGWGFHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + L+Y+ +R+LGE  D    +A ARGR WIL  GG T+IPSWGK +LS+ G+++W G NP
Sbjct  178   TTLSYICMRILGEGPDGGRENACARGRKWILDRGGVTSIPSWGKTWLSIFGLFDWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFWLFPS  P HPAKMW YCR  YMPMSYLY KR+ GP+T LVL +R E+ ++PY++
Sbjct  238   MPPEFWLFPSRLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPITTLVLELREELFLQPYNE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I+W   R  C KED YYPH  IQD++W+ L  CTEP++ RWPFNK+R+ A+   + H+ Y
Sbjct  298   INWRKVRHLCAKEDLYYPHPLIQDLMWDGLYICTEPLLTRWPFNKLRQKALEVTMKHIHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLAR+PD++W+ EDG+ MQ+FGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLSCWVEDPNGDYFKKHLARIPDYIWVGEDGIKMQSFGSQEW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D  FA QA+++  M +E G  LKK H ++K+SQ+K+NP GDFKSMYRH SKG+W FSDQD
Sbjct  418   DTGFALQAVLACNMTDEIGPTLKKGHEFVKESQVKDNPSGDFKSMYRHISKGSWTFSDQD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LL   M PEI G K++ + L+++V+I L LQS ++GG A WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSMMPPEIVGVKMEPERLFDSVNILLSLQS-KNGGLAAWEPA  536

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LE+LNP+E FADIV++ E+VE T S + AL  FK  YP +R KE+   I  AA+Y
Sbjct  537   GASEWLELLNPTEFFADIVIEHEYVECTASAIQALVLFKKLYPGHRKKEIDNFITYAAKY  596

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             +E  Q  DGSWYG WG+CF YG+ FAL GL AAG++Y N  AIR+A  F L+ Q  +GGW
Sbjct  597   IEDIQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYHNCHAIRRAVEFLLNSQRDDGGW  656

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP  KY P EGNRSN+V T WA++GL+ +                         
Sbjct  657   GESYVSCPDKKYTPLEGNRSNLVHTGWALMGLISS-------------------------  691

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
                 Q+ITG +MKNCMLHYA++R+ +PL AL+EYR+RV
Sbjct  692   ---GQEITGVFMKNCMLHYAAYRNIYPLWALAEYRRRV  726



>ref|XP_006436395.1| hypothetical protein CICLE_v10030771mg [Citrus clementina]
 gb|ESR49635.1| hypothetical protein CICLE_v10030771mg [Citrus clementina]
Length=763

 Score =   873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/760 (53%), Positives = 539/760 (71%), Gaps = 11/760 (1%)
 Frame = -3

Query  2586  MWKLKIGEGG---GPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2416
             MW+LKIG+ G    PYI+STNN+ GRQ W +DP+AG+PEE    E+AR  + K R    +
Sbjct  1     MWRLKIGDHGTKKDPYIFSTNNFDGRQFWVFDPDAGSPEEIAEVEEARLNYFKNRFNVKN  60

Query  2415  TCGDLFMRMQMIKESEVDVLSIPPVRLREE-EEVNYEAITTAVRKAVRLNCALQAKDGHW  2239
                +L  ++Q+++E + +  +IP V++ +  E++ +E  TTA+R+AV    ALQ+  GHW
Sbjct  61    A-SELIWQIQILREKKFEQ-TIPQVKIGDHGEKITHEIATTALRRAVHKFSALQSSHGHW  118

Query  2238  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  2059
             PA+NSGPLF+  P +I LYI+G ++++ +SEH+KE++RY YNHQNEDGGWGL+++GHSTM
Sbjct  119   PADNSGPLFYNTPFIICLYITGYLNIVFSSEHRKEMLRYTYNHQNEDGGWGLHVEGHSTM  178

Query  2058  IGSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGC  1891
              G+  NY+ +RLLGE  D    +A AR R WIL  GGAT IPSWGK +LS+LGVY+W GC
Sbjct  179   FGTVFNYICMRLLGEGPDGGGNNACARARKWILDRGGATGIPSWGKTWLSILGVYDWSGC  238

Query  1890  NPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPY  1711
             NP+PPEFW FPS  P  P K+  YCR TYMPMSYLY KR+  P+T L+L +R EI+ +PY
Sbjct  239   NPMPPEFWKFPSFLPISPGKLLCYCRVTYMPMSYLYGKRFVSPITPLILQLREEIYTQPY  298

Query  1710  DQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHM  1531
               I W+  R  C KED ++PHT +Q++LW+ L    EP++ RWP N++RE ++   + H+
Sbjct  299   SDIHWSKMRHFCAKEDIFFPHTSVQNLLWDTLYNVVEPVLNRWPLNQLREKSLEIAMNHI  358

Query  1530  RYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQ  1351
              Y  E SRY+TIG +EK L M+  W EDPN D  K HL+R+ ++LW+ EDGM +Q+FGSQ
Sbjct  359   HYEDEASRYMTIGCVEKPLNMLSCWVEDPNSDYFKKHLSRISEYLWVGEDGMKVQSFGSQ  418

Query  1350  NWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSD  1171
              WD   A Q L++  + +E G  L KAH +LK SQ+ +NP GDFK M+RH SKG W FS+
Sbjct  419   TWDCAIAVQTLLACSLTDEIGPILMKAHDFLKTSQVTDNPPGDFKRMFRHISKGGWTFSN  478

Query  1170  QDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWE  991
             +DHGW VSDCTAEA+ C L    M PEI GEK++ +  Y+AV+  L LQS E+GG   WE
Sbjct  479   KDHGWPVSDCTAEALLCCLHFSMMRPEIVGEKMEPERFYDAVNYVLSLQS-ETGGVPAWE  537

Query  990   PPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAA  811
             P     +LE+LNP E   +++++ + VE T S + A+  FK  YP +R KEV   IAKA 
Sbjct  538   PTGAPSWLELLNPIEFLDEVIIEYDKVECTASALKAMTLFKKLYPKHRTKEVKNFIAKAT  597

Query  810   EYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEG  631
             +++E  Q++DGSWYG WGICF YG  FA+ GL AA ++Y N  AIRKA  F L  Q ++G
Sbjct  598   KFIEDIQKSDGSWYGSWGICFTYGAWFAISGLVAAKKTYSNCLAIRKATDFLLKIQCEDG  657

Query  630   GWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQME  451
             GWGE   SCP  KYIP +GNRSN+VQT+WAM+ L++  Q ERDPTPLHRAAKLLIN+Q+E
Sbjct  658   GWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMSLIHAGQMERDPTPLHRAAKLLINSQLE  717

Query  450   DGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             DGDFPQQ++TG +M+NCMLHY  +R+ FP+ AL+EYR R+
Sbjct  718   DGDFPQQELTGVFMENCMLHYPIYRNIFPMWALAEYRSRL  757



>sp|Q8W3Z2.1|LUPS_BETPL RecName: Full=Lupeol synthase [Betula platyphylla]
 dbj|BAB83087.1| lupeol synthase [Betula platyphylla]
Length=755

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/756 (53%), Positives = 539/756 (71%), Gaps = 8/756 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI EGG P + S N++ GRQ WE+DP+AGTP+E+   EK R+ FTK R +   +  
Sbjct  1     MWKLKIAEGG-PGLVSGNDFIGRQHWEFDPDAGTPQERAEVEKVREEFTKNRFQMKQS-A  58

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             DL MRMQ+ KE+    +  PPV+++E E +  EA+ T +R+++    ++QA DGHWP E+
Sbjct  59    DLLMRMQLRKENPCQPIP-PPVKVKETEVITEEAVITTLRRSLSFYSSIQAHDGHWPGES  117

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             +GPLFF  P ++ALYI+G ++ I +  H+KE++RYLYNHQNEDGGWG +I+GHSTM GSA
Sbjct  118   AGPLFFLQPFVMALYITGDLNTIFSPAHQKEIIRYLYNHQNEDGGWGFHIEGHSTMFGSA  177

Query  2046  LNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             L+Y+ALR+LGE  +D    A+A+ R WIL HGG  AIPSWGK +++VLG+YEW GCNP+P
Sbjct  178   LSYIALRILGEGLEDGEDGAMAKSRKWILDHGGLVAIPSWGKFWVTVLGLYEWSGCNPLP  237

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PEFW  P  FP HP KM  YCR  YMPMSYLY KR+ GP+T L+ S+R E++ +PY QI+
Sbjct  238   PEFWFLPDIFPIHPGKMLCYCRLVYMPMSYLYGKRFVGPITGLIQSLRQELYNEPYHQIN  297

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             WN  R    KED YYPH  IQD+LW  L +  EP++ RWPF+ +RE A++  I H+ Y  
Sbjct  298   WNKARSTVAKEDLYYPHPLIQDLLWGFLHHVAEPVLTRWPFSMLREKALKAAIGHVHYED  357

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             E S+Y+ IG++EK L ++  WAEDPN +  K HL R+PD  W+AEDG+ +Q+FG Q WDA
Sbjct  358   ENSKYLCIGSVEKVLCLIACWAEDPNGEAYKLHLGRIPDNYWVAEDGLKIQSFGCQMWDA  417

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
              FA QA++S  + EEY   L+KAH ++K SQ+ ENP GDFK+MYRH +KGAW FS QDHG
Sbjct  418   GFAIQAILSCNLNEEYWPTLRKAHEFVKASQVPENPSGDFKAMYRHINKGAWTFSMQDHG  477

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCTAE +K  +L  QM P++ GEK++ + LY+AV++ L LQS  +GGF  WEP   
Sbjct  478   WQVSDCTAEGLKVAILFSQMPPDLVGEKIEKERLYDAVNVILSLQS-SNGGFPAWEPQRA  536

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
               +LE  NP+E F D +++ E+VE T   V  LA F+  YP +R  E+  SI +  +Y+E
Sbjct  537   YGWLEKFNPTEFFEDTLIEREYVECTSPAVHGLALFRKFYPRHRGTEIDSSIYRGIQYIE  596

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
               Q+ DGSWYG+WGIC+ YGT FA+  L A GR+Y+N  A+RK+  F LSKQ   GGWGE
Sbjct  597   DVQEPDGSWYGHWGICYTYGTWFAVGALAACGRNYKNCPALRKSCEFLLSKQLPNGGWGE  656

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                S     +   EGNR+N+VQT+WA+L L+   QAE DPTP+HR  ++LIN+QMEDGDF
Sbjct  657   SYLSSQNKVWTNIEGNRANLVQTAWALLSLIDARQAEIDPTPIHRGVRVLINSQMEDGDF  716

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             PQQ+ITG +M+NC L+Y+S+R+ FP+ AL EYR+RV
Sbjct  717   PQQEITGVFMRNCTLNYSSYRNIFPIWALGEYRRRV  752



>ref|XP_009337925.1| PREDICTED: beta-amyrin synthase-like, partial [Pyrus x bretschneideri]
Length=722

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/726 (57%), Positives = 535/726 (74%), Gaps = 11/726 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MWKLK+ +GG  PYIYSTNN+ GRQI+E+DP AGT EE+   E+AR  F   R Q  P  
Sbjct  1     MWKLKVADGGNDPYIYSTNNFVGRQIFEFDPEAGTTEERAEVEEARLHFYNNRYQVKP--  58

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
              GDL  RMQ ++E      ++P +++ + EE+ +E  TT++R++VR   ALQA DGHWPA
Sbjct  59    SGDLLWRMQFLREKNFKQTNLP-IKVEDGEEITHEKATTSLRRSVRFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             EN+GPLFF PPL++ +YI+  ++ I  +EH+KE++RY+Y HQN+DGGWGL+I+GHSTM  
Sbjct  118   ENAGPLFFLPPLVMCVYITEHLNTIFHAEHRKEILRYIYCHQNQDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +AL+Y+ +R+LGE  D    +A AR R WIL HG  T IPSWGK +LS+LGV+EW G NP
Sbjct  178   TALSYICMRILGEGPDGGQDNACARARKWILDHGSVTHIPSWGKTWLSILGVFEWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKM  YCR  YMPMSYLY KR+ GP+T L+L +R E++ +PYD+
Sbjct  238   MPPEFWILPSFLPMHPAKMLCYCRMVYMPMSYLYGKRFVGPITPLILQLREELYAQPYDE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMR  1528
             I+W   R  C KED YYPH +IQD LW++L  CTEP++ RWPFNK IR+ A+   + H+ 
Sbjct  298   INWKGVRHHCAKEDIYYPHPWIQDFLWDSLYICTEPLLTRWPFNKLIRKRALEVTMEHIH  357

Query  1527  YGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQN  1348
             Y  E SRYITIG +EK L M+  WAEDPN D  K HLAR+PD+LW+AEDGM MQ+FGSQ 
Sbjct  358   YEDENSRYITIGCVEKVLCMLACWAEDPNGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQ  417

Query  1347  WDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQ  1168
             WD  FA QAL++S + +E    L + H ++K+SQ+K+NP GDFKSM+RH SKG+W FSDQ
Sbjct  418   WDTGFAIQALLASDLTDEIAPTLARGHDFVKKSQVKDNPSGDFKSMHRHISKGSWTFSDQ  477

Query  1167  DHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEP  988
             DHGW VSDCTAE +KC LLL  M PE+ GEK++ + LY+AV++ + LQS ++GG A WEP
Sbjct  478   DHGWQVSDCTAEGLKCCLLLSMMPPELVGEKMEPERLYDAVNVLISLQS-KNGGLAAWEP  536

Query  987   PIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAE  808
                  +LEMLNP+E FAD +V+ E+VE T S + AL  FK  YP +R KE+   I  AA+
Sbjct  537   AGAAEWLEMLNPTEFFADTIVEHEYVECTSSAIQALVLFKKLYPGHRKKEMDQFITNAAQ  596

Query  807   YLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGG  628
             YLE  Q  DGSWYG WG+CF YGT FAL GLTAAG+++ N  AIRKA +F L+ Q + GG
Sbjct  597   YLENIQMEDGSWYGSWGVCFTYGTWFALGGLTAAGKTFNNCAAIRKAINFLLAIQKENGG  656

Query  627   WGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMED  448
             WGE   SCP  +Y+P EGNRSN+V T+WAM+GL++  QA+RDPTPLHRAAKL+IN QME+
Sbjct  657   WGESYLSCPKKEYVPLEGNRSNLVHTAWAMMGLIHAGQAKRDPTPLHRAAKLIINTQMEN  716

Query  447   GDFPQQ  430
             GDFPQQ
Sbjct  717   GDFPQQ  722



>ref|XP_006374736.1| hypothetical protein POPTR_0014s00370g [Populus trichocarpa]
 gb|ERP52533.1| hypothetical protein POPTR_0014s00370g [Populus trichocarpa]
Length=757

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/754 (54%), Positives = 534/754 (71%), Gaps = 8/754 (1%)
 Frame = -3

Query  2586  MWKLKIGE-GGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LKI E G  PYI+STN++ GRQIW YDPNAGTPEE+E  E+AR+ FT+ R +   + 
Sbjct  1     MWRLKIAEKGSNPYIFSTNDFVGRQIWAYDPNAGTPEEREQVEEARRNFTRNRSEVKPS-  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  + Q+++E      +IP VR+ + EEV YE  TTA+R++     ALQA DGHWPAE
Sbjct  60    SDLLWQYQILREKNFKQ-TIPAVRVEDGEEVTYEKTTTALRRSANFLSALQASDGHWPAE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             NSG LFF PP +   YI+G ++ +   E++KE+ RY+YNHQNEDGGWGL+I+ HS M  +
Sbjct  119   NSGVLFFLPPFVFCFYITGHLNTMFPPEYRKEIFRYIYNHQNEDGGWGLHIESHSNMFCT  178

Query  2049  ALNYVALRLLGEEADD-AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPPE  1873
               +Y+ LR+LG   D+ A ARGR WIL  GG T+IPSWGK +LS+LG+++W GCNP+PPE
Sbjct  179   TFSYICLRMLGVAPDEEACARGRKWILDRGGVTSIPSWGKTWLSILGLFDWLGCNPMPPE  238

Query  1872  FWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDWN  1693
             FW+ PS  P HPAKMW Y R  YMPMSYLY KR+ GP+T L+LS+R E++++PY+ ++W 
Sbjct  239   FWIIPSTLPIHPAKMWCYTRLVYMPMSYLYGKRFVGPITPLILSLREELYLQPYESVNWK  298

Query  1692  NTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRYGAE  1516
             + R  C KED YYPHT IQD LW++L   +EP++ RWPFN+ IR+ A+   + H+ Y  E
Sbjct  299   HVRHLCAKEDLYYPHTLIQDFLWDSLYLMSEPLLTRWPFNQLIRKKALEVTMKHIHYEDE  358

Query  1515  ESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDAT  1336
              SRYITIG IEK L M+  W EDP+    K HLARVPDFLW+ EDGM +QTFGSQ WDAT
Sbjct  359   SSRYITIGCIEKVLCMLSCWVEDPDGVAFKRHLARVPDFLWVGEDGMKVQTFGSQLWDAT  418

Query  1335  FATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGW  1156
             F  QAL SS + EE    L KA  ++K+ Q+ +NP GDF+ MYRH S+G+W FSDQDHGW
Sbjct  419   FGFQALYSSDLGEEIKPTLAKAFDFIKKCQVVDNPAGDFRGMYRHISRGSWTFSDQDHGW  478

Query  1155  VVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQ  976
              VSDCTAEA+KC+L    +  E  GEK+D + ++EAV+I L LQ P  GG + WE    +
Sbjct  479   QVSDCTAEALKCVLFAQMLPSEYVGEKLDPRMIFEAVNIILSLQGPR-GGLSGWETIRGE  537

Query  975   PYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLET  796
              +LE LNP E   +IV+  ++ E T S +     F   YP +R KE+  SIA+A EYL+ 
Sbjct  538   MWLEKLNPLEFAENIVI--DYTECTSSAIQVFVMFMKMYPGHRKKEIETSIARAVEYLKM  595

Query  795   QQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGEC  616
              Q  DGSWYG WG+CF+Y T +AL+GL AAG++Y N++A+R+   F L  Q+ +GGWGE 
Sbjct  596   IQMPDGSWYGNWGVCFIYSTWYALVGLAAAGKTYYNNQAMRRGVDFLLRVQSPDGGWGES  655

Query  615   LESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFP  436
               SCP   Y   E NRS  VQ++WAMLGL++  QA+RDPTPLHRAAKLLIN+Q EDG +P
Sbjct  656   YLSCPNKIYTSLEENRSTYVQSAWAMLGLIHAGQADRDPTPLHRAAKLLINSQAEDGSYP  715

Query  435   QQDITGSYMKNCMLHYASHRSYFPLMALSEYRKR  334
             QQ+ITG +  NCMLHY  H++ FPL AL+EYRK+
Sbjct  716   QQEITGVFKNNCMLHYPIHKNVFPLWALAEYRKK  749



>gb|KDP37006.1| hypothetical protein JCGZ_06062 [Jatropha curcas]
Length=773

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/777 (53%), Positives = 545/777 (70%), Gaps = 36/777 (5%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+L++ EGG  PYIYSTNN+ GRQIWE+D +AG PEE+E  EK+R+ +   R Q  P +
Sbjct  1     MWRLRVAEGGNDPYIYSTNNFLGRQIWEFDSDAGNPEEREGVEKSRQNYWNNRFQIKPSS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  + Q ++E +    +IP V+L++ EE+ YE  T A+R++V L  ALQA DGHWPA
Sbjct  61    --DLLWQFQFLREKKFKQ-TIPQVKLQDGEEITYENATAALRRSVHLFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             ENSGPLF+ PPL+ +LY++G ++ + ++EH+KE++RY+Y HQNEDGGWGL+I+GHS+M  
Sbjct  118   ENSGPLFYFPPLVFSLYVTGHLNTVFSAEHRKEILRYIYCHQNEDGGWGLHIEGHSSMFC  177

Query  2052  SALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + LNY+ +R+LG       D+A  RGR WIL HGGATAI SWGK +LS+LG+YEWDG NP
Sbjct  178   TVLNYICMRILGNGRDGGKDNACERGRKWILDHGGATAISSWGKTWLSILGMYEWDGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW  P   P HPAKM  YCR TY+PMSYLY KR+ GP+T+L+L IR EI+ +PY++
Sbjct  238   MPPEFWACPIIVPLHPAKMMCYCRLTYVPMSYLYGKRFVGPITSLILQIREEIYNEPYNK  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I+W N       ED YYPH  IQ +LW+AL   +EP+   WPFNK+RE A++  + H+ Y
Sbjct  298   INWKN-------EDNYYPHPMIQKLLWDALYIFSEPLFTIWPFNKLREKALKITMDHIHY  350

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLAR+ D++W+ EDG+ MQ+FGSQ W
Sbjct  351   EDENSRYITIGCVEKPLNMLACWVEDPNGDAFKKHLARILDYIWVGEDGIKMQSFGSQVW  410

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D + A QAL++S + +E G  LK+ H ++K SQ+ ENP GDFK M+RH SKGAW FSD+D
Sbjct  411   DTSLALQALMASNLCDEIGPTLKEGHNFIKNSQVTENPSGDFKRMFRHTSKGAWTFSDKD  470

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSD TAE +KC LL   M  EI GEK+D   LY++V++ L LQS E+GGF+ WEP 
Sbjct  471   HGWQVSDTTAEGLKCCLLFSMMPSEIVGEKMDAIKLYDSVNVLLSLQS-ENGGFSAWEPA  529

Query  984   IPQPYLEMLNPSELFADIVVQGE-------------------HVETTGSIVSALAAFKHD  862
               + +LE LNP E   D+V++ +                   +VE T S + AL  F   
Sbjct  530   GERLWLEWLNPVEFIEDLVIEHDYLDTARSQLPKTNKKWSPRYVECTSSSIQALVLFSTL  589

Query  861   YPDYRAKEVAMSIAKAAEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSE  682
             YP+ R +E+  SI  A  ++E  Q+ DGSWYG WGICF+YGT FAL GL AAGR+YEN  
Sbjct  590   YPEQRNREINNSIVNAVRFIEDIQKPDGSWYGNWGICFMYGTWFALKGLAAAGRTYENCP  649

Query  681   AIRKAAHFFLSKQNQEGGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERD  502
             AI+K   F L  Q  +GGW E   SCP   Y+P+EG+RSN+VQT+WAM+GL++  Q +RD
Sbjct  650   AIQKGVDFLLKSQRDDGGWAESYLSCPKKVYVPYEGDRSNLVQTAWAMMGLIHGGQVKRD  709

Query  501   PTPLHRAAKLLINAQMEDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             P PLHRAAKLLIN+Q E GDFPQQ  +G +M+NCMLHYA +R+ FP+ AL+EYR  V
Sbjct  710   PMPLHRAAKLLINSQTELGDFPQQGQSGVFMRNCMLHYALYRNTFPIWALAEYRLHV  766



>ref|XP_010655247.1| PREDICTED: beta-Amyrin Synthase 1 isoform X2 [Vitis vinifera]
Length=735

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/727 (56%), Positives = 526/727 (72%), Gaps = 10/727 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQR-QKGPHT  2413
             MW+LK+ +GG  PYIYSTNN+ GRQIWE+DP+ GTPEE+   E AR+ F K R Q  P +
Sbjct  1     MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAARENFWKNRFQVKPSS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E      +IP V++ + EE+  E  TTAVR+      ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-TIPQVKVGDGEEIAEETATTAVRRGAHFFSALQASDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E+SGPLFF PPL++ LYI+G +D +   E++KE++RYLY HQNEDGGWGL+I+ HS M  
Sbjct  118   EHSGPLFFLPPLVMCLYITGHLDTVFPGEYRKEILRYLYCHQNEDGGWGLHIEEHSIMFC  177

Query  2052  SALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             + L+YV +R+LGE  D    +A ARGR WIL  GG T+IP+WGKI+LS+ G+++W G NP
Sbjct  178   TTLSYVCMRILGEGRDGGRDNACARGRKWILNRGGVTSIPTWGKIWLSIFGLFDWSGSNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEF LFPSH P +PAK+W Y R  +MPMSYLY KR+ GP+T LVL +R E+ ++PY++
Sbjct  238   MPPEFSLFPSHLPMNPAKIWCYSRLIFMPMSYLYGKRFVGPITPLVLELREELFLQPYNE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I+W   R  C KED YYPH  IQD++W++L  CTEP++ RWPFNK+R+ A+   + H+ Y
Sbjct  298   INWKKVRHLCAKEDLYYPHPLIQDMMWDSLYICTEPLLTRWPFNKLRKKALEVTMKHIHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L M+  W EDPN D  K HLAR+PD++W+ EDG+ MQTFGSQ W
Sbjct  358   EDENSRYITIGCVEKVLCMLSCWVEDPNGDYFKKHLARIPDYIWVGEDGIKMQTFGSQEW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             D + A QAL++  M  E G  LKK H +LK+SQ+K+NP GDFKSMYRH SKG+W FSD+D
Sbjct  418   DTSLALQALLACNMTNEIGPTLKKGHEFLKESQVKDNPSGDFKSMYRHISKGSWTFSDKD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE +KC LL   M+PEI G K++   L+++V+I L LQS E+GG   WEP 
Sbjct  478   HGWQVSDCTAEGLKCCLLFSMMAPEIVGMKIEPGRLFDSVNILLSLQS-ENGGIVGWEPA  536

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LE+LNPSE+F D+V++ E+VE T S + AL  FK  YP++R +E+   I  A +Y
Sbjct  537   GASEWLELLNPSEMFEDLVIEHEYVECTASAIQALVLFKKLYPEHRTEEIDNFITNATKY  596

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             +E QQ  DGSWYG WG+CF+Y + +AL GL AAG++Y N  AI +A  F L  Q  +GGW
Sbjct  597   IEDQQMPDGSWYGKWGVCFIYSSWWALGGLAAAGKTYHNCLAIGRAVEFLLKSQRDDGGW  656

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SC   KY P EGN+SN+VQT WA++GL+ + QAERDPTPLHRAAKLLIN+QMEDG
Sbjct  657   GESYISCRDKKYTPLEGNKSNLVQTGWALMGLLSSGQAERDPTPLHRAAKLLINSQMEDG  716

Query  444   DFPQQDI  424
             DFPQQ I
Sbjct  717   DFPQQII  723



>ref|XP_002304910.2| putative oxidosqualene cyclase family protein [Populus trichocarpa]
 gb|EEE85421.2| putative oxidosqualene cyclase family protein [Populus trichocarpa]
Length=760

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/756 (53%), Positives = 537/756 (71%), Gaps = 7/756 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKL++ EG  P++ STN++ GRQ+WE+DP+ GTPEE    EKAR+ F++ R +      
Sbjct  1     MWKLEVAEGHDPWLLSTNDFVGRQVWEFDPDLGTPEEHAEVEKARENFSQNRFQ-VKASS  59

Query  2406  DLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAEN  2227
             D+   +Q+IKE+ +D LSIP VRL + EE+  E   T +RKAVR   ALQA+DGHWP E 
Sbjct  60    DVLKNLQLIKENGID-LSIPSVRLGDREEITCEKAETTLRKAVRFTSALQARDGHWPFEF  118

Query  2226  SGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGSA  2047
             S  LF  P L+IALYI+G+++ IL+ EHK+E+VRY+YNHQNEDGGWG +I+ HS M+ +A
Sbjct  119   SALLFEQPFLVIALYITGTLNTILSPEHKREMVRYIYNHQNEDGGWGFHIESHSMMLCTA  178

Query  2046  LNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIP  1879
             LNYV+LRLLGEE     D  +A+ R WIL HGG T I  WGK +LS +G+YEW GCNP+P
Sbjct  179   LNYVSLRLLGEEPEGGKDGVVAKARKWILDHGGVTMISIWGKYFLSFIGLYEWSGCNPVP  238

Query  1878  PEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQID  1699
             PE  L PS  PF    +W Y RT Y+P++YLY K++  P+T+LV+ +R E++++PY ++D
Sbjct  239   PECLLLPSFLPFSTGNLWCYFRTIYIPLAYLYGKKFVAPITDLVILLREELYIQPYGEVD  298

Query  1698  WNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYGA  1519
             W   R++C K+D Y PH+ +++VL + L Y  EP+   WPF+K+RE A+ K +  +RY  
Sbjct  299   WTKARISCLKKDLYKPHSLVENVLSSVLYYFAEPLSTHWPFSKLREKALAKAMRLIRYED  358

Query  1518  EESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDA  1339
             E + Y+T  ++EKSL M+  WAEDPN D LK HLA VPD+LW+AEDGM +Q  GSQ WD+
Sbjct  359   EHTGYLTHASVEKSLNMIANWAEDPNQDSLKRHLATVPDYLWVAEDGMKVQNMGSQLWDS  418

Query  1338  TFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHG  1159
              FATQA+I+S + +EYG  L+KA  ++K SQI+ENP GDF+S Y    KGAW  + +D G
Sbjct  419   VFATQAIIASNLTDEYGSTLRKAFNFIKLSQIRENPPGDFQSTYHQICKGAWTLTVKDQG  478

Query  1158  WVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIP  979
             W VSDCTAEA+K LLLL QM  +I  + ++V+ LYEAVD  L LQS E+GGF+ WEP   
Sbjct  479   WQVSDCTAEALKTLLLLSQMPADIVRDTIEVEQLYEAVDFLLTLQS-ENGGFSAWEPATS  537

Query  978   QPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLE  799
               ++EM NP+E F  ++V+ E+V+ T S+  ALA F H +P+YR KE+  S+ KA  Y+E
Sbjct  538   PQWMEMFNPTETFGGVMVETEYVDCTASVTQALALFSHLHPEYRGKEIETSVVKATHYIE  597

Query  798   TQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGE  619
               Q ADGSWYG WGIC+ Y     L+ L A G+++ NSE + K   F LSKQ + GGWGE
Sbjct  598   NAQMADGSWYGNWGICYTYAAYIVLVALAAVGKTHRNSEVVCKGCDFLLSKQLKSGGWGE  657

Query  618   CLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDF  439
                SC   +Y P +GNRSN+VQT+W M+GL+   QAERD TPLH+AA+LLIN+Q+E G+F
Sbjct  658   SYLSCRNSEYTPLDGNRSNLVQTAWTMVGLIRAGQAERDATPLHQAARLLINSQLESGEF  717

Query  438   PQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             PQQ+ITG+ +K  MLHYAS+R+ FPL AL EYRK V
Sbjct  718   PQQEITGASVKTSMLHYASYRNIFPLWALGEYRKHV  753



>emb|CDY35103.1| BnaA06g11130D [Brassica napus]
Length=788

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/761 (53%), Positives = 541/761 (71%), Gaps = 11/761 (1%)
 Frame = -3

Query  2589  KMWKLKIGEGGG---PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGP  2419
             KMW+L IGEG G   PY+ STNN+AGRQIWE+DPNAGT EE  A E+AR+ F   R +  
Sbjct  31    KMWRLNIGEGRGEDNPYLISTNNFAGRQIWEFDPNAGTSEELFAVEEARRTFYNCRHR-V  89

Query  2418  HTCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHW  2239
               CGDL  RMQ +KE + + + IPPV++ + + +  E  T A+R++V    ALQ+ DGHW
Sbjct  90    KACGDLLWRMQFLKEKKFEQV-IPPVKVDDAQRITKEEATNALRRSVHYFSALQSSDGHW  148

Query  2238  PAENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTM  2059
             PAE +GPLF+ P ++   YI+G +D + T EH+KE++RY+Y HQNEDGGWGL+I+G S M
Sbjct  149   PAEITGPLFYVPVMVFCFYITGHLDEMFTKEHRKEMLRYIYCHQNEDGGWGLHIEGKSGM  208

Query  2058  IGSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGC  1891
               +ALNY+ LR+LGE  D    +A  R R WIL HGG T IPSWGK +LS+LG+Y+W G 
Sbjct  209   FCTALNYICLRILGEGPDGGPRNACKRARQWILDHGGVTYIPSWGKSWLSILGIYDWSGT  268

Query  1890  NPIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPY  1711
             NP+PPE WL PS  P H  K   +CR  Y+  SY Y KR+ GP+T L+L +R E++V+PY
Sbjct  269   NPMPPEIWLLPSWLPIHLGKTTCFCRLVYLVTSYFYGKRFVGPITPLILQLREELYVQPY  328

Query  1710  DQIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMH  1534
             ++IDWN  R +  KED YYPH  IQD +W++L    EP++ RWP NK +RE A++ V+ +
Sbjct  329   EEIDWNKARRSYAKEDMYYPHPSIQDFVWDSLHVFGEPLLTRWPLNKLVREKALKVVVDY  388

Query  1533  MRYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGS  1354
             + Y  E SRYI IG   K++ ++  W EDPN +  K HLARVPD+ W+AEDGM +Q+FGS
Sbjct  389   IHYEDENSRYINIGCAGKAMCVLASWVEDPNGEYFKKHLARVPDYFWIAEDGMKVQSFGS  448

Query  1353  QNWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFS  1174
             Q WD + A QAL++S M  E    LKK H ++K+SQI+ENP GDFK M RH SKG W FS
Sbjct  449   QLWDTSLAIQALLASNMSNETAHVLKKGHDFIKRSQIRENPSGDFKKMNRHISKGGWTFS  508

Query  1173  DQDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVW  994
             D+D GW VSDC+AEA KC LLL +M P++ G ++D + LY++V++ L  QS E+GG   W
Sbjct  509   DRDQGWNVSDCSAEAFKCCLLLSKMPPDVVGPRMDPEQLYDSVNLLLSYQS-ENGGMTAW  567

Query  993   EPPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKA  814
             EP     +LE+ NP+E+ AD+V++ E+VE T S++ AL  FK  YPD+R +E+  +I KA
Sbjct  568   EPARGYGWLELFNPTEMLADLVIEREYVECTSSVIQALIMFKKLYPDHRTREIDRTIEKA  627

Query  813   AEYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQE  634
              +++E  Q+ADGSWYG WG+C+ Y T FAL GL A G++YEN  AIR+   F L KQN  
Sbjct  628   VQFIENTQEADGSWYGSWGVCYTYATWFALEGLVAVGKTYENCLAIREGVAFLLKKQNSS  687

Query  633   GGWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQM  454
             GGWGE   SC   +YI  EG RSN+VQT+WA++GL+ T QAERDP PLHRAAKL+IN+Q+
Sbjct  688   GGWGESYLSCSEKRYIELEGGRSNLVQTAWALMGLIQTGQAERDPVPLHRAAKLIINSQL  747

Query  453   EDGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             E+GD+PQQ++TG +MKNC L+Y ++R+ FP+ AL+EYRK +
Sbjct  748   ENGDYPQQEMTGVFMKNCFLNYVTYRNIFPIWALAEYRKVI  788



>ref|XP_010313621.1| PREDICTED: delta-amyrin synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010313622.1| PREDICTED: delta-amyrin synthase isoform X1 [Solanum lycopersicum]
Length=768

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/725 (56%), Positives = 519/725 (72%), Gaps = 10/725 (1%)
 Frame = -3

Query  2586  MWKLKIGEG-GGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQK-GPHT  2413
             MWKLKI +G    Y+YSTNNY GRQIWE+DPNAGT EEQ   E+AR+ +   R K  P++
Sbjct  1     MWKLKIAKGQDDRYLYSTNNYIGRQIWEFDPNAGTIEEQAKIEEARQHYWNNRYKVKPNS  60

Query  2412  CGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPA  2233
               DL  RMQ ++E       I  V++ E EE+++E  T A+R+AV    ALQA DGHWPA
Sbjct  61    --DLLWRMQFLREKNFKQ-RIRAVKVEEGEEISHEIATVALRRAVHFFSALQATDGHWPA  117

Query  2232  ENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIG  2053
             E++GPLFF PPL++ +YI+G ++ +  +EH+KE++RY+Y HQNEDGGWGL+I+GHSTM  
Sbjct  118   ESAGPLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFC  177

Query  2052  SALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNP  1885
             +A++Y+ +R+LGE      ++A AR R WIL HG   AIPSWGK +LS+LG +EW G NP
Sbjct  178   TAMSYICMRILGEGPEGGVNNACARARKWILDHGSVIAIPSWGKTWLSILGAFEWIGTNP  237

Query  1884  IPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQ  1705
             +PPEFW+ PS  P HPAKMW YCRT YMPMSYLY KR+ GP+T L+L +R E++ + YD+
Sbjct  238   MPPEFWILPSFLPVHPAKMWCYCRTVYMPMSYLYGKRFVGPITPLILKLREELYDQTYDE  297

Query  1704  IDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRY  1525
             I+W   R  C KED YYPH F+QD++W++L  CTEP++ RWPFNK+R  A+   + H+ Y
Sbjct  298   INWKKVRHVCAKEDLYYPHPFVQDLMWDSLYICTEPLLTRWPFNKLRNKALEVTMKHIHY  357

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYIT+G +EK L M+  W EDPN D  K HLAR+PDFLW+AEDGM MQ  GSQ+W
Sbjct  358   EDENSRYITMGCVEKVLSMLACWVEDPNGDHFKKHLARIPDFLWVAEDGMKMQGCGSQSW  417

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA+ A QAL++S M +E  D LK  H ++KQSQ+K+NP GDFK MYRH SKG+WAF+DQD
Sbjct  418   DASLAIQALLASEMNDEISDTLKNGHDFIKQSQVKDNPSGDFKVMYRHISKGSWAFADQD  477

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
              GW VSDCTAEA+KC LL   M PEI GE +D   LY++V++ L LQS ++GG + WEP 
Sbjct  478   LGWQVSDCTAEALKCCLLFSTMPPEIVGEAMDPVRLYDSVNVILSLQS-KNGGLSAWEPA  536

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 YLE+LNP+E F DIV++ EHVE T S + AL  FK  YP +R  EV   I    +Y
Sbjct  537   GAPEYLELLNPTEFFEDIVIEHEHVECTSSAIQALVRFKKLYPGHRTTEVDNFINNGVKY  596

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             +E  Q+ DGSWYG WG+CF+Y + FAL GL A G SY N  A+RK+  F L  Q  +GGW
Sbjct  597   IEDVQEPDGSWYGNWGVCFIYASWFALGGLAAVGLSYSNCAAVRKSVEFLLRTQRSDGGW  656

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   SCP   Y   E   SN+VQT+WA++GL+++ Q ERDP PLHRAAKLLIN+QMEDG
Sbjct  657   GESYRSCPDKVYRELETEHSNLVQTAWALMGLIHSGQVERDPRPLHRAAKLLINSQMEDG  716

Query  444   DFPQQ  430
             DFPQQ
Sbjct  717   DFPQQ  721



>sp|Q948R6.1|IMFS_LUFAE RecName: Full=Isomultiflorenol synthase; Short=LcIMS1 [Luffa 
aegyptiaca]
 dbj|BAB68529.1| isomultiflorenol synthase [Luffa aegyptiaca]
Length=759

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/755 (54%), Positives = 537/755 (71%), Gaps = 6/755 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG-PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MW+LK+ +GG  PYIYS NN+ GRQIWE+DPNAGTPEE+   E+ R  FTK R KG    
Sbjct  1     MWRLKVADGGNDPYIYSMNNFIGRQIWEFDPNAGTPEERAEIERLRHHFTKNRHKG-FPS  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  R+Q+++E      SIP V++ + EE++YE    A+R+      A+QA DGHWP+E
Sbjct  60    ADLLWRVQLLREKNFKQ-SIPAVKVGDGEEISYEMALDAMRRGAHFLAAIQASDGHWPSE  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
              SGPLF+  PL+I +YI G +D + + EHKKE++RY+YNHQNEDGGWGL++ GHS M  +
Sbjct  119   TSGPLFYVCPLLICMYIMGFMDKVFSPEHKKEMMRYIYNHQNEDGGWGLHVGGHSNMFCT  178

Query  2049  ALNYVALRLLGEEAD-DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPIPPE  1873
               NY++LRLLGEE D +A+ + RNWI  H G T+I SWGK +LS+L V++W   NP+PPE
Sbjct  179   TFNYISLRLLGEEPDVEAVCKARNWIHDHDGVTSILSWGKTWLSILNVFDWSASNPMPPE  238

Query  1872  FWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQIDWN  1693
             +W+ P+  P HP+ M  Y R TYMPMSYLY KR+  PLT LVL +R+E+H +PYDQI+W 
Sbjct  239   YWMLPTWVPIHPSNMMCYTRITYMPMSYLYGKRFQAPLTPLVLQLRDELHTQPYDQINWR  298

Query  1692  NTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHMRYGAE  1516
               R  C  ED Y+PH F+QD+LW+ L   +EP+M RWPFNK IR+ A+ + + H+ Y  E
Sbjct  299   KVRHMCATEDLYFPHPFVQDLLWDTLYLLSEPLMTRWPFNKLIRQKALNETMRHIHYEDE  358

Query  1515  ESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWDAT  1336
              SRYITIG +EK L M+  W EDPN + +K HLAR+PD+LW+AEDGM MQ+FGSQ+WDA 
Sbjct  359   NSRYITIGCVEKPLCMLACWVEDPNSEYVKKHLARIPDYLWMAEDGMKMQSFGSQSWDAA  418

Query  1335  FATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDHGW  1156
              A QAL+S  +  E G  L   H ++K SQ++ NP GD+KSM+R+ SKG+W FSD DHGW
Sbjct  419   LAMQALLSCNITREIGSVLNSGHDFIKNSQVRNNPPGDYKSMFRYMSKGSWTFSDCDHGW  478

Query  1155  VVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPIPQ  976
              VSDCTAE +KC LLL  + P+I GEK++ +  Y+AV++ L +QS ++GG   WEP    
Sbjct  479   QVSDCTAENLKCCLLLSLLPPDIVGEKMEPERFYDAVNVILNMQS-KNGGLPAWEPASSY  537

Query  975   PYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYLET  796
              ++E LNP E   D++++ +HVE T S + A+  F+  YP +R KE+   I KA ++L+ 
Sbjct  538   YWMEWLNPVEFLEDLIIEHQHVECTSSALQAILLFRKQYPGHRRKEINNFINKAVQFLQD  597

Query  795   QQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWGEC  616
              Q  DGSWYG WGIC+ YGT FAL  L+ AG++YEN EA+RK A+F    QN EGG+GE 
Sbjct  598   IQLPDGSWYGNWGICYTYGTWFALKALSMAGKTYENCEAVRKGANFLRKIQNPEGGFGES  657

Query  615   LESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGDFP  436
               SCP  +YIP +G RSN+VQT+W M+GL+   QA+ DPTP+HRAAKLLIN+Q EDGDFP
Sbjct  658   YLSCPYKRYIPLDGKRSNLVQTAWGMMGLICAGQADVDPTPIHRAAKLLINSQTEDGDFP  717

Query  435   QQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             Q++ITG + KNC LH+A+ R  FP+MAL EY  +V
Sbjct  718   QEEITGEFFKNCTLHFAAFREVFPVMALGEYCNKV  752



>ref|XP_010656690.1| PREDICTED: lupeol synthase isoform X3 [Vitis vinifera]
Length=752

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/757 (54%), Positives = 536/757 (71%), Gaps = 14/757 (2%)
 Frame = -3

Query  2586  MWKLKIGEGGGPYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTCG  2407
             MWKLKI EG GP++ + NN+ GRQ WE+DP+AG+ +E+   E+ R+ F K R +   +  
Sbjct  4     MWKLKIAEGKGPWLMTVNNHIGRQHWEFDPDAGSSQERAEVERVREEFKKNRFQFKQS-A  62

Query  2406  DLFMRMQMIKESEVDVLSIPP-VRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
             DL MRMQ+ KE+      IP  V+++E E+   EA+TT +R+A+     +QA DGHWPAE
Sbjct  63    DLLMRMQLTKENGCG--PIPAAVKVKETEDATKEAVTTTLRRAISFYSTIQAHDGHWPAE  120

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             ++GPLFF PPL++ALYI G+++ +L+ +H+KE++RY+YNHQNEDGGWG++I GHST+ GS
Sbjct  121   SAGPLFFLPPLVLALYIIGAVNAVLSLQHQKEIIRYIYNHQNEDGGWGIHIAGHSTIFGS  180

Query  2049  ALNYVALRLLGEEADD----AIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
             A +Y+ALRLLGE  +     A+ARGR WIL HGGA  IPSWGK +L+VLGVYEW GCNP+
Sbjct  181   AFSYIALRLLGEGPEGGEDGAMARGRKWILDHGGAVGIPSWGKFWLTVLGVYEWSGCNPL  240

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFWL P   P HP KM  YCR  YMPMSYLY KR+ G +T LV S+R E++++PY +I
Sbjct  241   PPEFWLLPKISPIHPGKMLCYCRLVYMPMSYLYGKRFVGRITGLVQSLREELYIEPYREI  300

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKIREMAMRKVIMHMRYG  1522
             +WN  R +C KED YYPH   QD+LW  L +  EPI+ RWPF+ +RE A++  + H+ Y 
Sbjct  301   NWNKARNSCAKEDLYYPHPLAQDMLWGFLHHVAEPILTRWPFSIMREKALKVALKHIHYE  360

Query  1521  AEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNWD  1342
              E SRY  IG +EK L ++  W EDPN +  K HLAR+PD+LW+AEDGM MQ      WD
Sbjct  361   DENSRYYCIGCVEKVLCLLACWVEDPNSEAYKRHLARIPDYLWMAEDGMKMQM-----WD  415

Query  1341  ATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQDH  1162
             A FA QA+ISS +  EYG  L+KAH ++K SQ+++NP G+F  MYRH  KGAW FS QDH
Sbjct  416   AAFAIQAIISSDLAHEYGPTLRKAHDFVKASQVRQNPTGNFTEMYRHTCKGAWTFSTQDH  475

Query  1161  GWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPPI  982
             GW VSDCT E +K  LL  QMSP++ GEK++ +  Y+AV++ L LQS  +GGF  WEP  
Sbjct  476   GWQVSDCTGEGLKVALLFSQMSPDLVGEKMEKERFYDAVNVILSLQS-SNGGFPAWEPQR  534

Query  981   PQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEYL  802
                +LE  NP+E F D++++ E+VE T S +  L  F   +P++R KE+   I++A  Y+
Sbjct  535   AFRWLEKFNPTEFFEDVLIEREYVECTSSAIQGLILFIKLHPEHRRKEIESCISRAIHYI  594

Query  801   ETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGWG  622
             E  Q  DGSWYG WGIC+ YGT F + GL A G++Y+NS A+RKA  F LSKQ  +GGWG
Sbjct  595   EDTQNPDGSWYGCWGICYTYGTWFGVEGLVACGKTYQNSPALRKACEFLLSKQLPDGGWG  654

Query  621   ECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDGD  442
             E   S     Y   EGNRSN+V TSWA+L L+   QAE DPTP+HR  ++LIN+QMEDGD
Sbjct  655   ESYLSSTNKVYTNLEGNRSNLVNTSWALLALIEGGQAEIDPTPIHRGMRVLINSQMEDGD  714

Query  441   FPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             FPQQ+ITG +MKNC L+Y+S+R+ FP+ AL EY +RV
Sbjct  715   FPQQEITGVFMKNCTLNYSSYRNIFPIWALGEYSRRV  751



>ref|XP_009149097.1| PREDICTED: amyrin synthase LUP2-like [Brassica rapa]
Length=757

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/760 (53%), Positives = 540/760 (71%), Gaps = 11/760 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGG---PYIYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPH  2416
             MW+L IGEG G   PY+ STNN+AGRQIWE+DPNAGT EE  A E+AR+ F   R +   
Sbjct  1     MWRLNIGEGRGEDNPYLISTNNFAGRQIWEFDPNAGTSEELFAVEEARRTFYNCRHR-VK  59

Query  2415  TCGDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWP  2236
              CGDL  RMQ +KE + + + +PPV++ + + +  E  T A+R++V    ALQ+ DGHWP
Sbjct  60    ACGDLLWRMQFLKEKKFEQV-MPPVKVDDAQRITKEEATNALRRSVHYFSALQSSDGHWP  118

Query  2235  AENSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMI  2056
             AE +GPLF+ P ++   YI+G +D + T EH+KE++RY+Y HQNEDGGWGL+I+G S M 
Sbjct  119   AEITGPLFYVPVMVFCFYITGHLDEMFTKEHRKEMLRYIYCHQNEDGGWGLHIEGKSGMF  178

Query  2055  GSALNYVALRLLGEEAD----DAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCN  1888
              +ALNY+ LR++GE  D    +A  R R WIL HGG T IPSWGK +LS+LG+Y+W G N
Sbjct  179   CTALNYICLRIVGEGPDGGPRNACKRARQWILDHGGVTYIPSWGKSWLSILGIYDWSGTN  238

Query  1887  PIPPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYD  1708
             P+PPE WL PS  P H  K   +CR  Y+  SY Y KR+ GP+T L+L +R E++V+PY+
Sbjct  239   PMPPEIWLLPSWLPIHLGKTTCFCRLVYLVTSYFYGKRFVGPITPLILQLREELYVQPYE  298

Query  1707  QIDWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNK-IREMAMRKVIMHM  1531
             +IDWN  R +  KED YYPH  IQD +W++L    EP++ RWP NK +RE A++ V+ ++
Sbjct  299   EIDWNKARRSYAKEDMYYPHPSIQDFVWDSLHVFGEPLLTRWPLNKLVREKALKVVVDYI  358

Query  1530  RYGAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQ  1351
              Y  E SRYI IG   K++ ++  W EDPN +  K HLARVPD+ W+AEDGM +Q+FGSQ
Sbjct  359   HYEDENSRYINIGCAGKAMCVLASWVEDPNGEYFKKHLARVPDYFWIAEDGMKVQSFGSQ  418

Query  1350  NWDATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSD  1171
              WD + A QAL++S M  E    LKK H ++K+SQI+ENP GDFK M RH SKG W FSD
Sbjct  419   LWDTSLAIQALLASNMSNETAHVLKKGHDFIKRSQIRENPSGDFKKMNRHISKGGWTFSD  478

Query  1170  QDHGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWE  991
             +D GW VSDC+AEA KC LLL +M P++ G ++D + LY++V++ L  QS E+GG   WE
Sbjct  479   RDQGWNVSDCSAEAFKCCLLLSKMPPDVVGPRMDPEQLYDSVNLLLSYQS-ENGGMTAWE  537

Query  990   PPIPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAA  811
             P     +LE+ NP+E+ AD+V++ E+VE T S++ AL  FK  YPD+R +E+  +I KA 
Sbjct  538   PARGYGWLELFNPTEMLADLVIEREYVECTSSVIQALIMFKKLYPDHRTREIDRTIEKAV  597

Query  810   EYLETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEG  631
             +++E  Q+ADGSWYG WG+C+ Y T FAL GL A G++YEN  AIR+   F L KQN  G
Sbjct  598   QFIENTQEADGSWYGSWGVCYTYATWFALEGLVAVGKTYENCLAIREGVAFLLKKQNSSG  657

Query  630   GWGECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQME  451
             GWGE   SC   +YI  EG RSN+VQT+WA++GL+ T QAERDP PLHRAAKL+IN+Q+E
Sbjct  658   GWGESYLSCSEKRYIELEGGRSNLVQTAWALMGLIQTGQAERDPVPLHRAAKLIINSQLE  717

Query  450   DGDFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRV  331
             +GD+PQQ++TG +MKNC L+Y ++R+ FP+ AL+EYRK +
Sbjct  718   NGDYPQQEMTGVFMKNCFLNYVTYRNIFPIWALAEYRKVI  757



>sp|Q9LRH7.1|ABAMS_PEA RecName: Full=Mixed-amyrin synthase [Pisum sativum]
 dbj|BAA97559.1| mixed-amyrin synthase [Pisum sativum]
Length=764

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/761 (53%), Positives = 542/761 (71%), Gaps = 9/761 (1%)
 Frame = -3

Query  2586  MWKLKIGEGGGPY-IYSTNNYAGRQIWEYDPNAGTPEEQEAFEKARKGFTKQRQKGPHTC  2410
             MWKLKIG+GG    I+STNN+ GRQ WE+DP+AGT +E+   E AR+ F   R +    C
Sbjct  1     MWKLKIGDGGKDRNIFSTNNFVGRQTWEFDPDAGTSQEKAQVEAARQHFYDNRFE-VKAC  59

Query  2409  GDLFMRMQMIKESEVDVLSIPPVRLREEEEVNYEAITTAVRKAVRLNCALQAKDGHWPAE  2230
              DL  R Q++KE      +I  V++++EEE++ E +   +R+AV     LQ+ DGHWPA 
Sbjct  60    SDLLWRFQILKEKNFKQ-TIESVKIKDEEEISEENVAITLRRAVHHLSTLQSNDGHWPAL  118

Query  2229  NSGPLFFTPPLMIALYISGSIDMILTSEHKKELVRYLYNHQNEDGGWGLYIDGHSTMIGS  2050
             N+GPLF+ PPL+  +Y++G +D I   E++KE++RY+Y HQNEDGGWGL+++GHS M  +
Sbjct  119   NAGPLFYFPPLVFCMYVTGHLDSIFPYEYRKEILRYIYCHQNEDGGWGLHVEGHSIMFCT  178

Query  2049  ALNYVALRLLGEE----ADDAIARGRNWILQHGGATAIPSWGKIYLSVLGVYEWDGCNPI  1882
              LNY+ +R+LGE      +DA AR R WI  HG  T + SWGKI+LSVLG+++W   NP+
Sbjct  179   VLNYICMRILGEGPNGGKEDACARARKWIHDHGSVTHVSSWGKIWLSVLGIFDWCASNPM  238

Query  1881  PPEFWLFPSHFPFHPAKMWNYCRTTYMPMSYLYAKRYHGPLTNLVLSIRNEIHVKPYDQI  1702
             PPEFW+ PS    HPAKM  YCR  YMPMSYLY KR+ GP+T L+L +R E+  +PY+++
Sbjct  239   PPEFWMLPSFLLKHPAKMLCYCRLVYMPMSYLYGKRFVGPITPLILMLREELLTQPYEKV  298

Query  1701  DWNNTRMACCKEDTYYPHTFIQDVLWNALQYCTEPIMRRWPFNKI-REMAMRKVIMHMRY  1525
             +W  TR  C KED YYPH  IQD++W++L    EP++  WPFNK+ RE A++ V+ H+ Y
Sbjct  299   NWKKTRHLCAKEDLYYPHPLIQDLIWDSLYIFVEPLLTHWPFNKLLREKALQTVMKHIHY  358

Query  1524  GAEESRYITIGAIEKSLQMMCWWAEDPNCDELKYHLARVPDFLWLAEDGMTMQTFGSQNW  1345
               E SRYITIG +EK L ++  W EDPN D  K HLAR+PD+LW++EDGMT+ +FGSQ W
Sbjct  359   EDENSRYITIGCVEKVLCILACWVEDPNGDAFKKHLARLPDYLWVSEDGMTLHSFGSQTW  418

Query  1344  DATFATQALISSGMVEEYGDCLKKAHFYLKQSQIKENPKGDFKSMYRHFSKGAWAFSDQD  1165
             DA+   QAL+++ ++E+ G  L KAH ++K+SQ+++NP GDFKSMYRH SKG+W FSD+D
Sbjct  419   DASLIIQALLATNLIEDVGPILTKAHEFIKKSQVRDNPSGDFKSMYRHISKGSWTFSDKD  478

Query  1164  HGWVVSDCTAEAIKCLLLLGQMSPEIAGEKVDVQCLYEAVDICLYLQSPESGGFAVWEPP  985
             HGW VSDCTAE++KC LLL  + PEI GEK++ + LY++V+I L LQ  + GG   WEP 
Sbjct  479   HGWQVSDCTAESLKCCLLLSMLPPEIVGEKMEPEMLYDSVNILLSLQG-KKGGLPAWEPS  537

Query  984   IPQPYLEMLNPSELFADIVVQGEHVETTGSIVSALAAFKHDYPDYRAKEVAMSIAKAAEY  805
                 +LE+ NP E   +IVV+ E+VE T S + AL  FK  YP++R KEV   IA A  +
Sbjct  538   EAVEWLELFNPIEFLEEIVVEREYVECTSSAIQALVLFKKLYPEHRKKEVENFIANAVRF  597

Query  804   LETQQQADGSWYGYWGICFLYGTCFALLGLTAAGRSYENSEAIRKAAHFFLSKQNQEGGW  625
             LE +Q +DGSWYG WGICF YG+ FAL GL AAG++Y+N  AIRK   F L+ Q ++GGW
Sbjct  598   LEYKQTSDGSWYGNWGICFTYGSWFALNGLVAAGKTYDNCAAIRKGVEFLLTTQREDGGW  657

Query  624   GECLESCPTMKYIPFEGNRSNVVQTSWAMLGLMYTEQAERDPTPLHRAAKLLINAQMEDG  445
             GE   S     Y+P E ++SN+VQTSWA++GL++  Q ERDPTPLHRA KL+IN Q E+G
Sbjct  658   GESHLSSSKKIYVPLERSQSNIVQTSWAIMGLIHAGQMERDPTPLHRAVKLIINFQQEEG  717

Query  444   DFPQQDITGSYMKNCMLHYASHRSYFPLMALSEYRKRVWIS  322
             D+PQQ++TG +MKNCML YA +R  FP  AL+EYR+R+ ++
Sbjct  718   DWPQQELTGVFMKNCMLQYAMYRDIFPTWALAEYRRRILLA  758



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8379267327684