BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24989_g3_i1 len=804 path=[1:0-296 298:297-326 4419:327-803]

Length=804
                                                                      Score     E

ref|XP_011080832.1|  PREDICTED: laccase-3-like                          416   2e-139   
ref|XP_002277722.1|  PREDICTED: laccase-12                              398   3e-132   Vitis vinifera
emb|CDP09079.1|  unnamed protein product                                398   3e-132   
ref|XP_007016999.1|  Laccase 3                                          394   1e-130   
ref|XP_004294763.1|  PREDICTED: laccase-3-like                          392   8e-130   
ref|XP_009343306.1|  PREDICTED: laccase-3-like                          389   1e-128   
ref|XP_010032957.1|  PREDICTED: laccase-13                              389   2e-128   
ref|XP_010542673.1|  PREDICTED: laccase-3-like                          387   3e-128   
ref|XP_011080750.1|  PREDICTED: laccase-3-like                          387   5e-128   
ref|XP_002516345.1|  laccase, putative                                  386   2e-127   Ricinus communis
ref|XP_006425169.1|  hypothetical protein CICLE_v10030322mg             384   8e-127   
ref|XP_010257021.1|  PREDICTED: laccase-12-like                         384   1e-126   
ref|XP_008232145.1|  PREDICTED: laccase-13                              384   1e-126   
ref|XP_007206448.1|  hypothetical protein PRUPE_ppa003408mg             384   1e-126   
ref|XP_002319955.1|  laccase family protein                             383   2e-126   Populus trichocarpa [western balsam poplar]
ref|XP_010685887.1|  PREDICTED: laccase-3-like                          382   2e-126   
emb|CBI15873.3|  unnamed protein product                                404   3e-126   
ref|XP_009616771.1|  PREDICTED: laccase-3-like                          382   4e-126   
ref|XP_008355071.1|  PREDICTED: laccase-3-like                          381   8e-126   
ref|XP_011021001.1|  PREDICTED: laccase-13-like                         382   9e-126   
ref|XP_008354603.1|  PREDICTED: laccase-3-like                          381   1e-125   
ref|XP_009763768.1|  PREDICTED: laccase-12-like                         381   2e-125   
ref|XP_009790079.1|  PREDICTED: laccase-3-like                          381   2e-125   
gb|KDP45752.1|  hypothetical protein JCGZ_17359                         380   2e-125   
ref|XP_010045386.1|  PREDICTED: laccase-3-like                          381   2e-125   
ref|XP_008457330.1|  PREDICTED: laccase-3                               380   3e-125   
ref|XP_009343323.1|  PREDICTED: laccase-3-like                          380   3e-125   
ref|XP_010264533.1|  PREDICTED: laccase-12                              380   3e-125   
ref|XP_009343324.1|  PREDICTED: laccase-3-like                          380   4e-125   
ref|XP_010099447.1|  hypothetical protein L484_011146                   379   7e-125   
ref|XP_004239959.1|  PREDICTED: laccase-12                              379   9e-125   
ref|XP_006353418.1|  PREDICTED: laccase-12-like                         379   1e-124   
ref|XP_006488594.1|  PREDICTED: laccase-3-like                          379   1e-124   
ref|XP_009804481.1|  PREDICTED: laccase-5-like isoform X2               376   1e-124   
ref|XP_010521986.1|  PREDICTED: laccase-3                               377   2e-124   
ref|XP_010457861.1|  PREDICTED: laccase-3-like                          378   2e-124   
ref|XP_006410143.1|  hypothetical protein EUTSA_v10016445mg             378   2e-124   
ref|XP_010475452.1|  PREDICTED: laccase-3-like                          377   2e-124   
ref|XP_006296399.1|  hypothetical protein CARUB_v10025575mg             377   3e-124   
ref|XP_004145307.1|  PREDICTED: laccase-3-like                          377   4e-124   
ref|XP_011041833.1|  PREDICTED: laccase-13                              378   5e-124   
emb|CDP09252.1|  unnamed protein product                                377   7e-124   
ref|XP_009141050.1|  PREDICTED: laccase-3                               376   7e-124   
ref|XP_010486989.1|  PREDICTED: laccase-3-like                          376   7e-124   
ref|XP_004307187.1|  PREDICTED: laccase-12-like                         377   8e-124   
ref|XP_004500522.1|  PREDICTED: laccase-12-like                         376   1e-123   
ref|XP_006303628.1|  hypothetical protein CARUB_v10011512mg             376   1e-123   
ref|XP_009354572.1|  PREDICTED: laccase-3-like                          376   1e-123   
ref|XP_008384707.1|  PREDICTED: laccase-3-like                          375   2e-123   
ref|XP_009144319.1|  PREDICTED: laccase-3                               375   2e-123   
ref|NP_180580.1|  laccase 3                                             375   2e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011014542.1|  PREDICTED: laccase-3-like                          377   2e-123   
ref|XP_009594351.1|  PREDICTED: laccase-12-like                         375   2e-123   
ref|XP_006355635.1|  PREDICTED: laccase-5-like                          375   2e-123   
ref|XP_010424027.1|  PREDICTED: laccase-3-like                          375   2e-123   
ref|XP_009611705.1|  PREDICTED: laccase-12-like                         375   2e-123   
ref|XP_006350924.1|  PREDICTED: laccase-3-like                          375   3e-123   
ref|XP_002881090.1|  hypothetical protein ARALYDRAFT_481932             375   3e-123   
ref|XP_009628839.1|  PREDICTED: laccase-12-like isoform X2              374   5e-123   
ref|XP_004500523.1|  PREDICTED: laccase-12-like                         374   5e-123   
ref|XP_009628838.1|  PREDICTED: laccase-12-like isoform X1              375   6e-123   
ref|XP_009771638.1|  PREDICTED: laccase-12-like                         374   7e-123   
ref|XP_010685886.1|  PREDICTED: laccase-3-like                          374   7e-123   
ref|XP_010414291.1|  PREDICTED: laccase-3                               374   9e-123   
ref|XP_004239961.1|  PREDICTED: laccase-12-like                         374   1e-122   
ref|XP_009598627.1|  PREDICTED: laccase-12-like                         374   1e-122   
emb|CDX97838.1|  BnaC04g41010D                                          373   1e-122   
ref|XP_004240885.1|  PREDICTED: laccase-5-like                          373   1e-122   
ref|XP_009804480.1|  PREDICTED: laccase-12-like isoform X1              374   1e-122   
ref|XP_006350864.1|  PREDICTED: laccase-3-like                          373   2e-122   
ref|XP_010510393.1|  PREDICTED: laccase-3-like                          373   2e-122   
ref|XP_010685889.1|  PREDICTED: laccase-3-like                          373   2e-122   
ref|XP_006355638.1|  PREDICTED: laccase-12-like                         373   2e-122   
ref|XP_006355637.1|  PREDICTED: laccase-12-like                         373   2e-122   
emb|CDP09253.1|  unnamed protein product                                393   2e-122   
ref|XP_002273875.2|  PREDICTED: laccase-12                              373   2e-122   Vitis vinifera
ref|XP_006367545.1|  PREDICTED: laccase-5-like                          372   3e-122   
ref|XP_002326089.1|  hypothetical protein POPTR_0019s14530g             372   3e-122   Populus trichocarpa [western balsam poplar]
ref|XP_009788692.1|  PREDICTED: laccase-12-like                         372   3e-122   
ref|XP_004242502.1|  PREDICTED: laccase-3-like                          372   4e-122   
ref|XP_004307184.1|  PREDICTED: laccase-12-like                         372   4e-122   
ref|XP_010535350.1|  PREDICTED: laccase-13                              371   8e-122   
gb|AFK35101.1|  unknown                                                 365   1e-121   
ref|XP_009763769.1|  PREDICTED: laccase-12-like                         371   1e-121   
ref|XP_004239957.1|  PREDICTED: laccase-12-like                         370   2e-121   
gb|KFK21959.1|  hypothetical protein AALP_AAs48252U000800               370   2e-121   
ref|XP_006435828.1|  hypothetical protein CICLE_v10031070mg             370   2e-121   
emb|CAN75316.1|  hypothetical protein VITISV_024159                     370   2e-121   Vitis vinifera
ref|XP_003544045.1|  PREDICTED: laccase-5-like                          370   3e-121   
ref|XP_003600994.1|  Laccase                                            370   3e-121   
gb|AES71245.2|  laccase/diphenol oxidase family protein                 370   4e-121   
ref|XP_003519418.1|  PREDICTED: laccase-5-like                          369   4e-121   
gb|KDO44836.1|  hypothetical protein CISIN_1g008066mg                   369   5e-121   
ref|XP_004307691.1|  PREDICTED: laccase-5-like                          369   5e-121   
ref|XP_003538485.1|  PREDICTED: laccase-5-like                          369   1e-120   
ref|XP_011004316.1|  PREDICTED: laccase-12-like                         368   1e-120   
ref|XP_010491316.1|  PREDICTED: laccase-13 isoform X1                   368   1e-120   
gb|KHN04792.1|  Laccase-5                                               369   1e-120   
ref|XP_006487674.1|  PREDICTED: laccase-3-like                          368   2e-120   
ref|XP_007142103.1|  hypothetical protein PHAVU_008G252800g             368   2e-120   
ref|XP_010087027.1|  hypothetical protein L484_012271                   367   2e-120   
ref|XP_002871251.1|  laccase-13 precursor                               367   3e-120   
ref|XP_011015318.1|  PREDICTED: laccase-12-like                         367   3e-120   
ref|XP_003616702.1|  Laccase                                            367   4e-120   
ref|XP_004239958.1|  PREDICTED: laccase-12-like                         367   4e-120   
gb|EYU43442.1|  hypothetical protein MIMGU_mgv1a003472mg                367   5e-120   
ref|XP_006431538.1|  hypothetical protein CICLE_v10003240mg             367   5e-120   
ref|XP_008359050.1|  PREDICTED: laccase-3-like                          366   6e-120   
ref|XP_007141728.1|  hypothetical protein PHAVU_008G220300g             368   6e-120   
ref|XP_009417976.1|  PREDICTED: laccase-3-like                          367   6e-120   
gb|ABK92474.1|  unknown                                                 365   6e-120   Populus trichocarpa [western balsam poplar]
ref|XP_002315131.1|  hypothetical protein POPTR_0010s19090g             366   8e-120   Populus trichocarpa [western balsam poplar]
ref|NP_196330.3|  laccase 13                                            366   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452665.1|  PREDICTED: laccase-13-like isoform X1              365   1e-119   
ref|XP_006289181.1|  hypothetical protein CARUB_v10002622mg             365   2e-119   
ref|XP_009386858.1|  PREDICTED: laccase-3-like                          365   2e-119   
gb|KDP44695.1|  hypothetical protein JCGZ_01195                         365   2e-119   
ref|XP_006355742.1|  PREDICTED: laccase-12-like                         365   2e-119   
ref|XP_009797628.1|  PREDICTED: laccase-3-like                          365   2e-119   
gb|KDP44694.1|  hypothetical protein JCGZ_01194                         365   2e-119   
ref|XP_010692917.1|  PREDICTED: laccase-12                              365   2e-119   
ref|XP_011084865.1|  PREDICTED: laccase-12-like                         365   2e-119   
ref|XP_002312186.2|  laccase family protein                             365   2e-119   Populus trichocarpa [western balsam poplar]
ref|XP_004491004.1|  PREDICTED: laccase-5-like                          365   3e-119   
ref|XP_010067566.1|  PREDICTED: laccase-5                               365   3e-119   
ref|XP_010931307.1|  PREDICTED: laccase-3-like                          364   7e-119   
ref|XP_008363776.1|  PREDICTED: laccase-12-like                         364   9e-119   
ref|XP_007008849.1|  Laccase 12                                         363   1e-118   
gb|KDO50911.1|  hypothetical protein CISIN_1g039963mg                   363   1e-118   
ref|XP_008792257.1|  PREDICTED: laccase-3-like                          363   2e-118   
ref|XP_004242503.1|  PREDICTED: laccase-3-like                          363   2e-118   
ref|XP_008441484.1|  PREDICTED: laccase-12                              362   3e-118   
ref|XP_010491317.1|  PREDICTED: laccase-13 isoform X2                   362   3e-118   
ref|XP_010423249.1|  PREDICTED: laccase-13-like isoform X1              362   3e-118   
ref|XP_011076646.1|  PREDICTED: laccase-12                              362   3e-118   
ref|XP_009599788.1|  PREDICTED: laccase-3-like                          362   4e-118   
ref|XP_004138412.1|  PREDICTED: laccase-12-like                         362   4e-118   
ref|XP_008799813.1|  PREDICTED: laccase-3                               361   6e-118   
ref|XP_010922645.1|  PREDICTED: laccase-3-like                          361   9e-118   
ref|XP_004241090.2|  PREDICTED: laccase-12-like isoform X1              361   1e-117   
ref|XP_007163585.1|  hypothetical protein PHAVU_001G246700g             360   1e-117   
ref|XP_006596443.1|  PREDICTED: laccase-3-like                          360   2e-117   
ref|XP_003518325.1|  PREDICTED: laccase-3-like                          360   3e-117   
ref|XP_002520797.1|  laccase, putative                                  360   3e-117   Ricinus communis
ref|XP_008343632.1|  PREDICTED: laccase-12-like                         360   3e-117   
gb|EYU20068.1|  hypothetical protein MIMGU_mgv1a020620mg                358   4e-117   
ref|XP_008374344.1|  PREDICTED: laccase-12-like                         359   4e-117   
ref|XP_008233819.1|  PREDICTED: laccase-12-like                         359   4e-117   
ref|XP_002520796.1|  laccase, putative                                  358   9e-117   Ricinus communis
emb|CDX99004.1|  BnaC09g48310D                                          358   9e-117   
ref|XP_007218932.1|  hypothetical protein PRUPE_ppa003349mg             358   1e-116   
ref|XP_008363777.1|  PREDICTED: laccase-12-like                         357   2e-116   
emb|CDX70010.1|  BnaA10g23590D                                          357   3e-116   
ref|XP_008369303.1|  PREDICTED: laccase-12-like                         357   3e-116   
ref|XP_009122370.1|  PREDICTED: laccase-13 isoform X1                   357   3e-116   
ref|XP_009369225.1|  PREDICTED: laccase-5-like                          356   3e-116   
ref|NP_001236616.1|  diphenol oxidase laccase precursor                 357   5e-116   
gb|KFK43018.1|  hypothetical protein AALP_AA1G068300                    367   5e-116   
gb|EPS73068.1|  hypothetical protein M569_01687                         355   7e-116   
ref|XP_010031156.1|  PREDICTED: laccase-12-like                         355   2e-115   
gb|AFV52382.1|  laccase                                                 355   2e-115   
ref|XP_003615861.1|  Laccase-like multicopper oxidase                   354   2e-115   
emb|CDX93188.1|  BnaC04g47080D                                          355   2e-115   
ref|XP_010534627.1|  PREDICTED: laccase-5                               355   2e-115   
ref|XP_004490661.1|  PREDICTED: laccase-3-like                          354   3e-115   
ref|XP_010921047.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-3-like     354   3e-115   
ref|XP_006411293.1|  hypothetical protein EUTSA_v10016439mg             354   5e-115   
ref|NP_001044679.1|  Os01g0827300                                       353   7e-115   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA57028.1|  TPA: putative laccase family protein                   353   8e-115   
emb|CDX70152.1|  BnaA10g25010D                                          353   9e-115   
gb|KFK24962.1|  hypothetical protein AALP_AA8G048100                    352   9e-115   
ref|XP_003537321.1|  PREDICTED: laccase-3-like                          353   1e-114   
ref|NP_001148479.1|  L-ascorbate oxidase precursor                      352   3e-114   Zea mays [maize]
ref|XP_006828131.1|  hypothetical protein AMTR_s00023p00051360          352   3e-114   
ref|XP_009141888.1|  PREDICTED: laccase-5-like                          352   4e-114   
ref|XP_010543702.1|  PREDICTED: laccase-12                              352   4e-114   
ref|XP_011015306.1|  PREDICTED: laccase-12-like                         352   4e-114   
ref|NP_196158.1|  laccase 12                                            351   6e-114   Arabidopsis thaliana [mouse-ear cress]
gb|KHN02112.1|  Laccase-3                                               351   7e-114   
emb|CDM84828.1|  unnamed protein product                                350   8e-114   
gb|AFV52384.1|  laccase                                                 351   8e-114   
ref|XP_009122149.1|  PREDICTED: laccase-12                              350   9e-114   
ref|XP_009125599.1|  PREDICTED: laccase-12                              350   9e-114   
ref|XP_009391695.1|  PREDICTED: laccase-3-like                          350   1e-113   
gb|AFV52383.1|  laccase                                                 350   1e-113   
ref|XP_003552931.1|  PREDICTED: laccase-3-like                          350   1e-113   
ref|XP_009143220.1|  PREDICTED: laccase-5                               350   1e-113   
emb|CBL95260.1|  laccase                                                350   1e-113   
emb|CDX74795.1|  BnaA05g05410D                                          350   1e-113   
ref|XP_006287390.1|  hypothetical protein CARUB_v10000596mg             350   2e-113   
ref|XP_011004433.1|  PREDICTED: laccase-12-like                         350   2e-113   
emb|CDX98841.1|  BnaC09g49940D                                          349   2e-113   
gb|EMT06365.1|  Laccase-3                                               349   3e-113   
gb|KFK36912.1|  hypothetical protein AALP_AA4G189000                    350   3e-113   
ref|XP_006644937.1|  PREDICTED: laccase-3-like                          349   4e-113   
gb|AFV52378.1|  laccase                                                 348   5e-113   
ref|XP_002871156.1|  hypothetical protein ARALYDRAFT_487334             348   6e-113   
ref|XP_010508873.1|  PREDICTED: laccase-5-like                          348   6e-113   
ref|XP_010517456.1|  PREDICTED: laccase-5-like                          348   6e-113   
emb|CDY14115.1|  BnaC02g02320D                                          348   6e-113   
gb|AAK37824.1|AF132120_1  laccase                                       348   7e-113   Pinus taeda
ref|XP_010452444.1|  PREDICTED: laccase-12-like                         348   8e-113   
emb|CAA74104.1|  laccase                                                348   9e-113   Populus trichocarpa [western balsam poplar]
ref|XP_006399003.1|  hypothetical protein EUTSA_v10015589mg             348   9e-113   
ref|NP_001183899.1|  putative laccase family protein precursor          348   1e-112   
emb|CDP13965.1|  unnamed protein product                                348   1e-112   
emb|CDY04949.1|  BnaAnng01310D                                          347   1e-112   
gb|KFK25107.1|  hypothetical protein AALP_AA8G066900                    361   2e-112   
ref|XP_002315130.1|  hypothetical protein POPTR_0010s19080g             348   2e-112   Populus trichocarpa [western balsam poplar]
emb|CDY52925.1|  BnaA04g29320D                                          347   2e-112   
ref|NP_181568.1|  laccase 5                                             347   2e-112   Arabidopsis thaliana [mouse-ear cress]
gb|ABR17539.1|  unknown                                                 347   2e-112   Picea sitchensis
ref|XP_010505765.1|  PREDICTED: laccase-5                               347   2e-112   
ref|XP_010322117.1|  PREDICTED: laccase-12-like isoform X2              347   3e-112   
ref|XP_010423473.1|  PREDICTED: laccase-12                              347   3e-112   
ref|XP_007146836.1|  hypothetical protein PHAVU_006G074000g             347   3e-112   
gb|EMS66367.1|  Laccase-3                                               345   3e-112   
gb|AAK37826.1|AF132122_1  laccase                                       346   5e-112   Pinus taeda
ref|XP_003564513.1|  PREDICTED: laccase-3                               345   8e-112   
ref|XP_008804167.1|  PREDICTED: laccase-3-like                          345   9e-112   
ref|XP_006293898.1|  hypothetical protein CARUB_v10022891mg             345   2e-111   
ref|XP_009407324.1|  PREDICTED: laccase-3-like                          344   2e-111   
ref|XP_002456566.1|  hypothetical protein SORBIDRAFT_03g038550          344   3e-111   Sorghum bicolor [broomcorn]
ref|XP_004970425.1|  PREDICTED: laccase-3-like                          343   4e-111   
gb|KHN46117.1|  Laccase-3                                               342   4e-111   
ref|XP_002881718.1|  hypothetical protein ARALYDRAFT_903327             344   5e-111   
gb|EEC71732.1|  hypothetical protein OsI_04280                          344   7e-111   Oryza sativa Indica Group [Indian rice]
emb|CDY18869.1|  BnaC04g04810D                                          343   8e-111   
ref|XP_004984887.1|  PREDICTED: laccase-3-like                          343   2e-110   
ref|XP_010491073.1|  PREDICTED: laccase-12-like                         341   3e-110   
ref|NP_001145891.1|  putative laccase family protein precursor          342   7e-110   Zea mays [maize]
gb|AFL65035.1|  laccase 2                                               333   2e-109   
gb|AFV52377.1|  laccase                                                 340   2e-109   
gb|EEC75054.1|  hypothetical protein OsI_11166                          335   2e-109   Oryza sativa Indica Group [Indian rice]
gb|EMS63105.1|  Laccase-3                                               337   9e-109   
gb|EMT30315.1|  Laccase-3                                               335   1e-107   
gb|EMT01053.1|  Laccase-3                                               335   2e-107   
emb|CBW38080.1|  laccase-like multicopper oxidase                       335   3e-107   
gb|EMS46935.1|  Laccase-3                                               335   3e-107   
ref|XP_003558123.1|  PREDICTED: laccase-3                               333   7e-107   
ref|NP_001049841.2|  Os03g0297900                                       333   4e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002468016.1|  hypothetical protein SORBIDRAFT_01g038130          332   4e-106   Sorghum bicolor [broomcorn]
gb|ABR17528.1|  unknown                                                 328   4e-105   Picea sitchensis
ref|XP_004302730.1|  PREDICTED: laccase-17-like                         328   6e-105   
ref|XP_006651285.1|  PREDICTED: laccase-5-like                          329   9e-105   
gb|AFV52381.1|  laccase                                                 325   5e-104   
gb|AFV52379.1|  laccase                                                 325   6e-104   
ref|NP_001044773.1|  Os01g0842500                                       325   7e-104   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71780.1|  hypothetical protein OsI_04394                          325   8e-104   Oryza sativa Indica Group [Indian rice]
gb|AFV52380.1|  laccase                                                 324   1e-103   
ref|XP_003579045.1|  PREDICTED: laccase-23-like                         324   2e-103   
gb|ACN40347.1|  unknown                                                 323   2e-103   Picea sitchensis
ref|XP_004978572.1|  PREDICTED: putative laccase-17-like                324   3e-103   
gb|EEE58886.1|  hypothetical protein OsJ_10502                          324   2e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006856866.1|  hypothetical protein AMTR_s00055p00190270          321   4e-102   
ref|XP_002269038.2|  PREDICTED: laccase-17 isoform X2                   321   4e-102   Vitis vinifera
sp|Q2RBK2.1|LAC17_ORYSJ  RecName: Full=Putative laccase-17; AltNa...    320   5e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010654257.1|  PREDICTED: laccase-17 isoform X1                   320   6e-102   
ref|XP_004970542.1|  PREDICTED: laccase-4-like                          320   6e-102   
ref|XP_003564593.1|  PREDICTED: laccase-12/13-like                      320   8e-102   
gb|EEE52618.1|  hypothetical protein OsJ_34955                          318   1e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010937049.1|  PREDICTED: putative laccase-9                      319   1e-101   
ref|XP_002448873.1|  hypothetical protein SORBIDRAFT_05g000680          319   3e-101   Sorghum bicolor [broomcorn]
ref|XP_007208294.1|  hypothetical protein PRUPE_ppa003308mg             319   3e-101   
ref|XP_008220423.1|  PREDICTED: laccase-4                               318   3e-101   
ref|XP_004294236.1|  PREDICTED: laccase-4-like                          318   3e-101   
ref|XP_006827100.1|  hypothetical protein AMTR_s00010p00242360          318   4e-101   
ref|NP_001065948.1|  Os12g0108000                                       318   4e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009597234.1|  PREDICTED: laccase-4-like                          317   5e-101   
emb|CAN66454.1|  hypothetical protein VITISV_020528                     317   5e-101   Vitis vinifera
ref|XP_008240716.1|  PREDICTED: laccase-17-like                         318   6e-101   
gb|AIS22739.1|  laccase 7                                               317   9e-101   
ref|XP_004961859.1|  PREDICTED: laccase-12/13-like                      317   2e-100   
emb|CDM84967.1|  unnamed protein product                                316   2e-100   
ref|XP_010107320.1|  hypothetical protein L484_009454                   317   2e-100   
ref|XP_010654256.1|  PREDICTED: laccase-17-like isoform X2              316   2e-100   
ref|XP_002268628.2|  PREDICTED: laccase-17-like isoform X1              316   2e-100   Vitis vinifera
gb|EMS48628.1|  Laccase-12/13                                           316   2e-100   
ref|NP_001044772.1|  Os01g0842400                                       316   3e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010922291.1|  PREDICTED: laccase-17-like                         316   3e-100   
gb|EAZ14115.1|  hypothetical protein OsJ_04039                          316   3e-100   
ref|XP_008358974.1|  PREDICTED: laccase-4-like                          315   3e-100   
ref|XP_004977611.1|  PREDICTED: laccase-23-like                         316   3e-100   
ref|NP_001105875.1|  putative laccase precursor                         316   3e-100   
ref|XP_009782930.1|  PREDICTED: laccase-4-like                          316   4e-100   
gb|EEC71777.1|  hypothetical protein OsI_04389                          315   4e-100   
ref|XP_011095211.1|  PREDICTED: laccase-7                               315   5e-100   
ref|XP_006644994.1|  PREDICTED: laccase-12/13-like                      315   5e-100   
emb|CBI30529.3|  unnamed protein product                                315   5e-100   
ref|XP_010683867.1|  PREDICTED: laccase-17-like                         315   6e-100   
ref|XP_009338594.1|  PREDICTED: laccase-17-like                         315   6e-100   
ref|XP_008665185.1|  PREDICTED: laccase-4-like                          315   7e-100   
ref|XP_007207096.1|  hypothetical protein PRUPE_ppa022440mg             314   7e-100   
ref|XP_008784581.1|  PREDICTED: laccase-21-like                         315   8e-100   
ref|XP_006363100.1|  PREDICTED: laccase-4-like                          315   8e-100   
ref|XP_007207312.1|  hypothetical protein PRUPE_ppa003714mg             314   9e-100   
dbj|BAJ84890.1|  predicted protein                                      315   9e-100   
emb|CDY10719.1|  BnaA05g12170D                                          313   9e-100   
ref|XP_004514392.1|  PREDICTED: laccase-17-like                         315   1e-99    
ref|XP_009337309.1|  PREDICTED: laccase-4-like                          314   1e-99    
ref|XP_002309069.1|  hypothetical protein POPTR_0006s08780g             314   1e-99    
ref|XP_007140301.1|  hypothetical protein PHAVU_008G1006000g            305   1e-99    
ref|XP_004246355.1|  PREDICTED: laccase-4-like                          314   2e-99    
emb|CDP06593.1|  unnamed protein product                                313   2e-99    
ref|XP_009374280.1|  PREDICTED: laccase-4-like                          313   2e-99    
ref|XP_006429125.1|  hypothetical protein CICLE_v10011362mg             314   2e-99    
ref|XP_010920540.1|  PREDICTED: laccase-10-like                         313   2e-99    
ref|XP_010683865.1|  PREDICTED: laccase-17-like                         313   3e-99    
ref|XP_002458746.1|  hypothetical protein SORBIDRAFT_03g039520          313   3e-99    
ref|XP_004294638.1|  PREDICTED: laccase-17-like                         313   3e-99    
gb|EMT02387.1|  hypothetical protein F775_52333                         313   3e-99    
gb|KCW85519.1|  hypothetical protein EUGRSUZ_B02316                     312   3e-99    
gb|KDO52343.1|  hypothetical protein CISIN_1g008085mg                   311   5e-99    
ref|XP_009346884.1|  PREDICTED: laccase-4-like                          312   5e-99    
ref|XP_011094885.1|  PREDICTED: laccase-17-like                         312   5e-99    
ref|XP_010937050.1|  PREDICTED: putative laccase-9                      313   5e-99    
ref|XP_011008003.1|  PREDICTED: laccase-7-like                          312   6e-99    
ref|XP_002531824.1|  laccase, putative                                  312   6e-99    
ref|XP_008355354.1|  PREDICTED: laccase-4                               311   7e-99    
gb|EMS57222.1|  Laccase-23                                              312   8e-99    
ref|XP_011004932.1|  PREDICTED: laccase-7-like                          312   8e-99    
ref|XP_007140298.1|  hypothetical protein PHAVU_008G100400g             313   9e-99    
ref|XP_002312187.2|  hypothetical protein POPTR_0008s07380g             310   9e-99    
ref|XP_009602033.1|  PREDICTED: laccase-4-like                          312   1e-98    
ref|XP_008778578.1|  PREDICTED: laccase-10-like                         312   1e-98    
ref|XP_010106521.1|  hypothetical protein L484_025281                   312   1e-98    
ref|XP_006429124.1|  hypothetical protein CICLE_v10011358mg             312   1e-98    
ref|XP_006480874.1|  PREDICTED: laccase-17-like isoform X1              312   1e-98    
ref|XP_011019838.1|  PREDICTED: laccase-17-like                         311   1e-98    
emb|CDP09087.1|  unnamed protein product                                312   1e-98    
ref|XP_010690924.1|  PREDICTED: laccase-17-like                         311   1e-98    
ref|XP_002439916.1|  hypothetical protein SORBIDRAFT_09g022510          311   2e-98    
gb|AFW84624.1|  putative laccase family protein                         311   2e-98    
dbj|BAJ96691.1|  predicted protein                                      311   2e-98    
ref|XP_010256735.1|  PREDICTED: laccase-7-like                          311   2e-98    
ref|XP_008223967.1|  PREDICTED: laccase-17                              311   2e-98    
gb|KCW51338.1|  hypothetical protein EUGRSUZ_J00889                     310   2e-98    
ref|NP_001146658.1|  uncharacterized protein LOC100280258 precursor     311   2e-98    
ref|XP_010262708.1|  PREDICTED: laccase-7-like                          311   2e-98    
emb|CDY67936.1|  BnaCnng57030D                                          307   2e-98    
ref|XP_008785569.1|  PREDICTED: laccase-17-like                         311   2e-98    
ref|XP_011019185.1|  PREDICTED: laccase-7                               311   2e-98    
ref|XP_002308196.1|  laccase family protein                             311   2e-98    
ref|XP_010043504.1|  PREDICTED: laccase-17                              311   2e-98    
emb|CDY09232.1|  BnaA02g06580D                                          311   3e-98    
ref|XP_011013044.1|  PREDICTED: laccase-7-like                          310   3e-98    
ref|XP_004241217.1|  PREDICTED: laccase-2-like                          311   3e-98    
ref|XP_010031937.1|  PREDICTED: laccase-15-like                         310   3e-98    
ref|XP_006373961.1|  hypothetical protein POPTR_0016s11500g             310   3e-98    
gb|AAC04576.1|  putative high-pI laccase                                310   3e-98    
ref|XP_003562893.1|  PREDICTED: laccase-4-like                          311   3e-98    
ref|XP_010690891.1|  PREDICTED: laccase-17-like                         311   3e-98    
ref|XP_002458747.1|  hypothetical protein SORBIDRAFT_03g039530          311   3e-98    
gb|KDP44151.1|  hypothetical protein JCGZ_05618                         310   3e-98    
gb|AAK37830.1|AF132126_1  laccase                                       310   3e-98    
ref|XP_010678347.1|  PREDICTED: laccase-7                               310   3e-98    
ref|XP_011013481.1|  PREDICTED: laccase-7-like                          310   4e-98    
ref|NP_001055746.1|  Os05g0458500                                       310   4e-98    
ref|XP_003564592.1|  PREDICTED: laccase-4-like                          310   5e-98    
ref|XP_009416152.1|  PREDICTED: laccase-4-like                          310   5e-98    
gb|KDO52342.1|  hypothetical protein CISIN_1g008085mg                   310   5e-98    
ref|XP_003532315.1|  PREDICTED: laccase-17-like                         310   5e-98    
ref|XP_008801379.1|  PREDICTED: laccase-7-like isoform X1               310   6e-98    
gb|KEH30177.1|  laccase/diphenol oxidase family protein                 309   6e-98    
gb|KHN24986.1|  Laccase-17                                              310   7e-98    
ref|XP_004148786.1|  PREDICTED: laccase-17-like                         310   7e-98    
ref|XP_006856865.1|  hypothetical protein AMTR_s00055p00189700          310   8e-98    
ref|XP_010040730.1|  PREDICTED: laccase-15-like                         309   9e-98    
ref|XP_007026834.1|  Laccase-7                                          314   9e-98    
ref|XP_007026973.1|  Laccase 17                                         310   9e-98    
ref|XP_002879726.1|  IRX12/LAC4                                         309   1e-97    
ref|XP_008785423.1|  PREDICTED: laccase-22                              309   1e-97    
ref|XP_008679334.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-23-like    311   1e-97    
ref|XP_008463808.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-17-like    309   1e-97    
ref|XP_006411009.1|  hypothetical protein EUTSA_v10016460mg             309   1e-97    
ref|XP_007026974.1|  Laccase 17                                         310   1e-97    
ref|XP_002531562.1|  laccase, putative                                  309   2e-97    
ref|XP_008222577.1|  PREDICTED: laccase-17-like                         309   2e-97    
ref|XP_006373964.1|  hypothetical protein POPTR_0016s11540g             308   2e-97    
ref|XP_008803092.1|  PREDICTED: laccase-17-like                         309   2e-97    
gb|ACN34362.1|  unknown                                                 309   2e-97    
ref|XP_010261111.1|  PREDICTED: laccase-15-like                         308   2e-97    
ref|NP_001055747.1|  Os05g0458600                                       309   2e-97    
ref|NP_001147942.1|  L-ascorbate oxidase precursor                      309   2e-97    
emb|CDY31581.1|  BnaA10g12900D                                          308   2e-97    
ref|XP_007207546.1|  hypothetical protein PRUPE_ppa017421mg             309   2e-97    
gb|KHN24984.1|  Laccase-17                                              308   2e-97    
ref|XP_008387787.1|  PREDICTED: laccase-17-like                         308   2e-97    
ref|XP_009126628.1|  PREDICTED: laccase-17-like                         308   2e-97    
gb|KDP35658.1|  hypothetical protein JCGZ_09096                         308   2e-97    
gb|KDO58020.1|  hypothetical protein CISIN_1g008422mg                   308   2e-97    
gb|KHF97742.1|  Laccase-17 -like protein                                308   3e-97    
gb|KHN14004.1|  Laccase-17                                              308   3e-97    
ref|XP_010920538.1|  PREDICTED: laccase-4-like                          308   3e-97    
ref|XP_009788568.1|  PREDICTED: laccase-4-like                          308   3e-97    
ref|XP_003606701.1|  Laccase                                            308   3e-97    
ref|XP_003552179.1|  PREDICTED: laccase-17-like                         308   3e-97    
ref|XP_010923124.1|  PREDICTED: laccase-22                              307   4e-97    
ref|XP_007026975.1|  Laccase 17                                         308   4e-97    
ref|XP_006429258.1|  hypothetical protein CICLE_v10011375mg             308   4e-97    
ref|XP_003530894.1|  PREDICTED: laccase-17-like                         308   4e-97    
ref|XP_009796024.1|  PREDICTED: laccase-2-like                          308   4e-97    
ref|XP_003604619.1|  Laccase 1a                                         307   5e-97    
dbj|BAJ99773.1|  predicted protein                                      308   5e-97    
ref|XP_006293932.1|  hypothetical protein CARUB_v10022927mg             307   5e-97    
ref|XP_008787257.1|  PREDICTED: laccase-21-like                         307   5e-97    
ref|XP_004246339.1|  PREDICTED: laccase-4                               307   5e-97    
ref|XP_009403441.1|  PREDICTED: laccase-4-like                          307   6e-97    
gb|EMT21652.1|  Laccase-4                                               308   6e-97    
ref|XP_006429254.1|  hypothetical protein CICLE_v10011384mg             307   6e-97    
ref|XP_008385213.1|  PREDICTED: laccase-17-like                         307   7e-97    
ref|XP_007208016.1|  hypothetical protein PRUPE_ppa003296mg             307   7e-97    
ref|XP_009358279.1|  PREDICTED: laccase-17-like                         307   7e-97    
ref|XP_006480933.1|  PREDICTED: laccase-7-like                          307   8e-97    
ref|XP_006424671.1|  hypothetical protein CICLE_v10030166mg             307   8e-97    
gb|KDO73109.1|  hypothetical protein CISIN_1g047497mg                   307   8e-97    
ref|NP_180477.1|  laccase 2                                             307   8e-97    
ref|XP_010037821.1|  PREDICTED: laccase-17-like                         307   8e-97    
gb|KDO58025.1|  hypothetical protein CISIN_1g008351mg                   306   8e-97    
gb|ABW81073.1|  unknown                                                 306   9e-97    
ref|NP_565881.1|  laccase-4                                             306   9e-97    
ref|XP_010098906.1|  hypothetical protein L484_006544                   306   1e-96    
ref|XP_006388846.1|  hypothetical protein POPTR_0091s002702g            306   1e-96    
ref|XP_007140513.1|  hypothetical protein PHAVU_008G119000g             307   1e-96    
ref|XP_008358049.1|  PREDICTED: laccase-17-like                         307   1e-96    
ref|XP_010104683.1|  hypothetical protein L484_022066                   306   1e-96    
ref|XP_004246867.2|  PREDICTED: laccase-17-like                         298   1e-96    
ref|XP_006840270.1|  hypothetical protein AMTR_s00045p00045490          306   1e-96    
ref|XP_009354528.1|  PREDICTED: laccase-17-like                         306   1e-96    
ref|XP_010505418.1|  PREDICTED: laccase-4                               306   1e-96    
gb|AGJ83750.1|  Laccase 1a                                              297   1e-96    
ref|XP_004492318.1|  PREDICTED: laccase-17-like                         306   1e-96    
gb|AAL73968.1|AF465468_1  laccase LAC5-6                                306   1e-96    
emb|CDP06537.1|  unnamed protein product                                306   1e-96    
ref|XP_002881031.1|  hypothetical protein ARALYDRAFT_901874             306   2e-96    
ref|XP_009407561.1|  PREDICTED: laccase-22-like                         306   2e-96    
gb|AAK37827.1|AF132123_1  laccase                                       306   2e-96    
gb|ABW74558.1|  putative laccase                                        306   2e-96    
ref|XP_008222248.1|  PREDICTED: laccase-2                               306   2e-96    
ref|XP_009358814.1|  PREDICTED: laccase-7-like                          306   2e-96    
ref|XP_009593041.1|  PREDICTED: laccase-4-like                          305   2e-96    
ref|XP_008358843.1|  PREDICTED: laccase-17-like                         306   2e-96    
ref|XP_003544873.2|  PREDICTED: laccase-4-like                          305   2e-96    
ref|XP_007016183.1|  Laccase/Diphenol oxidase family protein            305   2e-96    
ref|XP_009120521.1|  PREDICTED: laccase-17-like                         306   2e-96    
ref|XP_006602563.1|  PREDICTED: laccase-17-like                         306   2e-96    
ref|XP_010517091.1|  PREDICTED: laccase-4-like                          305   2e-96    
ref|XP_008359730.1|  PREDICTED: laccase-17-like                         306   2e-96    
ref|XP_006583598.1|  PREDICTED: laccase-17-like                         306   2e-96    
gb|KFK27539.1|  hypothetical protein AALP_AA8G396300                    306   2e-96    
ref|XP_010907627.1|  PREDICTED: laccase-22-like                         305   2e-96    
ref|XP_004137913.1|  PREDICTED: laccase-4-like                          305   2e-96    
gb|KHN16226.1|  Laccase-17                                              306   2e-96    
ref|XP_004163861.1|  PREDICTED: laccase-4-like                          305   3e-96    
ref|XP_006654510.1|  PREDICTED: laccase-12/13-like                      306   3e-96    
emb|CBI16199.3|  unnamed protein product                                305   3e-96    
gb|EYU26602.1|  hypothetical protein MIMGU_mgv1a003840mg                305   3e-96    
ref|XP_008239920.1|  PREDICTED: laccase-7                               305   3e-96    
ref|XP_010262771.1|  PREDICTED: laccase-4-like                          305   3e-96    
ref|XP_006846275.1|  hypothetical protein AMTR_s00012p00248430          305   3e-96    
ref|XP_008442464.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like     305   3e-96    
ref|XP_006425016.1|  hypothetical protein CICLE_v10028117mg             305   3e-96    
ref|XP_008441433.1|  PREDICTED: laccase-4-like                          305   3e-96    
ref|XP_003552160.2|  PREDICTED: laccase-17-like isoform X1              305   3e-96    
ref|XP_008359106.1|  PREDICTED: laccase-17-like                         305   4e-96    
ref|XP_009624727.1|  PREDICTED: laccase-4-like                          305   4e-96    
ref|XP_010553062.1|  PREDICTED: laccase-7 isoform X2                    305   4e-96    
ref|XP_002531561.1|  laccase, putative                                  304   4e-96    
gb|EMT04658.1|  Laccase-12/13                                           306   4e-96    
ref|XP_006409960.1|  hypothetical protein EUTSA_v10016434mg             305   4e-96    
ref|XP_006846062.1|  hypothetical protein AMTR_s00012p00061910          305   4e-96    
gb|KEH22816.1|  laccase/diphenol oxidase family protein                 305   4e-96    
ref|XP_004294637.1|  PREDICTED: laccase-17-like                         305   4e-96    
ref|XP_010557244.1|  PREDICTED: laccase-2-like                          305   4e-96    
gb|KDO58019.1|  hypothetical protein CISIN_1g008366mg                   305   4e-96    
emb|CDX71061.1|  BnaC03g11450D                                          305   4e-96    
emb|CAN80346.1|  hypothetical protein VITISV_003134                     306   4e-96    
dbj|BAJ91763.1|  predicted protein                                      305   4e-96    
gb|EYU26609.1|  hypothetical protein MIMGU_mgv1a003496mg                305   5e-96    
ref|XP_006350913.1|  PREDICTED: laccase-2-like                          305   5e-96    
ref|XP_010062036.1|  PREDICTED: laccase-15-like                         305   5e-96    
ref|XP_008385215.1|  PREDICTED: laccase-17-like                         305   5e-96    
ref|XP_002322939.2|  hypothetical protein POPTR_0016s11520g             305   5e-96    
gb|KDO37344.1|  hypothetical protein CISIN_1g009854mg                   303   5e-96    
emb|CDX88735.1|  BnaA03g09140D                                          305   5e-96    
ref|XP_010553061.1|  PREDICTED: laccase-7 isoform X1                    305   5e-96    
ref|XP_010676357.1|  PREDICTED: laccase-4-like                          304   6e-96    
ref|XP_002284473.1|  PREDICTED: laccase-17                              305   6e-96    
ref|XP_009131958.1|  PREDICTED: laccase-17                              305   6e-96    
gb|EMT20803.1|  Laccase-4                                               305   6e-96    
ref|XP_002280416.1|  PREDICTED: laccase-4                               304   7e-96    
gb|AAC49536.1|  diphenol oxidase                                        304   7e-96    
ref|XP_002278215.1|  PREDICTED: laccase-17                              305   7e-96    
ref|XP_010414434.1|  PREDICTED: laccase-2 isoform X1                    305   7e-96    
gb|EYU41858.1|  hypothetical protein MIMGU_mgv1a003895mg                304   7e-96    
ref|XP_010931158.1|  PREDICTED: laccase-7-like                          304   7e-96    
ref|XP_002864664.1|  hypothetical protein ARALYDRAFT_496140             305   8e-96    
ref|XP_011032272.1|  PREDICTED: laccase-2-like                          304   8e-96    
ref|NP_200810.1|  laccase 17                                            304   8e-96    
ref|XP_009338597.1|  PREDICTED: laccase-17-like                         305   9e-96    



>ref|XP_011080832.1| PREDICTED: laccase-3-like, partial [Sesamum indicum]
Length=554

 Score =   416 bits (1068),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 217/244 (89%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + ETHYH+F +  TP KRLCKTH+IITVNGQFPGPTLEVR+GDTLVIKV+N+ARYN TLH
Sbjct  8    TAETHYHQFFVQQTPVKRLCKTHNIITVNGQFPGPTLEVRDGDTLVIKVVNSARYNVTLH  67

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHGIRQ+ + WADGP Y+TQCPIQPGA YTYRFTI+ Q+GTLWWHAH+RWLRATVYGA++
Sbjct  68   WHGIRQMRTPWADGPEYVTQCPIQPGASYTYRFTIENQDGTLWWHAHSRWLRATVYGALI  127

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            IYP+LGVPYPFPKP KEIP+LLGEWW+RDI SV+RQATFTGAAPN SDAYTING PGDLY
Sbjct  128  IYPKLGVPYPFPKPTKEIPVLLGEWWDRDIISVLRQATFTGAAPNASDAYTINGQPGDLY  187

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +  TK  VK+GETVLLR+INAALNQ+LFF+VANH+ TVV  DATY KPF++ V+ML
Sbjct  188  RCSSKETTKFYVKSGETVLLRIINAALNQELFFTVANHMLTVVGNDATYNKPFATRVVML  247

Query  793  GPGQ  804
            GPGQ
Sbjct  248  GPGQ  251



>ref|XP_002277722.1| PREDICTED: laccase-12 [Vitis vinifera]
Length=574

 Score =   398 bits (1023),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 179/249 (72%), Positives = 214/249 (86%), Gaps = 1/249 (0%)
 Frame = +1

Query  61   TATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARY  240
            +A+    ETHYH+FV+  TP KRLC+TH+IITVNGQFPGPTLEVR+GDTLVIKV+N+ARY
Sbjct  26   SASLADAETHYHDFVVQQTPVKRLCRTHNIITVNGQFPGPTLEVRDGDTLVIKVVNSARY  85

Query  241  NATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATV  420
            N TLHWHGIRQ+ + WADGP Y+TQCPI+PGA YTYRFTI+ QEGTLWWHAH++WLRATV
Sbjct  86   NVTLHWHGIRQMRTPWADGPEYVTQCPIRPGATYTYRFTIENQEGTLWWHAHSKWLRATV  145

Query  421  YGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGW  600
            YGA+VIYP+LG  YPFP+P+ E PILLGEWW+RD  +V+RQATFTGAAPN+SDAYTING 
Sbjct  146  YGALVIYPKLGSSYPFPQPNHEAPILLGEWWDRDPIAVLRQATFTGAAPNISDAYTINGQ  205

Query  601  PGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSS  777
            PGDLY C  +   ++ + +GE +LLR+IN+ALNQQLFFSVANH  TVV  DA YTKPF++
Sbjct  206  PGDLYRCSSKETARLPLDSGERILLRIINSALNQQLFFSVANHKLTVVGADAAYTKPFTT  265

Query  778  NVIMLGPGQ  804
             V+MLGPGQ
Sbjct  266  TVMMLGPGQ  274



>emb|CDP09079.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   398 bits (1022),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 183/247 (74%), Positives = 210/247 (85%), Gaps = 1/247 (0%)
 Frame = +1

Query  67   TFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNA  246
            +F + ETHYH+FV+ A P KRLC+TH+IITVN +FPGPTL VRNGDTLVIK +N ARYN 
Sbjct  21   SFANAETHYHDFVVEAKPVKRLCRTHNIITVNKKFPGPTLTVRNGDTLVIKALNKARYNV  80

Query  247  TLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYG  426
            TLHWHGIRQ+ + WADGP Y+TQCPIQPGA YTYRFTI+ QEGTLWWHAH++WLRATVYG
Sbjct  81   TLHWHGIRQMRTPWADGPEYVTQCPIQPGATYTYRFTIEDQEGTLWWHAHSKWLRATVYG  140

Query  427  AIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPG  606
            A+VI P+LG PYPFPKP  E+PI+LGEWW+RDI SV+RQA FTGAAPNVSDAYTING PG
Sbjct  141  ALVILPKLGSPYPFPKPRHEVPIILGEWWDRDIISVLRQALFTGAAPNVSDAYTINGQPG  200

Query  607  DLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNV  783
            DLY C  +G  KV V +G+ VLLRVINAALNQQLFF++ANH  TVV  DA Y KPF++ V
Sbjct  201  DLYRCSSKGTFKVSVNSGDRVLLRVINAALNQQLFFTIANHQLTVVGADAIYHKPFATRV  260

Query  784  IMLGPGQ  804
            IMLGPGQ
Sbjct  261  IMLGPGQ  267



>ref|XP_007016999.1| Laccase 3 [Theobroma cacao]
 gb|EOY34618.1| Laccase 3 [Theobroma cacao]
Length=576

 Score =   394 bits (1012),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 181/248 (73%), Positives = 206/248 (83%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+F     HYH+FVI A P KRLC+THS ITVNGQFPGPTLEVR+GDTLVIK IN ARYN
Sbjct  27   ASFADAAVHYHDFVIEAKPVKRLCRTHSTITVNGQFPGPTLEVRDGDTLVIKAINRARYN  86

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             TLHWHGIRQ+ + WADGP Y+TQCPIQPG  YTY+FTIQ QEGTLWWHAH+RWLRATVY
Sbjct  87   ITLHWHGIRQLRNPWADGPEYVTQCPIQPGRSYTYQFTIQNQEGTLWWHAHSRWLRATVY  146

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYP+LG PYPFP P KEIPILLGEWW+RD   V+R A FTGAAPNVSDA+TING P
Sbjct  147  GALIIYPKLGSPYPFPMPKKEIPILLGEWWDRDPMDVLRLALFTGAAPNVSDAFTINGQP  206

Query  604  GDLYTCHRGITKV-QVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C    T +  V+ GET+LLR+IN+A+NQ+LFF VANH  TVV VDA YTKPF++N
Sbjct  207  GDLYRCSSKETAIFPVEAGETILLRIINSAMNQELFFGVANHKLTVVAVDAAYTKPFTTN  266

Query  781  VIMLGPGQ  804
            VIM+ PGQ
Sbjct  267  VIMIAPGQ  274



>ref|XP_004294763.1| PREDICTED: laccase-3-like [Fragaria vesca subsp. vesca]
Length=578

 Score =   392 bits (1007),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 173/248 (70%), Positives = 208/248 (84%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+F + ETHYHEFV+ A P KRLC+TH+ ITVNGQFPGPTLEVRNGD+L +KV N A+YN
Sbjct  27   ASFAAAETHYHEFVVEAKPVKRLCRTHNTITVNGQFPGPTLEVRNGDSLAVKVTNRAKYN  86

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG++Q+ + WADGP Y+TQCPIQPGA YTYRFTIQ QEGTLWWHAH++WLRATVY
Sbjct  87   VTIHWHGLKQLRNPWADGPEYVTQCPIQPGATYTYRFTIQNQEGTLWWHAHSKWLRATVY  146

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYPRLG PYPF  P KE P+LLGEWW+R+   V R A FTG APNVSDAYTING P
Sbjct  147  GALIIYPRLGTPYPFSMPKKEFPLLLGEWWDRNPLDVQRLAQFTGGAPNVSDAYTINGQP  206

Query  604  GDLYTCHR-GITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C + G  ++ V++ ET+LLR+IN+ALNQ+LFF++ANH  TVV  DA+YTKPF++ 
Sbjct  207  GDLYRCSKQGTVRIPVESSETILLRIINSALNQELFFTIANHRLTVVSADASYTKPFTTR  266

Query  781  VIMLGPGQ  804
            VIMLGPGQ
Sbjct  267  VIMLGPGQ  274



>ref|XP_009343306.1| PREDICTED: laccase-3-like [Pyrus x bretschneideri]
Length=567

 Score =   389 bits (998),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 175/248 (71%), Positives = 209/248 (84%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+F + E H+HEF++ A P +RLC+THS ITVNGQFPGPTLEVRNGD++ + V N ARYN
Sbjct  20   ASFSAAEFHFHEFIVEARPVRRLCRTHSTITVNGQFPGPTLEVRNGDSVAVTVTNRARYN  79

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG+RQ+ + WADGP Y+TQCPIQPGA YTYRFTI  QEGTLWWHAH+RWLRATVY
Sbjct  80   VTIHWHGLRQLNNPWADGPEYVTQCPIQPGATYTYRFTIIDQEGTLWWHAHSRWLRATVY  139

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYPRLGVPYPFP P +E+PILLGEW++RD   VMR A FTG APNVSDAYTING P
Sbjct  140  GALIIYPRLGVPYPFPMPKREVPILLGEWFDRDPQDVMRLAAFTGGAPNVSDAYTINGQP  199

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C R  T ++ V +GE++LLR+IN+ALNQ+LFF+VANH  TVV  DA+YTKPF++ 
Sbjct  200  GDLYRCSRKETIRIPVVSGESLLLRIINSALNQELFFTVANHQLTVVGADASYTKPFATR  259

Query  781  VIMLGPGQ  804
            VIMLGPGQ
Sbjct  260  VIMLGPGQ  267



>ref|XP_010032957.1| PREDICTED: laccase-13 [Eucalyptus grandis]
 gb|KCW52465.1| hypothetical protein EUGRSUZ_J01857 [Eucalyptus grandis]
Length=575

 Score =   389 bits (998),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 177/247 (72%), Positives = 206/247 (83%), Gaps = 1/247 (0%)
 Frame = +1

Query  67   TFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNA  246
            +F   ETHYHEFVI   P KRLC+TH IITVNGQFPGP LEVR+GD+L+IK  N A+YN 
Sbjct  28   SFSDAETHYHEFVIQEQPVKRLCRTHKIITVNGQFPGPILEVRDGDSLIIKTTNIAQYNV  87

Query  247  TLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYG  426
            TLHWHG+RQI + WADGP YITQCPIQPG  YTYRFTIQ Q GTLWWHAH++WLRATVYG
Sbjct  88   TLHWHGVRQIANPWADGPEYITQCPIQPGGTYTYRFTIQNQVGTLWWHAHSQWLRATVYG  147

Query  427  AIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPG  606
            A++IYP+ G+PYPF  P++EIP++LGEWW+RD  +V+RQA FTGAAPNVSDAYTING PG
Sbjct  148  ALIIYPKFGLPYPFATPNQEIPVILGEWWDRDPMAVLRQAQFTGAAPNVSDAYTINGQPG  207

Query  607  DLYTCHRGITKV-QVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNV  783
            D Y C    T V  V++GETVLLR+INAALNQ+LFF+VANH  TVV VDA YTKPF ++V
Sbjct  208  DFYRCSSQETTVFSVESGETVLLRIINAALNQELFFAVANHKLTVVGVDAAYTKPFPTSV  267

Query  784  IMLGPGQ  804
            IM+GPGQ
Sbjct  268  IMIGPGQ  274



>ref|XP_010542673.1| PREDICTED: laccase-3-like [Tarenaya hassleriana]
Length=564

 Score =   387 bits (995),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 177/251 (71%), Positives = 207/251 (82%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            S  ++F S E H  EFVI A P KRLC+TH  ITVNGQFPGPTLEVRNGD+L I V+N A
Sbjct  18   SFLSSFASAELHVREFVIEARPVKRLCRTHQTITVNGQFPGPTLEVRNGDSLAITVVNKA  77

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            RYN ++HWHGIRQ+ + WADGP +ITQCPI+PG  YTYRFTI+ QEGTLWWHAH+RWLRA
Sbjct  78   RYNISIHWHGIRQLRNPWADGPEFITQCPIRPGQSYTYRFTIEGQEGTLWWHAHSRWLRA  137

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGA++IYPRLG PYPFP P ++IPILLGEWW+R+   V+RQA FTGAAPNVSDAYTIN
Sbjct  138  TVYGALIIYPRLGSPYPFPMPKRDIPILLGEWWDRNPMDVLRQAQFTGAAPNVSDAYTIN  197

Query  595  GWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C  RG  +  V  GETV LR+INAA+NQ+LFF+VANH  TVVEVD+ YTKPF
Sbjct  198  GQPGDLYRCSRRGTLRFPVFPGETVQLRLINAAMNQELFFAVANHRLTVVEVDSAYTKPF  257

Query  772  SSNVIMLGPGQ  804
            ++NV+M+ PGQ
Sbjct  258  TTNVVMIAPGQ  268



>ref|XP_011080750.1| PREDICTED: laccase-3-like [Sesamum indicum]
Length=568

 Score =   387 bits (994),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 176/251 (70%), Positives = 206/251 (82%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            S  A+    ETHYH+FV+  TP  RLC+TH+IITVNGQFPGPT+  RNGDTLVIKV N A
Sbjct  21   SFMASLADAETHYHDFVVQQTPVTRLCRTHNIITVNGQFPGPTIAARNGDTLVIKVTNRA  80

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            RYN TLHWHGIRQ+ + WADGP Y+TQCPI+PG  YTYRFTI+ QEGTLWWHAH++WLRA
Sbjct  81   RYNVTLHWHGIRQMRTPWADGPEYVTQCPIKPGGTYTYRFTIENQEGTLWWHAHSKWLRA  140

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGA+VI+P+ G  YPFP P  ++PI+LGEWW+R+I  V+RQA FTGAAPNVSDAYTIN
Sbjct  141  TVYGALVIFPKSGSSYPFPAPKIDVPIILGEWWDRNIVDVLRQALFTGAAPNVSDAYTIN  200

Query  595  GWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C  +G  ++ V +G+TVLLRVINAALNQQLFFSVANH  TVV  DA Y KPF
Sbjct  201  GQPGDLYRCSSQGTVRISVNSGDTVLLRVINAALNQQLFFSVANHKLTVVGADAAYNKPF  260

Query  772  SSNVIMLGPGQ  804
            ++ VIM+GPGQ
Sbjct  261  TTRVIMVGPGQ  271



>ref|XP_002516345.1| laccase, putative [Ricinus communis]
 gb|EEF46029.1| laccase, putative [Ricinus communis]
Length=577

 Score =   386 bits (991),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 176/248 (71%), Positives = 207/248 (83%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+    +THYHEFVI A P KRLC+THSIITVNGQFPGPTLEVR+GD+LVIK +N A+YN
Sbjct  27   ASSSQAKTHYHEFVIQAKPVKRLCRTHSIITVNGQFPGPTLEVRDGDSLVIKAVNNAKYN  86

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             TLHWHGIRQ+ + WADGP ++TQCPI PG  YTYRFTIQ QEGTLWWHAH+RWLRATVY
Sbjct  87   VTLHWHGIRQLRNPWADGPDHVTQCPILPGGSYTYRFTIQNQEGTLWWHAHSRWLRATVY  146

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYP+LG  YPFP P +EIPILLGEWW+R+   V+RQA FTGAAPNVSDAY ING P
Sbjct  147  GALIIYPKLGSSYPFPMPKREIPILLGEWWDRNPMDVLRQAIFTGAAPNVSDAYNINGQP  206

Query  604  GDLYTCHRGITKV-QVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C    T +  V +GET+LLR+IN+A+NQ+LFF+VANH  TVV VDA YTKPF+++
Sbjct  207  GDLYRCSSKETVIFPVDSGETILLRIINSAMNQELFFAVANHRLTVVAVDAAYTKPFTTS  266

Query  781  VIMLGPGQ  804
            VIM+ PGQ
Sbjct  267  VIMIAPGQ  274



>ref|XP_006425169.1| hypothetical protein CICLE_v10030322mg [Citrus clementina]
 gb|ESR38409.1| hypothetical protein CICLE_v10030322mg [Citrus clementina]
Length=578

 Score =   384 bits (987),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 173/248 (70%), Positives = 203/248 (82%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+    E HYHEFVI A P KRLC+THS +TVNGQFPGPTL+VRNGDTLVI+ IN ARYN
Sbjct  27   ASLSHAEIHYHEFVIEARPVKRLCRTHSTVTVNGQFPGPTLQVRNGDTLVIRAINRARYN  86

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             TLHWHG+RQ  + WADGP Y+TQCPIQPG  YTYRFTI+ QEGTLWWHAH+RWLRATVY
Sbjct  87   VTLHWHGVRQTRNPWADGPEYVTQCPIQPGRSYTYRFTIEDQEGTLWWHAHSRWLRATVY  146

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA+++YPR+G PYPFP P KEIPIL+GEWW+RD   V+RQA FTG APN+SDA TING P
Sbjct  147  GALIVYPRMGSPYPFPMPKKEIPILIGEWWDRDPMDVLRQALFTGGAPNISDALTINGQP  206

Query  604  GDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C  +   +  V+ GET+LLR+IN+A+NQ+ FF VANH  TVV VD +YTKPFS++
Sbjct  207  GDLYRCSSKETVRFPVEAGETILLRIINSAMNQEHFFGVANHKLTVVGVDTSYTKPFSTS  266

Query  781  VIMLGPGQ  804
            VIM+ PGQ
Sbjct  267  VIMIAPGQ  274



>ref|XP_010257021.1| PREDICTED: laccase-12-like [Nelumbo nucifera]
Length=575

 Score =   384 bits (986),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/252 (71%), Positives = 210/252 (83%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            +S   +  + ETHYH+FV+ ATP KRLCKTH+IITVNGQ+PGPTLEVRNGDTLVI V+N 
Sbjct  21   ASEPVSLANPETHYHDFVVQATPVKRLCKTHNIITVNGQYPGPTLEVRNGDTLVINVVNR  80

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN TLHWHGIRQ+ + WADGP ++TQCPIQPG +YTYRFTI+ QEGTLWWHAH+ WLR
Sbjct  81   ARYNVTLHWHGIRQMRTGWADGPEFVTQCPIQPGGRYTYRFTIEGQEGTLWWHAHSSWLR  140

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++IYPRLG  YPF KP +E PILLGEWW+ +   V+RQAT TGAAPNVSDAYTI
Sbjct  141  ATVYGALIIYPRLGSSYPFTKPRREAPILLGEWWDANPIDVVRQATRTGAAPNVSDAYTI  200

Query  592  NGWPGDLYTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C  +    + V +GET LLRVINAALNQ+LFF+VANH  TVV  DA+YTKP
Sbjct  201  NGQPGDLYNCSAQDTVIIPVDSGETNLLRVINAALNQELFFTVANHQMTVVAADASYTKP  260

Query  769  FSSNVIMLGPGQ  804
            F+++V+MLGPGQ
Sbjct  261  FTTSVLMLGPGQ  272



>ref|XP_008232145.1| PREDICTED: laccase-13 [Prunus mume]
Length=577

 Score =   384 bits (986),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 170/242 (70%), Positives = 205/242 (85%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            ETHYHEFV+ A P +RLC+TH+ ITVNGQFPGP LEVRNGD+LVIKV NAARYN T+HWH
Sbjct  33   ETHYHEFVVQAKPVRRLCRTHNTITVNGQFPGPNLEVRNGDSLVIKVTNAARYNVTIHWH  92

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP YITQCPIQPGA YTYRFTIQ QEGTLWWHAH+RWLRATVYGA++IY
Sbjct  93   GLRQLRNPWADGPEYITQCPIQPGATYTYRFTIQDQEGTLWWHAHSRWLRATVYGALIIY  152

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P+LG PYPF  P +E+P+LLGEW++R+   V + A FTG APN SDAYTING PGDLY C
Sbjct  153  PKLGSPYPFSMPKREVPLLLGEWFDRNPLDVQKLAAFTGGAPNASDAYTINGQPGDLYRC  212

Query  622  HRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
             +  T ++ V +GE++LLR+IN+ALNQ+LFFS+ANH  TVV  DA+YTKPF++ V+M+GP
Sbjct  213  SKQETVRIPVDSGESILLRIINSALNQELFFSIANHRLTVVSADASYTKPFTTRVLMMGP  272

Query  799  GQ  804
            GQ
Sbjct  273  GQ  274



>ref|XP_007206448.1| hypothetical protein PRUPE_ppa003408mg [Prunus persica]
 gb|EMJ07647.1| hypothetical protein PRUPE_ppa003408mg [Prunus persica]
Length=577

 Score =   384 bits (986),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 204/242 (84%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            ETHYHEFV+ A P KRLC+TH+ ITVNGQFPGP LEVRNGD+L IKV NAARYN T+HWH
Sbjct  33   ETHYHEFVVQAKPVKRLCRTHNTITVNGQFPGPNLEVRNGDSLAIKVTNAARYNVTIHWH  92

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP YITQCPIQPGA YTYRFTIQ QEGTLWWHAH+RWLRATVYGA++IY
Sbjct  93   GVRQLRNPWADGPEYITQCPIQPGATYTYRFTIQDQEGTLWWHAHSRWLRATVYGALIIY  152

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P+LG PYPF  P +E+P+LLGEW++R+   V R A FTG APN SDAYTING PGDLY C
Sbjct  153  PKLGSPYPFLMPKREVPLLLGEWFDRNPLDVQRLAAFTGGAPNASDAYTINGQPGDLYRC  212

Query  622  HRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
             +  T ++ V +GE++LLR+IN+ALNQ+LFFS+ANH  TVV  DA+YTKPF++ V+M+GP
Sbjct  213  SKQETVRIPVDSGESILLRIINSALNQELFFSIANHRLTVVSADASYTKPFTTRVLMMGP  272

Query  799  GQ  804
            GQ
Sbjct  273  GQ  274



>ref|XP_002319955.1| laccase family protein [Populus trichocarpa]
 gb|EEE95878.1| laccase family protein [Populus trichocarpa]
Length=576

 Score =   383 bits (984),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 178/251 (71%), Positives = 206/251 (82%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            S  A F   ETHY EFVI A P KRLC+TH+ ITVNG FPGPTLEVR+GDTLVIK +N A
Sbjct  24   SFQAHFSEAETHYREFVIQAKPVKRLCRTHNTITVNGLFPGPTLEVRDGDTLVIKAVNNA  83

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            RYN TLHWHGIRQ+ + WADGP  +TQCPI+PG  YTYRFTI+ QEGTLWWHAH+RWLRA
Sbjct  84   RYNVTLHWHGIRQLRNPWADGPDRVTQCPIRPGRSYTYRFTIENQEGTLWWHAHSRWLRA  143

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGA++I+P+LG PYPFP P  EIPILLGEWW+R+   V+R A FTGAAPN+SDAYTIN
Sbjct  144  TVYGALIIHPKLGSPYPFPMPRTEIPILLGEWWDRNPMDVLRIADFTGAAPNISDAYTIN  203

Query  595  GWPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C +  T +  V +GET+LLRVIN+ALNQ+LFF VANHI TVV VDA YTKPF
Sbjct  204  GQPGDLYRCSKQETVRFPVGSGETILLRVINSALNQELFFGVANHILTVVAVDAAYTKPF  263

Query  772  SSNVIMLGPGQ  804
            +++VIM+ PGQ
Sbjct  264  TTSVIMIAPGQ  274



>ref|XP_010685887.1| PREDICTED: laccase-3-like [Beta vulgaris subsp. vulgaris]
Length=563

 Score =   382 bits (982),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 171/248 (69%), Positives = 204/248 (82%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A     ETHYH FVI  TP KRLC  H I+TVNGQFPGPTL+VRNGDT+VIK  NA +YN
Sbjct  21   ACLARAETHYHNFVIQPTPVKRLCNNHVIMTVNGQFPGPTLQVRNGDTVVIKATNAGKYN  80

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             TLHWHG+RQ+ + WADGP Y+TQCPI+PG  YTYR+TI++QEGTLWWHAH++WLRATVY
Sbjct  81   ITLHWHGVRQMRTPWADGPEYVTQCPIRPGGTYTYRYTIEEQEGTLWWHAHSQWLRATVY  140

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA+VIYP+LG  YPFPKP +E P++LGEWW RD   V++Q+  TGAAPNVSDAYTING P
Sbjct  141  GALVIYPKLGSSYPFPKPAREFPLILGEWWNRDPMQVLQQSMITGAAPNVSDAYTINGQP  200

Query  604  GDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY+C  R  T   VK GET+LLR+INAALNQQLFF++ANH  T+VE DA YTKPF++N
Sbjct  201  GDLYSCSSRDTTTFPVKAGETILLRIINAALNQQLFFAIANHQMTIVEADAAYTKPFTTN  260

Query  781  VIMLGPGQ  804
            ++M+GPGQ
Sbjct  261  IVMIGPGQ  268



>emb|CBI15873.3| unnamed protein product [Vitis vinifera]
Length=1561

 Score =   404 bits (1037),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/249 (72%), Positives = 214/249 (86%), Gaps = 1/249 (0%)
 Frame = +1

Query  61    TATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARY  240
             +A+    ETHYH+FV+  TP KRLC+TH+IITVNGQFPGPTLEVR+GDTLVIKV+N+ARY
Sbjct  1013  SASLADAETHYHDFVVQQTPVKRLCRTHNIITVNGQFPGPTLEVRDGDTLVIKVVNSARY  1072

Query  241   NATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATV  420
             N TLHWHGIRQ+ + WADGP Y+TQCPI+PGA YTYRFTI+ QEGTLWWHAH++WLRATV
Sbjct  1073  NVTLHWHGIRQMRTPWADGPEYVTQCPIRPGATYTYRFTIENQEGTLWWHAHSKWLRATV  1132

Query  421   YGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGW  600
             YGA+VIYP+LG  YPFP+P+ E PILLGEWW+RD  +V+RQATFTGAAPN+SDAYTING 
Sbjct  1133  YGALVIYPKLGSSYPFPQPNHEAPILLGEWWDRDPIAVLRQATFTGAAPNISDAYTINGQ  1192

Query  601   PGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSS  777
             PGDLY C  +   ++ + +GE +LLR+IN+ALNQQLFFSVANH  TVV  DA YTKPF++
Sbjct  1193  PGDLYRCSSKETARLPLDSGERILLRIINSALNQQLFFSVANHKLTVVGADAAYTKPFTT  1252

Query  778   NVIMLGPGQ  804
              V+MLGPGQ
Sbjct  1253  TVMMLGPGQ  1261



>ref|XP_009616771.1| PREDICTED: laccase-3-like [Nicotiana tomentosiformis]
Length=574

 Score =   382 bits (982),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 183/275 (67%), Positives = 214/275 (78%), Gaps = 7/275 (3%)
 Frame = +1

Query  1    MEACTKYlflfaifaflS------SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVN  162
            ME C  YL +      L+      S  ++F + E HYHEF++  T   RLC+T +IITVN
Sbjct  1    METCKNYLKIPLSNGLLATIIAILSLLSSFANAEFHYHEFIVQETSVTRLCRTKNIITVN  60

Query  163  GQFPGPTLEVRNGDTLVIKVINAARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQY  342
            GQFPGPTL VRNGDTL + V+N ARYN T+HWHGIRQ+ + WADGP Y+TQCPI+PG  Y
Sbjct  61   GQFPGPTLTVRNGDTLFVTVVNRARYNVTIHWHGIRQMRTPWADGPEYVTQCPIRPGGFY  120

Query  343  TYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERD  522
            TYRFTI+ QEGTLWWHAH++WLRATVYGA+VI P+ G  +PF  P K+IPILLGEWW RD
Sbjct  121  TYRFTIENQEGTLWWHAHSKWLRATVYGALVILPKQGSNFPFSLPQKDIPILLGEWWNRD  180

Query  523  IFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQ  699
            I +V RQA FTGAAPN+S+AYTING PGDLY C  +G  KV V  GETVLLRVINAALNQ
Sbjct  181  IIAVQRQAQFTGAAPNISNAYTINGQPGDLYRCSSQGTMKVSVNPGETVLLRVINAALNQ  240

Query  700  QLFFSVANHIFTVVEVDATYTKPFSSNVIMLGPGQ  804
            QLFFSVANH+ TVV VDATY KPF++NVIM+GPGQ
Sbjct  241  QLFFSVANHMLTVVGVDATYNKPFTTNVIMVGPGQ  275



>ref|XP_008355071.1| PREDICTED: laccase-3-like [Malus domestica]
Length=568

 Score =   381 bits (979),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 169/248 (68%), Positives = 207/248 (83%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+F + E H+HEFV+ A P +RLC+TH+ ITVNGQFPGPTLEVRNGD++ +KV N A+YN
Sbjct  19   ASFSAAEDHFHEFVVEAKPVRRLCRTHTTITVNGQFPGPTLEVRNGDSIAVKVTNRAKYN  78

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG++Q  + WADGP Y+TQCPIQPGA YTYRFTI  QEGTLWWHAH+RWLRATVY
Sbjct  79   ITIHWHGLKQQRNPWADGPEYVTQCPIQPGATYTYRFTITDQEGTLWWHAHSRWLRATVY  138

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYPRLG PYPFP P +E+P+LLGEW++R+   V R A FTG APNVSDAYTING P
Sbjct  139  GALIIYPRLGSPYPFPMPKREVPLLLGEWFDRNPLDVQRLAAFTGGAPNVSDAYTINGLP  198

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C +  T ++ V++GE++LLRV+N+ALNQ+LFF+VANH  TVV  DA YTKPF++ 
Sbjct  199  GDLYRCSKQETIRIPVESGESLLLRVVNSALNQELFFTVANHQLTVVSADAAYTKPFTTR  258

Query  781  VIMLGPGQ  804
            VIMLGPGQ
Sbjct  259  VIMLGPGQ  266



>ref|XP_011021001.1| PREDICTED: laccase-13-like [Populus euphratica]
Length=576

 Score =   382 bits (980),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 178/251 (71%), Positives = 205/251 (82%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            S  A F   ETHY EFVI A P KRLC+TH+ ITVNG FPGPTLEVR+GD+LVIK +N A
Sbjct  24   SFQAHFSEAETHYREFVIQAKPVKRLCRTHNTITVNGLFPGPTLEVRDGDSLVIKAVNNA  83

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            RYN TLHWHGIRQ+ + WADGP  ITQCPIQPG  YTYRFTI+ QEGTLWWHAH++WLRA
Sbjct  84   RYNVTLHWHGIRQLRNPWADGPDRITQCPIQPGRSYTYRFTIENQEGTLWWHAHSKWLRA  143

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGA++I+P+LG PYPFP P  EIPILLGEWW+R+   V+R A FTGAAPN+SDAYTIN
Sbjct  144  TVYGALIIHPKLGSPYPFPMPRTEIPILLGEWWDRNPMDVLRLADFTGAAPNISDAYTIN  203

Query  595  GWPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C +  T +  V +GET+LLRVINAALNQ+LFF VANH  TVV VDA YTKPF
Sbjct  204  GQPGDLYRCSKQETVRFPVGSGETILLRVINAALNQELFFGVANHKLTVVAVDAAYTKPF  263

Query  772  SSNVIMLGPGQ  804
            +++VIM+ PGQ
Sbjct  264  TTSVIMISPGQ  274



>ref|XP_008354603.1| PREDICTED: laccase-3-like [Malus domestica]
Length=568

 Score =   381 bits (978),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 169/248 (68%), Positives = 207/248 (83%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+F + E H+HEFV+ A P +RLC+TH+ ITVNGQFPGPTLEVRNGD++ +KV N A+YN
Sbjct  19   ASFSAAEDHFHEFVVEAKPVRRLCRTHTTITVNGQFPGPTLEVRNGDSIAVKVTNRAKYN  78

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG++Q  + WADGP Y+TQCPIQPGA YTYRFTI  QEGTLWWHAH+RWLRATVY
Sbjct  79   ITIHWHGLKQQRNPWADGPEYVTQCPIQPGATYTYRFTITDQEGTLWWHAHSRWLRATVY  138

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYPRLG PYPFP P +E+P+LLGEW++R+   V R A FTG APNVSDAYTING P
Sbjct  139  GALIIYPRLGSPYPFPMPKREVPLLLGEWFDRNPLDVQRLAAFTGGAPNVSDAYTINGXP  198

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C +  T ++ V++GE++LLRV+N+ALNQ+LFF+VANH  TVV  DA YTKPF++ 
Sbjct  199  GDLYRCSKQETIRIPVESGESLLLRVVNSALNQELFFTVANHQLTVVSADAAYTKPFTTR  258

Query  781  VIMLGPGQ  804
            VIMLGPGQ
Sbjct  259  VIMLGPGQ  266



>ref|XP_009763768.1| PREDICTED: laccase-12-like [Nicotiana sylvestris]
Length=574

 Score =   381 bits (978),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/248 (72%), Positives = 206/248 (83%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A   SG+TH+H+FVI ATP KRLCKTH+ ITVNGQFPGPTLEV NGDTLV+KV+N ARYN
Sbjct  24   ANAASGKTHHHDFVIQATPVKRLCKTHNTITVNGQFPGPTLEVNNGDTLVVKVVNRARYN  83

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG+RQ+ + WADGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVY
Sbjct  84   VTIHWHGVRQMRTGWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVY  143

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++I+P+ G  YPF KP +E PILLGEWW+ +   V+RQAT TGAAPNVSDAYTING P
Sbjct  144  GALIIHPKDGGSYPFAKPKRETPILLGEWWDANPIDVIRQATRTGAAPNVSDAYTINGQP  203

Query  604  GDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C  +  T V V +GET LLRVINAALNQQLFFSVANH  TVV  DA+Y KPF+++
Sbjct  204  GDLYKCSSQDTTIVHVDSGETNLLRVINAALNQQLFFSVANHKLTVVGADASYVKPFTTS  263

Query  781  VIMLGPGQ  804
            V+MLGPGQ
Sbjct  264  VLMLGPGQ  271



>ref|XP_009790079.1| PREDICTED: laccase-3-like [Nicotiana sylvestris]
Length=575

 Score =   381 bits (978),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/251 (71%), Positives = 205/251 (82%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            S   +F + E HYHEF++  T   RLC+T +IITVNGQFPGPTL VRNGDTL + V+N A
Sbjct  26   SLLPSFANAEFHYHEFIVQETRITRLCRTKNIITVNGQFPGPTLTVRNGDTLFVTVVNRA  85

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            RYN T+HWHGIRQ+ + WADGP Y+TQCPI+PG  YTYRFTI+ QEGTLWWHAH++WLRA
Sbjct  86   RYNVTIHWHGIRQMRTPWADGPEYVTQCPIRPGGFYTYRFTIENQEGTLWWHAHSKWLRA  145

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGA+VI P+ G  +PF +P K+IPILLGEWW RDI +V RQA FTGAAPN SDAYTIN
Sbjct  146  TVYGALVILPKQGSNFPFLQPQKDIPILLGEWWNRDIIAVQRQAQFTGAAPNNSDAYTIN  205

Query  595  GWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C  +G  KV V  GETVLLRVINAALNQQLFFSVANH+ TVV VDATY KPF
Sbjct  206  GQPGDLYRCSSQGTVKVSVNPGETVLLRVINAALNQQLFFSVANHMLTVVGVDATYNKPF  265

Query  772  SSNVIMLGPGQ  804
            ++NVIM+GPGQ
Sbjct  266  TTNVIMVGPGQ  276



>gb|KDP45752.1| hypothetical protein JCGZ_17359 [Jatropha curcas]
Length=570

 Score =   380 bits (977),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 173/243 (71%), Positives = 206/243 (85%), Gaps = 1/243 (0%)
 Frame = +1

Query  79   GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHW  258
             E HYHEFVI A P KRLC+TH+ ITVNGQFPGPTL+VRNGD+LVIK IN A+YN TLHW
Sbjct  25   AEIHYHEFVIQAKPVKRLCRTHNTITVNGQFPGPTLQVRNGDSLVIKAINNAQYNVTLHW  84

Query  259  HGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVI  438
            HGIRQ+ + WADGP  +TQCPI+PG  YTYRFTIQ QEGTLWWHAH++WLRATVYGA++I
Sbjct  85   HGIRQLRNPWADGPDMVTQCPIRPGRSYTYRFTIQNQEGTLWWHAHSKWLRATVYGALII  144

Query  439  YPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYT  618
            YP+LG  YPFP P +EIPILLGEWW+R+   V++ ATFTGAAPNVSDAYTING PGDLY 
Sbjct  145  YPKLGSSYPFPMPKQEIPILLGEWWDRNPMDVLKLATFTGAAPNVSDAYTINGQPGDLYR  204

Query  619  CHRGITKV-QVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLG  795
            C +  T V  V +GET+LLR+IN+A+NQ+LFF++ANH  TVVEVDA YTKPF+++VI++ 
Sbjct  205  CSQKETAVFPVASGETILLRIINSAMNQELFFAIANHKMTVVEVDAAYTKPFTTSVIVIS  264

Query  796  PGQ  804
            PGQ
Sbjct  265  PGQ  267



>ref|XP_010045386.1| PREDICTED: laccase-3-like [Eucalyptus grandis]
 gb|KCW87557.1| hypothetical protein EUGRSUZ_B04003 [Eucalyptus grandis]
Length=575

 Score =   381 bits (978),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 204/249 (82%), Gaps = 1/249 (0%)
 Frame = +1

Query  61   TATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARY  240
            + +F   E H+HEFVI A P KRLC+THS ITVNGQFPGPTL VR+GD+LVI  IN ARY
Sbjct  24   SVSFSVAEVHFHEFVIQARPVKRLCRTHSTITVNGQFPGPTLAVRDGDSLVITAINRARY  83

Query  241  NATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATV  420
            N TLHWHG+RQ+ + WADGP Y+TQCPIQPG  YTYRFTIQ QEGTLWWHAH++WLRATV
Sbjct  84   NVTLHWHGVRQLRNPWADGPEYVTQCPIQPGGTYTYRFTIQNQEGTLWWHAHSKWLRATV  143

Query  421  YGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGW  600
            YGA++I+P+LG  YPFP P +E P+LLGEW++R+   V++QA FTGAAPNVSDAYTING 
Sbjct  144  YGALIIFPKLGSHYPFPMPKREFPVLLGEWFDRNPMDVLKQALFTGAAPNVSDAYTINGQ  203

Query  601  PGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSS  777
            PGDLY C  +G        GET+LLR+INAALNQ+LFFSVANH  TVV VDA YT+PF++
Sbjct  204  PGDLYRCSSKGTAVFPAIPGETILLRIINAALNQELFFSVANHQMTVVGVDAAYTRPFAT  263

Query  778  NVIMLGPGQ  804
            NVIM+GPGQ
Sbjct  264  NVIMIGPGQ  272



>ref|XP_008457330.1| PREDICTED: laccase-3 [Cucumis melo]
Length=574

 Score =   380 bits (976),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 172/248 (69%), Positives = 208/248 (84%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            + F   +THYH+F++   P KRLCK H+IITVNGQFPGPTL VR+GD+LVIKV+NAARYN
Sbjct  28   SAFPLPKTHYHQFIVQPKPVKRLCKVHNIITVNGQFPGPTLAVRDGDSLVIKVVNAARYN  87

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             +LHWHGIRQ+ + WADGP +ITQC I+PG  YTYRFTI+ QEGTLWWHAH+RWLRATVY
Sbjct  88   VSLHWHGIRQLRNPWADGPEFITQCSIKPGGSYTYRFTIEGQEGTLWWHAHSRWLRATVY  147

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYP+L  P+PF  P KE P+LLGEW++RD  SV+RQA FTGAAPNVSDAYTING P
Sbjct  148  GALIIYPKLASPHPFVMPKKEFPLLLGEWFDRDPISVLRQALFTGAAPNVSDAYTINGQP  207

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GD Y C +  T ++ V +GET+LLR+IN+ALNQ+LFFS+ANH  TVV VDA YTKPF++N
Sbjct  208  GDFYICSKKETMRLAVNSGETILLRIINSALNQELFFSIANHQMTVVAVDAAYTKPFATN  267

Query  781  VIMLGPGQ  804
            VIM+GPGQ
Sbjct  268  VIMIGPGQ  275



>ref|XP_009343323.1| PREDICTED: laccase-3-like [Pyrus x bretschneideri]
Length=563

 Score =   380 bits (975),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 170/248 (69%), Positives = 207/248 (83%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+F + E H+HEFV+ A P +RLC+THS ITVNGQFPGPTLEVRNGD++ +KV N A+YN
Sbjct  20   ASFSAAEDHFHEFVVEARPVRRLCRTHSRITVNGQFPGPTLEVRNGDSVAVKVTNIAKYN  79

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG++Q  + WADGP Y+TQCPIQPGA YTYRFTI  QEGTLWWHAH+RWLRATVY
Sbjct  80   ITIHWHGLKQQNNPWADGPEYVTQCPIQPGATYTYRFTITDQEGTLWWHAHSRWLRATVY  139

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            G ++IYPRLG PYPFP P +E+P+LLGEW++R+   VMR A FTG APNVS+AYTING P
Sbjct  140  GVLIIYPRLGSPYPFPMPKREVPLLLGEWFDRNPHDVMRLAAFTGGAPNVSNAYTINGQP  199

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C +  T ++ V +GE++LLRVIN+ALNQ+LFF+VANH  TVV  DA+YTKPF++ 
Sbjct  200  GDLYRCSKKETIRIPVVSGESLLLRVINSALNQELFFTVANHQLTVVGADASYTKPFATR  259

Query  781  VIMLGPGQ  804
            VIMLGPGQ
Sbjct  260  VIMLGPGQ  267



>ref|XP_010264533.1| PREDICTED: laccase-12 [Nelumbo nucifera]
Length=578

 Score =   380 bits (976),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 202/242 (83%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            ETHYHEFV+ ATP KRLCKTH+ ITVNGQFPGPTLEVRNGDTLVI+VIN ARYN T+HWH
Sbjct  34   ETHYHEFVVQATPVKRLCKTHNTITVNGQFPGPTLEVRNGDTLVIRVINRARYNVTIHWH  93

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP Y+TQCPIQPG  YTYRFTIQ QEGTLWWHAH+ WLRATVYGA++IY
Sbjct  94   GVRQLRTAWADGPEYVTQCPIQPGGSYTYRFTIQDQEGTLWWHAHSSWLRATVYGALIIY  153

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            PRLG  YPF KP +E P+LLGEWW+ +   V+R+AT TGAAPNVSDAYTING PGDLY C
Sbjct  154  PRLGSSYPFTKPKRETPVLLGEWWDDNPIDVIRRATRTGAAPNVSDAYTINGQPGDLYNC  213

Query  622  HRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
                T  + V +GET LLRVINAALNQ+LF ++ NH  TVV  DA+Y KPF+++V+MLGP
Sbjct  214  SSQDTVIIPVDSGETNLLRVINAALNQELFLAIGNHQLTVVAADASYKKPFTTSVLMLGP  273

Query  799  GQ  804
            GQ
Sbjct  274  GQ  275



>ref|XP_009343324.1| PREDICTED: laccase-3-like [Pyrus x bretschneideri]
Length=567

 Score =   380 bits (975),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 170/248 (69%), Positives = 207/248 (83%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+F + E H+HEFV+ A P +RLC+THS ITVNGQFPGPTLEVRNGD++ +KV N A+YN
Sbjct  20   ASFSAAEDHFHEFVVEARPVRRLCRTHSRITVNGQFPGPTLEVRNGDSVAVKVTNIAKYN  79

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG++Q  + WADGP Y+TQCPIQPGA YTYRFTI  QEGTLWWHAH+RWLRATVY
Sbjct  80   ITIHWHGLKQQNNPWADGPEYVTQCPIQPGATYTYRFTITDQEGTLWWHAHSRWLRATVY  139

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            G ++IYPRLG PYPFP P +E+P+LLGEW++R+   VMR A FTG APNVS+AYTING P
Sbjct  140  GVLIIYPRLGSPYPFPMPKREVPLLLGEWFDRNPLDVMRLAAFTGGAPNVSNAYTINGQP  199

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C +  T ++ V +GE++LLRVIN+ALNQ+LFF+VANH  TVV  DA+YTKPF++ 
Sbjct  200  GDLYRCSKKETIRIPVVSGESLLLRVINSALNQELFFTVANHQLTVVGADASYTKPFATR  259

Query  781  VIMLGPGQ  804
            VIMLGPGQ
Sbjct  260  VIMLGPGQ  267



>ref|XP_010099447.1| hypothetical protein L484_011146 [Morus notabilis]
 gb|EXB78522.1| hypothetical protein L484_011146 [Morus notabilis]
Length=575

 Score =   379 bits (974),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 204/244 (84%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
              ETHYH+FV+  TP  RLC+T + ITVNGQFPGPTL VRNGDTLVI+VIN+A+YN T+H
Sbjct  31   DAETHYHQFVVQPTPVTRLCRTRNRITVNGQFPGPTLAVRNGDTLVIRVINSAQYNVTMH  90

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHGIRQ+ + WADGP Y+TQCPIQPG  YTYRFTI  QEGTLWWHAH+RWLRATVYGA++
Sbjct  91   WHGIRQLQNPWADGPEYVTQCPIQPGGTYTYRFTIIDQEGTLWWHAHSRWLRATVYGALI  150

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            IYP+LG PYPF  P +E+PILLGEWW R+   V+RQ+ FTGAAPNVSDAYTING PGDLY
Sbjct  151  IYPKLGTPYPFHMPKREVPILLGEWWNRNPMDVLRQSQFTGAAPNVSDAYTINGQPGDLY  210

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C ++   ++ V +GET+LLR+IN+ALNQ+LFF++ANH  TVV  DA YTKPF++ VIM+
Sbjct  211  RCSNKETVRIPVDSGETILLRLINSALNQELFFAIANHKMTVVAADALYTKPFTTQVIMI  270

Query  793  GPGQ  804
            GPGQ
Sbjct  271  GPGQ  274



>ref|XP_004239959.1| PREDICTED: laccase-12 [Solanum lycopersicum]
Length=574

 Score =   379 bits (973),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 175/248 (71%), Positives = 206/248 (83%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A   S +THYH+FVI ATP KRLCKTH+ ITVNGQFPGPTLEV NGDTLV+KV+N ARYN
Sbjct  24   ADAASAKTHYHDFVIQATPVKRLCKTHNTITVNGQFPGPTLEVNNGDTLVVKVVNRARYN  83

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG+RQ+ S WADGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVY
Sbjct  84   VTIHWHGVRQMRSAWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVY  143

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++I+P+ G  YPFPKP +E PILLGEWW+ +   V+R+AT TGAAPNVSDAYTING P
Sbjct  144  GALIIHPKEGGNYPFPKPRRETPILLGEWWDANPIDVVREATRTGAAPNVSDAYTINGQP  203

Query  604  GDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C  +  T V + +GET LLRVINA +NQ+LFF+VANH FTVV  DA+Y KPF+++
Sbjct  204  GDLYKCSSQDTTIVHMDSGETNLLRVINAGMNQELFFTVANHKFTVVGADASYVKPFTTS  263

Query  781  VIMLGPGQ  804
            V+MLGPGQ
Sbjct  264  VLMLGPGQ  271



>ref|XP_006353418.1| PREDICTED: laccase-12-like [Solanum tuberosum]
Length=567

 Score =   379 bits (972),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 173/248 (70%), Positives = 204/248 (82%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+    + HYH+FVI ATP KRLC THS ITVNGQFPGPTLEV NGD+LV+KV+N A+YN
Sbjct  17   ASLAKAKIHYHDFVIQATPVKRLCNTHSTITVNGQFPGPTLEVNNGDSLVVKVVNRAQYN  76

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG+RQ+ + WADGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVY
Sbjct  77   VTIHWHGVRQMRTAWADGPEFITQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVY  136

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA+VI+P+ G  YPFPKP ++ PILLGEWW+ +   V+RQAT TGAAPN SDAYTING P
Sbjct  137  GALVIHPKEGTAYPFPKPKRQTPILLGEWWDANPIDVIRQATRTGAAPNASDAYTINGQP  196

Query  604  GDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C ++  T V V +GET LLRVIN+ LNQQLFFSVANH FTVV  DA+Y KPF+++
Sbjct  197  GDLYKCSNQDTTIVHVDSGETNLLRVINSGLNQQLFFSVANHKFTVVGADASYVKPFTTS  256

Query  781  VIMLGPGQ  804
            V+MLGPGQ
Sbjct  257  VLMLGPGQ  264



>ref|XP_006488594.1| PREDICTED: laccase-3-like [Citrus sinensis]
Length=578

 Score =   379 bits (973),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 170/248 (69%), Positives = 201/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+    E HYHEFVI A P KRLC+THS +TVNGQFPGPTL+VRNGDTLVI+ IN ARYN
Sbjct  27   ASLSHAEIHYHEFVIEARPVKRLCRTHSTVTVNGQFPGPTLQVRNGDTLVIRAINRARYN  86

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             TLHWHG+ Q  + WADGP Y+TQCPIQPG  YTYRFTI+ QEGTLWWHAH+RWLRATVY
Sbjct  87   VTLHWHGVHQTRNPWADGPEYVTQCPIQPGRSYTYRFTIEDQEGTLWWHAHSRWLRATVY  146

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA+++YPR+G PYPFP P +EIPIL+GEWW+RD   V+RQA FTG APN+SDA TING P
Sbjct  147  GALIVYPRMGSPYPFPMPKREIPILIGEWWDRDPMDVLRQALFTGGAPNISDALTINGQP  206

Query  604  GDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C  +   +  V+ GET+LLR+IN+A+NQ+ FF VANH  TVV VD +YTKPF ++
Sbjct  207  GDLYRCSSKETVRFPVEAGETILLRIINSAMNQEHFFGVANHRLTVVGVDTSYTKPFPTS  266

Query  781  VIMLGPGQ  804
            VIM+ PGQ
Sbjct  267  VIMIAPGQ  274



>ref|XP_009804481.1| PREDICTED: laccase-5-like isoform X2 [Nicotiana sylvestris]
Length=508

 Score =   376 bits (966),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 174/246 (71%), Positives = 203/246 (83%), Gaps = 1/246 (0%)
 Frame = +1

Query  70   FLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNAT  249
            F + +T YH FVI ATP KRLCKTH+ ITVNGQFPGPTLEV NGDTLVI V+N ARYN T
Sbjct  39   FANAKTQYHHFVIQATPVKRLCKTHNTITVNGQFPGPTLEVNNGDTLVINVVNRARYNVT  98

Query  250  LHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGA  429
            +HWHG++QI + WADGP +ITQCPI+PG  YTYRFTIQ+QEGTLWWHAH+ WLRATVYGA
Sbjct  99   IHWHGVKQIRTAWADGPEFITQCPIRPGGSYTYRFTIQEQEGTLWWHAHSSWLRATVYGA  158

Query  430  IVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGD  609
            ++I+P+ G  YPFP P +E PILLGEWW+ +   V+RQAT TGAAPNVSDAYTING PGD
Sbjct  159  LIIHPKEGEFYPFPNPRRETPILLGEWWDANPIDVVRQATRTGAAPNVSDAYTINGQPGD  218

Query  610  LYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVI  786
            LY C  +  T V V +GET LLRVINAALNQQLFF+VANH  TVV  DA+Y +PF+++V+
Sbjct  219  LYRCSSKDTTIVLVDSGETSLLRVINAALNQQLFFTVANHKLTVVGADASYVQPFTTSVL  278

Query  787  MLGPGQ  804
            MLGPGQ
Sbjct  279  MLGPGQ  284



>ref|XP_010521986.1| PREDICTED: laccase-3 [Tarenaya hassleriana]
Length=565

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/248 (70%), Positives = 202/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+F S E H  EFVI A P KRLC+TH  ITVNGQFPGPTLEVRNGD+L I VIN ARYN
Sbjct  22   ASFASAELHVREFVIEARPVKRLCRTHQTITVNGQFPGPTLEVRNGDSLAITVINKARYN  81

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             ++HWHGIRQ+ + WADGP YITQCPIQPG  YTYR  I+ QEGT WWHAH+RWLRATVY
Sbjct  82   ISIHWHGIRQLRNPWADGPEYITQCPIQPGQSYTYRIMIEGQEGTFWWHAHSRWLRATVY  141

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYPRLG PYPFP P ++IPILLGEWW+R+   V+R A FTGAAPNVSDAYTING P
Sbjct  142  GALIIYPRLGSPYPFPMPKRDIPILLGEWWDRNPMDVLRLAQFTGAAPNVSDAYTINGQP  201

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C R  T +  V  GET+ LR+INAA+NQ+LFF++ANH  TVVEVD+ YTKPF+++
Sbjct  202  GDLYRCSRQETVRFPVFPGETIQLRLINAAMNQELFFAIANHPLTVVEVDSAYTKPFTTS  261

Query  781  VIMLGPGQ  804
            V+M+ PGQ
Sbjct  262  VVMIAPGQ  269



>ref|XP_010457861.1| PREDICTED: laccase-3-like [Camelina sativa]
Length=571

 Score =   378 bits (970),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/254 (70%), Positives = 204/254 (80%), Gaps = 3/254 (1%)
 Frame = +1

Query  52   SSCT--ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVI  225
            + CT  A+  S E H  EFVI A P KRLC+TH  ITVNGQFPGPTLEVRNGD+L I VI
Sbjct  19   ACCTFLASLTSAEVHVREFVIEAKPVKRLCRTHQTITVNGQFPGPTLEVRNGDSLAITVI  78

Query  226  NAARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRW  405
            N ARYN +LHWHGIRQ+ + WADGP YITQCPIQPG  YTYR  I+ QEGTLWWHAH+ W
Sbjct  79   NRARYNISLHWHGIRQLRNPWADGPEYITQCPIQPGQSYTYRIKIEDQEGTLWWHAHSHW  138

Query  406  LRATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAY  585
            LRATVYGA++IYPRLG PYPF  P ++IPI+LGEWW+R+   V+R A FTGAAPNVSDAY
Sbjct  139  LRATVYGALIIYPRLGSPYPFSMPKRDIPIILGEWWDRNPMDVLRLAQFTGAAPNVSDAY  198

Query  586  TINGWPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYT  762
            TING PGDLY C +  T +  +  GETV LR+INAALNQ+LFF+VANH  TVVEVD+ YT
Sbjct  199  TINGQPGDLYRCSKPETVRFPIVPGETVQLRLINAALNQELFFTVANHQLTVVEVDSAYT  258

Query  763  KPFSSNVIMLGPGQ  804
            KPF++NV+MLGPGQ
Sbjct  259  KPFTTNVVMLGPGQ  272



>ref|XP_006410143.1| hypothetical protein EUTSA_v10016445mg [Eutrema salsugineum]
 gb|ESQ51596.1| hypothetical protein EUTSA_v10016445mg [Eutrema salsugineum]
Length=570

 Score =   378 bits (970),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 176/248 (71%), Positives = 201/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A F S E H  EFVI   P KRLC+TH  ITVNGQFPGP LEVRNGD+L I VIN ARYN
Sbjct  20   ALFASAELHVREFVIQPKPVKRLCRTHQSITVNGQFPGPNLEVRNGDSLAITVINRARYN  79

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             ++HWHGIRQ+ + WADGP YITQCPI+PG  YTYRFTI+ QEGTLWWHAH++WLRATVY
Sbjct  80   ISIHWHGIRQLRNPWADGPEYITQCPIRPGQSYTYRFTIEGQEGTLWWHAHSKWLRATVY  139

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYPRLG PYPF  P ++IPILLGEWW+R+   V+R A FTGAAPNVSDAYTING P
Sbjct  140  GALIIYPRLGSPYPFSMPKRDIPILLGEWWDRNPMDVLRLAQFTGAAPNVSDAYTINGQP  199

Query  604  GDLYTCHRG-ITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C R   T+  +  GETV LRVINAALNQ+LFFSVANH  TVVE D+ YTKPF+++
Sbjct  200  GDLYRCSRAETTRFPIFPGETVQLRVINAALNQELFFSVANHQLTVVETDSAYTKPFTTS  259

Query  781  VIMLGPGQ  804
            VIM+GPGQ
Sbjct  260  VIMIGPGQ  267



>ref|XP_010475452.1| PREDICTED: laccase-3-like [Camelina sativa]
Length=568

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/251 (70%), Positives = 201/251 (80%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            +C     S E H  EFVI A P KRLC+TH  ITVNGQFPGPTLEVRNGD+L I VIN A
Sbjct  19   ACCTLLASAELHVREFVIEAKPVKRLCRTHQTITVNGQFPGPTLEVRNGDSLAITVINRA  78

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            RYN +LHWHGIRQ+ + WADGP YITQCPIQPG  YTYR  I+ QEGTLWWHAH+ WLRA
Sbjct  79   RYNISLHWHGIRQLRNPWADGPEYITQCPIQPGQSYTYRIKIEDQEGTLWWHAHSHWLRA  138

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGA++IYPRLG PYPF  P ++IPI+LGEWW+R+   V+R A FTGAAPNVSDAYTIN
Sbjct  139  TVYGALIIYPRLGSPYPFSMPKRDIPIILGEWWDRNPMDVLRLAQFTGAAPNVSDAYTIN  198

Query  595  GWPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C +  T +  +  GETV LR+INAALNQ+LFF+VANH  TVVEVD+ YTKPF
Sbjct  199  GQPGDLYRCSKPETVRFPIVPGETVQLRLINAALNQELFFTVANHQLTVVEVDSAYTKPF  258

Query  772  SSNVIMLGPGQ  804
            ++NV+MLGPGQ
Sbjct  259  TTNVVMLGPGQ  269



>ref|XP_006296399.1| hypothetical protein CARUB_v10025575mg [Capsella rubella]
 gb|EOA29297.1| hypothetical protein CARUB_v10025575mg [Capsella rubella]
Length=570

 Score =   377 bits (969),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/248 (71%), Positives = 200/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A   S E H  EFVI   P KRLC+TH  ITVNGQFPGPTLEVRNGD+L I VIN ARYN
Sbjct  20   AFLASAELHVREFVIEPRPVKRLCRTHQSITVNGQFPGPTLEVRNGDSLAITVINRARYN  79

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             ++HWHG+RQ+ + WADGP YITQCPI+PG  YTY+FTI+ QEGTLWWHAH+RWLRATVY
Sbjct  80   ISIHWHGLRQMRNPWADGPEYITQCPIRPGQSYTYKFTIEDQEGTLWWHAHSRWLRATVY  139

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYPRLG PYPF  P ++IPILLGEWW+R+   V+RQA FTGAA NVSDAYTING P
Sbjct  140  GALIIYPRLGSPYPFSMPKRDIPILLGEWWDRNPMDVLRQAQFTGAAANVSDAYTINGQP  199

Query  604  GDLYTCHR-GITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C R G  +  +  GETV LRVINA +NQ+LFFSVANH  TVVE D+ YTKPF++N
Sbjct  200  GDLYRCSRAGTMRFPIFPGETVQLRVINAGMNQELFFSVANHQLTVVETDSAYTKPFTTN  259

Query  781  VIMLGPGQ  804
            VIMLGPGQ
Sbjct  260  VIMLGPGQ  267



>ref|XP_004145307.1| PREDICTED: laccase-3-like [Cucumis sativus]
 ref|XP_004153690.1| PREDICTED: laccase-3-like [Cucumis sativus]
 ref|XP_004168716.1| PREDICTED: laccase-3-like [Cucumis sativus]
Length=574

 Score =   377 bits (969),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 171/248 (69%), Positives = 207/248 (83%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            + F   +TH+H+F++   P KRLCK H+IITVNGQFPGPTL VR+GD+LVIKV+NAARYN
Sbjct  28   SAFPLPKTHFHQFIVQPKPVKRLCKVHNIITVNGQFPGPTLAVRDGDSLVIKVVNAARYN  87

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             +LHWHGIRQ+ + WADGP +ITQC I+PG  YTYRFTI+ QEGTLWWHAH+RWLRATVY
Sbjct  88   VSLHWHGIRQLRNPWADGPEFITQCSIKPGGTYTYRFTIEGQEGTLWWHAHSRWLRATVY  147

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYP+LG P PF  P KE P+LLGEW++RD  SV+RQA FTGA PNVSDAYTING P
Sbjct  148  GALIIYPKLGSPRPFIMPKKEFPLLLGEWFDRDPISVLRQALFTGAGPNVSDAYTINGQP  207

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GD Y C +  T ++ V +GET+LLR+IN+ALNQ+LFFS+ANH  TVV VDA YTKPF++N
Sbjct  208  GDFYICSKKETMRLAVDSGETILLRIINSALNQELFFSIANHQMTVVAVDAAYTKPFATN  267

Query  781  VIMLGPGQ  804
            VIM+GPGQ
Sbjct  268  VIMVGPGQ  275



>ref|XP_011041833.1| PREDICTED: laccase-13 [Populus euphratica]
Length=611

 Score =   378 bits (971),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 175/252 (69%), Positives = 205/252 (81%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            +S  A+F   ETHYHEFVI A P +RLC+TH+ ITVNG FPGPTLEVR+GDTLVIK IN 
Sbjct  58   TSFQASFSEAETHYHEFVIQAKPVRRLCRTHNTITVNGLFPGPTLEVRDGDTLVIKAINN  117

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN TLHWHG+RQ+ + WADGP  +TQCPIQPG  YTYRFTI+ QEGTLWWHAH+ WLR
Sbjct  118  ARYNVTLHWHGVRQLRNPWADGPDRVTQCPIQPGRSYTYRFTIENQEGTLWWHAHSSWLR  177

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P+LG PY FP P +EIPILLGEWW+R+   V+R A FTGAAPNVSDAYTI
Sbjct  178  ATVYGALIIHPKLGSPYSFPMPRREIPILLGEWWDRNPMDVLRLADFTGAAPNVSDAYTI  237

Query  592  NGWPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C +  T +  V  GET+LLRVIN+ LNQ+LFF+VANHI TVV VDA  TKP
Sbjct  238  NGQPGDLYRCSKQETVRFPVDPGETILLRVINSGLNQELFFAVANHILTVVAVDADCTKP  297

Query  769  FSSNVIMLGPGQ  804
            F+++ IM+ PGQ
Sbjct  298  FATSFIMIAPGQ  309



>emb|CDP09252.1| unnamed protein product [Coffea canephora]
Length=589

 Score =   377 bits (968),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 175/263 (67%), Positives = 207/263 (79%), Gaps = 20/263 (8%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
              ETHYHEFV+ +TP KRLC + SI+TVNGQFPGPT+EVR+GD+LVIKVIN A YN T+H
Sbjct  24   DSETHYHEFVVQSTPIKRLCTSRSILTVNGQFPGPTIEVRDGDSLVIKVINRALYNVTIH  83

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHGIRQ G+QWADGP Y+TQCPIQPGA YTYRF+IQ Q+GTLWWHAH+RW+RAT+YGA+V
Sbjct  84   WHGIRQRGTQWADGPEYVTQCPIQPGAAYTYRFSIQNQDGTLWWHAHSRWIRATIYGALV  143

Query  436  IYPRLGVPYPFPK-PDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDL  612
            IYP+LGVPYPF   PDK+ P++LGEWW+ DI  +MRQA F+GAAPNVSDAYTING PGD 
Sbjct  144  IYPKLGVPYPFQNHPDKDFPVILGEWWDTDILGIMRQALFSGAAPNVSDAYTINGQPGDF  203

Query  613  YTCHR-GITKV------------------QVKTGETVLLRVINAALNQQLFFSVANHIFT  735
            Y C   G+ +                    V  G+TVLLR+INAALNQQLFF+VANH+ T
Sbjct  204  YRCSSLGLLQTCSLYDCQVLLVSTYTATFYVDAGDTVLLRIINAALNQQLFFTVANHMLT  263

Query  736  VVEVDATYTKPFSSNVIMLGPGQ  804
            VV  DA Y KPF++ VIM+GPGQ
Sbjct  264  VVGADAAYNKPFTTRVIMVGPGQ  286



>ref|XP_009141050.1| PREDICTED: laccase-3 [Brassica rapa]
 emb|CDY29689.1| BnaA04g17380D [Brassica napus]
Length=570

 Score =   376 bits (966),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 176/248 (71%), Positives = 200/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A   S E H  EFVI   P KRLC+TH  ITVNGQFPGPTLEVRNGD+L I VIN ARYN
Sbjct  20   AFLASAELHVREFVIEPKPVKRLCRTHQSITVNGQFPGPTLEVRNGDSLAITVINRARYN  79

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             ++HWHGIRQ+ + WADGP YITQCPI+PG  YTYRFTI+ QEGTLWWHAH+RWLRATVY
Sbjct  80   ISIHWHGIRQLRNPWADGPEYITQCPIRPGQSYTYRFTIEDQEGTLWWHAHSRWLRATVY  139

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYPRLG PYPF  P ++IPILLGEWW+R+   V+RQA FTGAA NVSDAYTING P
Sbjct  140  GALIIYPRLGSPYPFSMPKRDIPILLGEWWDRNPMDVLRQAQFTGAAANVSDAYTINGQP  199

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C R  T +  +  GETV LRVINA LNQ+LFFSVANH  TVVE D+ YTKPF+++
Sbjct  200  GDLYRCSRAETVRFPIFPGETVQLRVINAGLNQELFFSVANHQLTVVETDSAYTKPFTTS  259

Query  781  VIMLGPGQ  804
            VIM+GPGQ
Sbjct  260  VIMIGPGQ  267



>ref|XP_010486989.1| PREDICTED: laccase-3-like [Camelina sativa]
Length=571

 Score =   376 bits (966),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 176/254 (69%), Positives = 204/254 (80%), Gaps = 3/254 (1%)
 Frame = +1

Query  52   SSCT--ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVI  225
            + CT  A+  S E H  EFVI A P KRLC+TH  ITVNGQFPGPTLEVRNGD+L I VI
Sbjct  19   ACCTLLASLASAELHVREFVIEAKPLKRLCRTHQTITVNGQFPGPTLEVRNGDSLAITVI  78

Query  226  NAARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRW  405
            N ARYN +LHWHGIRQ+ + WADGP YITQCPIQPG  YTYR  I+ QEGTLWWHAH+ W
Sbjct  79   NRARYNISLHWHGIRQLRNPWADGPEYITQCPIQPGQSYTYRIKIEDQEGTLWWHAHSHW  138

Query  406  LRATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAY  585
            LRAT+YGA++IYPRLG PYPF  P ++IPI+LGEWW+R+   V+R A FTGAAPNVSDAY
Sbjct  139  LRATIYGALIIYPRLGSPYPFSMPKRDIPIILGEWWDRNPMDVLRLAQFTGAAPNVSDAY  198

Query  586  TINGWPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYT  762
            TING PGDLY C +  T +  +  GETV LR+INAALNQ+LFF+VANH  TVVEVD+ YT
Sbjct  199  TINGQPGDLYRCSKPETLRFPIVPGETVQLRLINAALNQELFFTVANHQLTVVEVDSAYT  258

Query  763  KPFSSNVIMLGPGQ  804
            KPF++NV+MLGPGQ
Sbjct  259  KPFTTNVVMLGPGQ  272



>ref|XP_004307187.1| PREDICTED: laccase-12-like [Fragaria vesca subsp. vesca]
Length=574

 Score =   377 bits (967),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 178/269 (66%), Positives = 212/269 (79%), Gaps = 1/269 (0%)
 Frame = +1

Query  1    MEACTKYlflfaifaflSSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGP  180
            MEA +  L L     F SS  +T    + H+HEFVI ATP KRLCKTH+ ITVNGQFPGP
Sbjct  1    MEAPSSILLLGLCLLFASSAMSTLAEPKAHHHEFVIQATPAKRLCKTHNSITVNGQFPGP  60

Query  181  TLEVRNGDTLVIKVINAARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTI  360
            TLEV NGDTLV+KV N ARYN T+HWHGIRQ+ + WADGP ++TQCPI+PG  YTYRFT+
Sbjct  61   TLEVNNGDTLVVKVTNKARYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTV  120

Query  361  QKQEGTLWWHAHTRWLRATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMR  540
            Q QEGTLWWHAH+ WLRATVYGA++I+P+ G  YPFPKP+++  +LLGEWW+ +   V+R
Sbjct  121  QGQEGTLWWHAHSSWLRATVYGALIIHPKQGDSYPFPKPNRQETLLLGEWWDANPIDVVR  180

Query  541  QATFTGAAPNVSDAYTINGWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSV  717
            QAT TGAAPN+SDAYTING PGDLY C  +G   V + +GET LLRV+NAALNQ LFFSV
Sbjct  181  QATRTGAAPNISDAYTINGQPGDLYNCSKKGTVVVPIDSGETNLLRVVNAALNQPLFFSV  240

Query  718  ANHIFTVVEVDATYTKPFSSNVIMLGPGQ  804
            ANH  TVV  DA+YTKPF++ V+MLGPGQ
Sbjct  241  ANHKLTVVGADASYTKPFTTKVLMLGPGQ  269



>ref|XP_004500522.1| PREDICTED: laccase-12-like [Cicer arietinum]
Length=569

 Score =   376 bits (965),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 171/251 (68%), Positives = 204/251 (81%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            S   +  + +TH HEFV+ ATP KRLCKTH+ ITVNGQ+PGPTLE+ NGD+LVIKV N A
Sbjct  22   SSALSLANAKTHNHEFVVEATPVKRLCKTHNTITVNGQYPGPTLEINNGDSLVIKVTNKA  81

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            RYN T+HWHG+RQ+ + WADGP +ITQCPI+PG  YTYRFT++ QEGTLWWHAH+ WLRA
Sbjct  82   RYNVTIHWHGVRQVRTGWADGPEFITQCPIRPGGSYTYRFTVEGQEGTLWWHAHSSWLRA  141

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGA++I PR G  YPFPKP++E PILLGEWW+R+   V+RQA  TGAAPNVSDAYTIN
Sbjct  142  TVYGALIIRPREGETYPFPKPNRETPILLGEWWDRNPIDVVRQAQRTGAAPNVSDAYTIN  201

Query  595  GWPGDLYTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C  +G T V ++ GET L+RVINAALNQ LFF +ANH  TVV  DA+Y KPF
Sbjct  202  GQPGDLYNCSTKGTTIVPIRYGETNLIRVINAALNQPLFFKIANHKLTVVGADASYLKPF  261

Query  772  SSNVIMLGPGQ  804
            ++NV+MLGPGQ
Sbjct  262  TTNVLMLGPGQ  272



>ref|XP_006303628.1| hypothetical protein CARUB_v10011512mg [Capsella rubella]
 gb|EOA36526.1| hypothetical protein CARUB_v10011512mg [Capsella rubella]
Length=574

 Score =   376 bits (966),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 176/252 (70%), Positives = 203/252 (81%), Gaps = 3/252 (1%)
 Frame = +1

Query  58   CT--ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            CT  A+  S E H  EFVI A P KRLC+TH  ITVNGQFPGPTLEVRNGD+L I VIN 
Sbjct  24   CTFLASLASAELHVREFVIEAKPVKRLCRTHQTITVNGQFPGPTLEVRNGDSLAITVINK  83

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN +LHWHG+RQ+ + WADGP YITQCPIQPG  YTYR  I+ QEGTLWWHAH+ WLR
Sbjct  84   ARYNISLHWHGLRQLRNPWADGPEYITQCPIQPGQSYTYRIKIEDQEGTLWWHAHSHWLR  143

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++IYPRLG PYPF  P ++IPI+LGEWW+R+   V+R A FTGAAPNVSDAYTI
Sbjct  144  ATVYGALIIYPRLGSPYPFSMPKRDIPIILGEWWDRNPMDVLRLAQFTGAAPNVSDAYTI  203

Query  592  NGWPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C +  T +  +  GETV LR+INAALNQ+LFF+VANH  TVVEVD+ YTKP
Sbjct  204  NGQPGDLYRCSKPETLRFPIVPGETVQLRLINAALNQELFFTVANHPLTVVEVDSAYTKP  263

Query  769  FSSNVIMLGPGQ  804
            F++NV+MLGPGQ
Sbjct  264  FTTNVVMLGPGQ  275



>ref|XP_009354572.1| PREDICTED: laccase-3-like [Pyrus x bretschneideri]
Length=569

 Score =   376 bits (965),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 166/248 (67%), Positives = 206/248 (83%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+F + E H+HEF++ A P +RLC+TH+ ITVNGQFPGPTLEVRNGD++ ++V N A+YN
Sbjct  20   ASFSAAEDHFHEFIVEAKPVRRLCRTHTTITVNGQFPGPTLEVRNGDSVAVQVTNRAKYN  79

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG++Q  + WADGP Y+TQCPIQPGA YTYRFTI  QEGTLWWHAH+RWLRATVY
Sbjct  80   ITIHWHGLKQQRNPWADGPEYVTQCPIQPGATYTYRFTITDQEGTLWWHAHSRWLRATVY  139

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYPRLG PYPF  P +E+P+LLGEW++R+   V R A FTG APNVSDAYTING P
Sbjct  140  GALIIYPRLGSPYPFSMPKQEVPLLLGEWFDRNPLDVQRLAAFTGGAPNVSDAYTINGQP  199

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C +  T ++ V++GE++LLRV+N+ALNQ+LFF+VANH  TVV  DA YTKPF++ 
Sbjct  200  GDLYRCSKQETIRIPVESGESLLLRVVNSALNQELFFTVANHQLTVVSADAAYTKPFTTR  259

Query  781  VIMLGPGQ  804
            VIMLGPGQ
Sbjct  260  VIMLGPGQ  267



>ref|XP_008384707.1| PREDICTED: laccase-3-like [Malus domestica]
Length=567

 Score =   375 bits (964),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 170/247 (69%), Positives = 205/247 (83%), Gaps = 1/247 (0%)
 Frame = +1

Query  67   TFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNA  246
            +F + E H++EF++ A P  RLC T S ITVNGQFPGPTLEVRNGD++ +KV N ARYN 
Sbjct  21   SFSAAEVHFYEFIVEARPVXRLCXTLSTITVNGQFPGPTLEVRNGDSVAVKVTNRARYNI  80

Query  247  TLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYG  426
            T+HWHG++Q  + WADGP Y+TQCPIQPGA YTYRFTI+ QEGTLWWHAH+RWLRATVYG
Sbjct  81   TIHWHGLKQQNNPWADGPEYVTQCPIQPGATYTYRFTIKDQEGTLWWHAHSRWLRATVYG  140

Query  427  AIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPG  606
            A++IYPRLG PYPFP P +E+PILLGEW++RD   VMR A FTG APNVSDAYTING PG
Sbjct  141  ALIIYPRLGSPYPFPMPKREVPILLGEWFDRDPQDVMRLAAFTGGAPNVSDAYTINGQPG  200

Query  607  DLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNV  783
            DLY C R  T ++ V +GE++LLRVIN+ALNQ+LFF+VANH  TVV  DA+YT+PF++ V
Sbjct  201  DLYRCSRQETIRIPVVSGESLLLRVINSALNQELFFTVANHQLTVVGADASYTRPFTTRV  260

Query  784  IMLGPGQ  804
            IM+GPGQ
Sbjct  261  IMIGPGQ  267



>ref|XP_009144319.1| PREDICTED: laccase-3 [Brassica rapa]
Length=570

 Score =   375 bits (964),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/248 (71%), Positives = 200/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A   S E H  EFVI   P KRLC+TH  ITVNGQFPGPTLEVRNGD+L I VIN ARYN
Sbjct  20   AFLASAELHVREFVIQPKPVKRLCRTHESITVNGQFPGPTLEVRNGDSLAITVINKARYN  79

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             ++HWHGIRQ+ + WADGP YITQCPI+PG  YTYRFTI+ QEGTLWWHAH+RWLRATVY
Sbjct  80   ISIHWHGIRQLRNPWADGPEYITQCPIRPGQSYTYRFTIEDQEGTLWWHAHSRWLRATVY  139

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYPRLG PYPF  P ++IPILLGEWW+R+   V+RQA FTGAA NVSDAYTING P
Sbjct  140  GALIIYPRLGSPYPFHMPKRDIPILLGEWWDRNPMDVLRQAQFTGAAANVSDAYTINGQP  199

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C R  T +  +  GETV LRVINA LNQ+LFFSVANH  TVVE D+ YTKPF+++
Sbjct  200  GDLYRCSRSETVRFPIFPGETVQLRVINAGLNQELFFSVANHQLTVVETDSAYTKPFTTS  259

Query  781  VIMLGPGQ  804
            VIM+GPGQ
Sbjct  260  VIMIGPGQ  267



>ref|NP_180580.1| laccase 3 [Arabidopsis thaliana]
 sp|Q56YT0.2|LAC3_ARATH RecName: Full=Laccase-3; AltName: Full=Benzenediol:oxygen oxidoreductase 
3; AltName: Full=Diphenol oxidase 3; AltName: Full=Urishiol 
oxidase 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC16927.1| putative laccase [Arabidopsis thaliana]
 gb|AAM14916.1| putative laccase [Arabidopsis thaliana]
 gb|AEC08358.1| laccase 3 [Arabidopsis thaliana]
Length=570

 Score =   375 bits (964),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/248 (70%), Positives = 201/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A   S E H H+FVI  TP KRLC+TH  ITVNGQ+PGPTL VRNGD+L I VIN ARYN
Sbjct  20   AFLASAEHHVHQFVITPTPVKRLCRTHQSITVNGQYPGPTLVVRNGDSLAITVINRARYN  79

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             ++HWHGIRQ+ + WADGP YITQCPI+PG  YTYRF I+ QEGTLWWHAH+RWLRATVY
Sbjct  80   ISIHWHGIRQLRNPWADGPEYITQCPIRPGQTYTYRFKIEDQEGTLWWHAHSRWLRATVY  139

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYPRLG PYPF  P ++IPILLGEWW+R+   V++QA FTGAA NVSDAYTING P
Sbjct  140  GALIIYPRLGSPYPFSMPKRDIPILLGEWWDRNPMDVLKQAQFTGAAANVSDAYTINGQP  199

Query  604  GDLYTCHR-GITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C R G  +  +  GETV LRVINA +NQ+LFFSVANH FTVVE D+ YTKPF++N
Sbjct  200  GDLYRCSRAGTIRFPIFPGETVQLRVINAGMNQELFFSVANHQFTVVETDSAYTKPFTTN  259

Query  781  VIMLGPGQ  804
            VIM+GPGQ
Sbjct  260  VIMIGPGQ  267



>ref|XP_011014542.1| PREDICTED: laccase-3-like [Populus euphratica]
Length=631

 Score =   377 bits (968),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/251 (69%), Positives = 204/251 (81%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            S  A+F   ETHYHEFVI A P +RLC+TH+ ITVNG FPGPTLEVR+GD+LVIK IN A
Sbjct  79   SFQASFSEAETHYHEFVIQAKPVRRLCRTHNTITVNGLFPGPTLEVRDGDSLVIKAINNA  138

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            RYN TLHWHG+RQ+ + WADGP  +TQCPI+PG  YTYRFTI+ QEGTLWWHAH+ WLRA
Sbjct  139  RYNVTLHWHGVRQLRNPWADGPDRVTQCPIRPGRSYTYRFTIENQEGTLWWHAHSSWLRA  198

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGA++I+P+LG PY FP P +EIPILLGEWW+R+   V+R A FTGAAPNVSDAYTIN
Sbjct  199  TVYGALIIHPKLGSPYSFPMPRREIPILLGEWWDRNPMDVLRLADFTGAAPNVSDAYTIN  258

Query  595  GWPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C +  T +  V  GET+LLRVIN+ LNQ+ FF+VANHI TVV VDA +TKPF
Sbjct  259  GQPGDLYRCSKQETVRFPVDPGETILLRVINSGLNQEFFFAVANHILTVVSVDADFTKPF  318

Query  772  SSNVIMLGPGQ  804
            +++ IM+ PGQ
Sbjct  319  ATSFIMIAPGQ  329



>ref|XP_009594351.1| PREDICTED: laccase-12-like [Nicotiana tomentosiformis]
Length=574

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 205/249 (82%), Gaps = 1/249 (0%)
 Frame = +1

Query  61   TATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARY  240
            +A   S +THYH+FVI ATP KRLCKTH+ ITVNGQFPGPTLEV NGDTLV+ V+N ARY
Sbjct  23   SANAASAKTHYHDFVIQATPVKRLCKTHNTITVNGQFPGPTLEVNNGDTLVVNVVNKARY  82

Query  241  NATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATV  420
            N T+HWHG+RQ+ + WADGP ++TQCPI+PG  YTY+FTIQ QEGTLWWHAH+ WLRATV
Sbjct  83   NVTIHWHGVRQMRTGWADGPEFVTQCPIRPGKSYTYQFTIQGQEGTLWWHAHSSWLRATV  142

Query  421  YGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGW  600
            YGA++I+P+ G  YPF KP +E PI+LGEWW+ +   V+R+AT TGAAPNVSDAYTING 
Sbjct  143  YGALIIHPKEGESYPFVKPKRETPIMLGEWWDTNPIDVVRRATRTGAAPNVSDAYTINGQ  202

Query  601  PGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSS  777
            PGDLY C  +  T V V TGET LLRVINAALNQQLFF+VANH  TVV  DA+Y KPF++
Sbjct  203  PGDLYKCSSKDTTTVHVDTGETNLLRVINAALNQQLFFTVANHKLTVVGADASYVKPFTT  262

Query  778  NVIMLGPGQ  804
            +V+MLGPGQ
Sbjct  263  SVLMLGPGQ  271



>ref|XP_006355635.1| PREDICTED: laccase-5-like [Solanum tuberosum]
Length=574

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/248 (69%), Positives = 203/248 (82%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A   S +THYH+FVI ATP KRLCKTH+ ITVNGQFPGPTLEV NGDTLV+ V+N ARYN
Sbjct  24   ANAASAKTHYHDFVIQATPVKRLCKTHNSITVNGQFPGPTLEVNNGDTLVVNVVNRARYN  83

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG+RQ+ + W+DGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVY
Sbjct  84   VTIHWHGVRQMRTAWSDGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVY  143

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++I+P+ G  YPFPKP +E P+LLGEWW+ +   V+R+AT TGAAPNVSDAYTING P
Sbjct  144  GALIIHPKQGENYPFPKPKRETPVLLGEWWDTNPIDVVRRATRTGAAPNVSDAYTINGQP  203

Query  604  GDLYTCHR-GITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C +   T V + +GET LLRVINA LNQQLFF+VANH  TVV  DA Y KPF+++
Sbjct  204  GDLYKCSKQDTTIVHMDSGETNLLRVINAGLNQQLFFTVANHKLTVVGADANYVKPFTTS  263

Query  781  VIMLGPGQ  804
            V+MLGPGQ
Sbjct  264  VLMLGPGQ  271



>ref|XP_010424027.1| PREDICTED: laccase-3-like [Camelina sativa]
Length=557

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/248 (70%), Positives = 200/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A   S E H  +FVIA  P  RLC+TH  ITVNGQFPGPTLEVRNGD++ I VIN ARYN
Sbjct  20   AFLASAEHHVRQFVIAPRPVTRLCRTHQSITVNGQFPGPTLEVRNGDSVAITVINRARYN  79

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             ++HWHG+RQ+ + WADGP YITQCPI+PG  YTY+FTI+ QEGTLWWHAH+RWLRATVY
Sbjct  80   ISIHWHGLRQMRNPWADGPEYITQCPIRPGQSYTYKFTIEDQEGTLWWHAHSRWLRATVY  139

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYPRLG PYPF  P ++IPILLGEWW+R+   V+RQA FTGAA NVSDAYTING P
Sbjct  140  GALIIYPRLGSPYPFSMPKRDIPILLGEWWDRNPMDVLRQAQFTGAAANVSDAYTINGQP  199

Query  604  GDLYTCHR-GITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C R G  +  +  GETV LRVINA +NQ+LFFSVANH  TVVE D+ YTKPF++N
Sbjct  200  GDLYRCSRAGTMRFPIFPGETVQLRVINAGMNQELFFSVANHQLTVVETDSAYTKPFTTN  259

Query  781  VIMLGPGQ  804
            VIMLGPGQ
Sbjct  260  VIMLGPGQ  267



>ref|XP_009611705.1| PREDICTED: laccase-12-like [Nicotiana tomentosiformis]
Length=574

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/243 (71%), Positives = 202/243 (83%), Gaps = 1/243 (0%)
 Frame = +1

Query  79   GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHW  258
            G+THYH+FVI ATP KRLCKTH+ ITVNGQFPGPTLEV NGDTLV+ V+N ARYN T+HW
Sbjct  29   GKTHYHDFVIQATPVKRLCKTHNTITVNGQFPGPTLEVNNGDTLVVNVVNKARYNVTIHW  88

Query  259  HGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVI  438
            HG+RQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYGA++I
Sbjct  89   HGVRQMRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALII  148

Query  439  YPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYT  618
            +P+ G  YPF KP +E PI+LGEWW+ +   V+RQAT TGAAPNVSDAYTING PGDLY 
Sbjct  149  HPKEGESYPFAKPKRETPIMLGEWWDANPIDVIRQATRTGAAPNVSDAYTINGQPGDLYK  208

Query  619  C-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLG  795
            C  +  T V V  GET LLRVINAALNQQLFF+VANH  TVV  DA+Y KPF+++V+MLG
Sbjct  209  CSSQDTTIVPVDAGETNLLRVINAALNQQLFFTVANHKLTVVGADASYVKPFTTSVLMLG  268

Query  796  PGQ  804
            PGQ
Sbjct  269  PGQ  271



>ref|XP_006350924.1| PREDICTED: laccase-3-like [Solanum tuberosum]
Length=571

 Score =   375 bits (963),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/251 (69%), Positives = 202/251 (80%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            S  +TF + E HYHEF++  T   RLC+T +IITVNGQFPGPTL VRNGDTL + V+N A
Sbjct  14   SLLSTFANAEFHYHEFIVQETSVTRLCRTKNIITVNGQFPGPTLTVRNGDTLFVTVVNRA  73

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            RYN T+HWHGIRQ+ + WADGP Y+TQCPI+PG  YTYRFTI+ QEGTLWWHAH++WLRA
Sbjct  74   RYNVTIHWHGIRQMRTPWADGPEYVTQCPIRPGGFYTYRFTIENQEGTLWWHAHSKWLRA  133

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGA+VI P+ G  +PF  P K+ P+LLGEWW RDI  V RQA FTGAAPN SDAYTIN
Sbjct  134  TVYGALVILPKQGSNFPFSLPQKDFPVLLGEWWNRDIIVVQRQAQFTGAAPNNSDAYTIN  193

Query  595  GWPGDLYTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C  +G  K  V  GE+VLLRVINAALNQQLFFSVANH+ TVV +DATY KPF
Sbjct  194  GQPGDLYRCSTQGTVKYLVNPGESVLLRVINAALNQQLFFSVANHMLTVVGIDATYNKPF  253

Query  772  SSNVIMLGPGQ  804
            ++NVIM+GPGQ
Sbjct  254  TTNVIMVGPGQ  264



>ref|XP_002881090.1| hypothetical protein ARALYDRAFT_481932 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57349.1| hypothetical protein ARALYDRAFT_481932 [Arabidopsis lyrata subsp. 
lyrata]
Length=570

 Score =   375 bits (962),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 175/248 (71%), Positives = 201/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A   S E H  +FVI  TP KRLC+TH  ITVNGQFPGPTL VRNGD+L I VIN ARYN
Sbjct  20   AFLASAEHHVQQFVIIPTPVKRLCRTHQSITVNGQFPGPTLIVRNGDSLAITVINRARYN  79

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             ++HWHGIRQ+ + WADGP YITQCPI+PG  YTYRF I+ QEGTLWWHAH+RWLRATVY
Sbjct  80   ISIHWHGIRQLRNPWADGPEYITQCPIRPGQSYTYRFKIEDQEGTLWWHAHSRWLRATVY  139

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYPRLG PYPF  P ++IPILLGEWW+R+   V+RQA FTGAA NVSDAYTING P
Sbjct  140  GALIIYPRLGSPYPFSMPKRDIPILLGEWWDRNPMDVLRQAQFTGAAANVSDAYTINGQP  199

Query  604  GDLYTCHR-GITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C R G  +  +  GETV LRVINAA+NQ+LFFSVANH FTVVE D+ YTKPF+++
Sbjct  200  GDLYRCSRAGTIRFPIFPGETVQLRVINAAMNQELFFSVANHQFTVVETDSAYTKPFTTS  259

Query  781  VIMLGPGQ  804
            VIM+GPGQ
Sbjct  260  VIMIGPGQ  267



>ref|XP_009628839.1| PREDICTED: laccase-12-like isoform X2 [Nicotiana tomentosiformis]
Length=574

 Score =   374 bits (961),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 174/242 (72%), Positives = 203/242 (84%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            +TH+H+FVI ATP KRLC TH+ ITVNGQFPGPTLEV NGDTLV+KV+N A+YN T+HWH
Sbjct  30   KTHHHDFVIQATPVKRLCMTHNTITVNGQFPGPTLEVNNGDTLVVKVVNKAQYNVTIHWH  89

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQI + WADGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYGA++I+
Sbjct  90   GVRQIRTGWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIH  149

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P+ G  YPFPKP +E PILLGEWW+ +   V+R+AT TGAAPNVSDAYTING PGDLY C
Sbjct  150  PKEGDSYPFPKPKRETPILLGEWWDANPIDVIRRATRTGAAPNVSDAYTINGQPGDLYKC  209

Query  622  -HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
              +  T V V +GET LLRVINAALNQQLFFSVANH  TVV  DA+Y KPF+++V+MLGP
Sbjct  210  SSQDTTIVPVDSGETNLLRVINAALNQQLFFSVANHKLTVVGADASYVKPFTTSVLMLGP  269

Query  799  GQ  804
            GQ
Sbjct  270  GQ  271



>ref|XP_004500523.1| PREDICTED: laccase-12-like [Cicer arietinum]
Length=572

 Score =   374 bits (961),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 171/244 (70%), Positives = 202/244 (83%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + +TH HEFV+ ATP KRLCKTH+ ITVNGQ+PGPTLE+ NGD+LVIKV N ARYN T+H
Sbjct  32   NAKTHNHEFVVEATPVKRLCKTHNTITVNGQYPGPTLEINNGDSLVIKVTNKARYNVTIH  91

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHGIRQ+ + WADGP +ITQCPI+PG  YTYRFT++ QEGTLWWHAH+ WLRATVYGA++
Sbjct  92   WHGIRQMRTGWADGPEFITQCPIRPGGSYTYRFTVEGQEGTLWWHAHSSWLRATVYGALI  151

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I PR G  YPFPKP++E PILLGEWW+R+   V+RQA  TGAAPNVSDAYTING PGDLY
Sbjct  152  IRPREGETYPFPKPNRETPILLGEWWDRNPIDVVRQAQRTGAAPNVSDAYTINGQPGDLY  211

Query  616  TCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +G T V ++ GET L+RVINAALNQ LFF +ANH  TVV  DA+Y KPF++NV+ML
Sbjct  212  KCSTKGTTIVPIRYGETNLIRVINAALNQPLFFKIANHKLTVVGADASYLKPFTTNVLML  271

Query  793  GPGQ  804
            GPGQ
Sbjct  272  GPGQ  275



>ref|XP_009628838.1| PREDICTED: laccase-12-like isoform X1 [Nicotiana tomentosiformis]
Length=596

 Score =   375 bits (963),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 174/242 (72%), Positives = 203/242 (84%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            +TH+H+FVI ATP KRLC TH+ ITVNGQFPGPTLEV NGDTLV+KV+N A+YN T+HWH
Sbjct  30   KTHHHDFVIQATPVKRLCMTHNTITVNGQFPGPTLEVNNGDTLVVKVVNKAQYNVTIHWH  89

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQI + WADGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYGA++I+
Sbjct  90   GVRQIRTGWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIH  149

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P+ G  YPFPKP +E PILLGEWW+ +   V+R+AT TGAAPNVSDAYTING PGDLY C
Sbjct  150  PKEGDSYPFPKPKRETPILLGEWWDANPIDVIRRATRTGAAPNVSDAYTINGQPGDLYKC  209

Query  622  -HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
              +  T V V +GET LLRVINAALNQQLFFSVANH  TVV  DA+Y KPF+++V+MLGP
Sbjct  210  SSQDTTIVPVDSGETNLLRVINAALNQQLFFSVANHKLTVVGADASYVKPFTTSVLMLGP  269

Query  799  GQ  804
            GQ
Sbjct  270  GQ  271



>ref|XP_009771638.1| PREDICTED: laccase-12-like [Nicotiana sylvestris]
Length=578

 Score =   374 bits (961),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 174/247 (70%), Positives = 200/247 (81%), Gaps = 1/247 (0%)
 Frame = +1

Query  67   TFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNA  246
            +    + H H+FVI ATP KRLC T S ITVNGQFPGPTLEV NGDTLV+KV+N A+YN 
Sbjct  29   SLAKAKIHNHDFVIQATPVKRLCNTRSTITVNGQFPGPTLEVNNGDTLVVKVVNKAQYNV  88

Query  247  TLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYG  426
            T+HWHG+RQ+ + WADGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYG
Sbjct  89   TIHWHGVRQMRTAWADGPEFITQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVYG  148

Query  427  AIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPG  606
            A+VI+P+ G  YPFPKP +E PILLGEWW+ +   V+RQAT TGAAPNVSDAYTING PG
Sbjct  149  ALVIHPKEGTSYPFPKPKRETPILLGEWWDANPIDVIRQATRTGAAPNVSDAYTINGQPG  208

Query  607  DLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNV  783
            DLY C  +  T V V +GET LLRVINA LNQQLFF VANH FTVV  DA+Y KPF+++V
Sbjct  209  DLYKCSSQDTTIVHVDSGETNLLRVINAGLNQQLFFKVANHKFTVVGADASYVKPFTTSV  268

Query  784  IMLGPGQ  804
            IMLGPGQ
Sbjct  269  IMLGPGQ  275



>ref|XP_010685886.1| PREDICTED: laccase-3-like [Beta vulgaris subsp. vulgaris]
Length=573

 Score =   374 bits (960),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 173/251 (69%), Positives = 202/251 (80%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            S  A   + E HYH+FV+   P KRLCKTH I+TVNG+FPGPTLE+R+GDT+VIKV NA 
Sbjct  20   SFVACLANAEIHYHDFVVQPAPVKRLCKTHHILTVNGEFPGPTLEIRDGDTVVIKVTNAG  79

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            +YN TLHWHGIRQ+ + WADGPAY+TQCPI+PG  YTY+FTI++QEGTLWWHAH  WLRA
Sbjct  80   KYNITLHWHGIRQMRTPWADGPAYVTQCPIRPGETYTYKFTIEEQEGTLWWHAHIYWLRA  139

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGAIVIYP+LG  YPF  P +E PILLGEWW RD  S+++QA  TG APNVSDAYTIN
Sbjct  140  TVYGAIVIYPKLGSSYPFSHPAREFPILLGEWWNRDSMSILQQALNTGIAPNVSDAYTIN  199

Query  595  GWPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C    T    V+ GET+LLR+INAALNQQLFF++ANH  TVV  DA YTKPF
Sbjct  200  GQPGDLYQCSSTDTITFFVEAGETILLRIINAALNQQLFFAIANHQMTVVSADAAYTKPF  259

Query  772  SSNVIMLGPGQ  804
            ++NVIM+GPGQ
Sbjct  260  TTNVIMIGPGQ  270



>ref|XP_010414291.1| PREDICTED: laccase-3 [Camelina sativa]
 ref|XP_010469882.1| PREDICTED: laccase-3 [Camelina sativa]
Length=572

 Score =   374 bits (959),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 173/248 (70%), Positives = 200/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A   S E H  +FVIA  P  RLC+TH  ITVNGQFPGPTLEVRNGD++ I VIN ARYN
Sbjct  20   AFLASAEHHVRQFVIAPRPVTRLCRTHQSITVNGQFPGPTLEVRNGDSVAITVINRARYN  79

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             ++HWHG+RQ+ + WADGP YITQCPI+PG  YTY+FTI+ QEGTLWWHAH+RWLRATVY
Sbjct  80   ISIHWHGLRQMRNPWADGPEYITQCPIRPGQSYTYKFTIEDQEGTLWWHAHSRWLRATVY  139

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYPRLG PYPF  P ++IPILLGEWW+R+   V+RQA FTGAA NVSDAYTING P
Sbjct  140  GALIIYPRLGSPYPFSMPKRDIPILLGEWWDRNPMDVLRQAQFTGAAANVSDAYTINGQP  199

Query  604  GDLYTCHR-GITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C R G  +  +  GETV LRVINA +NQ+LFFSVANH  TVVE D+ YTKPF++N
Sbjct  200  GDLYRCSRAGTMRFPIFPGETVQLRVINAGMNQELFFSVANHQLTVVETDSAYTKPFTTN  259

Query  781  VIMLGPGQ  804
            VIMLGPGQ
Sbjct  260  VIMLGPGQ  267



>ref|XP_004239961.1| PREDICTED: laccase-12-like [Solanum lycopersicum]
Length=574

 Score =   374 bits (959),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/248 (69%), Positives = 203/248 (82%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A   S +TH+H+FVI ATP KRLCKTH+ ITVNGQFPGPTLEV NGDTLV+ V+N ARYN
Sbjct  24   ANVASAKTHHHDFVIQATPVKRLCKTHNSITVNGQFPGPTLEVNNGDTLVVNVVNRARYN  83

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG+RQ+ + WADGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVY
Sbjct  84   VTIHWHGVRQMRTGWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVY  143

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++I+P+ G  YPFPKP +E PI+LGEWW+ +   V+R+AT TGAAPNVSDAYTING P
Sbjct  144  GALIIHPKEGGNYPFPKPKRETPIVLGEWWDTNPIDVVRRATRTGAAPNVSDAYTINGQP  203

Query  604  GDLYTCHR-GITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C +   T V + +GET LLRVINA LNQQLFF+VANH  TVV  DA Y KPF+++
Sbjct  204  GDLYKCSKQDTTIVHIDSGETNLLRVINAGLNQQLFFTVANHKLTVVGADANYVKPFTTS  263

Query  781  VIMLGPGQ  804
            V+MLGPGQ
Sbjct  264  VLMLGPGQ  271



>ref|XP_009598627.1| PREDICTED: laccase-12-like [Nicotiana tomentosiformis]
Length=578

 Score =   374 bits (959),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/247 (70%), Positives = 200/247 (81%), Gaps = 1/247 (0%)
 Frame = +1

Query  67   TFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNA  246
            +    + H H+FVI ATP KRLC T S ITVNGQFPGPTLEV NGDTLV+KV+N A+YN 
Sbjct  29   SLAKAKIHNHDFVIQATPVKRLCNTRSTITVNGQFPGPTLEVNNGDTLVVKVVNRAQYNV  88

Query  247  TLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYG  426
            T+HWHG+RQ+ + WADGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYG
Sbjct  89   TIHWHGVRQMRTAWADGPEFITQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVYG  148

Query  427  AIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPG  606
            A+VI+P+ G  YPFPKP +E PILLGEWW+ +   V+RQAT TGAAPNVSDAYTING PG
Sbjct  149  ALVIHPKEGTSYPFPKPKRETPILLGEWWDANPIDVIRQATRTGAAPNVSDAYTINGQPG  208

Query  607  DLYTCHRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNV  783
            DLY C    T  V V +GET LLRVINA LNQQLFF+VANH FTVV  DA+Y KPF+++V
Sbjct  209  DLYKCSSQDTMIVHVDSGETNLLRVINAGLNQQLFFTVANHKFTVVGADASYVKPFTTSV  268

Query  784  IMLGPGQ  804
            IMLGPGQ
Sbjct  269  IMLGPGQ  275



>emb|CDX97838.1| BnaC04g41010D [Brassica napus]
Length=570

 Score =   373 bits (958),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/248 (71%), Positives = 199/248 (80%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A   S E H  EFVI   P KRLC+TH  ITVNGQFPGPTLEVRNGD+L I VIN ARYN
Sbjct  20   AFLASAELHVREFVIEPKPVKRLCRTHQSITVNGQFPGPTLEVRNGDSLAITVINRARYN  79

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             ++HWHGIRQ+ + WADGP YITQCPI+PG  YTYRFTI+ QEGTLWWHAH+RWLRATVY
Sbjct  80   ISIHWHGIRQLRNPWADGPEYITQCPIRPGQSYTYRFTIEDQEGTLWWHAHSRWLRATVY  139

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYPRLG PYPF  P ++IPILLGEWW+R+   V+R A FTGAA NVSDAYTING P
Sbjct  140  GALIIYPRLGSPYPFSMPKRDIPILLGEWWDRNPMDVLRLAQFTGAAANVSDAYTINGQP  199

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C R  T +  +  GETV LRVINA LNQ+LFFSVANH  TVVE D+ YTKPF+++
Sbjct  200  GDLYRCSRAETVRFPIFPGETVQLRVINAGLNQELFFSVANHQLTVVETDSAYTKPFTTS  259

Query  781  VIMLGPGQ  804
            VIM+GPGQ
Sbjct  260  VIMIGPGQ  267



>ref|XP_004240885.1| PREDICTED: laccase-5-like [Solanum lycopersicum]
Length=567

 Score =   373 bits (958),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 170/248 (69%), Positives = 202/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+    + HYH+FVI ATP KRLC THS ITVNGQFPGPTLEV NGDTLV+KV+N A+YN
Sbjct  17   ASLAKAKVHYHDFVIQATPVKRLCNTHSTITVNGQFPGPTLEVNNGDTLVVKVVNRAQYN  76

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG+RQ+ + WADGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRAT Y
Sbjct  77   VTIHWHGVRQMRTAWADGPEFITQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATAY  136

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA+VI+P+ G  YPFPKP ++ PILLGEWW+ +   V+RQAT TGAAPN SDAYTING P
Sbjct  137  GALVIHPKEGTTYPFPKPKRQTPILLGEWWDANPIDVIRQATRTGAAPNSSDAYTINGQP  196

Query  604  GDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C ++  T V V +GET LLRVIN+ LNQQLFF+VANH  TVV  DA+Y KPF+++
Sbjct  197  GDLYKCSNQDTTIVHVDSGETNLLRVINSGLNQQLFFTVANHKLTVVGADASYVKPFTTS  256

Query  781  VIMLGPGQ  804
            V+MLGPG+
Sbjct  257  VLMLGPGE  264



>ref|XP_009804480.1| PREDICTED: laccase-12-like isoform X1 [Nicotiana sylvestris]
Length=587

 Score =   374 bits (959),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/246 (71%), Positives = 203/246 (83%), Gaps = 1/246 (0%)
 Frame = +1

Query  70   FLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNAT  249
            F + +T YH FVI ATP KRLCKTH+ ITVNGQFPGPTLEV NGDTLVI V+N ARYN T
Sbjct  39   FANAKTQYHHFVIQATPVKRLCKTHNTITVNGQFPGPTLEVNNGDTLVINVVNRARYNVT  98

Query  250  LHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGA  429
            +HWHG++QI + WADGP +ITQCPI+PG  YTYRFTIQ+QEGTLWWHAH+ WLRATVYGA
Sbjct  99   IHWHGVKQIRTAWADGPEFITQCPIRPGGSYTYRFTIQEQEGTLWWHAHSSWLRATVYGA  158

Query  430  IVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGD  609
            ++I+P+ G  YPFP P +E PILLGEWW+ +   V+RQAT TGAAPNVSDAYTING PGD
Sbjct  159  LIIHPKEGEFYPFPNPRRETPILLGEWWDANPIDVVRQATRTGAAPNVSDAYTINGQPGD  218

Query  610  LYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVI  786
            LY C  +  T V V +GET LLRVINAALNQQLFF+VANH  TVV  DA+Y +PF+++V+
Sbjct  219  LYRCSSKDTTIVLVDSGETSLLRVINAALNQQLFFTVANHKLTVVGADASYVQPFTTSVL  278

Query  787  MLGPGQ  804
            MLGPGQ
Sbjct  279  MLGPGQ  284



>ref|XP_006350864.1| PREDICTED: laccase-3-like [Solanum tuberosum]
Length=568

 Score =   373 bits (957),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 170/251 (68%), Positives = 203/251 (81%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            S  + F + E+H H+F +  T   RLC+T +IITVNGQFPGPTL VRNGDT+V+ V+N A
Sbjct  20   SLLSYFANAESHKHDFTVQQTRVTRLCRTKNIITVNGQFPGPTLTVRNGDTVVVTVVNRA  79

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            RYN T+HWHGIRQ+ + WADGP Y+TQCPI+PG  YTYRFTI+ QEGTLWWHAH++WLRA
Sbjct  80   RYNVTIHWHGIRQMRTPWADGPEYVTQCPIRPGGSYTYRFTIENQEGTLWWHAHSKWLRA  139

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGA+VI P+ G  +PF  P K+ P++LGEWW RDI +V RQA FTGAAPN+SDAYTIN
Sbjct  140  TVYGALVILPKQGSNFPFSLPQKDFPVILGEWWNRDIIAVQRQAQFTGAAPNISDAYTIN  199

Query  595  GWPGDLYTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C  +G  K  V  GE+VLLRVINAALNQQLFFSVANH+ TVV +DATY KPF
Sbjct  200  GQPGDLYRCSTQGTVKYSVNPGESVLLRVINAALNQQLFFSVANHMLTVVGIDATYNKPF  259

Query  772  SSNVIMLGPGQ  804
            ++NVIM+GPGQ
Sbjct  260  TTNVIMVGPGQ  270



>ref|XP_010510393.1| PREDICTED: laccase-3-like [Camelina sativa]
Length=572

 Score =   373 bits (958),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/248 (70%), Positives = 200/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A   S E H  +FVIA  P  RLC+TH  ITVNGQFPGPTLEVRNGD++ I VIN ARYN
Sbjct  20   AFLASAEHHVRQFVIAPRPVTRLCRTHQSITVNGQFPGPTLEVRNGDSVAITVINRARYN  79

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             ++HWHG+RQ+ + WADGP YITQCPI+PG  YTY+FTI+ QEGTLWWHAH+RWLRATVY
Sbjct  80   ISIHWHGLRQMRNPWADGPEYITQCPIRPGQSYTYKFTIEDQEGTLWWHAHSRWLRATVY  139

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYPRLG PYPF  P ++IPILLGEWW+R+   V+RQA FTGAA NVSDAYTING P
Sbjct  140  GALIIYPRLGSPYPFVMPKRDIPILLGEWWDRNPMDVLRQAQFTGAAANVSDAYTINGQP  199

Query  604  GDLYTCHR-GITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C R G  +  +  GETV LRVINA +NQ+LFFSVANH  TVVE D+ YTKPF++N
Sbjct  200  GDLYRCSRAGTMRFPIFPGETVQLRVINAGMNQELFFSVANHQLTVVETDSAYTKPFTTN  259

Query  781  VIMLGPGQ  804
            VIMLGPGQ
Sbjct  260  VIMLGPGQ  267



>ref|XP_010685889.1| PREDICTED: laccase-3-like [Beta vulgaris subsp. vulgaris]
Length=569

 Score =   373 bits (957),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 169/247 (68%), Positives = 200/247 (81%), Gaps = 1/247 (0%)
 Frame = +1

Query  67   TFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNA  246
            +F +G+THYHEF I  T   RLCKT  I+TVNGQFPGPTL V NGDTLVIKV NA +Y+ 
Sbjct  23   SFTNGKTHYHEFDIQPTAVNRLCKTQQIMTVNGQFPGPTLRVHNGDTLVIKVKNAGKYDI  82

Query  247  TLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYG  426
            +LHWHG+RQ+ + WADGP Y+TQCPI+PG  YTYRFTI+ QEGTLWWHAH++WLRATVYG
Sbjct  83   SLHWHGVRQMRNPWADGPEYVTQCPIKPGGTYTYRFTIENQEGTLWWHAHSKWLRATVYG  142

Query  427  AIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPG  606
            A++IYP+ G  YPFPKP +E P++LGEWW RD   V+RQAT TGAAPNVSDAYTIN  PG
Sbjct  143  ALIIYPKPGSSYPFPKPAREFPLILGEWWNRDPMQVLRQATITGAAPNVSDAYTINSQPG  202

Query  607  DLYTCHRGITKV-QVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNV  783
            DLY C +  T +  V  GET+LLR+INAALNQQLFF++ANH  TVVE DA Y KPF++NV
Sbjct  203  DLYGCSKKDTTIFPVAAGETILLRIINAALNQQLFFAIANHQMTVVEADAAYNKPFTTNV  262

Query  784  IMLGPGQ  804
            IM+ PGQ
Sbjct  263  IMIAPGQ  269



>ref|XP_006355638.1| PREDICTED: laccase-12-like [Solanum tuberosum]
Length=574

 Score =   373 bits (957),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/248 (70%), Positives = 201/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A   S +THYH+FVI ATP KRLCKT + ITVNGQ+PGPTLEV NGDTLV+ V+N ARYN
Sbjct  24   ANAASEKTHYHDFVIQATPVKRLCKTSNAITVNGQYPGPTLEVNNGDTLVVNVVNKARYN  83

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG+RQ+ + WADGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVY
Sbjct  84   VTIHWHGVRQMRTAWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVY  143

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++I+P+ G  YPFPKP +E PILLGEWW  +   V+RQAT TGAAPNVSDAYTING P
Sbjct  144  GALIIHPKEGGNYPFPKPKRETPILLGEWWNTNPIDVVRQATRTGAAPNVSDAYTINGQP  203

Query  604  GDLYTCHR-GITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C R   T V + +GET LLRVINA LNQQLFF+VANH  TVV  DA Y KPF+++
Sbjct  204  GDLYKCSRQDTTIVHMDSGETNLLRVINAGLNQQLFFTVANHKLTVVGADANYVKPFTTS  263

Query  781  VIMLGPGQ  804
            V+MLGPGQ
Sbjct  264  VLMLGPGQ  271



>ref|XP_006355637.1| PREDICTED: laccase-12-like [Solanum tuberosum]
Length=573

 Score =   373 bits (957),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/248 (70%), Positives = 203/248 (82%), Gaps = 2/248 (1%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A   S +THYH+FVI ATP KRLCKTH+ ITVNGQFPGPTLEV NGDTLV+KV+N ARYN
Sbjct  24   ADAASAKTHYHDFVIQATPVKRLCKTHNTITVNGQFPGPTLEVNNGDTLVVKVVNRARYN  83

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG+RQ+ + WADGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVY
Sbjct  84   VTIHWHGVRQMRTAWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVY  143

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++I+P+ G  YPFPKP +E PILLGEWW  +   V+R+AT TGAAPNVSDAYTING P
Sbjct  144  GALIIHPK-GGSYPFPKPKRETPILLGEWWNANPIDVVREATRTGAAPNVSDAYTINGQP  202

Query  604  GDLYTCHRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C    T  V   +GET LLRVINA +NQ+LFF+VANH FTVV  DA+Y KPF+++
Sbjct  203  GDLYKCSSQDTNIVHTDSGETNLLRVINAGMNQELFFTVANHKFTVVGADASYVKPFTTS  262

Query  781  VIMLGPGQ  804
            V+MLGPGQ
Sbjct  263  VLMLGPGQ  270



>emb|CDP09253.1| unnamed protein product [Coffea canephora]
Length=1557

 Score =   393 bits (1009),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 183/252 (73%), Positives = 209/252 (83%), Gaps = 2/252 (1%)
 Frame = +1

Query  55    SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
             +  A+  +GE HYHEFV+ A    RLC THSIITVNGQFPGPTL VRNGDTLVI+V+N A
Sbjct  1007  AAVASHPNGEIHYHEFVVQAKSVTRLCSTHSIITVNGQFPGPTLAVRNGDTLVIRVLNRA  1066

Query  235   RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
              YN TLHWHG+RQ+ + WADGP Y+TQCPIQPG  YTYRFTI+ QEGTLWWHAH+RWLRA
Sbjct  1067  PYNVTLHWHGVRQMRTPWADGPEYVTQCPIQPGGTYTYRFTIENQEGTLWWHAHSRWLRA  1126

Query  415   TVYGAIVIYPRLGVPYPFPKPDKEIPILL-GEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
             TVYGA+VI+P+ G  YPF KP  ++PI+L GEWW+RDI SVMRQA FTGAAPNVSDAYTI
Sbjct  1127  TVYGALVIFPKQGFAYPFAKPKLDVPIILAGEWWKRDIISVMRQALFTGAAPNVSDAYTI  1186

Query  592   NGWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
             NG PGDLY C +RG  KV V +G+TVLLRVINAALNQQLFF++ANH  TVV  DA+Y KP
Sbjct  1187  NGQPGDLYRCSNRGTFKVYVNSGDTVLLRVINAALNQQLFFTIANHQLTVVGADASYLKP  1246

Query  769   FSSNVIMLGPGQ  804
             FS+ VIMLGPGQ
Sbjct  1247  FSTRVIMLGPGQ  1258



>ref|XP_002273875.2| PREDICTED: laccase-12 [Vitis vinifera]
 emb|CBI25418.3| unnamed protein product [Vitis vinifera]
Length=577

 Score =   373 bits (957),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 169/246 (69%), Positives = 202/246 (82%), Gaps = 1/246 (0%)
 Frame = +1

Query  70   FLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNAT  249
            F   ETH+H+FV+ ATP KRLCKTH+ ITVNGQ+PGPTLE+ NGDTL +KV N ARYN T
Sbjct  28   FTEAETHHHDFVVQATPVKRLCKTHNTITVNGQYPGPTLEINNGDTLEVKVTNKARYNVT  87

Query  250  LHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGA  429
            +HWHGIRQ+ + WADGP ++TQCPI+PG  YTYRFT+Q QEGTLWWHAH+ WLRATVYGA
Sbjct  88   IHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTVQGQEGTLWWHAHSSWLRATVYGA  147

Query  430  IVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGD  609
            ++I+P+ G  YPF KP +E PILLGEWW+ +   V+RQAT TGAAPNVSDAYTING PGD
Sbjct  148  LIIHPKPGSSYPFTKPKRETPILLGEWWDANPIDVVRQATRTGAAPNVSDAYTINGQPGD  207

Query  610  LYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVI  786
            LY C  +    V + +GET LLRVIN+ LNQ+LFF+VANH FTVV  DA+YTKPF+++VI
Sbjct  208  LYNCSSKDTVIVPIDSGETNLLRVINSGLNQELFFTVANHKFTVVSADASYTKPFTTSVI  267

Query  787  MLGPGQ  804
            MLGPGQ
Sbjct  268  MLGPGQ  273



>ref|XP_006367545.1| PREDICTED: laccase-5-like [Solanum tuberosum]
Length=574

 Score =   372 bits (956),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/244 (72%), Positives = 201/244 (82%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + ETHYH+FVI ATP KRLCK H+ ITVNGQFPGPTLEV NGDTLVI V+N ARYN T+H
Sbjct  29   TAETHYHDFVIQATPVKRLCKIHNTITVNGQFPGPTLEVNNGDTLVINVVNRARYNVTIH  88

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHGI+QI + WADGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYGA++
Sbjct  89   WHGIKQIRTAWADGPEFITQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALI  148

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            IYP+ G  YPF KP +E PILLGEWW+ +   V+RQAT TGAAPNVSDAYTING PGDLY
Sbjct  149  IYPKEGEFYPFSKPKRETPILLGEWWDANPIDVVRQATRTGAAPNVSDAYTINGQPGDLY  208

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +  T V V +GET LLRVINAALNQ LFF+VANH  TVV  DA+Y +PF+++V+ML
Sbjct  209  RCSSKDTTVVIVDSGETNLLRVINAALNQALFFAVANHKLTVVAADASYVQPFTTSVLML  268

Query  793  GPGQ  804
            GPGQ
Sbjct  269  GPGQ  272



>ref|XP_002326089.1| hypothetical protein POPTR_0019s14530g [Populus trichocarpa]
 gb|EEF00471.1| hypothetical protein POPTR_0019s14530g [Populus trichocarpa]
Length=576

 Score =   372 bits (956),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 172/242 (71%), Positives = 200/242 (83%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            ETHYHEFVI A P +RLC+TH+ ITVNG FPGPTLEVR+GDTLVIK IN ARYN TLHWH
Sbjct  33   ETHYHEFVIQAKPVRRLCRTHNTITVNGLFPGPTLEVRDGDTLVIKAINNARYNVTLHWH  92

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP  +TQCPIQPG  YTYRFTI+ QEGTLWWHAH+RWLRATVYGA++I+
Sbjct  93   GVRQLRNPWADGPDRVTQCPIQPGRSYTYRFTIENQEGTLWWHAHSRWLRATVYGALIIH  152

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P+LG PY FP P +EIPILLGEWW R+   V+R A FTGAAPNVSDAYTING PGDLY C
Sbjct  153  PKLGSPYSFPMPIREIPILLGEWWVRNPMDVLRLADFTGAAPNVSDAYTINGQPGDLYRC  212

Query  622  HRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
             +  T +  V  GET+LLRVIN+A+NQ+LFF+VANHI TVV VDA  T PF+++ IM+ P
Sbjct  213  SKQETVRFPVDPGETILLRVINSAMNQELFFAVANHILTVVAVDAACTMPFATSFIMIAP  272

Query  799  GQ  804
            GQ
Sbjct  273  GQ  274



>ref|XP_009788692.1| PREDICTED: laccase-12-like [Nicotiana sylvestris]
Length=574

 Score =   372 bits (956),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 170/243 (70%), Positives = 200/243 (82%), Gaps = 1/243 (0%)
 Frame = +1

Query  79   GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHW  258
            G+ HYH+FVI ATP KRLCKTH+ ITVNGQFPGPTLEV NGDTLV+  +N ARYN T+HW
Sbjct  29   GKVHYHDFVIQATPVKRLCKTHNTITVNGQFPGPTLEVNNGDTLVVNAVNKARYNVTIHW  88

Query  259  HGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVI  438
            HG+RQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYGA++I
Sbjct  89   HGVRQMRTAWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALII  148

Query  439  YPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYT  618
            +P+ G  YPF KP +E PI+LGEWW+ +   V+R+AT TGAAPNVSDAYTING PGDLY 
Sbjct  149  HPKEGESYPFAKPKRETPIMLGEWWDTNPIDVVRRATRTGAAPNVSDAYTINGQPGDLYK  208

Query  619  C-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLG  795
            C  +  T V V  GET LLRVINAALNQQLFF+VANH  TVV  DA+Y KPF+++V+MLG
Sbjct  209  CSSKDTTIVHVDAGETNLLRVINAALNQQLFFTVANHKLTVVGADASYVKPFTTSVLMLG  268

Query  796  PGQ  804
            PGQ
Sbjct  269  PGQ  271



>ref|XP_004242502.1| PREDICTED: laccase-3-like [Solanum lycopersicum]
Length=562

 Score =   372 bits (955),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 171/251 (68%), Positives = 202/251 (80%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            S  +TF + E HYHEF++  T   RLC+T +IITVNGQFPGPTL VRNGDTL + V+N A
Sbjct  14   SLLSTFANAEFHYHEFIVQETSVTRLCRTKNIITVNGQFPGPTLTVRNGDTLFVTVVNRA  73

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            RYN T+HWHG+R + + WADGP Y+TQCPI+PG  YTYRFTI+ QEGTLWWHAH++WLRA
Sbjct  74   RYNVTIHWHGVRLMRTPWADGPEYVTQCPIRPGGFYTYRFTIENQEGTLWWHAHSKWLRA  133

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGA+VI P+ G  +PF  P K+ P++LGEWW RDI +V RQA FTGAAPN SDAYTIN
Sbjct  134  TVYGALVILPKQGSNFPFSLPQKDFPVILGEWWNRDIIAVQRQAQFTGAAPNNSDAYTIN  193

Query  595  GWPGDLYTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C  +G  K  V  GE+VLLRVINAALNQQLFFSVANH+ TVV +DATY KPF
Sbjct  194  GQPGDLYRCSTQGTVKYSVNPGESVLLRVINAALNQQLFFSVANHMLTVVGIDATYNKPF  253

Query  772  SSNVIMLGPGQ  804
            ++NVIM+GPGQ
Sbjct  254  TTNVIMVGPGQ  264



>ref|XP_004307184.1| PREDICTED: laccase-12-like [Fragaria vesca subsp. vesca]
Length=575

 Score =   372 bits (955),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 171/252 (68%), Positives = 205/252 (81%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            S+ T+T    + H+HEFV+ ATP KRLCKTH+ ITVNGQFPGPTLEV NGDTLV+KV N 
Sbjct  19   SAMTSTLAEPKAHHHEFVVQATPVKRLCKTHNSITVNGQFPGPTLEVNNGDTLVVKVTNK  78

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
             RYN T+HWHGIRQ+ + WADGP ++TQCPI+PG  YTYRFT+Q QEGTLWWHAH+ WLR
Sbjct  79   GRYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTVQGQEGTLWWHAHSSWLR  138

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGAI+I+P+ G  YPFPKP+++  +LLGEWW+ +   V+RQAT TGAAPNVS+AYTI
Sbjct  139  ATVYGAIIIHPKQGDSYPFPKPNRQETLLLGEWWDANPIDVVRQATRTGAAPNVSNAYTI  198

Query  592  NGWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C  +G   V + +GET LLRV+NAALNQ LFFSVANH  TVV  DA+YTKP
Sbjct  199  NGQPGDLYNCSSKGTVIVPIDSGETNLLRVVNAALNQPLFFSVANHKLTVVGADASYTKP  258

Query  769  FSSNVIMLGPGQ  804
            F++ V+MLGPGQ
Sbjct  259  FTTKVLMLGPGQ  270



>ref|XP_010535350.1| PREDICTED: laccase-13 [Tarenaya hassleriana]
Length=573

 Score =   371 bits (953),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 204/249 (82%), Gaps = 2/249 (1%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            AT +  + HYHEFVI ATP KRLC  H++ITVNGQFPGPTLEV++GDTL I  IN A+YN
Sbjct  17   ATSVITQVHYHEFVIQATPVKRLCIVHNVITVNGQFPGPTLEVQDGDTLAITAINKAQYN  76

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             + HWHGIRQ+ + WADGP YITQCPIQPG  YTYRFTIQ+QEGTLWWHAH+RWLRATVY
Sbjct  77   ISFHWHGIRQVRNPWADGPEYITQCPIQPGGSYTYRFTIQEQEGTLWWHAHSRWLRATVY  136

Query  424  GAIVIYPRLGVPYPFP-KPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGW  600
            GA++I P+LG PYPFP  P +EI +LLGEWW+R+   V++   FTGAAPNVSD++TING 
Sbjct  137  GALIIRPKLGSPYPFPVLPKREITLLLGEWWDRNPMDVLQLTQFTGAAPNVSDSFTINGQ  196

Query  601  PGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSS  777
            PGDLY C +  T K  V +GETVLLR+IN+ALNQ+LFF VANH  TVV  DA+YTKPFS+
Sbjct  197  PGDLYRCSKQETVKYLVNSGETVLLRIINSALNQELFFGVANHKLTVVAADASYTKPFST  256

Query  778  NVIMLGPGQ  804
            NVIM+GPGQ
Sbjct  257  NVIMIGPGQ  265



>gb|AFK35101.1| unknown [Medicago truncatula]
Length=396

 Score =   365 bits (937),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 166/248 (67%), Positives = 200/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+  + + H HEFV+ ATP KRLC T   ITVNGQFPGPTLE+ NGDTLV+KVIN ARYN
Sbjct  16   ASLANAKVHEHEFVVQATPVKRLCNTQMSITVNGQFPGPTLEINNGDTLVVKVINKARYN  75

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG+RQI + WADGP ++TQCPI+PG  YTYRFTI  QEGTLWWHAH+ WLRATVY
Sbjct  76   VTIHWHGVRQIRTGWADGPEFVTQCPIRPGESYTYRFTINGQEGTLWWHAHSSWLRATVY  135

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++I+P+ G  YPF KP +E PILLGEWW+ +   V+RQAT TGAAP++SDAYTING P
Sbjct  136  GALIIHPKEGDAYPFTKPKRETPILLGEWWDANPIDVVRQATQTGAAPDISDAYTINGQP  195

Query  604  GDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C  +G T V + +GET L+RVINAALNQ LFF++ANH  TVV  DA+Y KPF++N
Sbjct  196  GDLYKCSSKGTTIVPIDSGETNLIRVINAALNQPLFFTIANHKLTVVGADASYVKPFTTN  255

Query  781  VIMLGPGQ  804
            V++LGPGQ
Sbjct  256  VLVLGPGQ  263



>ref|XP_009763769.1| PREDICTED: laccase-12-like [Nicotiana sylvestris]
Length=574

 Score =   371 bits (952),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 200/242 (83%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            + HYH FVI ATP KRLCKTH+ ITVNGQFPGPTLEV NGDTLV+ V+N ARYN T+HWH
Sbjct  30   KIHYHNFVIQATPVKRLCKTHNTITVNGQFPGPTLEVNNGDTLVVNVVNKARYNVTIHWH  89

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYGA++I+
Sbjct  90   GVRQMRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIH  149

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P+ G  YPF KP +E PI+LGEWW+ +   V+R+AT TGAAPNVSDAYTING PGDLY C
Sbjct  150  PKEGESYPFAKPKRETPIMLGEWWDANPMDVIRRATRTGAAPNVSDAYTINGQPGDLYKC  209

Query  622  -HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
              +  T V V +GET LLRVINAALNQQLFFSVANH  TVV  DA+Y KPF+++V+MLGP
Sbjct  210  SSQDTTIVPVDSGETNLLRVINAALNQQLFFSVANHKLTVVGADASYVKPFTTSVLMLGP  269

Query  799  GQ  804
            GQ
Sbjct  270  GQ  271



>ref|XP_004239957.1| PREDICTED: laccase-12-like [Solanum lycopersicum]
Length=574

 Score =   370 bits (951),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/248 (69%), Positives = 200/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A   S +THYH+FVI ATP KRLCKT + ITVNGQ+PGPTLEV NGDTLV+ V+N ARYN
Sbjct  24   ANAASEKTHYHDFVIQATPVKRLCKTSNAITVNGQYPGPTLEVNNGDTLVVNVVNKARYN  83

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG+RQ+ + WADGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVY
Sbjct  84   VTIHWHGVRQMRTAWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVY  143

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++I+P+ G  YPFP P +E P+LLGEWW  +   V+RQAT TGAAPNVSDAYTING P
Sbjct  144  GALIIHPKEGGNYPFPNPKRETPVLLGEWWNTNPIDVVRQATRTGAAPNVSDAYTINGQP  203

Query  604  GDLYTCHR-GITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C R   T V + +GET LLRVINA LNQQLFF+VANH  TVV  DA Y KPF+++
Sbjct  204  GDLYKCSRQDTTIVHMDSGETNLLRVINAGLNQQLFFTVANHKLTVVGADANYVKPFTTS  263

Query  781  VIMLGPGQ  804
            V+MLGPGQ
Sbjct  264  VLMLGPGQ  271



>gb|KFK21959.1| hypothetical protein AALP_AAs48252U000800 [Arabis alpina]
Length=570

 Score =   370 bits (950),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/243 (71%), Positives = 198/243 (81%), Gaps = 1/243 (0%)
 Frame = +1

Query  79   GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHW  258
             E H  +FVI   P KRLC+TH  ITVNGQFPGPTLEVRNGD+L I VIN ARYN ++HW
Sbjct  25   AEHHVRQFVIEPRPVKRLCRTHQSITVNGQFPGPTLEVRNGDSLAITVINRARYNISIHW  84

Query  259  HGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVI  438
            HGIRQ+ + WADGP YITQCPI+PG  YTYRF I+ QEGTLWWHAH+RWLRATVYGA++I
Sbjct  85   HGIRQLRNPWADGPEYITQCPIRPGQSYTYRFKIEDQEGTLWWHAHSRWLRATVYGALII  144

Query  439  YPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYT  618
            YPRLG PYPF  P ++IPILLGEWW+R+   V+RQA FTGAA NVSDAYTING PGDLY 
Sbjct  145  YPRLGSPYPFSMPKRDIPILLGEWWDRNPMDVLRQAQFTGAAANVSDAYTINGQPGDLYR  204

Query  619  CHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLG  795
            C R  T +  +  GETV LRVINAA+NQ+LFFSVANH  TVVE D+ YTKPF+++VIM+G
Sbjct  205  CSRAETIRFPIFPGETVQLRVINAAMNQELFFSVANHQLTVVETDSAYTKPFTTSVIMVG  264

Query  796  PGQ  804
            PGQ
Sbjct  265  PGQ  267



>ref|XP_006435828.1| hypothetical protein CICLE_v10031070mg [Citrus clementina]
 ref|XP_006486242.1| PREDICTED: laccase-5-like [Citrus sinensis]
 gb|ESR49068.1| hypothetical protein CICLE_v10031070mg [Citrus clementina]
Length=579

 Score =   370 bits (951),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/252 (67%), Positives = 204/252 (81%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            S+   +F + + H+H+FVI ATP KRLCKTH+ ITVNG +PGPTLEV NGDTLV+KV N 
Sbjct  24   SNALLSFANAKAHHHDFVIQATPVKRLCKTHNTITVNGMYPGPTLEVNNGDTLVVKVTNK  83

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN T+HWHG+RQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  84   ARYNVTIHWHGVRQMRTAWADGPEFVTQCPIRPGMSYTYRFTIQGQEGTLWWHAHSSWLR  143

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P+ G  YPFPKP +E PILLGEWW+ +   V+RQAT TGAAPN+SDAYTI
Sbjct  144  ATVYGALIIHPKEGSSYPFPKPKRETPILLGEWWDANPIDVVRQATRTGAAPNISDAYTI  203

Query  592  NGWPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C    T  V + +GET LLRVINA LNQ LFF++ANH FTVV  DA+Y KP
Sbjct  204  NGQPGDLYNCSSQDTVVVPIDSGETNLLRVINAGLNQPLFFTIANHQFTVVGADASYLKP  263

Query  769  FSSNVIMLGPGQ  804
            F+++VIMLGPGQ
Sbjct  264  FTTSVIMLGPGQ  275



>emb|CAN75316.1| hypothetical protein VITISV_024159 [Vitis vinifera]
Length=566

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 169/246 (69%), Positives = 200/246 (81%), Gaps = 1/246 (0%)
 Frame = +1

Query  70   FLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNAT  249
            F   ETH+H+FV+ ATP KRLCKTH+ ITVNGQ+PGPTLE  NGDTL +KV N ARYN T
Sbjct  28   FTEAETHHHDFVVQATPVKRLCKTHNTITVNGQYPGPTLEXNNGDTLEVKVTNKARYNVT  87

Query  250  LHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGA  429
            +HWHGIRQ+ + WADGP ++TQCPI+PG  YTYRFT Q QEGTLWWHAH+ WLRATVYGA
Sbjct  88   IHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTXQGQEGTLWWHAHSSWLRATVYGA  147

Query  430  IVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGD  609
            ++I+P+ G  YPF KP +E PILLGEWW+ +   V+RQAT TGAAPNVSDAYTING PGD
Sbjct  148  LIIHPKPGSSYPFTKPKRETPILLGEWWDANPIDVVRQATRTGAAPNVSDAYTINGQPGD  207

Query  610  LYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVI  786
            LY C  +    V + +GET LLRVIN+ LNQ+LFF+VANH FTVV  DA+YTKPF+++VI
Sbjct  208  LYNCSSKDTVIVPIDSGETNLLRVINSGLNQELFFTVANHKFTVVSADASYTKPFTTSVI  267

Query  787  MLGPGQ  804
            MLGPGQ
Sbjct  268  MLGPGQ  273



>ref|XP_003544045.1| PREDICTED: laccase-5-like [Glycine max]
Length=569

 Score =   370 bits (949),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 174/244 (71%), Positives = 198/244 (81%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + +   HEFVI ATP KRLC THS ITVNGQFPGPTLEV NGDTLV+KV N ARYN T+H
Sbjct  23   NAKIQEHEFVIQATPVKRLCNTHSTITVNGQFPGPTLEVNNGDTLVVKVTNKARYNVTIH  82

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHGIRQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYGA++
Sbjct  83   WHGIRQMRTGWADGPEFVTQCPIRPGESYTYRFTIQGQEGTLWWHAHSSWLRATVYGALI  142

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I+PR G  YPF KP +E PILLGEWW+ +   V+RQAT TGAAPN SDAYTING PGDLY
Sbjct  143  IHPREGEAYPFTKPKRETPILLGEWWDANPIDVVRQATQTGAAPNTSDAYTINGQPGDLY  202

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +G T V + +GET LLRVINAALNQ LFF+VANH  TVV  DA+Y KPF++NVIML
Sbjct  203  KCSSQGTTIVPIDSGETNLLRVINAALNQPLFFTVANHKLTVVGADASYLKPFTTNVIML  262

Query  793  GPGQ  804
            GPGQ
Sbjct  263  GPGQ  266



>ref|XP_003600994.1| Laccase [Medicago truncatula]
Length=575

 Score =   370 bits (950),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 209/269 (78%), Gaps = 1/269 (0%)
 Frame = +1

Query  1    MEACTKYlflfaifaflSSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGP  180
            ++  +KY  +      LSS      + +TH HEFV+ ATP KRLCKTH+ ITVNGQ+PGP
Sbjct  4    VKTNSKYSSILIAIFVLSSFALALANPKTHEHEFVVEATPVKRLCKTHNTITVNGQYPGP  63

Query  181  TLEVRNGDTLVIKVINAARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTI  360
            TLE+ NGDTLV+KV N ARYN T+HWHG+RQ+ + WADGP ++TQCPI+PG  YTYRFT+
Sbjct  64   TLEINNGDTLVVKVTNKARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGGSYTYRFTV  123

Query  361  QKQEGTLWWHAHTRWLRATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMR  540
              QEGTLWWHAH+ WLRATVYGA++I PR G PYPFPKP+ E  ILLGEWW+ +   V+R
Sbjct  124  NGQEGTLWWHAHSSWLRATVYGALIIRPREGEPYPFPKPNHETSILLGEWWDGNPIDVVR  183

Query  541  QATFTGAAPNVSDAYTINGWPGDLYTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSV  717
            QA  TGAAPN+SDAYTING PGDLY C  +G T + + +GET L+RVINAALNQ LFF++
Sbjct  184  QAQRTGAAPNISDAYTINGQPGDLYKCSTKGTTIIPIHSGETNLVRVINAALNQPLFFTI  243

Query  718  ANHIFTVVEVDATYTKPFSSNVIMLGPGQ  804
            ANH  TVV  DA+Y KPF++N++MLGPGQ
Sbjct  244  ANHKLTVVGADASYVKPFTTNILMLGPGQ  272



>gb|AES71245.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=572

 Score =   370 bits (949),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 209/269 (78%), Gaps = 1/269 (0%)
 Frame = +1

Query  1    MEACTKYlflfaifaflSSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGP  180
            ++  +KY  +      LSS      + +TH HEFV+ ATP KRLCKTH+ ITVNGQ+PGP
Sbjct  4    VKTNSKYSSILIAIFVLSSFALALANPKTHEHEFVVEATPVKRLCKTHNTITVNGQYPGP  63

Query  181  TLEVRNGDTLVIKVINAARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTI  360
            TLE+ NGDTLV+KV N ARYN T+HWHG+RQ+ + WADGP ++TQCPI+PG  YTYRFT+
Sbjct  64   TLEINNGDTLVVKVTNKARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGGSYTYRFTV  123

Query  361  QKQEGTLWWHAHTRWLRATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMR  540
              QEGTLWWHAH+ WLRATVYGA++I PR G PYPFPKP+ E  ILLGEWW+ +   V+R
Sbjct  124  NGQEGTLWWHAHSSWLRATVYGALIIRPREGEPYPFPKPNHETSILLGEWWDGNPIDVVR  183

Query  541  QATFTGAAPNVSDAYTINGWPGDLYTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSV  717
            QA  TGAAPN+SDAYTING PGDLY C  +G T + + +GET L+RVINAALNQ LFF++
Sbjct  184  QAQRTGAAPNISDAYTINGQPGDLYKCSTKGTTIIPIHSGETNLVRVINAALNQPLFFTI  243

Query  718  ANHIFTVVEVDATYTKPFSSNVIMLGPGQ  804
            ANH  TVV  DA+Y KPF++N++MLGPGQ
Sbjct  244  ANHKLTVVGADASYVKPFTTNILMLGPGQ  272



>ref|XP_003519418.1| PREDICTED: laccase-5-like [Glycine max]
Length=569

 Score =   369 bits (948),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 173/245 (71%), Positives = 199/245 (81%), Gaps = 1/245 (0%)
 Frame = +1

Query  73   LSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATL  252
            ++ +   HEFVI ATP KRLC TH+ ITVNGQFPGPTLEV NGDTLV+KV N ARYN T+
Sbjct  22   VNAKIQEHEFVIQATPVKRLCNTHNTITVNGQFPGPTLEVNNGDTLVVKVTNKARYNVTI  81

Query  253  HWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAI  432
            HWHGIRQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYGA+
Sbjct  82   HWHGIRQMRTGWADGPEFVTQCPIRPGESYTYRFTIQGQEGTLWWHAHSSWLRATVYGAL  141

Query  433  VIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDL  612
            +I+PR G  YPF KP +E PILLGEWW+ +   V+RQAT TGAAPN+SDAYTING PGDL
Sbjct  142  IIHPREGEAYPFTKPKRETPILLGEWWDANPIDVVRQATQTGAAPNISDAYTINGQPGDL  201

Query  613  YTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIM  789
            Y C  +G T V + +GET LLRVINAALNQ LFF VANH  TVV  DA+Y KPF++NVIM
Sbjct  202  YKCSSQGSTIVPIDSGETNLLRVINAALNQPLFFKVANHKLTVVGADASYLKPFTTNVIM  261

Query  790  LGPGQ  804
            LGPGQ
Sbjct  262  LGPGQ  266



>gb|KDO44836.1| hypothetical protein CISIN_1g008066mg [Citrus sinensis]
Length=579

 Score =   369 bits (948),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 169/252 (67%), Positives = 204/252 (81%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            S+   +F + + H+H+FVI ATP KRLCKTH+ ITVNG +PGPTLEV NGDTLV+KV N 
Sbjct  24   SNALLSFANAKAHHHDFVIQATPVKRLCKTHNTITVNGMYPGPTLEVNNGDTLVVKVTNK  83

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN T+HWHG+RQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  84   ARYNVTIHWHGVRQMRTAWADGPEFVTQCPIRPGMSYTYRFTIQGQEGTLWWHAHSSWLR  143

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P+ G  YPFPKP +E PILLGEWW+ +   V+RQAT TGAAPN+SDAYTI
Sbjct  144  ATVYGALIIHPKEGSSYPFPKPKRETPILLGEWWDANPIDVVRQATRTGAAPNISDAYTI  203

Query  592  NGWPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C    T  V + +GET LLRVIN+ LNQ LFF++ANH FTVV  DA+Y KP
Sbjct  204  NGQPGDLYNCSSQDTVVVPIDSGETNLLRVINSGLNQPLFFTIANHQFTVVGADASYLKP  263

Query  769  FSSNVIMLGPGQ  804
            F+++VIMLGPGQ
Sbjct  264  FTTSVIMLGPGQ  275



>ref|XP_004307691.1| PREDICTED: laccase-5-like [Fragaria vesca subsp. vesca]
Length=574

 Score =   369 bits (948),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 172/252 (68%), Positives = 201/252 (80%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            +S T +    +TH HEFVI ATP KRLCKTH  ITVNGQFPGPTLEV NGDTLV+KV N 
Sbjct  18   ASSTMSSAEPKTHNHEFVIQATPVKRLCKTHKSITVNGQFPGPTLEVNNGDTLVVKVTNK  77

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN T+HWHGIRQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  78   ARYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLR  137

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P+ G  YPF KP +E  +LLGEWW+ +   V+RQAT TGAAPNVSDAYTI
Sbjct  138  ATVYGALIIHPKQGDSYPFTKPKREQTLLLGEWWDANPIDVLRQATRTGAAPNVSDAYTI  197

Query  592  NGWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C  +    V + +GET LLRV+NAALNQQLFF+VANH  TVV  DA+YTKP
Sbjct  198  NGQPGDLYKCSSKDTVIVPINSGETNLLRVVNAALNQQLFFAVANHKLTVVSADASYTKP  257

Query  769  FSSNVIMLGPGQ  804
            F++  +MLGPGQ
Sbjct  258  FTTTTLMLGPGQ  269



>ref|XP_003538485.1| PREDICTED: laccase-5-like [Glycine max]
Length=587

 Score =   369 bits (947),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/244 (69%), Positives = 198/244 (81%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + + H HEFV+ ATP KRLCKTH+ ITVNGQ+PGPTLE+ NGDTLV+KV N ARYN T+H
Sbjct  31   NAKIHEHEFVVEATPVKRLCKTHNSITVNGQYPGPTLEINNGDTLVVKVTNKARYNVTIH  90

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+RQ+ + WADGP ++TQCPI+PG  YTYRFT+Q QEGTLWWHAH+ WLRATVYGA++
Sbjct  91   WHGVRQMRTGWADGPEFVTQCPIRPGGSYTYRFTVQGQEGTLWWHAHSSWLRATVYGALI  150

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I PR G PYPFPKP  E PILLGEWW+ +   V+RQAT TG APNVSDAYTING PGDLY
Sbjct  151  IRPREGEPYPFPKPKHETPILLGEWWDANPIDVVRQATRTGGAPNVSDAYTINGQPGDLY  210

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +  T V + +GET LLRVINAALNQ LFF+VANH  TVV  DA+Y KPF++ V+ML
Sbjct  211  KCSSKDTTIVPIHSGETNLLRVINAALNQPLFFTVANHKLTVVGADASYLKPFTTKVLML  270

Query  793  GPGQ  804
            GPGQ
Sbjct  271  GPGQ  274



>ref|XP_011004316.1| PREDICTED: laccase-12-like [Populus euphratica]
Length=575

 Score =   368 bits (945),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 203/243 (84%), Gaps = 1/243 (0%)
 Frame = +1

Query  79   GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHW  258
             +TH+H+F++ AT  KRLCKTH+ ITVNG FPGPTLEV+NGDT+V+KV+N ARYN T+HW
Sbjct  31   AKTHHHDFIVQATKVKRLCKTHNSITVNGMFPGPTLEVKNGDTVVVKVVNKARYNVTIHW  90

Query  259  HGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVI  438
            HGIRQ+ + WADGP Y+TQCPI+PG  YTYRFTI+ QEGTLWWHAH+ WLRATVYGA++I
Sbjct  91   HGIRQMRTGWADGPEYVTQCPIRPGRSYTYRFTIEGQEGTLWWHAHSSWLRATVYGALII  150

Query  439  YPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYT  618
            +PR G  YPF KP++E PILLGEWW+ +   V+R+AT TGAAPN+SDAYTING PGDLY 
Sbjct  151  HPREGSSYPFSKPNRETPILLGEWWDTNPIDVVREATRTGAAPNISDAYTINGQPGDLYN  210

Query  619  C-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLG  795
            C  +  T V + +GET LLRVINAALNQ LFF++ANH FTVV  DA+Y KPF+++VIMLG
Sbjct  211  CSSKDTTIVPIDSGETNLLRVINAALNQPLFFTIANHKFTVVGADASYVKPFTTSVIMLG  270

Query  796  PGQ  804
            PGQ
Sbjct  271  PGQ  273



>ref|XP_010491316.1| PREDICTED: laccase-13 isoform X1 [Camelina sativa]
Length=569

 Score =   368 bits (945),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/250 (70%), Positives = 201/250 (80%), Gaps = 3/250 (1%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+ ++ E H+HEFVI  TP KRLC+ H+ ITVNGQFPGPTLEVRNGD+LVI  IN ARYN
Sbjct  16   ASLVNAEVHFHEFVIQETPVKRLCRVHNSITVNGQFPGPTLEVRNGDSLVITAINKARYN  75

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             +LHWHGIRQ+ + WADGP YITQCPIQPG  YTYRFTI+ QEGTLWWHAH+RWLRATVY
Sbjct  76   ISLHWHGIRQMRNPWADGPEYITQCPIQPGGSYTYRFTIEDQEGTLWWHAHSRWLRATVY  135

Query  424  GAIVIYPRLGVP-YPFPK-PDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTING  597
            GA++I P L  P YPFP  P +EI +LLGEWW+R+   V+  A FTGAAPN+SDAYTING
Sbjct  136  GALIIRPPLSSPHYPFPVIPKREITLLLGEWWDRNPMDVLNLAQFTGAAPNISDAYTING  195

Query  598  WPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFS  774
             PGDLY C    T +  V +GE VLLRVIN+ALNQ+LFF VANH  TVV  DA+YTKPFS
Sbjct  196  QPGDLYRCSSQETLRFLVGSGEIVLLRVINSALNQELFFGVANHKLTVVAADASYTKPFS  255

Query  775  SNVIMLGPGQ  804
            +NVIMLGPGQ
Sbjct  256  TNVIMLGPGQ  265



>gb|KHN04792.1| Laccase-5 [Glycine soja]
Length=587

 Score =   369 bits (946),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/244 (69%), Positives = 198/244 (81%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + + H HEFV+ ATP KRLCKTH+ ITVNGQ+PGPTLE+ NGDTLV+KV N ARYN T+H
Sbjct  31   NAKIHEHEFVVEATPVKRLCKTHNSITVNGQYPGPTLEINNGDTLVVKVTNKARYNVTIH  90

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+RQ+ + WADGP ++TQCPI+PG  YTYRFT+Q QEGTLWWHAH+ WLRATVYGA++
Sbjct  91   WHGVRQMRTGWADGPEFVTQCPIRPGGSYTYRFTVQGQEGTLWWHAHSSWLRATVYGALI  150

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I PR G PYPFPKP  E PILLGEWW+ +   V+RQAT TG APNVSDAYTING PGDLY
Sbjct  151  IRPREGEPYPFPKPKHETPILLGEWWDANPIDVVRQATRTGGAPNVSDAYTINGQPGDLY  210

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +  T V + +GET LLRVINAALNQ LFF+VANH  TVV  DA+Y KPF++ V+ML
Sbjct  211  KCSSKDTTIVPIHSGETNLLRVINAALNQPLFFTVANHKLTVVGADASYLKPFTTKVLML  270

Query  793  GPGQ  804
            GPGQ
Sbjct  271  GPGQ  274



>ref|XP_006487674.1| PREDICTED: laccase-3-like [Citrus sinensis]
Length=579

 Score =   368 bits (945),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/248 (68%), Positives = 201/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+    E  +HEFVI A P KRLC+TH+ +TVNGQFPGPTL+VR+GDTL+I  IN A+YN
Sbjct  28   ASLSHAEIQFHEFVIEAKPVKRLCRTHNTVTVNGQFPGPTLQVRDGDTLIITTINRAQYN  87

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             TLHWHG+   G+ WADGP Y+TQCPIQPG  YTY+FTI+ QEGTLWWHAH+RW+RATVY
Sbjct  88   ITLHWHGVNLKGNPWADGPEYVTQCPIQPGRSYTYQFTIEGQEGTLWWHAHSRWIRATVY  147

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GAI+IYPR G  YPFP P++EIPILLGEWW ++   V+ QA FTGAAPNVSDA+TING P
Sbjct  148  GAIIIYPRFGSSYPFPVPNREIPILLGEWWNKNPMDVLMQAIFTGAAPNVSDAFTINGQP  207

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C R  T + QV+ GETVLLR+INAA+NQ+LFF VANH  TVV VD +YTK FS++
Sbjct  208  GDLYRCSRRETVRFQVEAGETVLLRIINAAMNQELFFGVANHKLTVVGVDTSYTKAFSTS  267

Query  781  VIMLGPGQ  804
            VIM+ PGQ
Sbjct  268  VIMIAPGQ  275



>ref|XP_007142103.1| hypothetical protein PHAVU_008G252800g [Phaseolus vulgaris]
 gb|ESW14097.1| hypothetical protein PHAVU_008G252800g [Phaseolus vulgaris]
Length=573

 Score =   368 bits (944),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 164/242 (68%), Positives = 200/242 (83%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E HYHEFVI   P KRLC+TH+++TVNGQFPGPT+E RNGD+L I+V+NA  YN ++HWH
Sbjct  31   ENHYHEFVIQTVPVKRLCRTHNVLTVNGQFPGPTVEARNGDSLAIRVVNAGPYNISIHWH  90

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+R + + WADGP+Y+TQCPIQPG  YTYRFTIQ QEGTLWWHAHT +LRATVYGA++IY
Sbjct  91   GLRMLRNPWADGPSYVTQCPIQPGGSYTYRFTIQNQEGTLWWHAHTGFLRATVYGALIIY  150

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P+LG PYPF  P KE P+LLGEW++RD  +++RQA FTGA PNVS AYTING PGDLY C
Sbjct  151  PKLGSPYPFSMPKKEFPLLLGEWFDRDPMALLRQAQFTGAPPNVSVAYTINGQPGDLYRC  210

Query  622  HRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
                T +V V  GET+LLR+IN+ALNQ+LFF++ANH  TVV  DA YTKPF++NV+M+GP
Sbjct  211  SSQETVRVPVDAGETILLRIINSALNQELFFAIANHRMTVVATDAAYTKPFTTNVLMIGP  270

Query  799  GQ  804
            GQ
Sbjct  271  GQ  272



>ref|XP_010087027.1| hypothetical protein L484_012271 [Morus notabilis]
 gb|EXB25845.1| hypothetical protein L484_012271 [Morus notabilis]
Length=571

 Score =   367 bits (943),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/243 (70%), Positives = 199/243 (82%), Gaps = 1/243 (0%)
 Frame = +1

Query  79   GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHW  258
            G+TH+H+FVI ATP KRLCKTH+ ITVNGQFPGPTLEV NGDTLVIK+ N ARYN T+HW
Sbjct  26   GKTHHHDFVIQATPVKRLCKTHNSITVNGQFPGPTLEVNNGDTLVIKITNKARYNVTIHW  85

Query  259  HGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVI  438
            HGIRQ+ S WADGP ++TQCPI+PG  YTYRFTI+ QEGTLWWHAH+ WLRATVYGA++I
Sbjct  86   HGIRQLRSGWADGPEFVTQCPIRPGGSYTYRFTIEGQEGTLWWHAHSSWLRATVYGALII  145

Query  439  YPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYT  618
             PR G  YPF KP +E PILLGEWW+ +   V+RQAT TGAAPN S+A+TING PGDLY 
Sbjct  146  RPREGESYPFQKPKRETPILLGEWWDANPIDVVRQATRTGAAPNNSNAFTINGQPGDLYN  205

Query  619  C-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLG  795
            C  +    V ++ GET LLRVINAALNQ LFF +ANH  TVV  DA+YTKPF+++V+MLG
Sbjct  206  CSSKDTVVVPIEVGETNLLRVINAALNQPLFFKIANHKLTVVSADASYTKPFTTDVLMLG  265

Query  796  PGQ  804
            PGQ
Sbjct  266  PGQ  268



>ref|XP_002871251.1| laccase-13 precursor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47510.1| laccase-13 precursor [Arabidopsis lyrata subsp. lyrata]
Length=569

 Score =   367 bits (943),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/250 (70%), Positives = 201/250 (80%), Gaps = 3/250 (1%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+ ++ E H+HEFV+  TP KRLC+ H+ ITVNGQFPGPTLEVRNGD+LVI  IN ARYN
Sbjct  16   ASLVNAEVHFHEFVVQETPVKRLCRVHNSITVNGQFPGPTLEVRNGDSLVITAINKARYN  75

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             TLHWHGIRQ+ + WADGP YITQCPIQPG  YTYRFTI+ QEGTLWWHAH+RWLRATVY
Sbjct  76   ITLHWHGIRQMRNPWADGPEYITQCPIQPGGSYTYRFTIEDQEGTLWWHAHSRWLRATVY  135

Query  424  GAIVIYPRLGVP-YPFPK-PDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTING  597
            GA++I P L  P YPFP  P +EI +LLGEWW+R+   V+  A FTGAAPN+SDA+TING
Sbjct  136  GALIIRPPLSSPHYPFPVIPKREITLLLGEWWDRNPMDVLNLAQFTGAAPNISDAFTING  195

Query  598  WPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFS  774
             PGDLY C    T +  V +GE VLLRVIN+ALNQ+LFF VANH  TVV  DA+YTKPFS
Sbjct  196  QPGDLYRCSSQETLRFLVGSGEIVLLRVINSALNQELFFGVANHKLTVVAADASYTKPFS  255

Query  775  SNVIMLGPGQ  804
            +NVIMLGPGQ
Sbjct  256  TNVIMLGPGQ  265



>ref|XP_011015318.1| PREDICTED: laccase-12-like [Populus euphratica]
 ref|XP_011035866.1| PREDICTED: laccase-12-like [Populus euphratica]
Length=583

 Score =   367 bits (943),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/251 (67%), Positives = 202/251 (80%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            + T +    E H+H+FV+ AT  KRLCKTH+ ITVNG FPGPTLEV+NGDTLV+KV+N A
Sbjct  31   ASTLSLAIAEIHHHDFVVQATKVKRLCKTHNSITVNGMFPGPTLEVKNGDTLVVKVVNKA  90

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            RYN T+HWHG+RQI + WADGP ++TQCPI+PG  YTYRFTI+ QEGTLWWHAH+ WLRA
Sbjct  91   RYNVTIHWHGVRQIRTGWADGPEFVTQCPIRPGGSYTYRFTIEGQEGTLWWHAHSSWLRA  150

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGAI+I PR G  YPF KP +E PILLGEWW+ +   V+R+AT TGAAPN+SDAYTIN
Sbjct  151  TVYGAIIILPREGSSYPFTKPKRETPILLGEWWDANPVDVVREATRTGAAPNISDAYTIN  210

Query  595  GWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C     T V + +GET LLRVINAALNQ LFF++ANH FTV+  DA+Y KPF
Sbjct  211  GQPGDLYNCSSEDTTIVPIASGETNLLRVINAALNQPLFFTIANHKFTVIGADASYLKPF  270

Query  772  SSNVIMLGPGQ  804
            +++VIMLGPGQ
Sbjct  271  TTSVIMLGPGQ  281



>ref|XP_003616702.1| Laccase [Medicago truncatula]
 gb|AES99660.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=567

 Score =   367 bits (941),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 168/248 (68%), Positives = 200/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+  + + H HEFV+ ATP KRLC T   ITVNGQFPGPTLE+ NGDTLV+KVIN ARYN
Sbjct  16   ASLANAKVHEHEFVVQATPVKRLCNTQMSITVNGQFPGPTLEINNGDTLVVKVINKARYN  75

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG+RQI + WADGP ++TQCPI+PG  YTYRFTI  QEGTLWWHAH+ WLRATVY
Sbjct  76   VTIHWHGVRQIRTGWADGPEFVTQCPIRPGESYTYRFTINGQEGTLWWHAHSSWLRATVY  135

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++I+P+ G  YPF KP +E PILLGEWW+ +   V+RQAT TGAAPN+SDAYTING P
Sbjct  136  GALIIHPKEGDAYPFTKPKRETPILLGEWWDANPIDVVRQATQTGAAPNISDAYTINGQP  195

Query  604  GDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C  +G T V + +GET L+RVINAALNQ LFF++ANH  TVV  DA+Y KPF++N
Sbjct  196  GDLYKCSSKGTTIVPIDSGETNLIRVINAALNQPLFFTIANHKLTVVGADASYVKPFTTN  255

Query  781  VIMLGPGQ  804
            V+MLGPGQ
Sbjct  256  VLMLGPGQ  263



>ref|XP_004239958.1| PREDICTED: laccase-12-like [Solanum lycopersicum]
Length=570

 Score =   367 bits (941),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 199/244 (82%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            S +THYH+FV+ AT  KRLC+ H+IITVNG+FPGPTLEV NGDTLV+ V+N ARYN T+H
Sbjct  24   SAKTHYHDFVVQATLVKRLCEIHNIITVNGKFPGPTLEVNNGDTLVVNVVNRARYNVTIH  83

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+RQ+ + WADGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYGA++
Sbjct  84   WHGVRQMRTGWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALI  143

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I P+ GV YPFPKP +E PILLGEWW  +   V+RQAT TGAAPN+SDAYTIN  PGDLY
Sbjct  144  INPKEGVIYPFPKPKRETPILLGEWWNTNPIDVVRQATRTGAAPNISDAYTINSQPGDLY  203

Query  616  TCHRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C    T  V + +GE  LLRVINAALNQQLFF+VANH  TVV  DATY KPF+++V+ML
Sbjct  204  KCSSQDTAIVHMDSGEINLLRVINAALNQQLFFAVANHKLTVVGADATYVKPFTTSVLML  263

Query  793  GPGQ  804
            GPGQ
Sbjct  264  GPGQ  267



>gb|EYU43442.1| hypothetical protein MIMGU_mgv1a003472mg [Erythranthe guttata]
Length=583

 Score =   367 bits (942),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 163/244 (67%), Positives = 200/244 (82%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + + H+H+FV+ ATP KRLCKTH+ ITVNG +PGPTLEV NGDTLV+KV+N ARYN T+H
Sbjct  33   NAKVHHHDFVVQATPVKRLCKTHNTITVNGMYPGPTLEVNNGDTLVVKVVNRARYNVTIH  92

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+RQ+ + WADGPA++TQCPI+PG  YTYRFTI +QEGTLWWHAH+ WLRATVYGA++
Sbjct  93   WHGVRQMRTAWADGPAFVTQCPIRPGGSYTYRFTIDRQEGTLWWHAHSSWLRATVYGALI  152

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I PR G  YPFPKP +E P+LLGEWW+ +   V+RQAT TGAAPN+SDAYTING PGDLY
Sbjct  153  IRPRQGDEYPFPKPHRETPLLLGEWWDANPIDVVRQATRTGAAPNISDAYTINGQPGDLY  212

Query  616  TCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +    V +  GET LLRV+N+ALNQ+LFF VANH  T+V  DA+Y KPF+++V+ML
Sbjct  213  NCSAKDTIVVPIAAGETNLLRVVNSALNQELFFKVANHKLTIVGADASYVKPFTTSVLML  272

Query  793  GPGQ  804
            GPGQ
Sbjct  273  GPGQ  276



>ref|XP_006431538.1| hypothetical protein CICLE_v10003240mg [Citrus clementina]
 gb|ESR44778.1| hypothetical protein CICLE_v10003240mg [Citrus clementina]
Length=579

 Score =   367 bits (942),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 168/248 (68%), Positives = 201/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+    E  +HEFVI A P KRLC+TH+ +TVNG+FPGPTL VR+GDTL+I  IN A+YN
Sbjct  28   ASLSHAEIQFHEFVIEAKPVKRLCRTHNTVTVNGEFPGPTLLVRDGDTLIITTINRAQYN  87

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             TLHWHG+   G+ WADGP Y+TQCPIQPG  YTY+FTI+ QEGTLWWHAH+RW+RATVY
Sbjct  88   ITLHWHGVSLKGNPWADGPEYVTQCPIQPGRSYTYQFTIEDQEGTLWWHAHSRWIRATVY  147

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GAI+IYPR G  YPFP P++EIPILLGEWW+++   V+ QA FTGAAPNVSDA+TING P
Sbjct  148  GAIIIYPRFGSSYPFPVPNREIPILLGEWWDKNPMDVLMQAIFTGAAPNVSDAFTINGQP  207

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C R  T + QV+ GETVLLR+INAA+NQ+LFF VANH  TVV VD +YTK FS++
Sbjct  208  GDLYRCSRRETVRFQVEAGETVLLRIINAAMNQELFFGVANHKLTVVGVDTSYTKAFSTS  267

Query  781  VIMLGPGQ  804
            VIM+ PGQ
Sbjct  268  VIMIAPGQ  275



>ref|XP_008359050.1| PREDICTED: laccase-3-like [Malus domestica]
Length=567

 Score =   366 bits (940),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 164/248 (66%), Positives = 202/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+F + E H+HEF + A P KRLC+THS ITVNGQFPGPTLEVRNGD++ +KV N  +YN
Sbjct  20   ASFSAAEDHFHEFFVEAXPVKRLCRTHSRITVNGQFPGPTLEVRNGDSVAVKVTNXXKYN  79

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG +Q  + W +GP Y+TQCPIQPGA YTYRFTI  QEGTLWWHAH+RWLRA+VY
Sbjct  80   VTIHWHGXKQQNNPWEEGPEYVTQCPIQPGATYTYRFTITDQEGTLWWHAHSRWLRASVY  139

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++IYPRLG PYPFP P +E+P+LLGEW++R+   VMR A FTG APNVSDAYTING P
Sbjct  140  GALIIYPRLGSPYPFPMPQREVPLLLGEWFDRNPQDVMRLAAFTGGAPNVSDAYTINGQP  199

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C +  T ++ V +GE++LLRVIN+ALNQ+L F+VANH  TVV  DA+YT+P ++ 
Sbjct  200  GDLYRCSKKETIRIPVXSGESLLLRVINSALNQELXFTVANHQLTVVGADASYTEPLTTR  259

Query  781  VIMLGPGQ  804
            VIM+GPGQ
Sbjct  260  VIMIGPGQ  267



>ref|XP_007141728.1| hypothetical protein PHAVU_008G220300g [Phaseolus vulgaris]
 gb|ESW13722.1| hypothetical protein PHAVU_008G220300g [Phaseolus vulgaris]
Length=610

 Score =   368 bits (944),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 199/244 (82%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + +   H+FVI ATP KRLC TH+ ITVNGQFPGPTLEV NGDTLV+KV N ARYN T+H
Sbjct  64   NAKIQEHQFVIQATPVKRLCSTHNTITVNGQFPGPTLEVNNGDTLVVKVTNKARYNVTIH  123

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHGIRQ+ + WADGP ++TQCPI+PG  YTYRFTI+ QEGTLWWHAH+ WLRATVYGA++
Sbjct  124  WHGIRQMRTGWADGPEFVTQCPIRPGESYTYRFTIEGQEGTLWWHAHSSWLRATVYGALI  183

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            IYPR G  YPFPKP ++ PILLGEWW+ +   V+RQAT TGAAPN+SDAYTING PGDLY
Sbjct  184  IYPREGEAYPFPKPKRQTPILLGEWWDANPIDVLRQATRTGAAPNISDAYTINGQPGDLY  243

Query  616  TCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +G T V + +GET LLRVINAALNQ LFF+VANH   VV  DA+Y KPF+++VIML
Sbjct  244  KCSTQGTTIVPIDSGETNLLRVINAALNQPLFFTVANHKLKVVGADASYLKPFTTSVIML  303

Query  793  GPGQ  804
            GPGQ
Sbjct  304  GPGQ  307



>ref|XP_009417976.1| PREDICTED: laccase-3-like [Musa acuminata subsp. malaccensis]
Length=578

 Score =   367 bits (941),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 169/252 (67%), Positives = 200/252 (79%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            SS   T    E HYHEFV+ ATP KRLCKTH+IITVNGQ+PGPTL VRNGDTLV+ V+N 
Sbjct  25   SSVMFTCADAEVHYHEFVVQATPVKRLCKTHNIITVNGQYPGPTLAVRNGDTLVVNVVNR  84

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            A+YN TLHWHG+RQ+ + WADGP ++TQCPI+PG  YTYRFTI+ QEGTLWWHAH+ WLR
Sbjct  85   AKYNVTLHWHGVRQMRTAWADGPEFVTQCPIRPGGSYTYRFTIEDQEGTLWWHAHSSWLR  144

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATV+GA++IYPR    YPFPKP +E P++LGEWW  D  SV+R+AT TGAAPNVSDA+TI
Sbjct  145  ATVHGALIIYPRDASSYPFPKPHREFPVILGEWWNEDPISVVRRATRTGAAPNVSDAFTI  204

Query  592  NGWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C ++  T   V  GET LLR INAALN +LF S+A H+ TVV  DA YTKP
Sbjct  205  NGQPGDLYNCSNKDTTVFPVALGETNLLRFINAALNNELFVSIAGHMMTVVAADAAYTKP  264

Query  769  FSSNVIMLGPGQ  804
            F++ V+MLGPGQ
Sbjct  265  FTTAVLMLGPGQ  276



>gb|ABK92474.1| unknown [Populus trichocarpa]
Length=550

 Score =   365 bits (938),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 201/243 (83%), Gaps = 1/243 (0%)
 Frame = +1

Query  79   GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHW  258
             +TH+H+F + AT  KRLCKTH+ ITVNG FPGPTLEV+NGDTLV+KV+N ARYN T+HW
Sbjct  6    AKTHHHDFTVQATKVKRLCKTHNSITVNGMFPGPTLEVKNGDTLVVKVVNRARYNVTIHW  65

Query  259  HGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVI  438
            HGIRQ+ + WADGP ++TQCPI+PG  YTYRFTI+ QEGTLWWHAH+ WLRATVYGA++I
Sbjct  66   HGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIEGQEGTLWWHAHSSWLRATVYGALII  125

Query  439  YPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYT  618
            +PR G  YPF KP +E PILLGEWW+ +   V+R+AT TGAAPN+SDAYTING PGDL+ 
Sbjct  126  HPREGSSYPFSKPKRETPILLGEWWDANPIDVVREATRTGAAPNISDAYTINGQPGDLFN  185

Query  619  C-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLG  795
            C  +  T V + +GET LLRVINAALNQ LFF++ANH FTVV  DA+Y KPF+++VIMLG
Sbjct  186  CSSKDTTIVPIDSGETNLLRVINAALNQPLFFTIANHKFTVVGADASYLKPFTTSVIMLG  245

Query  796  PGQ  804
            PGQ
Sbjct  246  PGQ  248



>ref|XP_002315131.1| hypothetical protein POPTR_0010s19090g [Populus trichocarpa]
 gb|EEF01302.1| hypothetical protein POPTR_0010s19090g [Populus trichocarpa]
Length=575

 Score =   366 bits (940),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 167/251 (67%), Positives = 202/251 (80%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            + T +    E H+H+FV+ AT  KRLCKTH+ ITVNG FPGPTLEV+NGDTLV+KV+N A
Sbjct  23   ASTMSLAIAEIHHHDFVVQATKVKRLCKTHNSITVNGMFPGPTLEVKNGDTLVVKVVNKA  82

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            RYN T+HWHGIRQ+ + WADGP ++TQCPI+PG  YTYRF I+ QEGTLWWHAH+ WLRA
Sbjct  83   RYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFNIEGQEGTLWWHAHSSWLRA  142

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGA++I+PR G  YPF KP +E PILLGEWW+ +   V+R+AT TGAAPN+SDAYTIN
Sbjct  143  TVYGALIIHPREGSSYPFAKPKRETPILLGEWWDANPVDVVREATRTGAAPNISDAYTIN  202

Query  595  GWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C     T V + +GET LLRVINAALNQ LFF++ANH FTV+  DA+Y KPF
Sbjct  203  GQPGDLYNCSSEDTTIVPIASGETNLLRVINAALNQPLFFTIANHKFTVIGADASYLKPF  262

Query  772  SSNVIMLGPGQ  804
            +++VIMLGPGQ
Sbjct  263  TTSVIMLGPGQ  273



>ref|NP_196330.3| laccase 13 [Arabidopsis thaliana]
 sp|Q9LYQ2.1|LAC13_ARATH RecName: Full=Laccase-13; AltName: Full=Benzenediol:oxygen oxidoreductase 
13; AltName: Full=Diphenol oxidase 13; AltName: 
Full=Urishiol oxidase 13; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB87269.1| laccase-like protein [Arabidopsis thaliana]
 gb|AED91113.1| laccase 13 [Arabidopsis thaliana]
Length=569

 Score =   366 bits (939),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/250 (69%), Positives = 201/250 (80%), Gaps = 3/250 (1%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+ ++ E H+HEFVI  TP KRLC+ H+ ITVNGQFPGPTLEVRNGD+LVI  IN ARYN
Sbjct  16   ASLVNAEVHFHEFVIQETPVKRLCRVHNSITVNGQFPGPTLEVRNGDSLVITAINKARYN  75

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             +LHWHGIRQ+ + WADGP YITQCPIQPG  YTYRFT++ QEGTLWWHAH+RWLRATVY
Sbjct  76   ISLHWHGIRQMRNPWADGPEYITQCPIQPGGSYTYRFTMEDQEGTLWWHAHSRWLRATVY  135

Query  424  GAIVIYPRLGVP-YPFPK-PDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTING  597
            GA++I P L  P YPFP  P +EI +LLGEWW+R+   V+  A FTGAAPN+SDA+TING
Sbjct  136  GALIIRPPLSSPHYPFPVIPKREITLLLGEWWDRNPMDVLNLAQFTGAAPNISDAFTING  195

Query  598  WPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFS  774
             PGDLY C    T +  V +GE VLLRVIN+ALNQ+LFF VANH  TVV  DA+YTKPFS
Sbjct  196  QPGDLYRCSSQETLRFLVGSGEIVLLRVINSALNQELFFGVANHKLTVVAADASYTKPFS  255

Query  775  SNVIMLGPGQ  804
            +NVIMLGPGQ
Sbjct  256  TNVIMLGPGQ  265



>ref|XP_010452665.1| PREDICTED: laccase-13-like isoform X1 [Camelina sativa]
Length=569

 Score =   365 bits (938),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/250 (70%), Positives = 200/250 (80%), Gaps = 3/250 (1%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+ ++ E H HEFVI  TP KRLC+ H+ ITVNGQFPGPTLEVRNGD+LVI  IN ARYN
Sbjct  16   ASLVNAEVHLHEFVIQETPVKRLCRIHNSITVNGQFPGPTLEVRNGDSLVITAINKARYN  75

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             +LHWHGIRQ+ + WADGP YITQCPIQPG  YTYRFTI+ QEGTLWWHAH+RWLRATVY
Sbjct  76   ISLHWHGIRQMRNPWADGPEYITQCPIQPGGSYTYRFTIEDQEGTLWWHAHSRWLRATVY  135

Query  424  GAIVIYPRLGVP-YPFPK-PDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTING  597
            GA++I P L  P YPFP  P +EI +LLGEWW+R+   V+  A FTGAAPN+SDA+TING
Sbjct  136  GALIIRPPLSSPHYPFPVIPKREITLLLGEWWDRNPMDVLNLAQFTGAAPNISDAFTING  195

Query  598  WPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFS  774
             PGDLY C    T +  V +GE VLLRVIN+ALNQ+LFF VANH  TVV  DA+YTKPFS
Sbjct  196  QPGDLYRCSSQETLRFLVGSGEIVLLRVINSALNQELFFGVANHKLTVVAADASYTKPFS  255

Query  775  SNVIMLGPGQ  804
            +NVIMLGPGQ
Sbjct  256  TNVIMLGPGQ  265



>ref|XP_006289181.1| hypothetical protein CARUB_v10002622mg [Capsella rubella]
 gb|EOA22079.1| hypothetical protein CARUB_v10002622mg [Capsella rubella]
Length=568

 Score =   365 bits (938),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/250 (69%), Positives = 201/250 (80%), Gaps = 3/250 (1%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+ ++ E H+HEF+I  TP KRLC+ H+ ITVNGQFPGPTLEVRNGD+LVI  IN ARYN
Sbjct  15   ASLVNAEVHFHEFIIQETPVKRLCRVHNSITVNGQFPGPTLEVRNGDSLVITAINKARYN  74

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             +LHWHGIRQ+ + WADGP YITQCPIQPG  YTY+FTI+ QEGTLWWHAH+RWLRATVY
Sbjct  75   ISLHWHGIRQMRNPWADGPEYITQCPIQPGGSYTYKFTIEDQEGTLWWHAHSRWLRATVY  134

Query  424  GAIVIYPRLGVP-YPFP-KPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTING  597
            GA++I P L  P YPFP  P +EI +LLGEWW+R+   V+  A FTGAAPN+SDA+TING
Sbjct  135  GALIIRPPLSSPHYPFPVLPKREITLLLGEWWDRNPMDVLNLAQFTGAAPNISDAFTING  194

Query  598  WPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFS  774
             PGDLY C    T +  V +GE VLLRVIN+ALNQ+LFF VANH  TVV  DA+YTKPFS
Sbjct  195  QPGDLYRCSSQETLRFLVGSGEIVLLRVINSALNQELFFGVANHKLTVVAADASYTKPFS  254

Query  775  SNVIMLGPGQ  804
            +NVIMLGPGQ
Sbjct  255  TNVIMLGPGQ  264



>ref|XP_009386858.1| PREDICTED: laccase-3-like [Musa acuminata subsp. malaccensis]
Length=572

 Score =   365 bits (938),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 201/245 (82%), Gaps = 1/245 (0%)
 Frame = +1

Query  73   LSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATL  252
            +  E  YH+FV+ ATP KRLCK H+IITVNGQFPGPT+EV+NGDTLVI V+N ARYN TL
Sbjct  28   IDAEVQYHDFVVQATPVKRLCKAHNIITVNGQFPGPTIEVKNGDTLVINVVNRARYNVTL  87

Query  253  HWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAI  432
            HWHG+RQ+ + WADGP ++TQCPI+PG  YTYRFTI+ QEGTLWWHAH+ WLRATVYGA+
Sbjct  88   HWHGVRQMRTAWADGPEFVTQCPIRPGGSYTYRFTIEGQEGTLWWHAHSSWLRATVYGAL  147

Query  433  VIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDL  612
            +I P+    YPF KP +E+P++LGEWW+R+   V+R+AT TGAAPN+SDA+TING PGDL
Sbjct  148  IILPKENSSYPFTKPKREVPVILGEWWDRNPIDVVREATRTGAAPNISDAFTINGQPGDL  207

Query  613  YTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIM  789
            Y C ++  T + VK GET LLR INAALN +LF ++ANH  TVV  DA+YTKPF+++V+M
Sbjct  208  YNCSNKDTTMIPVKAGETNLLRFINAALNTELFVAIANHKMTVVSADASYTKPFTTSVLM  267

Query  790  LGPGQ  804
            LGPGQ
Sbjct  268  LGPGQ  272



>gb|KDP44695.1| hypothetical protein JCGZ_01195 [Jatropha curcas]
Length=576

 Score =   365 bits (938),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 165/240 (69%), Positives = 199/240 (83%), Gaps = 1/240 (0%)
 Frame = +1

Query  88   HYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWHGI  267
            H+HEFV+ AT  KRLCKTH+ ITVNG FPGPTLE+ NGD+LV+KV+N ARYN T+HWHG+
Sbjct  34   HHHEFVVQATKVKRLCKTHNTITVNGMFPGPTLELHNGDSLVVKVVNKARYNLTIHWHGV  93

Query  268  RQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIYPR  447
            RQ+ + WADGP ++TQCPI+PG  YTYRFTI+ QEGTLWWHAH+ WLRATVYGA++IYP+
Sbjct  94   RQMRTGWADGPEFVTQCPIRPGGSYTYRFTIEGQEGTLWWHAHSSWLRATVYGALIIYPK  153

Query  448  LGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC-H  624
             G  YPFPKP +E PILLGEWW+ +   V+R+AT TGAAPN+SDAYTING PGDLY C  
Sbjct  154  EGTSYPFPKPKRETPILLGEWWDANPIDVVREATRTGAAPNISDAYTINGQPGDLYNCSS  213

Query  625  RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGPGQ  804
            +    V + +GET LLRVINAALNQ LFF++ANH FTVV  DA+Y KPF+++VIMLGPGQ
Sbjct  214  KDTVIVPIGSGETNLLRVINAALNQPLFFTIANHKFTVVGADASYLKPFTTSVIMLGPGQ  273



>ref|XP_006355742.1| PREDICTED: laccase-12-like [Solanum tuberosum]
Length=574

 Score =   365 bits (937),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/248 (68%), Positives = 200/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A   S +THYH+FVI AT  KRLCK H+IITVNG+FPGPTLEV NGDTLV+ V+N ARYN
Sbjct  24   ANAASAKTHYHDFVIQATLVKRLCKIHNIITVNGKFPGPTLEVNNGDTLVVNVVNRARYN  83

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG++Q+ + WADGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVY
Sbjct  84   VTIHWHGVKQMRTGWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVY  143

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++I P+ G  YPFPKP +E PILLGEWW  +   V+RQAT TGAAPN+SDAYT+N  P
Sbjct  144  GALIINPKEGEIYPFPKPKRETPILLGEWWNTNPIDVVRQATRTGAAPNLSDAYTVNSQP  203

Query  604  GDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C  +  T V + +GET LLRVIN ALNQQLFF+VANH  TVV  DA+Y KPF+++
Sbjct  204  GDLYKCSSQDTTVVHIDSGETNLLRVINTALNQQLFFAVANHKLTVVGADASYVKPFTTS  263

Query  781  VIMLGPGQ  804
            V+MLGPGQ
Sbjct  264  VLMLGPGQ  271



>ref|XP_009797628.1| PREDICTED: laccase-3-like [Nicotiana sylvestris]
Length=570

 Score =   365 bits (937),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/251 (67%), Positives = 197/251 (78%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            S   +F + + H HEF +  T   RLCKT +IITVNGQFPGPTL VRNGD LV++V+N A
Sbjct  21   SLLFSFANADIHQHEFSVQETRITRLCKTKNIITVNGQFPGPTLTVRNGDKLVVRVVNRA  80

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            RYN T+HWHGIRQ+ + WADGP Y+TQCPI+PG  YTYRFTI+ QEGTLWWHAH+RWLRA
Sbjct  81   RYNVTIHWHGIRQMRTPWADGPEYVTQCPIKPGGVYTYRFTIEDQEGTLWWHAHSRWLRA  140

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGA+VI P+ G  +PF +P K+IPILLGEWW +DI  + RQ  FTGAAPN+SDAYTIN
Sbjct  141  TVYGALVILPKQGSHFPFSQPKKDIPILLGEWWNKDIIVIQRQTQFTGAAPNISDAYTIN  200

Query  595  GWPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C    T K  V  GET+LLRVINAALNQQLFFSVANH   VV  DA Y KPF
Sbjct  201  GQPGDLYRCSSQDTLKFLVNPGETILLRVINAALNQQLFFSVANHKLIVVGADAAYNKPF  260

Query  772  SSNVIMLGPGQ  804
            ++N+IM+GPGQ
Sbjct  261  TTNIIMVGPGQ  271



>gb|KDP44694.1| hypothetical protein JCGZ_01194 [Jatropha curcas]
Length=582

 Score =   365 bits (938),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/253 (67%), Positives = 203/253 (80%), Gaps = 5/253 (2%)
 Frame = +1

Query  61   TATFLS----GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVIN  228
            TA+ LS     +THYH+FVI ATP KRLCKT + ITVNG FPGPTLEV NGDTLV+ V+N
Sbjct  25   TASILSFANADKTHYHDFVIQATPVKRLCKTQNTITVNGMFPGPTLEVNNGDTLVVNVVN  84

Query  229  AARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWL  408
             A+YN T+HWHG+RQ+ + WADGP ++TQCPI+PG +YTYRFTIQ QEGTLWWHAH+ WL
Sbjct  85   RAQYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGGKYTYRFTIQGQEGTLWWHAHSSWL  144

Query  409  RATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYT  588
            RATVYGA++I+P+ G  YPFPKP +E PI+LGEWW  +   V+R+AT TGAAPNVSDAYT
Sbjct  145  RATVYGALIIHPKEGSSYPFPKPKRETPIILGEWWNANPIDVVREATRTGAAPNVSDAYT  204

Query  589  INGWPGDLYTCHRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTK  765
            ING PGDLY C    T  + + +GET LLRVINA LNQ LFF+VANH  TVV  DA+YTK
Sbjct  205  INGQPGDLYNCSSQDTAIIPIDSGETNLLRVINAGLNQPLFFTVANHKLTVVGADASYTK  264

Query  766  PFSSNVIMLGPGQ  804
            PF++ V+MLGPGQ
Sbjct  265  PFTTTVLMLGPGQ  277



>ref|XP_010692917.1| PREDICTED: laccase-12 [Beta vulgaris subsp. vulgaris]
Length=575

 Score =   365 bits (937),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/244 (70%), Positives = 197/244 (81%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            S +  YH+FV+  TP KRLCK+ + ITVNGQ PGPTLEV  GDTLV+ V+N A+YN T+H
Sbjct  28   SAKVQYHDFVVQETPVKRLCKSLNAITVNGQLPGPTLEVYEGDTLVVNVVNRAKYNVTVH  87

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+RQ+ + WADGP ++TQCPI+PG  YTYRFTI+ QEGTLWWHAH+ WLRATVYGA+V
Sbjct  88   WHGVRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIRGQEGTLWWHAHSSWLRATVYGALV  147

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I PR G PYPFPKP++E PILLGEWW RD  SV+RQAT TGAAPNVSDAYTING PGDLY
Sbjct  148  IRPRQGTPYPFPKPNRETPILLGEWWNRDPISVIRQATRTGAAPNVSDAYTINGQPGDLY  207

Query  616  TCHRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C +  T  V +  GE  LLRVINAALNQ+LFFSVANH  TVV  DA Y KPF++NV+ML
Sbjct  208  NCSKQDTVIVPIDIGERHLLRVINAALNQELFFSVANHQLTVVGADAGYLKPFTTNVLML  267

Query  793  GPGQ  804
            GPGQ
Sbjct  268  GPGQ  271



>ref|XP_011084865.1| PREDICTED: laccase-12-like [Sesamum indicum]
Length=580

 Score =   365 bits (937),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 198/244 (81%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
              +THYH+FV+ ATP KRLCKTH+ ITVNG +PGPTLEV NGDTLV+ V+N ARYN T+H
Sbjct  35   DAKTHYHDFVVQATPVKRLCKTHNAITVNGMYPGPTLEVNNGDTLVVNVVNRARYNVTIH  94

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+RQI + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYGA++
Sbjct  95   WHGVRQIRTGWADGPDFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALI  154

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I P+ G  YPFPKP +E  +LLGEWW+ +   V+RQAT TGAAPNVSDAYTING PGDLY
Sbjct  155  IRPKEGESYPFPKPKRETSLLLGEWWDANPVDVVRQATRTGAAPNVSDAYTINGQPGDLY  214

Query  616  TCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C    T  V V +GET LLRV+N+ALNQQLFF VANH  TVV  DA+Y KPF+++V+ML
Sbjct  215  NCSSKETITVPVDSGETNLLRVVNSALNQQLFFKVANHKLTVVGADASYVKPFTTSVLML  274

Query  793  GPGQ  804
            GPGQ
Sbjct  275  GPGQ  278



>ref|XP_002312186.2| laccase family protein [Populus trichocarpa]
 gb|EEE89553.2| laccase family protein [Populus trichocarpa]
Length=574

 Score =   365 bits (937),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 201/243 (83%), Gaps = 1/243 (0%)
 Frame = +1

Query  79   GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHW  258
             +TH+H+F + AT  KRLCKTH+ ITVNG FPGPTLEV+NGDTLV+KV+N ARYN T+HW
Sbjct  30   AKTHHHDFTVQATKVKRLCKTHNSITVNGMFPGPTLEVKNGDTLVVKVVNRARYNVTIHW  89

Query  259  HGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVI  438
            HGIRQ+ + WADGP ++TQCPI+PG  YTYRFTI+ QEGTLWWHAH+ WLRATVYGA++I
Sbjct  90   HGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIEGQEGTLWWHAHSSWLRATVYGALII  149

Query  439  YPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYT  618
            +PR G  YPF KP +E PILLGEWW+ +   V+R+AT TGAAPN+SDAYTING PGDL+ 
Sbjct  150  HPREGSSYPFSKPKRETPILLGEWWDANPIDVVREATRTGAAPNISDAYTINGQPGDLFN  209

Query  619  C-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLG  795
            C  +  T V + +GET LLRVINAALNQ LFF++ANH FTVV  DA+Y KPF+++VIMLG
Sbjct  210  CSSKDTTIVPIDSGETNLLRVINAALNQPLFFTIANHKFTVVGADASYLKPFTTSVIMLG  269

Query  796  PGQ  804
            PGQ
Sbjct  270  PGQ  272



>ref|XP_004491004.1| PREDICTED: laccase-5-like [Cicer arietinum]
Length=569

 Score =   365 bits (936),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 170/248 (69%), Positives = 198/248 (80%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+  + + H HEFV+ ATP KRLC THS ITVNGQFPGPTLEV NGDTLV+KVIN A YN
Sbjct  16   ASLANAKIHEHEFVVQATPVKRLCNTHSSITVNGQFPGPTLEVNNGDTLVVKVINKAHYN  75

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHGIRQI + WADGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVY
Sbjct  76   VTIHWHGIRQIRTGWADGPEFITQCPIRPGESYTYRFTIQGQEGTLWWHAHSSWLRATVY  135

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++I P+ G  YPF KP +E P+LLGEWW+ +   V++QAT TGAAPN+SDAYTING P
Sbjct  136  GALIIRPKEGETYPFTKPKRETPLLLGEWWDANPIDVIKQATQTGAAPNISDAYTINGQP  195

Query  604  GDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C  +  T V + +GET LLRVINAALNQ LFF+VANH   VV  DA+Y KPF++N
Sbjct  196  GDLYKCSSQETTIVPIDSGETNLLRVINAALNQPLFFTVANHKLIVVGADASYVKPFTTN  255

Query  781  VIMLGPGQ  804
             +MLGPGQ
Sbjct  256  TLMLGPGQ  263



>ref|XP_010067566.1| PREDICTED: laccase-5 [Eucalyptus grandis]
 gb|KCW65725.1| hypothetical protein EUGRSUZ_G03098 [Eucalyptus grandis]
Length=571

 Score =   365 bits (936),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 168/251 (67%), Positives = 199/251 (79%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            S   T    + +YH+FV+ AT  KRLC TH+ ITVNGQFPGPTLEV +GDTLV+ V+N A
Sbjct  18   SVAVTLADAKVYYHDFVVQATKVKRLCTTHNTITVNGQFPGPTLEVNDGDTLVVNVVNKA  77

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            RYN T+HWHG+RQ+ S WADGP ++TQCPI+PG  YTYRFTIQ Q GTLWWHAH+ WLRA
Sbjct  78   RYNVTIHWHGVRQVRSGWADGPEFVTQCPIRPGGSYTYRFTIQGQVGTLWWHAHSSWLRA  137

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGA+VI P+ G  YPFPKP +E PILLGEWW+ +   V+R+AT TG APNVSDAYTIN
Sbjct  138  TVYGALVIRPKEGTSYPFPKPKRETPILLGEWWDANPIDVVREATRTGGAPNVSDAYTIN  197

Query  595  GWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C  +    V + +GET LLRVINAALNQ+LFF+VANH FTVV  DA+Y KPF
Sbjct  198  GQPGDLYNCSSKDTVIVPIDSGETHLLRVINAALNQELFFTVANHRFTVVGADASYLKPF  257

Query  772  SSNVIMLGPGQ  804
            +++VIMLGPGQ
Sbjct  258  TTSVIMLGPGQ  268



>ref|XP_010931307.1| PREDICTED: laccase-3-like [Elaeis guineensis]
Length=574

 Score =   364 bits (934),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 165/245 (67%), Positives = 201/245 (82%), Gaps = 1/245 (0%)
 Frame = +1

Query  73   LSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATL  252
            +  E HYH+FV+ ATP KRLCKTH+IITVNGQ+PGPTLEV+NGDTLVI V+N ARYN T+
Sbjct  27   IKAEVHYHDFVVQATPVKRLCKTHNIITVNGQYPGPTLEVKNGDTLVINVVNRARYNVTI  86

Query  253  HWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAI  432
            HWHGIRQ+ + WADGP  +TQCPI+PG  YTYRFTI+ QEGTLWWHAH+ WLRATV+GA+
Sbjct  87   HWHGIRQMRTAWADGPEMVTQCPIRPGRSYTYRFTIEGQEGTLWWHAHSSWLRATVHGAL  146

Query  433  VIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDL  612
            +I+P+    YPF KP +EIPI+LGEWW+ +   V+RQAT TGAAPN SDA+TING PGDL
Sbjct  147  IIHPKEKTSYPFTKPKREIPIILGEWWDANPIDVVRQATRTGAAPNTSDAFTINGQPGDL  206

Query  613  YTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIM  789
            Y C  +G T + V  GET LLR+INAALN +LFF++A H  TVV  DA+YTKPF+++V+M
Sbjct  207  YKCSGKGTTVIPVAAGETNLLRIINAALNTELFFTIAGHKMTVVGADASYTKPFTTSVLM  266

Query  790  LGPGQ  804
            LGPGQ
Sbjct  267  LGPGQ  271



>ref|XP_008363776.1| PREDICTED: laccase-12-like [Malus domestica]
Length=582

 Score =   364 bits (934),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 198/249 (80%), Gaps = 1/249 (0%)
 Frame = +1

Query  61   TATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARY  240
            T +    + H HEFVI AT  KRLCKTH+ ITVNGQ+PGPTLEV NGDTLV+KV N ARY
Sbjct  29   TISLAEPKIHKHEFVIQATKVKRLCKTHNSITVNGQYPGPTLEVNNGDTLVVKVTNKARY  88

Query  241  NATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATV  420
            NAT+HWHGIRQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATV
Sbjct  89   NATIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATV  148

Query  421  YGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGW  600
            YGA++I+P+ G  YPF KP +E  ILLGEWW+ +   V+RQAT TGAAPNVSDAYTING 
Sbjct  149  YGALIIHPKQGDSYPFTKPKRETAILLGEWWDANPIDVVRQATRTGAAPNVSDAYTINGQ  208

Query  601  PGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSS  777
            PGDLY C  +    V +  GET LLRVINAALNQ LFFSVANH  TVV  DA+YTKPF++
Sbjct  209  PGDLYNCSSKDTVIVPIDVGETNLLRVINAALNQPLFFSVANHKLTVVSADASYTKPFTT  268

Query  778  NVIMLGPGQ  804
             V+MLGPGQ
Sbjct  269  TVLMLGPGQ  277



>ref|XP_007008849.1| Laccase 12 [Theobroma cacao]
 gb|EOY17659.1| Laccase 12 [Theobroma cacao]
Length=573

 Score =   363 bits (932),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/251 (68%), Positives = 202/251 (80%), Gaps = 2/251 (1%)
 Frame = +1

Query  58   CTATFLS-GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            C+A  L+  E   H+FVI ATP KRLCKTHS ITVNG FPGPTLEV++GDTL +KVIN A
Sbjct  19   CSALCLANAEVQQHQFVIQATPVKRLCKTHSSITVNGMFPGPTLEVKDGDTLEVKVINKA  78

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            RYN T+HWHGIRQ+ + WADGP ++TQCPI+PG  YTYRFTIQ Q GTLWWHAH+ WLRA
Sbjct  79   RYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIQGQVGTLWWHAHSSWLRA  138

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGA++I P+ G  YPFPKP +E PILLGEWW+ +   V+R+AT TGA+PN+SDAYTIN
Sbjct  139  TVYGALIIRPKEGESYPFPKPKRETPILLGEWWDANPIDVVREATRTGASPNISDAYTIN  198

Query  595  GWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C  +  T V + +GET LLRVINAALNQ LFF+VANH  TVV  DA+Y KPF
Sbjct  199  GQPGDLYICSSKDTTIVPIDSGETNLLRVINAALNQPLFFTVANHKLTVVGADASYLKPF  258

Query  772  SSNVIMLGPGQ  804
            +++VIMLGPGQ
Sbjct  259  TTSVIMLGPGQ  269



>gb|KDO50911.1| hypothetical protein CISIN_1g039963mg [Citrus sinensis]
Length=578

 Score =   363 bits (932),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/248 (68%), Positives = 202/248 (81%), Gaps = 2/248 (1%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+    E  +HEF I A P KRLC+TH+ +TVNGQFPGPTL+VR+GDTL+I  IN A+YN
Sbjct  28   ASLSHAEIQFHEF-IEAKPVKRLCRTHNTVTVNGQFPGPTLQVRDGDTLIITTINRAQYN  86

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             TLHWHG+   G+ WADGP Y+TQCPIQPG  YTY+FTI+ QEGTLWWHAH+RW+RATVY
Sbjct  87   ITLHWHGVNLKGNPWADGPEYVTQCPIQPGRSYTYQFTIEGQEGTLWWHAHSRWIRATVY  146

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GAI+IYPR+G  YPFP P++EIPILLGEWW+++   V+ QA FTGAAPNVSDA+TING P
Sbjct  147  GAIIIYPRIGSSYPFPVPNREIPILLGEWWDKNPMDVLMQAIFTGAAPNVSDAFTINGQP  206

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C R  T + QV+ GETVLLR+INAA+NQ+LFF VANH  TVV VD +YTK FS++
Sbjct  207  GDLYRCSRRETVRFQVEAGETVLLRIINAAMNQELFFGVANHNLTVVGVDTSYTKAFSTS  266

Query  781  VIMLGPGQ  804
            VIM+ PGQ
Sbjct  267  VIMIAPGQ  274



>ref|XP_008792257.1| PREDICTED: laccase-3-like [Phoenix dactylifera]
Length=576

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 164/247 (66%), Positives = 199/247 (81%), Gaps = 1/247 (0%)
 Frame = +1

Query  67   TFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNA  246
            + +  E HYH+FV+ A P KRLCKTH+IITVNGQFPGPTLEV+NGDTLVI V+N ARYN 
Sbjct  27   SHIKAEVHYHDFVVQAKPVKRLCKTHNIITVNGQFPGPTLEVKNGDTLVISVVNRARYNV  86

Query  247  TLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYG  426
            TLHWHG+RQ+ + WADGP  +TQCPI+PG  YTYRFT++ QEGTLWWHAH+ WLRATVYG
Sbjct  87   TLHWHGVRQMRTAWADGPEMVTQCPIRPGGSYTYRFTVEGQEGTLWWHAHSSWLRATVYG  146

Query  427  AIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPG  606
            A++I+P+    YPF KP +EIPILLGEWW+ +   V+R+AT TGAAPN SDA+TING PG
Sbjct  147  ALIIHPKEYTSYPFAKPKREIPILLGEWWDANPIDVVRKATRTGAAPNTSDAFTINGQPG  206

Query  607  DLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNV  783
            DLY C   G T + V  GE  LLR+INAALN +LFF++A H  TVV  DA+YTKPF+++V
Sbjct  207  DLYNCSSEGTTVISVAAGEANLLRIINAALNTELFFTIAGHKMTVVGADASYTKPFTTSV  266

Query  784  IMLGPGQ  804
            +MLGPGQ
Sbjct  267  LMLGPGQ  273



>ref|XP_004242503.1| PREDICTED: laccase-3-like [Solanum lycopersicum]
Length=568

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/251 (68%), Positives = 202/251 (80%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            S  ++F + E+H H+F +  T   RLC+T  IITVNGQFPGPTL VRNGDT+V+ V+N A
Sbjct  20   SLLSSFANAESHKHDFTVQETSVTRLCRTKKIITVNGQFPGPTLTVRNGDTVVVNVVNRA  79

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            RYN T+HWHGIRQ+ + WADGP Y+TQCPI+PG  YTYRFTI+ QEGTLWWHAH++WLRA
Sbjct  80   RYNVTIHWHGIRQMRTPWADGPEYVTQCPIRPGGSYTYRFTIENQEGTLWWHAHSKWLRA  139

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGA+VI P+ G  +PF  P K+ P++LGEWW RDI +V RQA FTGAAPN SDAYTIN
Sbjct  140  TVYGALVILPKQGSNFPFSLPQKDFPVILGEWWNRDIIAVQRQAQFTGAAPNNSDAYTIN  199

Query  595  GWPGDLYTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C  +G  K  V  GE+VLLRVINAALNQQLFFSVANH+ TVV +DATY KPF
Sbjct  200  GQPGDLYRCSTQGTVKYSVNPGESVLLRVINAALNQQLFFSVANHMLTVVGIDATYNKPF  259

Query  772  SSNVIMLGPGQ  804
            ++NVIM+GPGQ
Sbjct  260  TTNVIMVGPGQ  270



>ref|XP_008441484.1| PREDICTED: laccase-12 [Cucumis melo]
Length=574

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 200/242 (83%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            +TH H+F+I ATP KRLCKTH+ ITVNGQFPGPTLE+ NGDTL++ VIN A+YN T+HWH
Sbjct  28   QTHRHQFIIQATPVKRLCKTHNAITVNGQFPGPTLEINNGDTLIVNVINKAKYNVTIHWH  87

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            GIRQ+ + WADGP ++TQCPI+PG  YTYRFT+Q QEGTLWWHAH+ WLRATVYGA++I+
Sbjct  88   GIRQLRTGWADGPEFVTQCPIRPGGSYTYRFTVQGQEGTLWWHAHSSWLRATVYGALIIH  147

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P+ G  YPFPKP++E  +L+GEWW+ +   V+RQAT TGAAPNVSDAYT NG PGDLY C
Sbjct  148  PKEGDSYPFPKPNREATLLMGEWWDANPIDVLRQATRTGAAPNVSDAYTFNGQPGDLYKC  207

Query  622  -HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
              +    V + +GET LLRV+N+ALNQ LFF+VANH  TVV  DA+YTKPF+++V+MLGP
Sbjct  208  SSKDTIIVPIDSGETNLLRVVNSALNQALFFTVANHKLTVVGADASYTKPFTTSVLMLGP  267

Query  799  GQ  804
            GQ
Sbjct  268  GQ  269



>ref|XP_010491317.1| PREDICTED: laccase-13 isoform X2 [Camelina sativa]
Length=568

 Score =   362 bits (929),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 174/250 (70%), Positives = 200/250 (80%), Gaps = 4/250 (2%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+ ++ E H+HEF I  TP KRLC+ H+ ITVNGQFPGPTLEVRNGD+LVI  IN ARYN
Sbjct  16   ASLVNAEVHFHEF-IQETPVKRLCRVHNSITVNGQFPGPTLEVRNGDSLVITAINKARYN  74

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             +LHWHGIRQ+ + WADGP YITQCPIQPG  YTYRFTI+ QEGTLWWHAH+RWLRATVY
Sbjct  75   ISLHWHGIRQMRNPWADGPEYITQCPIQPGGSYTYRFTIEDQEGTLWWHAHSRWLRATVY  134

Query  424  GAIVIYPRLGVP-YPFPK-PDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTING  597
            GA++I P L  P YPFP  P +EI +LLGEWW+R+   V+  A FTGAAPN+SDAYTING
Sbjct  135  GALIIRPPLSSPHYPFPVIPKREITLLLGEWWDRNPMDVLNLAQFTGAAPNISDAYTING  194

Query  598  WPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFS  774
             PGDLY C    T +  V +GE VLLRVIN+ALNQ+LFF VANH  TVV  DA+YTKPFS
Sbjct  195  QPGDLYRCSSQETLRFLVGSGEIVLLRVINSALNQELFFGVANHKLTVVAADASYTKPFS  254

Query  775  SNVIMLGPGQ  804
            +NVIMLGPGQ
Sbjct  255  TNVIMLGPGQ  264



>ref|XP_010423249.1| PREDICTED: laccase-13-like isoform X1 [Camelina sativa]
Length=569

 Score =   362 bits (929),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/250 (69%), Positives = 199/250 (80%), Gaps = 3/250 (1%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+ ++ E H HEFVI  TP KRLC+ H+ ITVNGQFPGPTLEVRNGD+L I  IN ARYN
Sbjct  16   ASLVNAEVHLHEFVIQETPVKRLCRVHNSITVNGQFPGPTLEVRNGDSLFITAINKARYN  75

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             +LHWHGIRQ+ + WADGP YITQCPIQPG  YTY FTI+ QEGTLWWHAH+RWLRATVY
Sbjct  76   ISLHWHGIRQMRNPWADGPEYITQCPIQPGGSYTYSFTIEDQEGTLWWHAHSRWLRATVY  135

Query  424  GAIVIYPRLGVP-YPFPK-PDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTING  597
            GA++I P L  P YPFP  P +EI +LLGEWW+R+   V+  A FTGAAPN+SDA+TING
Sbjct  136  GALIIRPPLSSPHYPFPVIPKREITLLLGEWWDRNPMDVLNVAQFTGAAPNISDAFTING  195

Query  598  WPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFS  774
             PGDLY C    T +  V +GE VLLRVIN+ALNQ+LFF+VANH  TVV  DA+YTKPFS
Sbjct  196  QPGDLYRCSSQETLRFLVGSGEIVLLRVINSALNQELFFAVANHKLTVVAADASYTKPFS  255

Query  775  SNVIMLGPGQ  804
            +NVIMLGPGQ
Sbjct  256  TNVIMLGPGQ  265



>ref|XP_011076646.1| PREDICTED: laccase-12 [Sesamum indicum]
Length=578

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/249 (67%), Positives = 196/249 (79%), Gaps = 1/249 (0%)
 Frame = +1

Query  61   TATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARY  240
            T      + HYH+FV+ ATP KRLC+T S ITVNG +PGPTLEV NGDTLV+ V+N ARY
Sbjct  27   TMPITDAKVHYHDFVVQATPVKRLCRTRSTITVNGMYPGPTLEVNNGDTLVVNVVNRARY  86

Query  241  NATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATV  420
            N T+HWHG+RQI + W+DGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATV
Sbjct  87   NVTIHWHGVRQIRTGWSDGPEFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATV  146

Query  421  YGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGW  600
            YGA++I P+ G  YPFPKP +E  +LLGEWW  D   V+RQAT TGAAPNVSDAYTING 
Sbjct  147  YGALIIRPKEGDSYPFPKPKRETALLLGEWWNADPIDVVRQATRTGAAPNVSDAYTINGQ  206

Query  601  PGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSS  777
            PGDLY C  R    V V +GET LLRV+N+ALNQQLFF VANH  TVV  DA+Y KPF++
Sbjct  207  PGDLYNCSSRDTIIVPVDSGETNLLRVVNSALNQQLFFKVANHKLTVVGADASYVKPFTT  266

Query  778  NVIMLGPGQ  804
            +V+MLGPGQ
Sbjct  267  SVLMLGPGQ  275



>ref|XP_009599788.1| PREDICTED: laccase-3-like [Nicotiana tomentosiformis]
Length=570

 Score =   362 bits (928),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 167/244 (68%), Positives = 195/244 (80%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + + H HEF +  T   RLCKT +IITVNGQFPGPTL VRNGD LV++V N ARYN T+H
Sbjct  28   NADIHQHEFAVQETRITRLCKTKNIITVNGQFPGPTLTVRNGDKLVVRVANRARYNVTIH  87

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHGIRQ+ + WADGP Y+TQCPI+PG  YTYRFTI+ QEGTLWWHAH+RWLRATVYGA+V
Sbjct  88   WHGIRQMRTPWADGPEYVTQCPIKPGGVYTYRFTIEDQEGTLWWHAHSRWLRATVYGALV  147

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I P+ G  +PF +P K+IPI+LGEWW +DI ++ RQ  FTGAAPN+SDAYTING PGDLY
Sbjct  148  ILPKQGSHFPFSQPKKDIPIILGEWWNKDIIALQRQTQFTGAAPNISDAYTINGQPGDLY  207

Query  616  TCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C    T K+ V  GET+LLRVINAALNQQLFFSVANH   VV  DA Y KPF++NVIM+
Sbjct  208  RCSSQDTLKLLVNPGETILLRVINAALNQQLFFSVANHKLIVVGADAAYNKPFTTNVIMV  267

Query  793  GPGQ  804
            GPGQ
Sbjct  268  GPGQ  271



>ref|XP_004138412.1| PREDICTED: laccase-12-like [Cucumis sativus]
 ref|XP_004172777.1| PREDICTED: laccase-12-like [Cucumis sativus]
Length=574

 Score =   362 bits (928),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 164/242 (68%), Positives = 199/242 (82%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            +TH H+FVI ATP KRLCKTH+ ITVNGQFPGPTLE+RNGDTL++ VIN A+YN T+HWH
Sbjct  28   QTHRHQFVIQATPVKRLCKTHNAITVNGQFPGPTLEMRNGDTLIVTVINKAKYNVTIHWH  87

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            GIRQ+ + WADGP ++TQCPI+PG  YTYRFT+Q QEGTLWWHAH+ WLRATVYGA++I 
Sbjct  88   GIRQLRTGWADGPEFVTQCPIKPGRSYTYRFTVQGQEGTLWWHAHSSWLRATVYGALIIR  147

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            PR G  YPFPKP +E  +L+GEWW+ +   V+RQAT TGAAPN+SDAYT NG PGDLY C
Sbjct  148  PREGESYPFPKPHREATLLMGEWWDANPIDVVRQATRTGAAPNISDAYTFNGQPGDLYKC  207

Query  622  -HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
              +    V + +GET LLRV+N+ALNQ LFF+VANH  TVV  DA+YTKPF+++V+MLGP
Sbjct  208  SSKDTIIVPIDSGETNLLRVVNSALNQALFFTVANHKLTVVGADASYTKPFTTSVLMLGP  267

Query  799  GQ  804
            GQ
Sbjct  268  GQ  269



>ref|XP_008799813.1| PREDICTED: laccase-3 [Phoenix dactylifera]
Length=573

 Score =   361 bits (927),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 163/243 (67%), Positives = 199/243 (82%), Gaps = 1/243 (0%)
 Frame = +1

Query  79   GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHW  258
             E HYH+FV+ ATP KRLCKTH+IITVNGQ+PGPTLEV+NGDTLVI V+N A YN TLHW
Sbjct  30   AEVHYHDFVVQATPVKRLCKTHNIITVNGQYPGPTLEVKNGDTLVINVVNRASYNVTLHW  89

Query  259  HGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVI  438
            HG+RQ+ + WADGP  +TQCPI+PG  YTYRFTI+ QEGTLWWHAH+ WLRATVYGA++I
Sbjct  90   HGVRQMRTAWADGPEMVTQCPIRPGGSYTYRFTIEGQEGTLWWHAHSSWLRATVYGALII  149

Query  439  YPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYT  618
            +P+    YPF KP +EIPILLGEWW+ +   V+R+AT TGAAPN+SDA+TING PGDLY 
Sbjct  150  HPKENTSYPFAKPAREIPILLGEWWDANPIDVVREATRTGAAPNISDAFTINGQPGDLYN  209

Query  619  C-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLG  795
            C  +  T + V  G+T LLR+INAALN +LFF++A H  TVV  DA+YTKPF+++V+MLG
Sbjct  210  CSSKDTTVIPVAPGDTNLLRIINAALNTELFFAIAGHQMTVVGADASYTKPFTTSVVMLG  269

Query  796  PGQ  804
            PGQ
Sbjct  270  PGQ  272



>ref|XP_010922645.1| PREDICTED: laccase-3-like [Elaeis guineensis]
Length=573

 Score =   361 bits (926),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 165/245 (67%), Positives = 199/245 (81%), Gaps = 1/245 (0%)
 Frame = +1

Query  73   LSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATL  252
            +  E HYH+FV+ ATP KRLCKTH+IITVNGQ+PGPTLEV+NGDTLVI V+N ARYN TL
Sbjct  28   IKAEVHYHDFVVQATPVKRLCKTHNIITVNGQYPGPTLEVKNGDTLVINVVNRARYNVTL  87

Query  253  HWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAI  432
            HWHGIRQ+ + WADGP  +TQCPI+PG  YTYRFTI+ QEGTLWWHAH+ WLRATVYGA+
Sbjct  88   HWHGIRQMRTGWADGPEMVTQCPIRPGGSYTYRFTIEGQEGTLWWHAHSSWLRATVYGAL  147

Query  433  VIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDL  612
            +I+P+    YPF  P +EIPILLGEWW+ +   V+R+AT TGAAPN+SDA+TING PGD 
Sbjct  148  IIHPKENNSYPFTNPTREIPILLGEWWDANPIDVVREATRTGAAPNISDAFTINGQPGDF  207

Query  613  YTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIM  789
            Y C  +  T + V  G+T LLRVINAALN +LFF++A H  TVV  DA+YTKPF+++VIM
Sbjct  208  YNCSGKDTTVIPVGAGDTNLLRVINAALNTELFFAIAGHQMTVVGADASYTKPFTTSVIM  267

Query  790  LGPGQ  804
            LGPGQ
Sbjct  268  LGPGQ  272



>ref|XP_004241090.2| PREDICTED: laccase-12-like isoform X1 [Solanum lycopersicum]
Length=583

 Score =   361 bits (926),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 198/244 (81%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + E HYH+FVI ATP KRLCK H+ ITVNGQFPGPTL+V NGD LVI V+N A+YN T+H
Sbjct  38   TAEIHYHDFVIQATPVKRLCKIHNTITVNGQFPGPTLQVNNGDALVINVVNRAQYNVTIH  97

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG++QI + WADGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYGA++
Sbjct  98   WHGVKQIRTAWADGPEFITQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALI  157

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            IYP+ G  YPF KP +E PILLGEWW+ +   V+RQAT TGAAP VSDAYTING PG+LY
Sbjct  158  IYPKEGEFYPFSKPKRETPILLGEWWDVNPIDVVRQATRTGAAPKVSDAYTINGQPGNLY  217

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +  T V V +GET LLRVINAALNQ LFF+VANH  TVV  DA+Y +PF+++V+ML
Sbjct  218  RCSSKDTTVVIVDSGETNLLRVINAALNQALFFAVANHKLTVVAADASYVQPFTTSVLML  277

Query  793  GPGQ  804
            GPGQ
Sbjct  278  GPGQ  281



>ref|XP_007163585.1| hypothetical protein PHAVU_001G246700g [Phaseolus vulgaris]
 gb|ESW35579.1| hypothetical protein PHAVU_001G246700g [Phaseolus vulgaris]
Length=580

 Score =   360 bits (925),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 168/252 (67%), Positives = 200/252 (79%), Gaps = 4/252 (2%)
 Frame = +1

Query  61   TATFLS---GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            T+ F+S    + H HEF++ ATP KRLCKTH+ ITVNGQFPGPTLE+ NGDTLV+KV N 
Sbjct  17   TSPFMSSAYAKIHAHEFLVEATPVKRLCKTHNAITVNGQFPGPTLEINNGDTLVVKVTNK  76

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN T+HWHG+RQ+ + WADGP ++TQCPI+PG  YTYRFT+Q QEGTLWWHAH+ WLR
Sbjct  77   ARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGGSYTYRFTVQGQEGTLWWHAHSSWLR  136

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I PR G  YPFPKP+ E PILLGEWW+ +   V+R+A  TG APNVSDAYTI
Sbjct  137  ATVYGALIIRPREGELYPFPKPNHETPILLGEWWDANPIDVVREARRTGGAPNVSDAYTI  196

Query  592  NGWPGDLYTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C  +  + V +  GET LLRVINAALNQ LFF+VANH  TVV  DA+Y KP
Sbjct  197  NGQPGDLYKCSTKDTSIVPIHGGETNLLRVINAALNQPLFFTVANHKLTVVGADASYLKP  256

Query  769  FSSNVIMLGPGQ  804
            F++ V+MLGPGQ
Sbjct  257  FTTKVLMLGPGQ  268



>ref|XP_006596443.1| PREDICTED: laccase-3-like [Glycine max]
Length=575

 Score =   360 bits (924),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 162/244 (66%), Positives = 197/244 (81%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + E HYHEFVI   P KRLC+T +I+TVNGQFPGPT+E RNGD+L IKV+NA  YN ++H
Sbjct  29   AAENHYHEFVIQTVPVKRLCRTQNILTVNGQFPGPTVEARNGDSLAIKVVNAGPYNISIH  88

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+R + + WADGP+Y+TQCPIQPG  YTYRFTIQ QEGTLWWHAHT +LRATVYGA++
Sbjct  89   WHGLRMLRNPWADGPSYVTQCPIQPGGSYTYRFTIQNQEGTLWWHAHTGFLRATVYGALI  148

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            IYP+LG PYPF  P +E P+LL EW++RD   ++RQ  FTGA PNVS AYTING PGDLY
Sbjct  149  IYPKLGSPYPFSMPKREYPLLLAEWFDRDPMVLLRQTQFTGAPPNVSVAYTINGQPGDLY  208

Query  616  TCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C    T +V V  GET+LLR+IN+ALNQ+LFF++ANH  TVV  DA YTKPF++NV+M+
Sbjct  209  RCSSQETVRVPVDAGETILLRIINSALNQELFFAIANHRMTVVATDAAYTKPFTTNVLMI  268

Query  793  GPGQ  804
            GPGQ
Sbjct  269  GPGQ  272



>ref|XP_003518325.1| PREDICTED: laccase-3-like [Glycine max]
Length=575

 Score =   360 bits (923),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 162/244 (66%), Positives = 196/244 (80%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + E HYHEFVI   P KRLC+T +I+TVNGQFPGPT+E RNGD+L IKV+NA  YN ++H
Sbjct  29   AAENHYHEFVIQTVPVKRLCRTQNILTVNGQFPGPTVEARNGDSLAIKVVNAGPYNISIH  88

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+R + + WADGP+Y+TQCPIQPG  YTYRFTIQ QEGTLWWHAHT +LRATVYGA++
Sbjct  89   WHGLRMLRNPWADGPSYVTQCPIQPGGSYTYRFTIQNQEGTLWWHAHTGFLRATVYGALI  148

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            IYP+LG PYPF  P +E P+LL EW+ RD   ++RQ  FTGA PNVS AYTING PGDLY
Sbjct  149  IYPKLGSPYPFSMPKREYPLLLAEWFNRDPMVLLRQTQFTGAPPNVSVAYTINGQPGDLY  208

Query  616  TCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C    T +V V  GET+LLR+IN+ALNQ+LFF++ANH  TVV  DA YTKPF++NV+M+
Sbjct  209  RCSSQETVRVPVDAGETILLRIINSALNQELFFTIANHRMTVVATDAAYTKPFTTNVLMI  268

Query  793  GPGQ  804
            GPGQ
Sbjct  269  GPGQ  272



>ref|XP_002520797.1| laccase, putative [Ricinus communis]
 gb|EEF41506.1| laccase, putative [Ricinus communis]
Length=581

 Score =   360 bits (923),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 170/252 (67%), Positives = 200/252 (79%), Gaps = 4/252 (2%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            SS  AT +   TH HEFVI AT  KRLCKT ++ITVNG FPGPTLEV NGDTLV+ V N 
Sbjct  28   SSANATPM---THNHEFVIQATSVKRLCKTQNVITVNGMFPGPTLEVNNGDTLVVTVTNR  84

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            A+YN T+HWHGIRQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  85   AQYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGGTYTYRFTIQAQEGTLWWHAHSSWLR  144

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P+ G  YPFPKP +E PI+LGEWW  +   V+R+AT TG APNVSDAYTI
Sbjct  145  ATVYGALIIHPKEGSSYPFPKPKRETPIILGEWWNANPIDVLRKATRTGGAPNVSDAYTI  204

Query  592  NGWPGDLYTCHRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C    T  V + +GET LLRVINAA+NQ LFF+VANH  TVV  DA+YTKP
Sbjct  205  NGQPGDLYNCSSQDTVIVPIDSGETNLLRVINAAMNQPLFFTVANHRLTVVGADASYTKP  264

Query  769  FSSNVIMLGPGQ  804
            F+++V+MLGPGQ
Sbjct  265  FTTSVLMLGPGQ  276



>ref|XP_008343632.1| PREDICTED: laccase-12-like [Malus domestica]
Length=583

 Score =   360 bits (923),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 171/252 (68%), Positives = 197/252 (78%), Gaps = 3/252 (1%)
 Frame = +1

Query  58   CTATFLSGE--THYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
             ++T  S E  TH HEFVI AT  KRLCKTH+ ITVNGQ+PGPTLE  NGDTL IKV N 
Sbjct  26   ASSTMCSAEPKTHQHEFVIQATKVKRLCKTHNSITVNGQYPGPTLEANNGDTLFIKVTNK  85

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN T+HWHGIRQI + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  86   ARYNVTIHWHGIRQIRTGWADGPEFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLR  145

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P+ G  YPF KP +E  +LLGEWW+ +   V+RQAT TG APNVSDAYTI
Sbjct  146  ATVYGALIIHPKQGDSYPFTKPKRETTLLLGEWWDANPIDVIRQATRTGGAPNVSDAYTI  205

Query  592  NGWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C  +    V + +GET LLRVINA LNQ LFFSVANH  TVV  DA+YTKP
Sbjct  206  NGQPGDLYNCSSKDTVIVPIDSGETNLLRVINAGLNQPLFFSVANHKLTVVSADASYTKP  265

Query  769  FSSNVIMLGPGQ  804
            F++ V+MLGPGQ
Sbjct  266  FTTTVLMLGPGQ  277



>gb|EYU20068.1| hypothetical protein MIMGU_mgv1a020620mg [Erythranthe guttata]
Length=551

 Score =   358 bits (920),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 163/244 (67%), Positives = 198/244 (81%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + + HYH+FV+ ATP KRLCKTH+ ITVNG +PGPTLEV NGDTLV+ V+N ARYN T+H
Sbjct  5    NAKVHYHDFVVQATPVKRLCKTHNTITVNGMYPGPTLEVNNGDTLVVNVVNRARYNVTIH  64

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHGIRQ+ + WADGP ++TQCPI+PG  YTYRFTI+ QEGTLWWHAH+ WLRATVYGA++
Sbjct  65   WHGIRQMRTGWADGPEFVTQCPIRPGKSYTYRFTIEGQEGTLWWHAHSSWLRATVYGALI  124

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I+P+ G  YPF  P++E  +LLGEWW+ +   V+RQAT TGAAPNVSDAYTING PGDLY
Sbjct  125  IHPKEGDSYPFTTPNRETALLLGEWWDANPIDVVRQATRTGAAPNVSDAYTINGQPGDLY  184

Query  616  TCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +    V V +GET LLRV+N+ALNQQLFF VANH  TVV  DA+Y KPF+++V+ML
Sbjct  185  NCSTKDTVIVPVDSGETNLLRVVNSALNQQLFFKVANHKLTVVGADASYVKPFTTSVLML  244

Query  793  GPGQ  804
            GPGQ
Sbjct  245  GPGQ  248



>ref|XP_008374344.1| PREDICTED: laccase-12-like [Malus domestica]
Length=583

 Score =   359 bits (922),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 168/252 (67%), Positives = 195/252 (77%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            +S T +    +   HEFV+ ATP KRLCKT + ITVNGQ PGPTLEV NGDTLV+KV N 
Sbjct  26   ASSTMSLAEPQIXKHEFVVQATPVKRLCKTQNSITVNGQLPGPTLEVNNGDTLVVKVTNR  85

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            A+YN T+HWHGIRQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  86   AQYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLR  145

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P+ G  YPF KP  E  +LLGEWW  +   V+RQAT TGAAPNVSDAYTI
Sbjct  146  ATVYGALIIHPKQGDSYPFTKPKSETTLLLGEWWNANPIDVLRQATMTGAAPNVSDAYTI  205

Query  592  NGWPGDLYTCHRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C    T  V + +GET LLRVINAALNQ LFFSVANH  TVV  DA+YTKP
Sbjct  206  NGQPGDLYNCSSQDTVIVPIDSGETNLLRVINAALNQPLFFSVANHKLTVVSADASYTKP  265

Query  769  FSSNVIMLGPGQ  804
            F++ V+M GPGQ
Sbjct  266  FTTTVLMJGPGQ  277



>ref|XP_008233819.1| PREDICTED: laccase-12-like [Prunus mume]
Length=583

 Score =   359 bits (922),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 167/252 (66%), Positives = 198/252 (79%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            +S   +    +TH H+FVI ATP KRLC T + ITVNGQFPGPTLEV NGDTLV+KV N 
Sbjct  25   ASSAMSLAEPKTHQHDFVIQATPVKRLCTTQNSITVNGQFPGPTLEVNNGDTLVVKVTNK  84

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN T+HWHGIRQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  85   ARYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLR  144

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P+ G  YPF KP +E  +LLGEWW  +  +V+RQ+T TG APNVSDAYTI
Sbjct  145  ATVYGALIIHPKQGDSYPFTKPKRETTLLLGEWWNANPINVLRQSTRTGGAPNVSDAYTI  204

Query  592  NGWPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C    T  V + +GET LLR+INAALNQ LFF+VANH  T+V  DA+YTKP
Sbjct  205  NGQPGDLYNCSSQDTIIVPIDSGETNLLRIINAALNQPLFFTVANHKLTIVSADASYTKP  264

Query  769  FSSNVIMLGPGQ  804
            F+S V+MLGPGQ
Sbjct  265  FTSRVLMLGPGQ  276



>ref|XP_002520796.1| laccase, putative [Ricinus communis]
 gb|EEF41505.1| laccase, putative [Ricinus communis]
Length=577

 Score =   358 bits (920),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 166/244 (68%), Positives = 198/244 (81%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + + H+H+FV+ AT  KRLCKTH+ ITVNG FPGPT+EV +GDTLV+KV N ARYN T+H
Sbjct  31   NAKVHHHDFVVQATKVKRLCKTHNTITVNGMFPGPTIEVNSGDTLVVKVTNKARYNVTVH  90

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHGIRQ+ + WADGP +ITQCPI+PG  YTYRFTI+ QEGTLWWHAH+ WLRATVYGA++
Sbjct  91   WHGIRQMRTGWADGPEFITQCPIRPGGSYTYRFTIEGQEGTLWWHAHSSWLRATVYGALI  150

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            IYP+ G  YP+ KP +E PILLGEWW+ +   V+R+AT TGAAPN+SDAYTING PGDLY
Sbjct  151  IYPKDGTSYPYAKPKRETPILLGEWWDANPIDVVREATRTGAAPNISDAYTINGQPGDLY  210

Query  616  TCHRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C    T  V + +GET LLRVINAALNQ LFF++ANH FTVV  DA Y KPFS++VIML
Sbjct  211  NCSSKETVIVPIGSGETHLLRVINAALNQPLFFTIANHKFTVVGADALYLKPFSTSVIML  270

Query  793  GPGQ  804
            GPGQ
Sbjct  271  GPGQ  274



>emb|CDX99004.1| BnaC09g48310D [Brassica napus]
Length=566

 Score =   358 bits (919),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 168/250 (67%), Positives = 199/250 (80%), Gaps = 3/250 (1%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+ ++ E H+HEF+I  TP KRLC+ H+ ITVNGQFPGP LEVRNGD+LVI  IN ARYN
Sbjct  15   ASLVNAEVHFHEFIIQETPVKRLCRVHNSITVNGQFPGPPLEVRNGDSLVITAINKARYN  74

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             +LHWHGIRQ+ + WADGP YITQCPI+PG  Y+YRF I++QEGTLWWHAH+RWLRATVY
Sbjct  75   ISLHWHGIRQMRNPWADGPEYITQCPIKPGGSYSYRFNIEEQEGTLWWHAHSRWLRATVY  134

Query  424  GAIVIYPRLGVP-YPFP-KPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTING  597
            GA++I P L  P YPFP  P +E  +LLGEWW+R+   V+  A FTGAAPNVSDA+TING
Sbjct  135  GALIIRPPLSSPHYPFPVLPKREFTLLLGEWWDRNPMDVLNLAQFTGAAPNVSDAFTING  194

Query  598  WPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFS  774
             PGD Y C    T +  V +GETVLLRVIN+ALNQ+LFF VANH  TVV  DA+YTKPF+
Sbjct  195  QPGDFYRCSSQETLRFLVGSGETVLLRVINSALNQELFFGVANHKLTVVAADASYTKPFT  254

Query  775  SNVIMLGPGQ  804
            +NVIMLGPGQ
Sbjct  255  TNVIMLGPGQ  264



>ref|XP_007218932.1| hypothetical protein PRUPE_ppa003349mg [Prunus persica]
 gb|EMJ20131.1| hypothetical protein PRUPE_ppa003349mg [Prunus persica]
Length=583

 Score =   358 bits (920),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/252 (66%), Positives = 198/252 (79%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            +S   +    +TH+H+FVI ATP KRLC T + ITVNGQFPGPTLEV NGDTLV+KV N 
Sbjct  25   ASSAMSLAEPKTHHHDFVIQATPVKRLCTTQNSITVNGQFPGPTLEVNNGDTLVVKVTNK  84

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN T+HWHGIRQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  85   ARYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLR  144

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P+ G  YPF KP +E  +LLGEWW  +  +V+RQ+T TG APNVSDAYTI
Sbjct  145  ATVYGALIIHPKQGDSYPFTKPKRETTLLLGEWWNANPINVLRQSTRTGGAPNVSDAYTI  204

Query  592  NGWPGDLYTCHRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C    T  V + +GET LLR+INAALNQ LFF+VANH  TVV  DA+Y KP
Sbjct  205  NGQPGDLYNCSSQDTVIVPIDSGETNLLRIINAALNQPLFFTVANHKLTVVSADASYAKP  264

Query  769  FSSNVIMLGPGQ  804
            F++ V+MLGPGQ
Sbjct  265  FTTKVLMLGPGQ  276



>ref|XP_008363777.1| PREDICTED: laccase-12-like [Malus domestica]
Length=583

 Score =   357 bits (917),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/252 (66%), Positives = 198/252 (79%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            +S T +    +TH HEFVI ATP KRLCK+ + ITVNGQFPGPTLEV NGDTLV+KV N 
Sbjct  26   ASSTTSLAEPKTHKHEFVIQATPVKRLCKSRNSITVNGQFPGPTLEVNNGDTLVVKVTNR  85

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            A+YN T+HWHGIRQ+ + WADGP ++TQCPI+ G  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  86   AQYNVTIHWHGIRQMRTGWADGPEFVTQCPIRSGGSYTYRFTIQGQEGTLWWHAHSSWLR  145

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P+ G  YPF KP +E  +LLGEWW  +  +V+RQ+T TG APNVSDAYTI
Sbjct  146  ATVYGALIIHPKQGDSYPFTKPKRETTLLLGEWWNANPINVLRQSTRTGGAPNVSDAYTI  205

Query  592  NGWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C  +    V + + ET LLRVINAALNQ LFFSVANH  TVV  DA+YTKP
Sbjct  206  NGQPGDLYNCSSKDTVIVPIDSSETNLLRVINAALNQPLFFSVANHKLTVVSADASYTKP  265

Query  769  FSSNVIMLGPGQ  804
            F++ V+MLGPGQ
Sbjct  266  FTTTVLMLGPGQ  277



>emb|CDX70010.1| BnaA10g23590D [Brassica napus]
Length=567

 Score =   357 bits (916),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/250 (67%), Positives = 199/250 (80%), Gaps = 3/250 (1%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+ ++ E H+HEF+I  TP KRLC+ H+ ITVNGQFPGPTL+VRNGD+LVI  IN A+YN
Sbjct  15   ASLVNAEVHFHEFIIQETPVKRLCRVHNSITVNGQFPGPTLKVRNGDSLVITAINKAQYN  74

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             +LHWHGI+Q+ + WADGP YITQCPI+PG  YTYRF I++QEGTLWWHAH+RWLRATVY
Sbjct  75   ISLHWHGIKQMRNPWADGPEYITQCPIKPGGSYTYRFNIEEQEGTLWWHAHSRWLRATVY  134

Query  424  GAIVIYPRLGVP-YPFP-KPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTING  597
            GA++I P L  P YPFP  P +E  +LLGEWW+R+   V+  A FTGAAPNVSDA+TING
Sbjct  135  GALIIRPPLSSPHYPFPVLPKREFTLLLGEWWDRNPMDVLNMAQFTGAAPNVSDAFTING  194

Query  598  WPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFS  774
             PGD Y C    T +  V +GETVLLRVIN+ LNQ+LFF VANH  TVV  DA+YTKPFS
Sbjct  195  QPGDFYRCSSQETLRFLVGSGETVLLRVINSGLNQELFFGVANHKLTVVAADASYTKPFS  254

Query  775  SNVIMLGPGQ  804
            +NVIMLGPGQ
Sbjct  255  TNVIMLGPGQ  264



>ref|XP_008369303.1| PREDICTED: laccase-12-like [Malus domestica]
Length=583

 Score =   357 bits (917),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/252 (66%), Positives = 198/252 (79%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            +S T +    +TH HEFVI ATP KRLCK+ + ITVNGQFPGPTLEV NGDTLV+KV N 
Sbjct  26   ASSTTSLAEPKTHKHEFVIQATPVKRLCKSRNSITVNGQFPGPTLEVNNGDTLVVKVTNR  85

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            A+YN T+HWHGIRQ+ + WADGP ++TQCPI+ G  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  86   AQYNVTIHWHGIRQMRTGWADGPEFVTQCPIRSGGSYTYRFTIQGQEGTLWWHAHSSWLR  145

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P+ G  YPF KP +E  +LLGEWW  +  +V+RQ+T TG APNVSDAYTI
Sbjct  146  ATVYGALIIHPKQGDSYPFTKPKRETTLLLGEWWNANPINVLRQSTRTGGAPNVSDAYTI  205

Query  592  NGWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C  +    V + + ET LLRVINAALNQ LFFSVANH  TVV  DA+YTKP
Sbjct  206  NGQPGDLYNCSSKDTVIVPIDSSETNLLRVINAALNQPLFFSVANHKLTVVSADASYTKP  265

Query  769  FSSNVIMLGPGQ  804
            F++ V+MLGPGQ
Sbjct  266  FTTTVLMLGPGQ  277



>ref|XP_009122370.1| PREDICTED: laccase-13 isoform X1 [Brassica rapa]
Length=566

 Score =   357 bits (915),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/250 (67%), Positives = 199/250 (80%), Gaps = 3/250 (1%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+ ++ E H+HEF+I  TP KRLC+ H+ ITVNGQFPGPTL+VRNGD+LVI  IN A+YN
Sbjct  15   ASLVNAEVHFHEFIIQETPVKRLCRVHNSITVNGQFPGPTLKVRNGDSLVITAINKAQYN  74

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             +LHWHGI+Q+ + WADGP YITQCPI+PG  YTYRF I++QEGTLWWHAH+RWLRATVY
Sbjct  75   ISLHWHGIKQMRNPWADGPEYITQCPIKPGGSYTYRFNIEEQEGTLWWHAHSRWLRATVY  134

Query  424  GAIVIYPRLGVP-YPFP-KPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTING  597
            GA++I P L  P YPFP  P +E  +LLGEWW+R+   V+  A FTGAAPNVSDA+TING
Sbjct  135  GALIIRPPLSSPHYPFPVLPKREFTLLLGEWWDRNPMDVLNMAQFTGAAPNVSDAFTING  194

Query  598  WPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFS  774
             PGD Y C    T +  V +GETVLLRVIN+ LNQ+LFF VANH  TVV  DA+YTKPFS
Sbjct  195  QPGDFYRCSSQETLRFLVGSGETVLLRVINSGLNQELFFGVANHKLTVVAADASYTKPFS  254

Query  775  SNVIMLGPGQ  804
            +NVIMLGPGQ
Sbjct  255  TNVIMLGPGQ  264



>ref|XP_009369225.1| PREDICTED: laccase-5-like [Pyrus x bretschneideri]
 ref|XP_009350695.1| PREDICTED: laccase-5-like [Pyrus x bretschneideri]
Length=554

 Score =   356 bits (914),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/242 (68%), Positives = 196/242 (81%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            +TH HEFV+ ATP KRLCK+ + ITVNGQFPGPTLEV NGDTLV+KV N A+YN T+HWH
Sbjct  7    KTHKHEFVVQATPVKRLCKSRNSITVNGQFPGPTLEVNNGDTLVVKVTNRAQYNITIHWH  66

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            GIRQ+ + WADGP ++TQCPI+PG  YTY+FTIQ QEGTLWWHAH+ WLRATVYGA++I+
Sbjct  67   GIRQMRTGWADGPEFVTQCPIRPGGSYTYQFTIQGQEGTLWWHAHSSWLRATVYGALIIH  126

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P+ G  YPF KP +E  +LLGEWW  +  +V+RQAT TG APNVSDAYTING PGDLY C
Sbjct  127  PKQGDSYPFTKPKRETTLLLGEWWNANPINVLRQATKTGGAPNVSDAYTINGQPGDLYNC  186

Query  622  -HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
              +    V + +G+T LLRVINAALNQ LFFSVANH  TVV  DA+YTKPF++ V+MLGP
Sbjct  187  SSKDTVIVPIDSGKTNLLRVINAALNQPLFFSVANHKLTVVSADASYTKPFTTTVLMLGP  246

Query  799  GQ  804
            GQ
Sbjct  247  GQ  248



>ref|NP_001236616.1| diphenol oxidase laccase precursor [Glycine max]
 gb|AAM54731.1| diphenol oxidase laccase [Glycine max]
 gb|AAM89257.1| diphenol oxidase laccase [Glycine max]
Length=589

 Score =   357 bits (916),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/244 (68%), Positives = 194/244 (80%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + + H HEFV+ ATP KRLCKTH+ ITVNGQ+PGPTLE+ NGDTLV+KV N ARYN T+H
Sbjct  33   NAKIHEHEFVVEATPVKRLCKTHNSITVNGQYPGPTLEINNGDTLVVKVTNKARYNVTIH  92

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+RQ+ + WADGP ++T  P  PG  YTYRFT+Q QEGTLWWHAH+ WLRATVYGA++
Sbjct  93   WHGVRQMRTGWADGPEFVTSVPDCPGGSYTYRFTVQGQEGTLWWHAHSSWLRATVYGALI  152

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I PR G PYPFPKP +E PILLGEWW+ +   V+RQAT TG APNVSDAYTING PGDLY
Sbjct  153  IRPREGEPYPFPKPKRETPILLGEWWDANPIDVVRQATRTGGAPNVSDAYTINGQPGDLY  212

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +  T V +  GET LLRVINAALNQ LFF+VANH  TVV  DA+Y KPF++ V++L
Sbjct  213  KCSSKDTTIVPIHAGETNLLRVINAALNQPLFFTVANHKLTVVGADASYLKPFTTKVLIL  272

Query  793  GPGQ  804
            GPGQ
Sbjct  273  GPGQ  276



>gb|KFK43018.1| hypothetical protein AALP_AA1G068300 [Arabis alpina]
Length=970

 Score =   367 bits (942),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/242 (68%), Positives = 199/242 (82%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E H  +F I ATP KRLC+TH IITVNGQFPGPTLEVR+GD+L I VIN ARYN ++HWH
Sbjct  31   EVHVRKFFIKATPVKRLCRTHKIITVNGQFPGPTLEVRDGDSLAITVINKARYNISIHWH  90

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP YITQCPIQPG +YTYR  I +QEGT+WWHAH+RWLRATVYGA++IY
Sbjct  91   GLRQLRNPWADGPEYITQCPIQPGHKYTYRINIDEQEGTVWWHAHSRWLRATVYGALIIY  150

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            PR   PYPFP P ++IPI+LGEWW+R+   V+R A FTGAAPNVSDAYTING PGDLY C
Sbjct  151  PRRDTPYPFPMPKRDIPIILGEWWDRNPMDVLRLAEFTGAAPNVSDAYTINGQPGDLYRC  210

Query  622  HR-GITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
             R   T+  +  GETV LR+INAALNQ+LFF++ANH  TVVEVD+ YTKPF+++V+++ P
Sbjct  211  SRHETTRFTISPGETVQLRLINAALNQELFFAIANHQLTVVEVDSAYTKPFNTSVLVISP  270

Query  799  GQ  804
            GQ
Sbjct  271  GQ  272



>gb|EPS73068.1| hypothetical protein M569_01687, partial [Genlisea aurea]
Length=561

 Score =   355 bits (912),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 195/252 (77%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            SS   T    +THYH FV+  TP KRLC     +TVNG+FPGPTL+VR GDTLV+ V+N 
Sbjct  12   SSLFLTTAFADTHYHNFVVQETPVKRLCNVRDRLTVNGKFPGPTLKVREGDTLVVNVVNR  71

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN T+HWHGIRQ  + WADGP ++TQCPI+PG  YTYRFT+  QEGTLWWHAH+ WLR
Sbjct  72   ARYNVTIHWHGIRQFRTGWADGPEFVTQCPIRPGDGYTYRFTVWGQEGTLWWHAHSSWLR  131

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I P+ G+PYPF KPD E PILLG+WW+ +   V+ +AT TGAAPNVSDAYTI
Sbjct  132  ATVYGALIIRPKKGIPYPFAKPDHESPILLGQWWDENPMDVINRATRTGAAPNVSDAYTI  191

Query  592  NGWPGDLYTCHRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C    TK + +  GET LLRVINAA+NQQLFF +A H FTVV  DA+Y KP
Sbjct  192  NGQPGDLYRCSSQDTKIIHIDNGETKLLRVINAAMNQQLFFKIAGHRFTVVAADASYVKP  251

Query  769  FSSNVIMLGPGQ  804
            F+++VIMLGPGQ
Sbjct  252  FTTSVIMLGPGQ  263



>ref|XP_010031156.1| PREDICTED: laccase-12-like [Eucalyptus grandis]
 gb|KCW50425.1| hypothetical protein EUGRSUZ_J00166 [Eucalyptus grandis]
Length=570

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 194/243 (80%), Gaps = 1/243 (0%)
 Frame = +1

Query  79   GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHW  258
             +  YH+FV+ ATP KRLCKT S ITVNGQ+PGPTLEV +GDTLVI V+N ARYN T+HW
Sbjct  25   AKIQYHDFVVQATPVKRLCKTRSTITVNGQYPGPTLEVNDGDTLVISVVNRARYNVTIHW  84

Query  259  HGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVI  438
            HGIRQ+ + WADGP +ITQCPIQPG  YTYRFTI+ QEGTLWWHAH+ WLRATVYGA++I
Sbjct  85   HGIRQVRTGWADGPEFITQCPIQPGGIYTYRFTIEGQEGTLWWHAHSSWLRATVYGALII  144

Query  439  YPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYT  618
            YPR G  YPF +P +E PILLGEWW  +   V+ +AT TG APN+SDAYTING PGDLY 
Sbjct  145  YPRQGSTYPFAEPKRETPILLGEWWNANPIDVVNEATRTGGAPNISDAYTINGQPGDLYR  204

Query  619  CHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLG  795
            C    T  V + TGET LLRVINAALNQ+LFF+VA+H   VV  DA+Y KPF+++VIMLG
Sbjct  205  CSSSETIIVPIDTGETNLLRVINAALNQELFFAVASHELIVVGADASYLKPFTTSVIMLG  264

Query  796  PGQ  804
            PGQ
Sbjct  265  PGQ  267



>gb|AFV52382.1| laccase [Picea abies]
Length=574

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/244 (66%), Positives = 192/244 (79%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            S E   H FV+ +T  K+LC TH+IITVNGQFPGPTL V NGDTL++KV N A+YNAT+H
Sbjct  32   SAEIQTHTFVLQSTSVKKLCGTHNIITVNGQFPGPTLNVSNGDTLIVKVYNKAQYNATIH  91

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+RQ  + WADGP ++TQCPI+PG  YTYRFTI  QEGTLWWHAH+ WLRA+VYGA++
Sbjct  92   WHGVRQFRTAWADGPEFVTQCPIRPGGSYTYRFTITGQEGTLWWHAHSSWLRASVYGALI  151

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I P +G  YPF KPD++IPI LGEWW R+   V+ QAT TGAAPNVSDA+TING PGDLY
Sbjct  152  ISPTMGTTYPFTKPDRQIPIALGEWWNRNPIDVVNQATRTGAAPNVSDAFTINGQPGDLY  211

Query  616  TCHRG-ITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C    I +V VK GET LLR++N+A+N  LFFSVANH  TVV VDA YTKP  +NV+ML
Sbjct  212  PCSSSDIFRVSVKAGETNLLRIMNSAMNTDLFFSVANHTMTVVAVDALYTKPLKTNVLML  271

Query  793  GPGQ  804
            GPGQ
Sbjct  272  GPGQ  275



>ref|XP_003615861.1| Laccase-like multicopper oxidase [Medicago truncatula]
 gb|AES98819.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=560

 Score =   354 bits (909),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/244 (65%), Positives = 195/244 (80%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + E HYH+FVI     KRLCKT  I+TVNGQFPGPT+E R+GD++VIKV NA  YN ++H
Sbjct  21   AAENHYHQFVIQTATVKRLCKTRRILTVNGQFPGPTIEARDGDSMVIKVTNAGPYNISIH  80

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG R + + WADGP+Y+TQCPIQPG  YTYRFTIQ QEGTLWWHAHT +LRATVYGA +
Sbjct  81   WHGFRMLRNPWADGPSYVTQCPIQPGGSYTYRFTIQNQEGTLWWHAHTGFLRATVYGAFI  140

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            IYP++G PYPF  P +E PILLGEW++RD  +++RQ  FTGA PNVS AYT+NG PGDLY
Sbjct  141  IYPKMGSPYPFSMPTREFPILLGEWFDRDPMALLRQTQFTGAPPNVSVAYTMNGQPGDLY  200

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +G  + QV  GET+LLR+IN+ALNQ+LFFS+ANH  TVV +DA YTKP ++ V+M+
Sbjct  201  RCSSQGTVRFQVYAGETILLRIINSALNQELFFSIANHRMTVVAMDAAYTKPSNTRVLMI  260

Query  793  GPGQ  804
            GPGQ
Sbjct  261  GPGQ  264



>emb|CDX93188.1| BnaC04g47080D [Brassica napus]
Length=569

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/244 (66%), Positives = 196/244 (80%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            +   H+HEF+I AT  KRLC+TH+ ITVNG FPGP L + NGDTLV+KVIN ARYN T+H
Sbjct  25   ANRAHHHEFIIQATKVKRLCETHNSITVNGMFPGPQLVINNGDTLVVKVINRARYNVTIH  84

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+RQ+ + WADGP ++TQCPI+PG+ YTYRFTIQ QEGTLWWHAH+ WLRATVYG+++
Sbjct  85   WHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHSSWLRATVYGSLL  144

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I P  G  YPFP P + +P+LLGEWW+ +   V+R+AT TGAAPN+SDAYTING PGDLY
Sbjct  145  ILPPAGSSYPFPNPHRNVPLLLGEWWDGNPVDVLREATRTGAAPNISDAYTINGQPGDLY  204

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +  T V +  GET+LLRVINAALNQ LFF+VANH FTVV  DA+Y KPF++N I+L
Sbjct  205  KCSSQDTTIVPISVGETILLRVINAALNQPLFFTVANHKFTVVGADASYLKPFTTNAIVL  264

Query  793  GPGQ  804
            GPGQ
Sbjct  265  GPGQ  268



>ref|XP_010534627.1| PREDICTED: laccase-5 [Tarenaya hassleriana]
Length=574

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/250 (66%), Positives = 198/250 (79%), Gaps = 2/250 (1%)
 Frame = +1

Query  61   TATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARY  240
            +A+    + H HEF++ AT  KRLCKTH+ ITVNG FPGPTLEV NGDTLV+KV+N ARY
Sbjct  21   SASLSCAKVHEHEFIVQATKVKRLCKTHNSITVNGMFPGPTLEVYNGDTLVVKVVNRARY  80

Query  241  NATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQ-KQEGTLWWHAHTRWLRAT  417
            N T+HWHG+RQ+ + WADGP ++TQCPI+PG  YTYRFTI   QEGTLWWHAH+ WLRAT
Sbjct  81   NVTIHWHGVRQMRTGWADGPEFVTQCPIRPGHSYTYRFTIHGGQEGTLWWHAHSSWLRAT  140

Query  418  VYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTING  597
            VYGA+++YP+ G  YPFPKP +E PILLGEWW+ +   V+R+AT TGAAPNVSDAYTING
Sbjct  141  VYGALIVYPQRGTDYPFPKPHRETPILLGEWWDANPIDVVREATRTGAAPNVSDAYTING  200

Query  598  WPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFS  774
             PGDLY C  +  T V +  GE  LLRVIN+ALNQ LFF+VANH  TVV  DA+Y KPF+
Sbjct  201  QPGDLYKCSSQDTTIVPINVGERHLLRVINSALNQPLFFTVANHKLTVVGADASYVKPFT  260

Query  775  SNVIMLGPGQ  804
            + V+MLGPGQ
Sbjct  261  TTVLMLGPGQ  270



>ref|XP_004490661.1| PREDICTED: laccase-3-like [Cicer arietinum]
Length=573

 Score =   354 bits (909),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 159/244 (65%), Positives = 193/244 (79%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + E HYHEFVI     KRLCKT +I+TVNGQFPGPT+E R+GD++VIKV NA  YN ++H
Sbjct  27   AAENHYHEFVIQTKSVKRLCKTRNILTVNGQFPGPTIEARDGDSMVIKVTNAGPYNISIH  86

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG R + + WADGP+Y+TQCPIQPG  YTYRFTIQ QEGTLWWHAHT +LRATVYGA +
Sbjct  87   WHGFRMLRNPWADGPSYVTQCPIQPGGSYTYRFTIQNQEGTLWWHAHTGFLRATVYGAFI  146

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            +YP+LG PYPF  P KE PILLGEW++RD   ++RQ  FTGA PN S AYT+NG PGDLY
Sbjct  147  VYPKLGSPYPFSMPRKEFPILLGEWFDRDPMVILRQTQFTGAPPNASVAYTMNGQPGDLY  206

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +G  + QV  GET+LLR+IN+ LNQ+LFFS+ANH  TVV +DA YTKP ++ V+M+
Sbjct  207  RCSSQGTIRFQVDAGETILLRIINSGLNQELFFSIANHRMTVVAMDAAYTKPSTTTVLMI  266

Query  793  GPGQ  804
            GPGQ
Sbjct  267  GPGQ  270



>ref|XP_010921047.1| PREDICTED: LOW QUALITY PROTEIN: laccase-3-like [Elaeis guineensis]
Length=572

 Score =   354 bits (909),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 159/247 (64%), Positives = 197/247 (80%), Gaps = 1/247 (0%)
 Frame = +1

Query  67   TFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNA  246
             + + + HY++FVI  TP KRLCKTH IITVNGQ+PGPTLEVRNGDTLVI  +N A+YN 
Sbjct  25   NYTNAKVHYYDFVIQDTPVKRLCKTHRIITVNGQYPGPTLEVRNGDTLVINAVNRAKYNI  84

Query  247  TLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYG  426
            TLHWHG+ Q  + WADGP Y+TQCPI PG  YTYRFTI+ QEGTLWWHAH+ WLRATV+G
Sbjct  85   TLHWHGVHQNRTGWADGPEYLTQCPIMPGGSYTYRFTIENQEGTLWWHAHSSWLRATVHG  144

Query  427  AIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPG  606
            A++I+P+ G  YPFPKP+KEIP++LGEWW R+   V+RQA  TGAAPN+SDA+ ING PG
Sbjct  145  ALIIHPKEGSNYPFPKPNKEIPVILGEWWNRNPIDVLRQALKTGAAPNISDAFLINGQPG  204

Query  607  DLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNV  783
            DLY C  +  T + V +GET LLR++NAALN +LFFS+A H  TVV  DA YTKPF+++V
Sbjct  205  DLYNCSSKDTTVIPVASGETNLLRIVNAALNNELFFSIAGHKMTVVAADAAYTKPFTTSV  264

Query  784  IMLGPGQ  804
            + +GPG+
Sbjct  265  LKMGPGE  271



>ref|XP_006411293.1| hypothetical protein EUTSA_v10016439mg [Eutrema salsugineum]
 gb|ESQ52746.1| hypothetical protein EUTSA_v10016439mg [Eutrema salsugineum]
Length=573

 Score =   354 bits (908),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 161/249 (65%), Positives = 199/249 (80%), Gaps = 1/249 (0%)
 Frame = +1

Query  61   TATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARY  240
            T    + + H+HEF+I AT  KRLC+TH+ ITVNG FPGPTL V NGDTLV+KVIN ARY
Sbjct  20   TVVVEANKAHHHEFIIQATKVKRLCETHNSITVNGMFPGPTLVVNNGDTLVVKVINRARY  79

Query  241  NATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATV  420
            N T+HWHG+RQ+ + WADGP ++TQCPI+PG+ YTYRFTI+ QEGTLWWHAH+ WLRATV
Sbjct  80   NITIHWHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIEGQEGTLWWHAHSSWLRATV  139

Query  421  YGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGW  600
            YG+I+I P  G  YPFP P + +P+LLGEWW+ +   V+R++  TGAAPN+SDAYTING 
Sbjct  140  YGSILILPPAGSSYPFPNPHRNVPLLLGEWWDANPVDVLRESQRTGAAPNISDAYTINGQ  199

Query  601  PGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSS  777
            PG+LY C  +  T V +  GET+LLRVINAALNQ LFF+VANH FTVV  DA+Y KPF++
Sbjct  200  PGNLYKCSSQDTTIVPINVGETILLRVINAALNQPLFFTVANHKFTVVGADASYLKPFTT  259

Query  778  NVIMLGPGQ  804
            NV++LGPGQ
Sbjct  260  NVVVLGPGQ  268



>ref|NP_001044679.1| Os01g0827300 [Oryza sativa Japonica Group]
 sp|Q941X2.1|LAC3_ORYSJ RecName: Full=Laccase-3; AltName: Full=Benzenediol:oxygen oxidoreductase 
3; AltName: Full=Diphenol oxidase 3; AltName: Full=Urishiol 
oxidase 3; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB68098.1| putative laccase [Oryza sativa Japonica Group]
 dbj|BAF06593.1| Os01g0827300 [Oryza sativa Japonica Group]
 dbj|BAG92758.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55611.1| hypothetical protein OsJ_03932 [Oryza sativa Japonica Group]
Length=567

 Score =   353 bits (906),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 161/248 (65%), Positives = 195/248 (79%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A     E H+HEF++  TP KRLCKTH++ITVNGQ PGPTLEVR GDT+VI V+N A+YN
Sbjct  19   ALLAGAEVHHHEFIVQETPVKRLCKTHNVITVNGQLPGPTLEVREGDTVVINVVNHAQYN  78

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHGIRQ  + WADGP ++TQCPI+PG  Y YRFTI+ QEGTLWWHAH+ WLRATVY
Sbjct  79   VTIHWHGIRQFRTGWADGPEFVTQCPIKPGGSYKYRFTIEGQEGTLWWHAHSSWLRATVY  138

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GA++I PR    YPF KP +E+P++LGEWW+ D   V+R+A  TGAAPN+SDAYTING P
Sbjct  139  GALIIRPRENKTYPFEKPAREVPLILGEWWDADPIQVIREAQRTGAAPNISDAYTINGQP  198

Query  604  GDLYTCHR-GITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C +   T V VK GET LLR INAALNQ+LF S+A H  TVV VDA+YTKPF+++
Sbjct  199  GDLYNCSKEETTAVPVKPGETALLRFINAALNQELFVSIAQHKMTVVGVDASYTKPFTTS  258

Query  781  VIMLGPGQ  804
            V+M+ PGQ
Sbjct  259  VLMIAPGQ  266



>tpg|DAA57028.1| TPA: putative laccase family protein [Zea mays]
Length=572

 Score =   353 bits (906),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 161/244 (66%), Positives = 194/244 (80%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
              E H+HEFVI  TP KRLCKTH+IITVNGQ+PGPTLEVR GDTLVI V+N A+YNAT+H
Sbjct  26   DAEVHHHEFVIQETPVKRLCKTHNIITVNGQYPGPTLEVREGDTLVINVVNRAQYNATIH  85

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHGIRQI + WADGP ++TQCPI+PG  Y YRFTIQ QEGTLWWHAH+ WLRATVYGA++
Sbjct  86   WHGIRQIRTGWADGPEFVTQCPIRPGGSYKYRFTIQGQEGTLWWHAHSSWLRATVYGALI  145

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I PR    YPF KP +E+P++LGEWW+ +   V+R+A  TG  PNVSDA+TING PGDLY
Sbjct  146  IRPRENKTYPFAKPSREVPVILGEWWDANPIDVIREAQRTGGGPNVSDAFTINGQPGDLY  205

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C ++  T + VK GET LLR INAALN +LF ++A H  TVV  DA+YTKPF+++V+ML
Sbjct  206  KCSNKETTAIPVKAGETALLRFINAALNHELFVTIAQHKMTVVATDASYTKPFTTSVLML  265

Query  793  GPGQ  804
             PGQ
Sbjct  266  APGQ  269



>emb|CDX70152.1| BnaA10g25010D [Brassica napus]
Length=565

 Score =   353 bits (906),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 199/252 (79%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            S  +A+ +  +  +H FVI  TP KRLCKT + ITVNG FPGPTLEV +GDTL +KV+N 
Sbjct  15   SLLSASSIIAKVQHHNFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNDGDTLEVKVLNR  74

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN T+HWHG+RQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  75   ARYNITIHWHGVRQMRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLR  134

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P LG  +PFPKPD++  ++LGEWW+ +   V+ QAT TGAAPN+SDAYTI
Sbjct  135  ATVYGALIIHPALGSSFPFPKPDRQTALVLGEWWDANPVDVINQATRTGAAPNISDAYTI  194

Query  592  NGWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C ++    V V +GET LLRVINAALNQ LFF+VANH  TVV  DA+Y KP
Sbjct  195  NGQPGDLYNCSNKETVVVPVNSGETSLLRVINAALNQPLFFTVANHKLTVVGADASYLKP  254

Query  769  FSSNVIMLGPGQ  804
            F++ V+MLGPGQ
Sbjct  255  FTTKVLMLGPGQ  266



>gb|KFK24962.1| hypothetical protein AALP_AA8G048100 [Arabis alpina]
Length=526

 Score =   352 bits (902),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 196/249 (79%), Gaps = 1/249 (0%)
 Frame = +1

Query  61   TATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARY  240
            +A+ +  +  +H+FVI   P KRLCKT + ITVNG FPGPTLEV NGDTL +KV N ARY
Sbjct  18   SASSIIAKVQHHDFVIQEAPVKRLCKTRNAITVNGMFPGPTLEVNNGDTLQVKVHNNARY  77

Query  241  NATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATV  420
            N T+HWHG+RQI + WADGP ++TQCPI+PG  +TYRFTIQ QEGTLWWHAH+ WLRATV
Sbjct  78   NITIHWHGVRQIRTGWADGPEFVTQCPIRPGKSFTYRFTIQGQEGTLWWHAHSSWLRATV  137

Query  421  YGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGW  600
            YGA++I+P LG  +PFPKPD++  ++LGEWW  +   VM++AT TGAAPN+SDAYTING 
Sbjct  138  YGALIIHPTLGSSFPFPKPDRQTALMLGEWWNANPVDVMKEATRTGAAPNISDAYTINGQ  197

Query  601  PGDLYTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSS  777
            PGDLY C  +    V + +GET LLRVINAALNQ LFF+VANH  TVV  DA+Y KPF++
Sbjct  198  PGDLYKCSTKDTVVVPINSGETSLLRVINAALNQPLFFTVANHKLTVVGADASYLKPFTT  257

Query  778  NVIMLGPGQ  804
             V+MLGPGQ
Sbjct  258  KVLMLGPGQ  266



>ref|XP_003537321.1| PREDICTED: laccase-3-like [Glycine max]
 gb|KHN22790.1| Laccase-3 [Glycine soja]
Length=573

 Score =   353 bits (906),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 195/242 (81%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E H+HEFVI A P +RLCKT +IITVNGQFPGPT+E RNGD +VIKV+NAA+YN ++HWH
Sbjct  31   EIHFHEFVIQARPVRRLCKTQNIITVNGQFPGPTVEARNGDFIVIKVVNAAQYNISIHWH  90

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+R + + WADGP+Y+TQCPIQPG  YTYRF I+ QEGTLWWHAHT +LRATVYGA +IY
Sbjct  91   GLRMLRNPWADGPSYVTQCPIQPGGSYTYRFRIRDQEGTLWWHAHTGFLRATVYGAFIIY  150

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            PRLG PYPF  P +E+P+LLGEW++ D+  + RQA F G  PN S AYTING PGDLY C
Sbjct  151  PRLGSPYPFSMPKQEVPLLLGEWFDTDLVLLQRQADFAGLPPNTSVAYTINGQPGDLYRC  210

Query  622  HRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
                T +V V  GET++LR+I++ALNQ+LFFS+ANH  TVV  DA YTKPF ++V+M+GP
Sbjct  211  SSQETVRVPVDAGETIMLRIISSALNQELFFSIANHTMTVVGTDAAYTKPFKTSVLMIGP  270

Query  799  GQ  804
            GQ
Sbjct  271  GQ  272



>ref|NP_001148479.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG31666.1| L-ascorbate oxidase precursor [Zea mays]
Length=572

 Score =   352 bits (903),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/244 (66%), Positives = 194/244 (80%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
              E H+HEFVI  TP KRLCKTH+IITVNGQ+PGPTLEVR GDTLVI V+N A+YNAT+H
Sbjct  26   DAEVHHHEFVIQETPVKRLCKTHNIITVNGQYPGPTLEVREGDTLVINVVNRAQYNATIH  85

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHGIRQI + WADGP ++TQCPI+PG  Y YRFTIQ QEGTLWWHAH+ WLRATVYGA++
Sbjct  86   WHGIRQIRTGWADGPEFVTQCPIRPGGSYKYRFTIQGQEGTLWWHAHSSWLRATVYGALI  145

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I PR    YPF KP +E+P++LGEWW+ +   V+R+A  TG  PNVSDA+TING PGDLY
Sbjct  146  IRPRENKTYPFAKPSREVPVILGEWWDANPIDVIREAQRTGGGPNVSDAFTINGQPGDLY  205

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C ++  T + V+ GET LLR INAALN +LF ++A H  TVV  DA+YTKPF+++V+ML
Sbjct  206  KCSNKETTAIPVEAGETALLRFINAALNHELFVTIAQHKMTVVATDASYTKPFTTSVLML  265

Query  793  GPGQ  804
             PGQ
Sbjct  266  APGQ  269



>ref|XP_006828131.1| hypothetical protein AMTR_s00023p00051360 [Amborella trichopoda]
 gb|ERM95547.1| hypothetical protein AMTR_s00023p00051360 [Amborella trichopoda]
Length=589

 Score =   352 bits (904),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/250 (64%), Positives = 194/250 (78%), Gaps = 1/250 (0%)
 Frame = +1

Query  58   CTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAAR  237
            C   +  GE   H F+I +T   RLCKT ++ITVNGQ PGPTLEV NGDTL+I  +N AR
Sbjct  34   CMTVYSVGEVQTHNFIIQSTRVTRLCKTINVITVNGQLPGPTLEVNNGDTLIINAVNRAR  93

Query  238  YNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRAT  417
            YN TLHWHGIRQI + WADGP ++TQCPI+PG  YTYRFTI+ QEGTLWWHAH+ WLRAT
Sbjct  94   YNVTLHWHGIRQIRTGWADGPEFVTQCPIRPGGSYTYRFTIENQEGTLWWHAHSSWLRAT  153

Query  418  VYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTING  597
            VYGA++I+P+ G  YPF KP +E PI+LGEWW R+   V+ QAT TGAAPN+SDAYTING
Sbjct  154  VYGALIIHPKPGASYPFTKPKREAPIILGEWWNRNPIDVVNQATRTGAAPNISDAYTING  213

Query  598  WPGDLYTCHRGITKV-QVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFS  774
             PGDLY C    T V  V +GET L R+INAALN +LFF +ANH FTVV VDA+YTKP++
Sbjct  214  QPGDLYNCSSKDTVVIPVASGETNLFRIINAALNAELFFKIANHKFTVVAVDASYTKPYT  273

Query  775  SNVIMLGPGQ  804
            ++V+M+ PGQ
Sbjct  274  TDVLMIAPGQ  283



>ref|XP_009141888.1| PREDICTED: laccase-5-like [Brassica rapa]
Length=569

 Score =   352 bits (902),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 159/244 (65%), Positives = 195/244 (80%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            +   H+HEF+I AT  KRLC+TH+ ITVNG FPGP L + NGD+LV+KVIN ARYN T+H
Sbjct  25   ANRAHHHEFIIQATKVKRLCETHNSITVNGMFPGPQLVINNGDSLVVKVINRARYNVTIH  84

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+RQ+ + WADGP ++TQCPI+PG+ YTYRFTIQ QEGTLWWHAH+ WLRATVYG+++
Sbjct  85   WHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHSSWLRATVYGSLL  144

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I P  G  YPFP P + +P+LLGEWW+ +   V+R+A  TGAAPN+SDAYTING PGDLY
Sbjct  145  ILPPAGSSYPFPNPHRNVPLLLGEWWDGNPVDVLREAIRTGAAPNISDAYTINGQPGDLY  204

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +  T V +  GET+LLRVINAALNQ LFF+VANH FTVV  DA+Y KPF++N I+L
Sbjct  205  KCSSQDTTIVPINVGETILLRVINAALNQPLFFTVANHKFTVVGADASYLKPFTTNAIVL  264

Query  793  GPGQ  804
            GPGQ
Sbjct  265  GPGQ  268



>ref|XP_010543702.1| PREDICTED: laccase-12 [Tarenaya hassleriana]
Length=575

 Score =   352 bits (902),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 195/242 (81%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E H+H+FVI  TP KRLCKT ++ITVNG FPGPTLEV NGDTLV+KV+N A++N T+HWH
Sbjct  25   EVHHHDFVIQETPVKRLCKTQNVITVNGMFPGPTLEVNNGDTLVVKVVNRAQHNVTIHWH  84

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYGA++I+
Sbjct  85   GVRQMRTGWADGPEFVTQCPIRPGNSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALLIH  144

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P     YPFPKPD++  +LLGEWW  +   V+++A  TGAAPNVSDAYT+NG PGDLY C
Sbjct  145  PPPASSYPFPKPDRQTTLLLGEWWNANPIDVLKEAIRTGAAPNVSDAYTVNGQPGDLYNC  204

Query  622  -HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
             ++    V   +GET L+RVIN+A+NQ LFF+VANH  TVV  DA+Y KPFS+NVIMLGP
Sbjct  205  SNQDTIVVPTGSGETSLIRVINSAMNQPLFFTVANHKLTVVGADASYLKPFSTNVIMLGP  264

Query  799  GQ  804
            GQ
Sbjct  265  GQ  266



>ref|XP_011015306.1| PREDICTED: laccase-12-like [Populus euphratica]
 ref|XP_011035865.1| PREDICTED: laccase-12-like [Populus euphratica]
Length=582

 Score =   352 bits (902),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 194/243 (80%), Gaps = 2/243 (1%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            ++HYH+FVI ATP KRLCKT + ITVNG FPGPTLEV NGDTLV+ V+N ARYN T+HWH
Sbjct  35   KSHYHDFVIQATPVKRLCKTQNSITVNGMFPGPTLEVNNGDTLVVNVVNKARYNVTIHWH  94

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYGA++I+
Sbjct  95   GVRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIH  154

Query  442  PRLGVPYPFPK-PDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYT  618
            P+ G  YPF K P +E  ILLGEWW  +   V+R+AT TG APN SDAYTING PGDLY 
Sbjct  155  PKEGSSYPFSKQPKRETAILLGEWWNANPIDVVREATRTGGAPNSSDAYTINGQPGDLYN  214

Query  619  CHRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLG  795
            C    T  V + +GET LLRVINAALNQ LFF+VANH  TVV  DA+Y KPF+++V+MLG
Sbjct  215  CSSQDTVIVPIDSGETNLLRVINAALNQPLFFTVANHKLTVVGADASYVKPFTTSVLMLG  274

Query  796  PGQ  804
            PGQ
Sbjct  275  PGQ  277



>ref|NP_196158.1| laccase 12 [Arabidopsis thaliana]
 sp|Q9FLB5.1|LAC12_ARATH RecName: Full=Laccase-12; AltName: Full=Benzenediol:oxygen oxidoreductase 
12; AltName: Full=Diphenol oxidase 12; AltName: 
Full=Urishiol oxidase 12; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09982.1| laccase (diphenol oxidase) [Arabidopsis thaliana]
 gb|AED90868.1| laccase 12 [Arabidopsis thaliana]
Length=565

 Score =   351 bits (900),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 196/252 (78%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            S  +A+ +  +  +H+FVI  TP KRLCKT + ITVNG FPGPTLEV NGDTL +KV N 
Sbjct  15   SLFSASLIIAKVQHHDFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNNGDTLEVKVHNR  74

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN T+HWHG+RQI + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  75   ARYNITIHWHGVRQIRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLR  134

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P  G  +PFPKPD++  ++LGEWW  +   V+ QAT TGAAPN+SDAYTI
Sbjct  135  ATVYGALIIHPTPGSSFPFPKPDRQTALMLGEWWNANPVDVINQATRTGAAPNISDAYTI  194

Query  592  NGWPGDLYTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C  +    V + +GET LLRVINAALNQ LFF+VANH  TVV  DA+Y KP
Sbjct  195  NGQPGDLYNCSTKETVVVPINSGETSLLRVINAALNQPLFFTVANHKLTVVGADASYLKP  254

Query  769  FSSNVIMLGPGQ  804
            F++ V+MLGPGQ
Sbjct  255  FTTKVLMLGPGQ  266



>gb|KHN02112.1| Laccase-3 [Glycine soja]
Length=573

 Score =   351 bits (900),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 194/242 (80%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E H+HEFVI A P +RLCKT +IITVNGQFPGPT+E RNGD +VIKV+NAA+YN ++HWH
Sbjct  31   EIHFHEFVIQAKPVRRLCKTQNIITVNGQFPGPTVEARNGDFVVIKVVNAAQYNISIHWH  90

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+R + + WADGP+Y+TQCPIQPG  YTYRF I+ QEGTLWWHAHT +LRATVYGA +IY
Sbjct  91   GLRMLRNPWADGPSYVTQCPIQPGGSYTYRFRIRDQEGTLWWHAHTGFLRATVYGAFIIY  150

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            PRLG PYPF  P +E+P+LLGEW++ D+  + RQA F G  PN S AYTING PGDLY C
Sbjct  151  PRLGSPYPFSMPKQEVPLLLGEWFDTDLVLLQRQADFAGLPPNTSVAYTINGQPGDLYRC  210

Query  622  HRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
                T +V V  GET++LR+I++ LNQ+LFFS+ANH  TVV  DA YTKPF ++V+M+GP
Sbjct  211  SSQETVRVPVDAGETIMLRIISSTLNQELFFSIANHTMTVVGTDAAYTKPFKTSVLMIGP  270

Query  799  GQ  804
            GQ
Sbjct  271  GQ  272



>emb|CDM84828.1| unnamed protein product [Triticum aestivum]
Length=566

 Score =   350 bits (899),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 162/253 (64%), Positives = 198/253 (78%), Gaps = 4/253 (2%)
 Frame = +1

Query  58   CTAT-FLSGET--HYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVIN  228
            C A+  L+G T  H+HEF++  TP KRLC+ H+IITVNGQFPGPTLEVR GDTLV+ V+N
Sbjct  12   CLASALLAGATKVHHHEFIVQETPVKRLCEEHNIITVNGQFPGPTLEVREGDTLVVNVVN  71

Query  229  AARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWL  408
             A+YN T+HWHGIRQ  + WADGP ++TQCPI+PG  Y YRFTI+ QEGTLWWHAH+ WL
Sbjct  72   QAQYNVTIHWHGIRQFRTGWADGPEFVTQCPIKPGGSYKYRFTIEGQEGTLWWHAHSSWL  131

Query  409  RATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYT  588
            RATVYGA++I PR   PYPF KP +E+PILLGEWW  +   V+R+A  TG APNVSDA+T
Sbjct  132  RATVYGALIIRPREDKPYPFDKPAREVPILLGEWWNANPVEVIREAQRTGGAPNVSDAFT  191

Query  589  INGWPGDLYTCHR-GITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTK  765
            +NG PGDLY C R   T + VK GET LLR IN+ALN +LF S+A+H  TVV VDA+YTK
Sbjct  192  VNGQPGDLYNCSRQDTTAISVKPGETALLRFINSALNHELFVSIASHKMTVVGVDASYTK  251

Query  766  PFSSNVIMLGPGQ  804
            PF ++V+M+ PGQ
Sbjct  252  PFVTSVLMIAPGQ  264



>gb|AFV52384.1| laccase [Picea abies]
Length=573

 Score =   351 bits (900),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 165/247 (67%), Positives = 193/247 (78%), Gaps = 1/247 (0%)
 Frame = +1

Query  67   TFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNA  246
            T L+     H FVI A P  RLCKTH++I VNGQFPGPTL VRNGDTL +KV N A+YNA
Sbjct  23   TALAEHVIRHTFVIEAKPVTRLCKTHNVIIVNGQFPGPTLHVRNGDTLSVKVYNRAQYNA  82

Query  247  TLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYG  426
            T+HWHGIRQ  + WADGP +ITQCPI+PG  YTYRFTI  QEGTLWWHAH+ WLRA+VYG
Sbjct  83   TVHWHGIRQFRTGWADGPEFITQCPIRPGGSYTYRFTITGQEGTLWWHAHSSWLRASVYG  142

Query  427  AIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPG  606
            A++I+PRLG  YPF  P +E PI+LGEWW R+   V+ QAT TGAAPNVSDAYTING PG
Sbjct  143  ALIIHPRLGTTYPFTAPHRETPIMLGEWWNRNPIDVVNQATRTGAAPNVSDAYTINGQPG  202

Query  607  DLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNV  783
            DLY C R  T +V++   E  LLR++NAALNQ+LFF+VANH  TVV VDA+YTKPF +  
Sbjct  203  DLYPCSRRETFRVRIYNEEIHLLRIVNAALNQELFFTVANHKLTVVAVDASYTKPFRTKT  262

Query  784  IMLGPGQ  804
            +MLGPGQ
Sbjct  263  VMLGPGQ  269



>ref|XP_009122149.1| PREDICTED: laccase-12 [Brassica rapa]
Length=565

 Score =   350 bits (899),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 197/252 (78%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            S  +A+ +  +  +H FVI  TP KRLCKT + ITVNG FPGPTLEV +GDTL +KV+N 
Sbjct  15   SLLSASSIIAKVQHHNFVIQETPVKRLCKTRNAITVNGVFPGPTLEVNDGDTLEVKVLNR  74

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN T+HWHG+RQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  75   ARYNITIHWHGVRQMRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLR  134

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P LG  +PFPKPD +  ++LGEWW  +   V+ QAT TGAAPN+SDAYTI
Sbjct  135  ATVYGALIIHPALGSSFPFPKPDSQTALVLGEWWNANPVDVINQATRTGAAPNISDAYTI  194

Query  592  NGWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C ++    V V +GET LLRVINAALNQ LFF+VANH  TVV  DA+Y KP
Sbjct  195  NGQPGDLYNCSNKETVVVPVNSGETSLLRVINAALNQPLFFTVANHKLTVVGADASYLKP  254

Query  769  FSSNVIMLGPGQ  804
            F++ V+MLGPGQ
Sbjct  255  FTTKVLMLGPGQ  266



>ref|XP_009125599.1| PREDICTED: laccase-12 [Brassica rapa]
Length=565

 Score =   350 bits (899),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 163/252 (65%), Positives = 197/252 (78%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            S  +A+ +  +  +H FVI  TP KRLCKT + ITVNG FPGPTLEV +GDTL +KV N 
Sbjct  15   SLLSASSIIAKVQHHNFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNDGDTLEVKVHNR  74

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN T+HWHG+RQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  75   ARYNITIHWHGVRQMRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLR  134

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P  G  +PFPKPD++  ++LGEWW  +  +V+ QAT TGAAPNVSDAYTI
Sbjct  135  ATVYGALIIHPAPGSSFPFPKPDRQTALVLGEWWNANPVNVINQATRTGAAPNVSDAYTI  194

Query  592  NGWPGDLYTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C  +G   V V +GET LLRVINAALNQ LFF+VANH  TVV  DA+Y KP
Sbjct  195  NGQPGDLYNCSTKGTVVVPVNSGETSLLRVINAALNQPLFFTVANHKLTVVGADASYLKP  254

Query  769  FSSNVIMLGPGQ  804
            F++ V+MLGPGQ
Sbjct  255  FTTKVLMLGPGQ  266



>ref|XP_009391695.1| PREDICTED: laccase-3-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/244 (67%), Positives = 194/244 (80%), Gaps = 2/244 (1%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            S E H+HEFV+ ATP KRLC+TH+IITVNGQ+PGPTL VR+GDTLV+ VIN A+YN TLH
Sbjct  22   SAEVHHHEFVVEATPVKRLCRTHNIITVNGQYPGPTLAVRDGDTLVVNVINRAKYNVTLH  81

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+RQ+ + WADGP ++TQCPI+PG  YTYRFTI++QEGTLWWHAH+ WLRATV+GA++
Sbjct  82   WHGVRQLRTAWADGPEFVTQCPIRPGGSYTYRFTIEEQEGTLWWHAHSSWLRATVHGALI  141

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            IYP+ G  YPFP P KEIP +LGEWW  D   V+R+A  TGAAPNVSDA+TING PGDLY
Sbjct  142  IYPKHGS-YPFPTPKKEIPFILGEWWNEDPIRVVRRAARTGAAPNVSDAFTINGQPGDLY  200

Query  616  TCHRGITKV-QVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C    T V  V  GET LLR INAALN + F S+A H  TVV  DA YTKPF+++V+ML
Sbjct  201  KCSNKETTVFTVAPGETNLLRFINAALNNEHFISIAGHKMTVVAADAAYTKPFTTSVLML  260

Query  793  GPGQ  804
             PGQ
Sbjct  261  APGQ  264



>gb|AFV52383.1| laccase [Picea abies]
Length=573

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/247 (67%), Positives = 193/247 (78%), Gaps = 1/247 (0%)
 Frame = +1

Query  67   TFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNA  246
            T L+     H FVI A P  RLCKTH++I VNGQFPGPTL VRNGDTL +KV N A+YNA
Sbjct  23   TALAEHVIRHTFVIEAKPVTRLCKTHNVIIVNGQFPGPTLHVRNGDTLSVKVYNRAQYNA  82

Query  247  TLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYG  426
            T+HWHGIRQ  + WADGP +ITQCPI+PG  YTYRFTI  QEGTLWWHAH+ WLRA+VYG
Sbjct  83   TVHWHGIRQFRTGWADGPEFITQCPIRPGGSYTYRFTITGQEGTLWWHAHSSWLRASVYG  142

Query  427  AIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPG  606
            A++I+PRLG  YPF  P +E PI+LGEWW R+   V+ QAT TGAAPNVSDAYTING PG
Sbjct  143  ALIIHPRLGTTYPFTPPHRETPIMLGEWWNRNPIDVVNQATRTGAAPNVSDAYTINGQPG  202

Query  607  DLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNV  783
            DLY C R  T +V++   E  LLR++NAALNQ+LFF+VANH  TVV VDA+YTKPF +  
Sbjct  203  DLYPCSRRETFRVRIYNEEIHLLRIVNAALNQELFFTVANHKLTVVAVDASYTKPFRTKT  262

Query  784  IMLGPGQ  804
            +MLGPGQ
Sbjct  263  VMLGPGQ  269



>ref|XP_003552931.1| PREDICTED: laccase-3-like [Glycine max]
Length=573

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 193/242 (80%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E H+HEFVI A P +RLCKT +IITVNGQFPGPT+E RNGD +VIKV+NAA+YN ++HWH
Sbjct  31   EIHFHEFVIQAKPVRRLCKTQNIITVNGQFPGPTVEARNGDFVVIKVVNAAQYNISIHWH  90

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+R + + WADGP+Y+TQCPIQPG  YTYRF I+ QEGTLWWHAHT +LRATVYGA +IY
Sbjct  91   GLRMLRNPWADGPSYVTQCPIQPGGSYTYRFRIRDQEGTLWWHAHTGFLRATVYGAFIIY  150

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            PRLG PYPF  P +E+P+LLGEW++ D+  + RQA F G  PN S AYTING PGDLY C
Sbjct  151  PRLGSPYPFSMPKQEVPLLLGEWFDTDLVLLQRQADFAGLPPNTSVAYTINGQPGDLYRC  210

Query  622  HRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
                T +V V  GET++LR+I++ LNQ+LFFS+ANH  TVV  DA YTKPF + V+M+GP
Sbjct  211  SSQETVRVPVDAGETIMLRIISSTLNQELFFSIANHTMTVVGTDAAYTKPFKTTVLMIGP  270

Query  799  GQ  804
            GQ
Sbjct  271  GQ  272



>ref|XP_009143220.1| PREDICTED: laccase-5 [Brassica rapa]
Length=574

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 157/244 (64%), Positives = 197/244 (81%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + + H+HEF+I AT  KRLC+TH+ ITVNG FPGP L + NGDTLV+KVIN ARYN T+H
Sbjct  23   ANKAHHHEFIIQATKVKRLCETHNSITVNGMFPGPQLVINNGDTLVVKVINRARYNVTIH  82

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+RQ+ + WADGP ++TQCPI+PG+ YTYRFTIQ QEGTLWWHAH+ WLRATVYG+++
Sbjct  83   WHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHSSWLRATVYGSLL  142

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            + P  G  YPFP P + +P+LLGEWW+ +   V+R++  TGAAPN+SDAYTI+G PGDLY
Sbjct  143  VLPPAGSSYPFPTPHRNVPLLLGEWWDANPVDVLRESIRTGAAPNISDAYTIDGQPGDLY  202

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +  T V +  GET+LLRVIN+ALNQ LFF+VANH FTVV  DA+Y KPF++NVI+L
Sbjct  203  KCSSQDTTIVPINVGETILLRVINSALNQPLFFTVANHKFTVVGADASYLKPFTTNVIVL  262

Query  793  GPGQ  804
            GPGQ
Sbjct  263  GPGQ  266



>emb|CBL95260.1| laccase [Pinus pinaster]
Length=577

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/248 (67%), Positives = 194/248 (78%), Gaps = 3/248 (1%)
 Frame = +1

Query  70   FLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNAT  249
             +S + H H FV+ +TP KRLC TH+IITVNGQFPGPTL VRNGD L +KV N A+YNAT
Sbjct  30   MVSAKLHTHIFVLRSTPVKRLCGTHNIITVNGQFPGPTLHVRNGDKLKVKVHNQAQYNAT  89

Query  250  LHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGA  429
            +HWHG+RQ  + W+DGP +ITQCPI+PG  YTY+FT+  QEGTLWWHAH+ WLRATVYGA
Sbjct  90   IHWHGVRQFRTGWSDGPEFITQCPIRPGRSYTYKFTVTGQEGTLWWHAHSSWLRATVYGA  149

Query  430  IVIYPRLGVPYP--FPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            ++I PRL   YP  F +P ++IPILLGEWW R+   V+ QAT TGAAPNVSDA+TING P
Sbjct  150  LIILPRLDTTYPFTFTRPHRQIPILLGEWWNRNPMDVVNQATRTGAAPNVSDAFTINGQP  209

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C    T  V +K GET LLRVINAALN  LFFS+A+H  TVV VDA YTKPF +N
Sbjct  210  GDLYKCSASDTFSVSMKGGETNLLRVINAALNTDLFFSIASHTMTVVAVDALYTKPFQTN  269

Query  781  VIMLGPGQ  804
            V+MLGPGQ
Sbjct  270  VLMLGPGQ  277



>emb|CDX74795.1| BnaA05g05410D [Brassica napus]
Length=574

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 157/244 (64%), Positives = 197/244 (81%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + + H+HEF+I AT  KRLC+TH+ ITVNG FPGP L + NGDTLV+KVIN ARYN T+H
Sbjct  23   ANKAHHHEFIIQATKVKRLCETHNSITVNGMFPGPQLVINNGDTLVVKVINRARYNVTIH  82

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+RQ+ + WADGP ++TQCPI+PG+ YTYRFTIQ QEGTLWWHAH+ WLRATVYG+++
Sbjct  83   WHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHSSWLRATVYGSLL  142

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            + P  G  YPFP P + +P+LLGEWW+ +   V+R++  TGAAPN+SDAYTI+G PGDLY
Sbjct  143  VLPPAGSSYPFPTPHRNVPLLLGEWWDANPVDVLRESIRTGAAPNISDAYTIDGQPGDLY  202

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +  T V +  GET+LLRVIN+ALNQ LFF+VANH FTVV  DA+Y KPF++NVI+L
Sbjct  203  KCSSQDTTIVPINVGETILLRVINSALNQPLFFTVANHKFTVVGADASYLKPFTTNVIVL  262

Query  793  GPGQ  804
            GPGQ
Sbjct  263  GPGQ  266



>ref|XP_006287390.1| hypothetical protein CARUB_v10000596mg [Capsella rubella]
 gb|EOA20288.1| hypothetical protein CARUB_v10000596mg [Capsella rubella]
Length=563

 Score =   350 bits (897),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/252 (65%), Positives = 195/252 (77%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            S  +A+    +  +H+FVI  TP KRLCKT ++ITVNG FPGPTLEV NGDTL +KV N 
Sbjct  15   SLLSASSTIAKVQHHDFVIQETPVKRLCKTRNVITVNGMFPGPTLEVNNGDTLEVKVHNR  74

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN T+HWHG+RQI + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  75   ARYNITIHWHGVRQIRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLR  134

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P  G  +PFPKPD++  ++LGEWW  +   V+ QA  TGAAPN+SDAYTI
Sbjct  135  ATVYGALIIHPTPGSSFPFPKPDRQTALVLGEWWNANPVDVINQAIRTGAAPNISDAYTI  194

Query  592  NGWPGDLYTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C  +    V  K+GET LLRVINAALNQ LFFSVANH  TVV  DA+Y KP
Sbjct  195  NGQPGDLYNCSTKETIVVPTKSGETSLLRVINAALNQPLFFSVANHKLTVVGADASYLKP  254

Query  769  FSSNVIMLGPGQ  804
            F++ V+MLGPGQ
Sbjct  255  FTTKVLMLGPGQ  266



>ref|XP_011004433.1| PREDICTED: laccase-12-like [Populus euphratica]
Length=582

 Score =   350 bits (897),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/245 (65%), Positives = 196/245 (80%), Gaps = 2/245 (1%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + +TH H+FVI ATP KRLCKT + ITVNG FPGPTLEV NGDTLV+ V+N A+YN T+H
Sbjct  33   NAKTHSHDFVIQATPVKRLCKTQNSITVNGMFPGPTLEVNNGDTLVVNVVNKAKYNVTIH  92

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+RQ+ + WADGP ++TQCPI+PG  YTY+FTIQ QEGTLWWHAH+ WLRATVYGA++
Sbjct  93   WHGVRQMRTGWADGPEFVTQCPIRPGGSYTYKFTIQGQEGTLWWHAHSSWLRATVYGALI  152

Query  436  IYPRLGVPYPFPK-PDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDL  612
            ++P+ G PYPF K P +E  I+LGEWW  +   V+R+AT TG APNVSDAYT+NG PGDL
Sbjct  153  VHPKEGSPYPFSKQPKRETAIVLGEWWNANPIDVVREATRTGGAPNVSDAYTVNGQPGDL  212

Query  613  YTCHRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIM  789
            Y C    T  V + +GET LLRVIN+ALNQ LFF+VANH  TVV  DA+Y KPF+++V+M
Sbjct  213  YNCSSQDTVIVPIDSGETNLLRVINSALNQPLFFTVANHKLTVVGADASYVKPFTTSVLM  272

Query  790  LGPGQ  804
            LGPGQ
Sbjct  273  LGPGQ  277



>emb|CDX98841.1| BnaC09g49940D [Brassica napus]
Length=565

 Score =   349 bits (896),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/252 (64%), Positives = 197/252 (78%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            S  +A+ +  +  +H FVI  TP KRLCKT + ITVNG FPGPTLEV +GDTL +KV+N 
Sbjct  15   SLLSASSIIAKVQHHNFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNDGDTLEVKVLNR  74

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN T+HWHG+RQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  75   ARYNITIHWHGVRQMRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLR  134

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P  G  +PFPKPD++  ++LGEWW  +   V+ QAT TGAAPN+SDAYTI
Sbjct  135  ATVYGALIIHPAPGSSFPFPKPDRQTALVLGEWWNANPVDVINQATRTGAAPNISDAYTI  194

Query  592  NGWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C ++    V VK+GET LLRVINAALNQ LFF+VANH  TVV  DA+Y KP
Sbjct  195  NGQPGDLYNCSNKETVVVPVKSGETSLLRVINAALNQPLFFTVANHKLTVVGADASYLKP  254

Query  769  FSSNVIMLGPGQ  804
            F++  +MLGPGQ
Sbjct  255  FTTKFLMLGPGQ  266



>gb|EMT06365.1| Laccase-3 [Aegilops tauschii]
Length=566

 Score =   349 bits (896),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 192/242 (79%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            + H+HEFV+  TP KRLC+ H+IITVNGQFPGPTLEVR GDTLV+ V+N A+YN T+HWH
Sbjct  23   KVHHHEFVVQETPVKRLCEEHNIITVNGQFPGPTLEVREGDTLVVNVVNQAQYNVTIHWH  82

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            GIRQ  + WADGP ++TQCPI+PG  Y YRFTI+ QEGTLWWHAH+ WLRATVYGA++I 
Sbjct  83   GIRQFRTGWADGPEFVTQCPIKPGGSYKYRFTIEGQEGTLWWHAHSSWLRATVYGALIIR  142

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            PR   PYPF KP +E+PILLGEWW  +   V+R+A  TG APNVSDA+T+NG PGDLY C
Sbjct  143  PREDKPYPFEKPAREVPILLGEWWNANPVEVIREAQRTGGAPNVSDAFTVNGQPGDLYNC  202

Query  622  HR-GITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
             R   T + VK GET LLR IN+ALN +LF S+A+H  TVV VDA+YTKPF ++V+M+ P
Sbjct  203  SRQDTTAISVKPGETALLRFINSALNHELFVSIASHKMTVVGVDASYTKPFVTSVLMIAP  262

Query  799  GQ  804
            GQ
Sbjct  263  GQ  264



>gb|KFK36912.1| hypothetical protein AALP_AA4G189000 [Arabis alpina]
Length=578

 Score =   350 bits (897),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 156/244 (64%), Positives = 195/244 (80%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + + H+HEF+I AT  KRLC+TH+ ITVNG FPGP L V NGDTLV+KVIN ARYN T+H
Sbjct  25   ANKAHHHEFIIQATKVKRLCETHNSITVNGMFPGPQLVVNNGDTLVVKVINRARYNITIH  84

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+RQ+ + WADGP ++TQCPI+PG+ YTYRFTIQ QEGTLWWHAH+ WLRATVYG+++
Sbjct  85   WHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHSSWLRATVYGSLL  144

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            + P  G  YPFP P + +P+LLGEWW+ +   V+R++  TG APN+SDAYTING PGDLY
Sbjct  145  VLPPAGSSYPFPNPHRNVPLLLGEWWDANPVDVLRESIRTGGAPNISDAYTINGQPGDLY  204

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +  T V +  GET+LLRVIN+ALNQ LFF+VANH  TVV  DA+Y KPF++NV++L
Sbjct  205  KCSSKDTTIVPINVGETILLRVINSALNQALFFTVANHKLTVVGADASYLKPFTTNVVVL  264

Query  793  GPGQ  804
            GPGQ
Sbjct  265  GPGQ  268



>ref|XP_006644937.1| PREDICTED: laccase-3-like [Oryza brachyantha]
Length=566

 Score =   349 bits (895),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/251 (64%), Positives = 193/251 (77%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            S  A     E H+HEF++  TP KRLC TH +ITVNGQ PGPTLEVR GDT+VI V+N A
Sbjct  15   SVFALLAGAEVHHHEFIVQETPVKRLCNTHKVITVNGQLPGPTLEVREGDTVVINVVNHA  74

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            +YN T+HWHGIRQ  + WADGP ++TQCPI+PG  Y YRFTI+ QEGTLWWHAH+ WLRA
Sbjct  75   QYNVTIHWHGIRQFRTGWADGPEFVTQCPIKPGGSYRYRFTIEGQEGTLWWHAHSSWLRA  134

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGA++I PR    YPF KP  E+P+LLGEWW+ D   V+R+A  TGAAPN+SDA+TIN
Sbjct  135  TVYGALIIRPRENKTYPFEKPATEVPLLLGEWWDADPIQVIREAQRTGAAPNISDAFTIN  194

Query  595  GWPGDLYTCHR-GITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C +   T V VK GET LLR INAALNQ+LF S+A H  TVV VDA+YTKP+
Sbjct  195  GQPGDLYNCSKQETTAVPVKPGETALLRFINAALNQELFVSIAQHRMTVVGVDASYTKPY  254

Query  772  SSNVIMLGPGQ  804
            +++V+M+ PGQ
Sbjct  255  TTSVLMIAPGQ  265



>gb|AFV52378.1| laccase [Picea abies]
Length=570

 Score =   348 bits (894),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 167/245 (68%), Positives = 190/245 (78%), Gaps = 5/245 (2%)
 Frame = +1

Query  73   LSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATL  252
            L GET    FVI +T  KRLC  H+IITVNGQFPGPTL VRNGDTL++KV N A+YNAT+
Sbjct  30   LRGET----FVIQSTSVKRLCGMHNIITVNGQFPGPTLHVRNGDTLMVKVYNNAQYNATI  85

Query  253  HWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAI  432
            HWHG+RQ  + WADGP +ITQCPI+PG  YTYRF I  QEGTLWWH H+ WLRATVYGA+
Sbjct  86   HWHGVRQFRTGWADGPEFITQCPIRPGGSYTYRFNITDQEGTLWWHGHSSWLRATVYGAL  145

Query  433  VIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDL  612
            +I PR G  YPF KP  ++PILLGEWW R+   V+ QAT TGAAPNVSDA+TING PGDL
Sbjct  146  IITPRPGTTYPFTKPHGQVPILLGEWWNRNPMDVVNQATRTGAAPNVSDAFTINGQPGDL  205

Query  613  YTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIM  789
            Y C    T +V VK+GET LLRVINAALN  LFFSV +H  TVV VDA YTKPF +N +M
Sbjct  206  YQCSSSDTFRVSVKSGETKLLRVINAALNTDLFFSVGSHKMTVVAVDALYTKPFQTNFLM  265

Query  790  LGPGQ  804
            LGPGQ
Sbjct  266  LGPGQ  270



>ref|XP_002871156.1| hypothetical protein ARALYDRAFT_487334 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47415.1| hypothetical protein ARALYDRAFT_487334 [Arabidopsis lyrata subsp. 
lyrata]
Length=565

 Score =   348 bits (893),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 160/252 (63%), Positives = 196/252 (78%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            S  +A+ +  +  +H+FVI  TP KRLCKT + ITVNG FPGPTLEV NGDTL +KV N 
Sbjct  15   SLFSASLIIAKVQHHDFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNNGDTLEVKVHNR  74

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN T+HWHG+RQI + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  75   ARYNITIHWHGVRQIRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLR  134

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P  G  +PFPKPD++  ++LGEWW  +   ++ QAT TGAAPN+SDAYTI
Sbjct  135  ATVYGALIIHPTPGSSFPFPKPDRQTALMLGEWWNANPVDIINQATRTGAAPNISDAYTI  194

Query  592  NGWPGDLYTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C  +    V + +GET L+RVINAALNQ LFF+VANH  TVV  DA+Y KP
Sbjct  195  NGQPGDLYKCSTKETVVVPINSGETNLVRVINAALNQPLFFTVANHKLTVVGADASYLKP  254

Query  769  FSSNVIMLGPGQ  804
            F++ V+MLGPGQ
Sbjct  255  FATKVLMLGPGQ  266



>ref|XP_010508873.1| PREDICTED: laccase-5-like [Camelina sativa]
Length=578

 Score =   348 bits (894),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 157/242 (65%), Positives = 194/242 (80%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            + H+HEF+I AT  KRLC+TH+ ITVNG FPGPTL V NGDTLV+KV+N ARYN T+HWH
Sbjct  30   KAHHHEFIIQATKVKRLCETHNSITVNGMFPGPTLVVNNGDTLVVKVVNRARYNVTIHWH  89

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP ++TQCPI+PG+ YTYRFTIQ QEGTLWWHAH+ WLRATVYG++++ 
Sbjct  90   GVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHSSWLRATVYGSLLVL  149

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P  G  YPFP P + +P+LLGEWW+ +   V+R++  TG AP+ SDAYTING PGDLY C
Sbjct  150  PPAGSSYPFPNPHRNVPLLLGEWWDANPVDVLRKSIRTGGAPSNSDAYTINGQPGDLYKC  209

Query  622  -HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
              R  T V +  GET+LLRVIN+ALNQ LFF+VANH  TVV  DA+Y KPF++NVI+LGP
Sbjct  210  SSRDTTIVPINVGETILLRVINSALNQPLFFTVANHKLTVVGADASYLKPFTTNVIVLGP  269

Query  799  GQ  804
            GQ
Sbjct  270  GQ  271



>ref|XP_010517456.1| PREDICTED: laccase-5-like [Camelina sativa]
Length=577

 Score =   348 bits (894),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 194/242 (80%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            + H+HEF+I AT  KRLC+TH+ ITVNG FPGPTL V NGDTLV+KVIN ARYN T+HWH
Sbjct  29   KAHHHEFIIQATKVKRLCETHNSITVNGMFPGPTLVVNNGDTLVVKVINRARYNVTIHWH  88

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP ++TQCPI+PG+ YTYRFTIQ QEGTLWWHAH+ WLRATVYG++++ 
Sbjct  89   GVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHSSWLRATVYGSLLVL  148

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P  G  YPFP P + +P+LLGEWW+ +   V+R++  TG AP+ SDAYTING PGDLY C
Sbjct  149  PPAGSSYPFPNPHRNVPLLLGEWWDANPVDVLRKSIRTGGAPSNSDAYTINGQPGDLYKC  208

Query  622  -HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
              R  T V +  GET+LLRVIN+ALNQ LFF+VANH  TVV  DA+Y KPF++NVI+LGP
Sbjct  209  SSRDTTIVPINVGETILLRVINSALNQPLFFTVANHKLTVVGADASYLKPFTTNVIVLGP  268

Query  799  GQ  804
            GQ
Sbjct  269  GQ  270



>emb|CDY14115.1| BnaC02g02320D [Brassica napus]
Length=564

 Score =   348 bits (893),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 195/252 (77%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            S  +A+ +  +  +H FVI  TP KRLCKT + ITVNG FPGPTLEV +GDTL +KV N 
Sbjct  14   SLLSASSIIAKVQHHNFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNDGDTLEVKVHNR  73

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN T+HWHG+RQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  74   ARYNITIHWHGVRQMRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLR  133

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYG ++I+P  G  +PFPKPD++  ++LGEWW  +  +V+ QAT TGAAPNVSDAYTI
Sbjct  134  ATVYGTLIIHPAPGSSFPFPKPDRQTALVLGEWWNANPVNVINQATRTGAAPNVSDAYTI  193

Query  592  NGWPGDLYTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C  +G   V V  GET LLRVINAALNQ LFF+VANH  TVV  DA+Y KP
Sbjct  194  NGQPGDLYNCSTKGTVVVPVNAGETSLLRVINAALNQPLFFTVANHKLTVVGADASYLKP  253

Query  769  FSSNVIMLGPGQ  804
            F++ V+MLGPGQ
Sbjct  254  FTTKVLMLGPGQ  265



>gb|AAK37824.1|AF132120_1 laccase [Pinus taeda]
Length=576

 Score =   348 bits (894),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 165/248 (67%), Positives = 193/248 (78%), Gaps = 3/248 (1%)
 Frame = +1

Query  70   FLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNAT  249
             +S + H H FV+ +TP KRLC TH+IITVNGQFPGPTL VRNGD L +KV N A+YNAT
Sbjct  30   MVSAKLHTHIFVLRSTPVKRLCGTHNIITVNGQFPGPTLHVRNGDKLKVKVHNQAQYNAT  89

Query  250  LHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGA  429
            +HWHG+RQ  + W+DGP +ITQCPI+PG  YTY+FTI  QEGTLWWHAH+ WLRATVYGA
Sbjct  90   IHWHGVRQFRTGWSDGPEFITQCPIRPGRSYTYKFTITGQEGTLWWHAHSSWLRATVYGA  149

Query  430  IVIYPRLGVPYP--FPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            ++I PRL   YP  F +P ++IPILLGEWW R+   V+ QAT TGAAPNVSDA+TING P
Sbjct  150  LIILPRLDTTYPFTFTRPHRQIPILLGEWWNRNPMDVVNQATQTGAAPNVSDAFTINGQP  209

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C    T  V +K GET LLRVINAALN  LFFS+ +H  TVV VDA YTKPF +N
Sbjct  210  GDLYKCSTSDTFSVSMKGGETNLLRVINAALNSDLFFSIGSHTMTVVAVDALYTKPFQTN  269

Query  781  VIMLGPGQ  804
            V+MLGPGQ
Sbjct  270  VLMLGPGQ  277



>ref|XP_010452444.1| PREDICTED: laccase-12-like [Camelina sativa]
Length=565

 Score =   348 bits (892),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 194/252 (77%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            S  +A+    +  +H+FVI  TP KRLCKT + ITVNG FPGPTLEV NGDTL +KV N 
Sbjct  15   SLLSASSTIAKVQHHDFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNNGDTLEVKVHNR  74

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN T+HWHG+RQI + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  75   ARYNITIHWHGVRQIRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLR  134

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I+P  G  +PFPKPD++  ++LGEWW  +   V+ QA  TGAAPN+SDAYTI
Sbjct  135  ATVYGALIIHPTPGSSFPFPKPDRQTALVLGEWWNANPVDVINQAIRTGAAPNISDAYTI  194

Query  592  NGWPGDLYTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C  +    V + +GET LLRVINAALNQ LFFSVANH  TVV  DA+Y KP
Sbjct  195  NGQPGDLYNCSTKETVVVPINSGETSLLRVINAALNQPLFFSVANHKLTVVGADASYLKP  254

Query  769  FSSNVIMLGPGQ  804
            F++ V+MLGPGQ
Sbjct  255  FTTKVLMLGPGQ  266



>emb|CAA74104.1| laccase [Populus trichocarpa]
 emb|CAC14720.1| laccase [Populus trichocarpa]
Length=574

 Score =   348 bits (893),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 161/244 (66%), Positives = 197/244 (81%), Gaps = 2/244 (1%)
 Frame = +1

Query  79   GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHW  258
             +TH+H+F + AT  KRLCKTH+ ITVNG FPGPTLEV+NGDTLV+KV+N ARYN T+HW
Sbjct  30   AKTHHHDFTVQATKVKRLCKTHNSITVNGMFPGPTLEVKNGDTLVVKVVNRARYNVTIHW  89

Query  259  HGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQ-KQEGTLWWHAHTRWLRATVYGAIV  435
            HGIRQ+ + WADGP ++TQCPI+PG  YTYRFTI+  +  TL WHAH+ WLRATVYGA++
Sbjct  90   HGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIEGTRRNTLGWHAHSSWLRATVYGALI  149

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I+PR G  Y F KP +E PILLGEWW+ +   V+R+AT TGAAPN+SDAYTING PGDL+
Sbjct  150  IHPREGSSYSFSKPKRETPILLGEWWDTNPIDVVREATRTGAAPNISDAYTINGQPGDLF  209

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +  T V + +GET LLRVINAALNQ LFF++ANH FTVV  DA+Y KPF+++VIML
Sbjct  210  NCSSKDTTIVPIDSGETNLLRVINAALNQPLFFTIANHKFTVVGADASYLKPFTTSVIML  269

Query  793  GPGQ  804
            GPGQ
Sbjct  270  GPGQ  273



>ref|XP_006399003.1| hypothetical protein EUTSA_v10015589mg [Eutrema salsugineum]
 gb|ESQ40456.1| hypothetical protein EUTSA_v10015589mg [Eutrema salsugineum]
Length=565

 Score =   348 bits (892),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 161/249 (65%), Positives = 193/249 (78%), Gaps = 1/249 (0%)
 Frame = +1

Query  61   TATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARY  240
            +A+ +  +  +H FVI  TP KRLCKT + ITVNG FPGPTLEV NGDTL +KV+N ARY
Sbjct  18   SASTIIAKVQHHNFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNNGDTLEVKVLNRARY  77

Query  241  NATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATV  420
            N T+HWHG+RQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATV
Sbjct  78   NITIHWHGVRQMRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATV  137

Query  421  YGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGW  600
            YGA++I P  G  +PFPKPD +  ++LGEWW  +   V+ QAT TGAAPN+SDAYTING 
Sbjct  138  YGALIIQPTPGSSFPFPKPDHQTALMLGEWWNANPVDVINQATQTGAAPNISDAYTINGQ  197

Query  601  PGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSS  777
            PGDLY C    T  V + +GET LLRVINAALNQ LFF+VANH  TVV  DA+Y KPF++
Sbjct  198  PGDLYNCSTNETVVVPINSGETSLLRVINAALNQPLFFTVANHKLTVVGADASYLKPFTT  257

Query  778  NVIMLGPGQ  804
             V+MLGPGQ
Sbjct  258  TVLMLGPGQ  266



>ref|NP_001183899.1| putative laccase family protein precursor [Zea mays]
 gb|ACN28316.1| unknown [Zea mays]
 gb|ACR38706.1| unknown [Zea mays]
 gb|AFW84716.1| putative laccase family protein [Zea mays]
Length=571

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 156/244 (64%), Positives = 193/244 (79%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
              E H+HEFV+  TP KRLCKTH++ITVNGQ+PGPTLEVR GDTLVI V+N A+YN T+H
Sbjct  26   DAEVHHHEFVVQETPVKRLCKTHNVITVNGQYPGPTLEVREGDTLVINVVNRAQYNVTIH  85

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHGIRQ+ + WADGP ++TQCPI+PG  Y YRFTI+ QEGTLWWHAH+ WLRATVYGA++
Sbjct  86   WHGIRQMRTGWADGPEFVTQCPIRPGGSYKYRFTIEGQEGTLWWHAHSSWLRATVYGALI  145

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I PR    YPF KP +E+P++LGEWW+ +   V+R+A  TG APNVSDA+TING PGDLY
Sbjct  146  IRPRENKTYPFAKPSREVPVILGEWWDANPIDVIREAQRTGGAPNVSDAFTINGQPGDLY  205

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +  T + VK GET LLR INAALN +LF ++A H  TVV  DA+YTKPF+++V+M+
Sbjct  206  KCSQKETTAIPVKPGETALLRFINAALNHELFVTIAQHRMTVVATDASYTKPFTTSVLMV  265

Query  793  GPGQ  804
             PGQ
Sbjct  266  APGQ  269



>emb|CDP13965.1| unnamed protein product [Coffea canephora]
Length=571

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 192/240 (80%), Gaps = 1/240 (0%)
 Frame = +1

Query  88   HYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWHGI  267
            H H+FVI ATP KRLC THS ITVNGQ+PGPTLEV NGD+L I+VIN A+YN T+HWHG+
Sbjct  29   HSHQFVIQATPVKRLCNTHSTITVNGQYPGPTLEVNNGDSLEIEVINKAQYNLTIHWHGV  88

Query  268  RQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIYPR  447
            RQ+ + W+DGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYG ++I P+
Sbjct  89   RQMRTAWSDGPEFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVYGGLIIRPK  148

Query  448  LGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC-H  624
             G  YPFPKP +E  +LLGEWW+ +   V+R+AT TGA PNVSDA+TING PGDL  C  
Sbjct  149  EGDSYPFPKPKRESLLLLGEWWDANPMDVVREATRTGATPNVSDAFTINGQPGDLLKCSS  208

Query  625  RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGPGQ  804
             G T V V +GET L+RV+N+ LNQQLF ++ANH  TVV  DA+Y KPF+++V+MLGPGQ
Sbjct  209  NGTTIVPVDSGETNLIRVVNSGLNQQLFLTIANHKLTVVGADASYVKPFTTSVLMLGPGQ  268



>emb|CDY04949.1| BnaAnng01310D [Brassica napus]
Length=565

 Score =   347 bits (891),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 195/252 (77%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            S  +A+ +  +  +H FVI  TP KRLCKT + ITVNG FPGPTLEV +GDTL +KV N 
Sbjct  15   SLLSASSIIAKVQHHNFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNDGDTLEVKVHNR  74

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            ARYN T+HWHG+RQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  75   ARYNITIHWHGVRQMRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLR  134

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYG ++I+P  G  +PFPKPD++  ++LGEWW  +  +V+ QAT TGAAPNVSDAYTI
Sbjct  135  ATVYGTLIIHPAPGSSFPFPKPDRQTALVLGEWWNANPVNVINQATRTGAAPNVSDAYTI  194

Query  592  NGWPGDLYTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C  +G   V V  GET LLRVINAALNQ LFF+VANH  TVV  DA+Y KP
Sbjct  195  NGQPGDLYNCSTKGTVVVPVNAGETSLLRVINAALNQPLFFTVANHKLTVVGADASYLKP  254

Query  769  FSSNVIMLGPGQ  804
            F++ V+MLGPGQ
Sbjct  255  FTTKVLMLGPGQ  266



>gb|KFK25107.1| hypothetical protein AALP_AA8G066900 [Arabis alpina]
Length=1134

 Score =   361 bits (926),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 195/250 (78%), Gaps = 3/250 (1%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A+ ++ E H+HEFVI  TP KRLC   + ITVNGQFPGPTLEVRNGD+LVI  IN A+YN
Sbjct  16   ASLVNAEVHFHEFVIQKTPVKRLCNVQNSITVNGQFPGPTLEVRNGDSLVITAINKAQYN  75

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             TLHWHGIRQ+ + WADGP YITQCPIQPG  YTYRF I+ QEGTLWWHAH+RWLRATVY
Sbjct  76   ITLHWHGIRQVRNPWADGPEYITQCPIQPGGSYTYRFNIEDQEGTLWWHAHSRWLRATVY  135

Query  424  GAIVIYPRLGVP-YPFP-KPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTING  597
            GA++I P L  P YPFP  P +EI +LLGEWW R+   V+ QA FTGAAPNVSDA TING
Sbjct  136  GALIIRPPLASPHYPFPVLPKREITLLLGEWWNRNPMDVLNQAQFTGAAPNVSDALTING  195

Query  598  WPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFS  774
             PGD Y C    T +  V +GET+LLRVIN+ALN ++FF VANH  TVV  DA+Y KPFS
Sbjct  196  QPGDFYRCSSQETLRYLVGSGETILLRVINSALNAEMFFGVANHKLTVVAADASYMKPFS  255

Query  775  SNVIMLGPGQ  804
            +NVIMLGPGQ
Sbjct  256  TNVIMLGPGQ  265



>ref|XP_002315130.1| hypothetical protein POPTR_0010s19080g [Populus trichocarpa]
 gb|EEF01301.1| hypothetical protein POPTR_0010s19080g [Populus trichocarpa]
Length=582

 Score =   348 bits (892),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 193/243 (79%), Gaps = 2/243 (1%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            ++HYH+FVI ATP KRLCKT + ITVNG FPGPTLEV NGDTLV+ V+N ARYN T+HWH
Sbjct  35   KSHYHDFVIQATPVKRLCKTQNSITVNGMFPGPTLEVNNGDTLVVNVVNKARYNVTIHWH  94

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            GIRQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYGA++I+
Sbjct  95   GIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIH  154

Query  442  PRLGVPYPFPK-PDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYT  618
            P+ G  YPF K P +E  ILLGEWW  +   V+R++T TG  PN SDAYTING PGDLY 
Sbjct  155  PKEGSSYPFSKQPKRETAILLGEWWNANPIDVVRESTRTGGTPNSSDAYTINGQPGDLYN  214

Query  619  CHRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLG  795
            C    T  V + +GET LLRV+N+ALNQ LFF+VANH  TVV  DA+Y KPF+++V+MLG
Sbjct  215  CSSQDTVIVPIDSGETNLLRVVNSALNQPLFFTVANHKLTVVGADASYVKPFTTSVLMLG  274

Query  796  PGQ  804
            PGQ
Sbjct  275  PGQ  277



>emb|CDY52925.1| BnaA04g29320D [Brassica napus]
Length=573

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 195/248 (79%), Gaps = 5/248 (2%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNG----QFPGPTLEVRNGDTLVIKVINAARYN  243
            +   H+HEF+I AT  KRLC+TH+ ITVNG     FPGP L + NGDTLV+KVIN ARYN
Sbjct  25   ANRAHHHEFIIQATKVKRLCETHNSITVNGILSNMFPGPQLVINNGDTLVVKVINRARYN  84

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
             T+HWHG+RQ+ + WADGP ++TQCPI+PG+ YTYRFTIQ QEGTLWWHAH+ WLRATVY
Sbjct  85   VTIHWHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHSSWLRATVY  144

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            G+++I P  G  YPFP P + +P+LLGEWW+ +   V+R+A  TGAAPN+SDAYTING P
Sbjct  145  GSLLILPPAGSSYPFPNPHRNVPLLLGEWWDGNPVDVLREAIRTGAAPNISDAYTINGQP  204

Query  604  GDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C  +  T V +  GET+LLRVINAALNQ LFF+VANH FTVV  DA+Y KPF++N
Sbjct  205  GDLYKCSSQDTTIVPINVGETILLRVINAALNQPLFFTVANHKFTVVGADASYLKPFTTN  264

Query  781  VIMLGPGQ  804
             I+LGPGQ
Sbjct  265  AIVLGPGQ  272



>ref|NP_181568.1| laccase 5 [Arabidopsis thaliana]
 sp|Q9SIY8.1|LAC5_ARATH RecName: Full=Laccase-5; AltName: Full=Benzenediol:oxygen oxidoreductase 
5; AltName: Full=Diphenol oxidase 5; AltName: Full=Urishiol 
oxidase 5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM77221.1|AF506030_1 laccase [Arabidopsis thaliana]
 gb|AAD25671.1| putative laccase (diphenol oxidase) [Arabidopsis thaliana]
 gb|AEC09819.1| laccase 5 [Arabidopsis thaliana]
Length=580

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/244 (64%), Positives = 195/244 (80%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + + H+HEF+I AT  KRLC+TH+ ITVNG FPGP L V NGDTLV+KVIN ARYN T+H
Sbjct  25   ANKAHHHEFIIQATKVKRLCETHNSITVNGMFPGPMLVVNNGDTLVVKVINRARYNITIH  84

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+RQ+ + WADGP ++TQCPI+PG+ YTYRFTIQ QEGTLWWHAH+ WLRATVYG+++
Sbjct  85   WHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHSSWLRATVYGSLL  144

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            ++P  G  YPF KP + +P+LLGEWW+ +   V+R++  TG APN SDAYTING PGDLY
Sbjct  145  VFPPAGSSYPFTKPHRNVPLLLGEWWDANPVDVLRESIRTGGAPNNSDAYTINGQPGDLY  204

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +  T V +  GET+LLRVIN+ALNQ LFF+VANH  TVV  DA+Y KPF++NVI+L
Sbjct  205  KCSSQDTTVVPINVGETILLRVINSALNQPLFFTVANHKLTVVGADASYLKPFTTNVIVL  264

Query  793  GPGQ  804
            GPGQ
Sbjct  265  GPGQ  268



>gb|ABR17539.1| unknown [Picea sitchensis]
Length=573

 Score =   347 bits (890),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/247 (66%), Positives = 191/247 (77%), Gaps = 1/247 (0%)
 Frame = +1

Query  67   TFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNA  246
            T L+     H FVI A P  RLCKTH++I VNGQFPGPTL VRNGDTL +KV N A+YNA
Sbjct  23   TALAEHVIRHTFVIEAKPVTRLCKTHNVIIVNGQFPGPTLHVRNGDTLSVKVYNRAQYNA  82

Query  247  TLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYG  426
            T+HWHGIRQ  + WADGP +ITQCPI+PG  YTYRFTI  QEGTLWWHAH+ WLRA+VYG
Sbjct  83   TVHWHGIRQFRTGWADGPEFITQCPIRPGGSYTYRFTITGQEGTLWWHAHSSWLRASVYG  142

Query  427  AIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPG  606
            A++I+PRLG  YPF  P +E PI+LGEWW R+   V+ QAT TGAAPNVSDAYTING PG
Sbjct  143  ALIIHPRLGTTYPFTAPHRETPIMLGEWWNRNPIDVVNQATRTGAAPNVSDAYTINGQPG  202

Query  607  DLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNV  783
            DLY C R  T +V +   E  LLR++NAALNQ+LFF+VANH  TVV VDA+YTKPF +  
Sbjct  203  DLYPCSRRETFRVPIYNEEIHLLRIVNAALNQELFFTVANHKLTVVAVDASYTKPFRTKT  262

Query  784  IMLGPGQ  804
            + LGPGQ
Sbjct  263  VKLGPGQ  269



>ref|XP_010505765.1| PREDICTED: laccase-5 [Camelina sativa]
Length=575

 Score =   347 bits (890),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 197/249 (79%), Gaps = 1/249 (0%)
 Frame = +1

Query  61   TATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARY  240
            T+   + + ++HEF+I AT  KRLC+TH+ ITVNG FPGPTL V NGDTLV+KVIN ARY
Sbjct  20   TSMAEANKAYHHEFIIQATKVKRLCETHNSITVNGMFPGPTLVVNNGDTLVVKVINRARY  79

Query  241  NATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATV  420
            N T+HWHG+RQ+ + WADGP ++TQCPI+PG+ YTYRFTIQ QEGTLWWHAH+ WLRATV
Sbjct  80   NVTIHWHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHSSWLRATV  139

Query  421  YGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGW  600
            YG++++ P  G  YPFP P + +P+LLGEWW+ +   V+R++  TG AP+ SDAYTING 
Sbjct  140  YGSLLVLPPAGSSYPFPNPHRNVPLLLGEWWDANPVDVLRKSIRTGGAPSNSDAYTINGQ  199

Query  601  PGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSS  777
            PGDLY C  R  T V +  GET+LLRVIN+ALNQ LFF+VANH  TVV  DA+Y KPF++
Sbjct  200  PGDLYKCSSRDTTIVPINVGETILLRVINSALNQPLFFTVANHKLTVVGADASYLKPFTT  259

Query  778  NVIMLGPGQ  804
            NVI+LGPGQ
Sbjct  260  NVIVLGPGQ  268



>ref|XP_010322117.1| PREDICTED: laccase-12-like isoform X2 [Solanum lycopersicum]
Length=574

 Score =   347 bits (889),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 192/243 (79%), Gaps = 8/243 (3%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + E HYH+FVI ATP KRLCK H+ ITVNGQFPGPTL+V NGD LVI V+N A+YN T+H
Sbjct  38   TAEIHYHDFVIQATPVKRLCKIHNTITVNGQFPGPTLQVNNGDALVINVVNRAQYNVTIH  97

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG++QI + WADGP +ITQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYGA++
Sbjct  98   WHGVKQIRTAWADGPEFITQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALI  157

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            IYP+ G  YPF KP +E PILLGEWW+ +   V+RQAT TGAAP VSDAYTING P    
Sbjct  158  IYPKEGEFYPFSKPKRETPILLGEWWDVNPIDVVRQATRTGAAPKVSDAYTINGQP----  213

Query  616  TCHRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLG  795
                  T V V +GET LLRVINAALNQ LFF+VANH  TVV  DA+Y +PF+++V+MLG
Sbjct  214  ----DTTVVIVDSGETNLLRVINAALNQALFFAVANHKLTVVAADASYVQPFTTSVLMLG  269

Query  796  PGQ  804
            PGQ
Sbjct  270  PGQ  272



>ref|XP_010423473.1| PREDICTED: laccase-12 [Camelina sativa]
Length=565

 Score =   347 bits (889),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/242 (66%), Positives = 190/242 (79%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            +  +H+FVI  TP KRLCKT + ITVNG FPGPTLEV NGDTL +KV N ARYN T+HWH
Sbjct  25   KVQHHDFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNNGDTLEVKVHNRARYNITIHWH  84

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQI + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATVYGA++I+
Sbjct  85   GVRQIRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIH  144

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P  G  +PFPKPD++  ++LGEWW  +   V+ QA  TGAAPN+SDAYTING PGDLY C
Sbjct  145  PTPGSSFPFPKPDRQTALVLGEWWNANPVDVINQAIRTGAAPNISDAYTINGQPGDLYNC  204

Query  622  H-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
              +    V + +GET LLRVINAALNQ LFFSVANH  TVV  DA+Y KPF++ V+MLGP
Sbjct  205  STKETVVVPINSGETSLLRVINAALNQPLFFSVANHKLTVVGADASYLKPFTTKVLMLGP  264

Query  799  GQ  804
            GQ
Sbjct  265  GQ  266



>ref|XP_007146836.1| hypothetical protein PHAVU_006G074000g [Phaseolus vulgaris]
 gb|ESW18830.1| hypothetical protein PHAVU_006G074000g [Phaseolus vulgaris]
Length=573

 Score =   347 bits (889),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 155/242 (64%), Positives = 194/242 (80%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E H+HEFV+ A   +RLCKT +IITVNGQFPGPT+E RNGD ++IKV+NAA+YN ++HWH
Sbjct  31   EIHFHEFVVQARSVRRLCKTQNIITVNGQFPGPTVEARNGDFMIIKVVNAAQYNISIHWH  90

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+R + + WADGP+Y+TQCPIQPG  YTYRF I+ QEGTLWWHAHT +LRATVYGA +IY
Sbjct  91   GLRMLRNPWADGPSYVTQCPIQPGGSYTYRFRIRDQEGTLWWHAHTSFLRATVYGAFIIY  150

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            PRLG PYPF  P +E P+LLGEW++ DI  + RQA F G  P+ S AYTING PGDLY C
Sbjct  151  PRLGSPYPFSMPKQEFPLLLGEWFDSDIVLLQRQADFAGLPPHPSVAYTINGQPGDLYRC  210

Query  622  -HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
              +G  +V V+ GE+++LR+I++ LNQ+LFFS+ANH  TVV  DATYTKPF + V+M+GP
Sbjct  211  SSQGTVRVPVEAGESIMLRIISSTLNQELFFSIANHSMTVVGTDATYTKPFRTTVLMIGP  270

Query  799  GQ  804
            GQ
Sbjct  271  GQ  272



>gb|EMS66367.1| Laccase-3 [Triticum urartu]
Length=526

 Score =   345 bits (885),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 156/242 (64%), Positives = 191/242 (79%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            + H+HEF++  TP KRLC+ H+IITVNGQFPGPTLEVR GDTLV+ V+N A+YN T+HWH
Sbjct  23   KVHHHEFIVQETPVKRLCEEHNIITVNGQFPGPTLEVREGDTLVVNVVNQAQYNVTIHWH  82

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            GIRQ  + WADGP ++TQCPI+PG  Y YRFTI+ QEGTLWWHAH+  LRATVYGA++I 
Sbjct  83   GIRQFRTGWADGPEFVTQCPIKPGGSYKYRFTIEGQEGTLWWHAHSSCLRATVYGALIIR  142

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            PR   PYPF KP +E+PILLGEWW  +   V+R+A  TG APNVSDA+T+NG PGDLY C
Sbjct  143  PREDKPYPFDKPSREVPILLGEWWNANPVEVIREAQRTGGAPNVSDAFTVNGQPGDLYNC  202

Query  622  HR-GITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
             R   T + VK GET LLR IN+ALN +LF S+A+H  TVV VDA+YTKPF ++V+M+ P
Sbjct  203  SRQDTTAISVKPGETALLRFINSALNHELFVSIASHKMTVVGVDASYTKPFVTSVLMIAP  262

Query  799  GQ  804
            GQ
Sbjct  263  GQ  264



>gb|AAK37826.1|AF132122_1 laccase [Pinus taeda]
Length=570

 Score =   346 bits (888),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 163/244 (67%), Positives = 188/244 (77%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            S +     FV+ +T  KRLC TH+IITVNGQFPGPTL VRNGDTLV+KV N A+YNAT+H
Sbjct  27   SAKLRTETFVLQSTSVKRLCGTHNIITVNGQFPGPTLHVRNGDTLVVKVYNNAQYNATIH  86

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+RQ  + W+DGP YITQCPI+PG  YTYRFTI  QEGTLWWHAH+ WLRATVYGA+V
Sbjct  87   WHGVRQFRTGWSDGPEYITQCPIRPGGSYTYRFTITGQEGTLWWHAHSSWLRATVYGALV  146

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I P  G  YPF +P  ++PILLGEWW R+   V+ QAT TGAAPNVSDA+TING PGDLY
Sbjct  147  ISPSPGATYPFTRPHGQVPILLGEWWSRNPIDVVDQATRTGAAPNVSDAFTINGQPGDLY  206

Query  616  TCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C    T +V +  GET LLRVINAALN  LFF+V  H  TVV VDA YTKPF +N++ML
Sbjct  207  QCSSSDTIRVSINNGETKLLRVINAALNTDLFFTVGGHTMTVVAVDALYTKPFQTNLLML  266

Query  793  GPGQ  804
            GPGQ
Sbjct  267  GPGQ  270



>ref|XP_003564513.1| PREDICTED: laccase-3 [Brachypodium distachyon]
Length=566

 Score =   345 bits (886),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 190/242 (79%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E H+HEF++  TP KRLCK H+IITVNGQFPGPTLEVR GDTLV+ V+N A+YN T+HWH
Sbjct  24   EVHHHEFIVQETPVKRLCKEHNIITVNGQFPGPTLEVREGDTLVVNVVNQAQYNVTIHWH  83

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            GIRQ  + WADGP ++TQCPI+PG  Y Y+FTI+ QEGTLWWHAH+ WLRATVYGA++I 
Sbjct  84   GIRQFRTGWADGPEFVTQCPIKPGGSYKYKFTIEGQEGTLWWHAHSSWLRATVYGALIIR  143

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            PR    YPF KP +E+P++LGEWW+ +   V+R+A  TG  PNVSDA+T+NG PGDLY C
Sbjct  144  PREDKAYPFEKPSREVPLMLGEWWDANPIDVIREAQRTGGGPNVSDAFTVNGQPGDLYNC  203

Query  622  HR-GITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
             R   T + VK GET LLR IN+ALN +LF S+ANH  TVV  DA+YT+PF ++V+M+ P
Sbjct  204  SREETTAISVKPGETALLRFINSALNHELFVSIANHKMTVVGADASYTEPFVTSVLMIAP  263

Query  799  GQ  804
            GQ
Sbjct  264  GQ  265



>ref|XP_008804167.1| PREDICTED: laccase-3-like [Phoenix dactylifera]
Length=576

 Score =   345 bits (886),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 157/251 (63%), Positives = 194/251 (77%), Gaps = 1/251 (0%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            S    + + + HY++FVI  TP KRLCKTH IITVNGQ+PGPTLEVR+GDTLVI  +N A
Sbjct  21   SLMFNYANAKVHYYDFVIQETPVKRLCKTHQIITVNGQYPGPTLEVRDGDTLVINAVNRA  80

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            +YN TLHWHG+ Q  + WADGP Y+TQCPI PG  YTYRFTI+ Q GTLWWHAH+ WLR 
Sbjct  81   KYNITLHWHGVHQNRTGWADGPEYLTQCPIMPGGSYTYRFTIENQVGTLWWHAHSSWLRV  140

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TV+GA++IYP+ G  YPFPKP+KEIP++LGEWW R+   V+RQA  TGAAPN+SDA+ IN
Sbjct  141  TVHGALIIYPKEGSYYPFPKPNKEIPVILGEWWNRNPLDVLRQALKTGAAPNISDAFLIN  200

Query  595  GWPGDLYTC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPF  771
            G PGDLY C  +  T + V  GET LLR+INAALN +LFF++A H  TVV  DA YTKPF
Sbjct  201  GQPGDLYNCSSKDTTIIPVSFGETNLLRIINAALNNELFFTIAGHEMTVVGADAAYTKPF  260

Query  772  SSNVIMLGPGQ  804
            +++V+ + PG+
Sbjct  261  TTSVLKISPGE  271



>ref|XP_006293898.1| hypothetical protein CARUB_v10022891mg [Capsella rubella]
 gb|EOA26796.1| hypothetical protein CARUB_v10022891mg [Capsella rubella]
Length=579

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/242 (64%), Positives = 192/242 (79%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            + H+HEF+I AT  KRLC+TH+ ITVNG FPGPTL V NGDTLV+KVIN ARYN T+HWH
Sbjct  29   KAHHHEFIIQATKVKRLCETHNSITVNGMFPGPTLVVNNGDTLVVKVINRARYNVTIHWH  88

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP ++TQCPI+PG+ YTYRFTIQ QEGTLWWHAH+ WLRATVYG++++ 
Sbjct  89   GVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHSSWLRATVYGSLLVL  148

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P  G  YPF  P + +P+LLGEWW+ +   V+R++  TG APN SDAYTING PGD Y C
Sbjct  149  PPAGSSYPFTNPHRNVPLLLGEWWDANPVDVLRESIRTGGAPNNSDAYTINGQPGDFYKC  208

Query  622  -HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
              +  T V +  GET+LLRVIN+ALNQ LFF+VANH  TVV  DA+Y KPF++NVI+LGP
Sbjct  209  SSQDTTIVPINVGETILLRVINSALNQPLFFTVANHKLTVVGADASYLKPFTTNVIVLGP  268

Query  799  GQ  804
            GQ
Sbjct  269  GQ  270



>ref|XP_009407324.1| PREDICTED: laccase-3-like [Musa acuminata subsp. malaccensis]
Length=562

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/246 (65%), Positives = 192/246 (78%), Gaps = 2/246 (1%)
 Frame = +1

Query  70   FLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNAT  249
            +   E HYHEFV+ ATP KRLCK H+IITVNGQFPGPT+EV+NGDTLVI V+N ARYN T
Sbjct  18   YSGAEVHYHEFVVQATPVKRLCKAHNIITVNGQFPGPTIEVKNGDTLVINVVNRARYNVT  77

Query  250  LHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGA  429
            LHWHG+RQ+ + WADGP ++TQCPI+P   Y YRFTI+ QEGTLWWHAH+ WLRAT+YGA
Sbjct  78   LHWHGVRQMRTAWADGPEFVTQCPIRPSGSYRYRFTIEGQEGTLWWHAHSSWLRATIYGA  137

Query  430  IVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGD  609
            ++I+P+     PF KP +EIP+LLGEWW R+   V+R+A  TGAAPN SDA+TING PGD
Sbjct  138  LIIHPKDN-SCPFTKPKREIPVLLGEWWNRNPIDVVRRAKRTGAAPNNSDAFTINGEPGD  196

Query  610  LYTCHRGITKV-QVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVI  786
            LY C R  T V     GET L R INAALN +LF ++A H  TVV  DA+YTKPF+++V+
Sbjct  197  LYKCSRKDTTVIPAMAGETNLFRFINAALNTELFVAIAGHKMTVVGADASYTKPFTTSVL  256

Query  787  MLGPGQ  804
            MLGPGQ
Sbjct  257  MLGPGQ  262



>ref|XP_002456566.1| hypothetical protein SORBIDRAFT_03g038550 [Sorghum bicolor]
 gb|EES01686.1| hypothetical protein SORBIDRAFT_03g038550 [Sorghum bicolor]
Length=568

 Score =   344 bits (883),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/242 (64%), Positives = 190/242 (79%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E H+HEFV+  TP KRLCKTH+IITVNGQFPGP LEVR GDTLVI V+N A+YN T+HWH
Sbjct  26   EVHHHEFVVQETPVKRLCKTHNIITVNGQFPGPMLEVREGDTLVINVVNRAQYNVTIHWH  85

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            GIRQ+ + WADGP ++TQCPI+PG  Y YRFTI+ QEGTLWWHAH+ WLRATVYG ++I 
Sbjct  86   GIRQMRTGWADGPEFVTQCPIKPGGSYKYRFTIEGQEGTLWWHAHSSWLRATVYGGLIIR  145

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            PR    YPF KP +E+P++LGEWW+ +   V+R+A  TG  PNVSDA+TING PGDL+ C
Sbjct  146  PRENKTYPFAKPSREVPLILGEWWDANPIDVIREAQKTGGGPNVSDAFTINGQPGDLFKC  205

Query  622  -HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
              +  T + VK GET LLR INAALN +LF ++A H  TVV  DA+YTKPF+++V+M+ P
Sbjct  206  SQKETTAIPVKAGETALLRFINAALNHELFVTIAQHKMTVVATDASYTKPFTTSVLMIAP  265

Query  799  GQ  804
            GQ
Sbjct  266  GQ  267



>ref|XP_004970425.1| PREDICTED: laccase-3-like [Setaria italica]
Length=567

 Score =   343 bits (881),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 155/243 (64%), Positives = 190/243 (78%), Gaps = 1/243 (0%)
 Frame = +1

Query  79   GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHW  258
             E H+HEFV+  TP KRLCKTH+IITVNGQFPGPTLEVR GDTLVI V+N A+Y+ T+HW
Sbjct  23   AEVHHHEFVVQETPVKRLCKTHNIITVNGQFPGPTLEVREGDTLVINVVNRAQYDVTIHW  82

Query  259  HGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVI  438
            HGIRQ+ + WADGP ++TQCPI+PG  Y YRFTI+ QEGTLWWHAH+ WLRATVYGA++I
Sbjct  83   HGIRQLRTGWADGPEFVTQCPIKPGGSYKYRFTIEGQEGTLWWHAHSSWLRATVYGALII  142

Query  439  YPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYT  618
             PR    YPF KP +E+P++LGEWW  +   V+R+A  TG APNVSDA+TING PGD   
Sbjct  143  RPRENKTYPFEKPSREVPVILGEWWNANPVDVIREAQRTGGAPNVSDAFTINGQPGDFLK  202

Query  619  C-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLG  795
            C  +  T + VK GET LLR INAALN +LF ++A H  TVV  DA+YTKPF+++V+M+ 
Sbjct  203  CSEKETTAIPVKPGETALLRFINAALNHELFVTIAQHKMTVVAADASYTKPFTTSVLMIA  262

Query  796  PGQ  804
            PGQ
Sbjct  263  PGQ  265



>gb|KHN46117.1| Laccase-3, partial [Glycine soja]
Length=537

 Score =   342 bits (878),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 188/234 (80%), Gaps = 1/234 (0%)
 Frame = +1

Query  106  IAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWHGIRQIGSQ  285
            I   P KRLC+T +I+TVNGQFPGPT+E RNGD+L IKV+NA  YN ++HWHG+R + + 
Sbjct  1    IQTVPVKRLCRTQNILTVNGQFPGPTVEARNGDSLAIKVVNAGPYNISIHWHGLRMLRNP  60

Query  286  WADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIYPRLGVPYP  465
            WADGP+Y+TQCPIQPG  YTYRFTIQ QEGTLWWHAHT +LRATVYGA++IYP+LG PYP
Sbjct  61   WADGPSYVTQCPIQPGGSYTYRFTIQNQEGTLWWHAHTGFLRATVYGALIIYPKLGSPYP  120

Query  466  FPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTCHRGIT-KV  642
            F  P +E P+LL EW+ RD   ++RQ  FTGA PNVS AYTING PGDLY C    T +V
Sbjct  121  FSMPKREYPLLLAEWFNRDPMVLLRQTQFTGAPPNVSVAYTINGQPGDLYRCSSQETVRV  180

Query  643  QVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGPGQ  804
             V  GET+LLR+IN+ALNQ+LFF++ANH  TVV  DA YTKPF++NV+M+GPGQ
Sbjct  181  PVDAGETILLRIINSALNQELFFTIANHRMTVVATDAAYTKPFTTNVLMIGPGQ  234



>ref|XP_002881718.1| hypothetical protein ARALYDRAFT_903327 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57977.1| hypothetical protein ARALYDRAFT_903327 [Arabidopsis lyrata subsp. 
lyrata]
Length=581

 Score =   344 bits (882),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 156/242 (64%), Positives = 192/242 (79%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            + H+HEF+I AT  KRLC+TH+ ITVNG FPGP L V NGDTLV+KVIN ARYN T+HWH
Sbjct  27   KAHHHEFIIQATKVKRLCETHNSITVNGMFPGPMLVVNNGDTLVVKVINRARYNITIHWH  86

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP ++TQCPI+PG+ YTYRFTIQ QEGTLWWHAH+ WLRATVYG++++ 
Sbjct  87   GVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHSSWLRATVYGSLLVL  146

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P  G  YPF  P + +P+LLGEWW+ +   V+R++  TG APN SDAYTING PGDLY C
Sbjct  147  PPAGSSYPFTNPHRNVPLLLGEWWDANPVDVLRESIRTGGAPNNSDAYTINGQPGDLYKC  206

Query  622  -HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
              +  T V +  GET+LLRVIN+ALNQ LFF+VANH  TVV  DA+Y KPF++NVI+LGP
Sbjct  207  SSQDTTIVPINVGETILLRVINSALNQPLFFTVANHKLTVVGADASYLKPFTTNVIVLGP  266

Query  799  GQ  804
            GQ
Sbjct  267  GQ  268



>gb|EEC71732.1| hypothetical protein OsI_04280 [Oryza sativa Indica Group]
Length=599

 Score =   344 bits (882),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 163/283 (58%), Positives = 196/283 (69%), Gaps = 33/283 (12%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            S  A     E H+HEF++  TP KRLCKTH++ITVNGQ PGPTLEVR GDT+VI V+N A
Sbjct  16   SVLALLAGAEVHHHEFIVQETPVKRLCKTHNVITVNGQLPGPTLEVREGDTVVINVVNHA  75

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            +YN T+HWHGIRQ  + WADGP ++TQCPI+PG  Y YRFTI+ QEGTLWWHAH+ WLRA
Sbjct  76   QYNVTIHWHGIRQFRTGWADGPEFVTQCPIKPGGSYKYRFTIEGQEGTLWWHAHSSWLRA  135

Query  415  TVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTIN  594
            TVYGA++I PR    YPF KP +E+P++LGEWW+ D   V+R+A  TGAAPN+SDAYTIN
Sbjct  136  TVYGALIIRPRENKTYPFEKPAREVPLILGEWWDADPIQVIREAQRTGAAPNISDAYTIN  195

Query  595  GWPGDLYTC---------------------------------HRGITKVQVKTGETVLLR  675
            G PGDLY C                                 H   T V VK GET LLR
Sbjct  196  GQPGDLYNCSKEGRKSLTLVCVFYQPVCVRQCVANLQRHDNMHAETTAVPVKPGETALLR  255

Query  676  VINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGPGQ  804
             INAALNQ+LF S+A H  TVV VDA+YTKPF+++V+M+ PGQ
Sbjct  256  FINAALNQELFVSIAQHKMTVVGVDASYTKPFTTSVLMIAPGQ  298



>emb|CDY18869.1| BnaC04g04810D [Brassica napus]
Length=574

 Score =   343 bits (880),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 154/244 (63%), Positives = 195/244 (80%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            + + H+HEF+I AT  KRLC+TH+ ITVNG FPGP L + NGDTLV+KVIN ARYN T+H
Sbjct  23   ASKAHHHEFIIQATKVKRLCETHNSITVNGIFPGPQLVINNGDTLVVKVINRARYNVTIH  82

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHG+RQ+ + WADGP ++TQCPI+PG+ Y YRFTIQ QEGTLWWHAH+ WLRATVYG+++
Sbjct  83   WHGVRQMRTGWADGPEFVTQCPIRPGSSYIYRFTIQGQEGTLWWHAHSSWLRATVYGSLL  142

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            + P  G  +PFP P + +P+LLGEWW+ +   V+ ++  TGAAPN+SDAYTI+G PGDLY
Sbjct  143  VLPSAGSSHPFPTPHRNVPLLLGEWWDANPVDVLGESIRTGAAPNISDAYTIDGQPGDLY  202

Query  616  TC-HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C  +  T V +  GET+LLRVIN+ALNQ LFF+VANH FTVV  DA+Y KPF++NVI+L
Sbjct  203  KCSSQDTTIVPINVGETILLRVINSALNQPLFFTVANHKFTVVGADASYLKPFTTNVIVL  262

Query  793  GPGQ  804
            GPGQ
Sbjct  263  GPGQ  266



>ref|XP_004984887.1| PREDICTED: laccase-3-like [Setaria italica]
Length=608

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/242 (64%), Positives = 186/242 (77%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E  ++EFV+  TP KRLC +  IITVNGQFPGPT+EV NGDTL IK +N ARYN TLHWH
Sbjct  29   EERFYEFVVQETPVKRLCSSQKIITVNGQFPGPTIEVYNGDTLAIKAVNLARYNVTLHWH  88

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLRATV+GA++I+
Sbjct  89   GLRQLRNGWADGPEFVTQCPIRPGGSYTYRFTIQDQEGTLWWHAHSSWLRATVHGALIIH  148

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            PR G+PYPFPKP  E P++L EWW RD  +V+RQ+  TGA PNVSDA  ING PGDL  C
Sbjct  149  PRRGLPYPFPKPHSEFPVILAEWWRRDPIAVLRQSMITGAPPNVSDALLINGQPGDLLPC  208

Query  622  HRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
                T  + V  GET LLR+INAA+N +LF S+A H  TVV  DA YTKPF + VI+LGP
Sbjct  209  SSQETSIIPVVAGETSLLRIINAAMNTELFVSLAGHKMTVVAADAMYTKPFETTVILLGP  268

Query  799  GQ  804
            GQ
Sbjct  269  GQ  270



>ref|XP_010491073.1| PREDICTED: laccase-12-like [Camelina sativa]
Length=565

 Score =   341 bits (875),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/252 (63%), Positives = 191/252 (76%), Gaps = 1/252 (0%)
 Frame = +1

Query  52   SSCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINA  231
            S  +A+    +  +H+FVI  TP KRLCKT + ITVNG FPGPTLEV NGDTL +KV N 
Sbjct  15   SLLSASSTIAKVQHHDFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNNGDTLEVKVHNR  74

Query  232  ARYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLR  411
            AR N T+HWHG+RQI + WADGP ++TQCPI+PG  YTYRFTIQ QEGTLWWHAH+ WLR
Sbjct  75   ARNNITIHWHGVRQIRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLR  134

Query  412  ATVYGAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTI  591
            ATVYGA++I P  G  +PFPKPD++  ++LGEWW  +   V+ QA  TGAAPN+SDAYTI
Sbjct  135  ATVYGALIIQPTPGSSFPFPKPDRQTALVLGEWWNANPVDVINQAIRTGAAPNISDAYTI  194

Query  592  NGWPGDLYTCH-RGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKP  768
            NG PGDLY C  +    V + +GET LLRVINAALNQ LFFSVA H  TVV  DA+Y KP
Sbjct  195  NGQPGDLYNCSTKETVVVPINSGETSLLRVINAALNQPLFFSVAKHKLTVVGADASYVKP  254

Query  769  FSSNVIMLGPGQ  804
            F++ V+MLGPGQ
Sbjct  255  FTTKVLMLGPGQ  266



>ref|NP_001145891.1| putative laccase family protein precursor [Zea mays]
 gb|ACL52797.1| unknown [Zea mays]
 tpg|DAA44912.1| TPA: putative laccase family protein [Zea mays]
Length=607

 Score =   342 bits (876),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 188/242 (78%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E  ++EFV+  TP KRLCKT  IITVNGQFPGPT+EV +GDTL ++ +N ARYN TLHWH
Sbjct  33   EERFYEFVVRGTPVKRLCKTQEIITVNGQFPGPTIEVYSGDTLAVRAVNLARYNVTLHWH  92

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP ++TQCPI+PG  YTYRFT++ QEGTLWWHAH+ WLRATV+GA++I+
Sbjct  93   GLRQLRNGWADGPEFVTQCPIRPGGSYTYRFTVEGQEGTLWWHAHSSWLRATVHGALIIH  152

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            PR GVPYPFPKP  E P++L EWW RD  +V+RQ+  TGA PNVSDA  ING PGDL  C
Sbjct  153  PRRGVPYPFPKPHTEAPVILAEWWRRDPIAVLRQSMITGAPPNVSDALLINGQPGDLLPC  212

Query  622  HRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
                T  + V  GET LLR+INAA+N +LF S+A H  TVV  DA YTKPF ++V++LGP
Sbjct  213  SSQETSIIPVVAGETSLLRIINAAMNTELFVSLAGHRMTVVAADAMYTKPFETDVVLLGP  272

Query  799  GQ  804
            GQ
Sbjct  273  GQ  274



>gb|AFL65035.1| laccase 2, partial [Pinus pinaster]
Length=371

 Score =   333 bits (853),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/253 (62%), Positives = 188/253 (74%), Gaps = 3/253 (1%)
 Frame = +1

Query  55   SCTATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAA  234
            + +   +S + H H FV+ +TP KRLC TH+IITVNGQFPGPTL VRNGD L +KV N A
Sbjct  7    TLSTAMVSAKLHTHIFVLRSTPVKRLCGTHNIITVNGQFPGPTLHVRNGDKLKVKVHNQA  66

Query  235  RYNATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRA  414
            +YNAT+HWHG+RQ  + W+DGP +ITQCPI+PG  YTY+FT+  QEGTLWWHAH+ WLRA
Sbjct  67   QYNATIHWHGVRQFRTGWSDGPEFITQCPIRPGRSYTYKFTVTGQEGTLWWHAHSSWLRA  126

Query  415  TVYGAIVIYPRLGVPYP--FPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYT  588
            TVYGA++I PRL   YP  F +P ++IPILLGEWW R+   V+ QA         SDA+T
Sbjct  127  TVYGALIILPRLDTTYPFTFTRPHRQIPILLGEWWNRNPMDVVNQAXXXXXXXXXSDAFT  186

Query  589  INGWPGDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTK  765
            ING PGDLY C    T  V +K GET LLRVINAALN  LFFS+A+H  TVV VDA YTK
Sbjct  187  INGQPGDLYKCSTSDTFSVSMKGGETNLLRVINAALNTDLFFSIASHTMTVVAVDALYTK  246

Query  766  PFSSNVIMLGPGQ  804
            PF +NV+MLGPGQ
Sbjct  247  PFQTNVLMLGPGQ  259



>gb|AFV52377.1| laccase [Picea abies]
Length=575

 Score =   340 bits (871),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/236 (66%), Positives = 187/236 (79%), Gaps = 1/236 (0%)
 Frame = +1

Query  100  FVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWHGIRQIG  279
            FV+ +T  K+LC T +IITVNGQFPGPT+  RNGDT+++KV N A+YNAT+HWHG+RQ  
Sbjct  40   FVLQSTTVKKLCGTQNIITVNGQFPGPTIHARNGDTVIVKVYNNAQYNATIHWHGVRQFR  99

Query  280  SQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIYPRLGVP  459
            + W+DGP +ITQCPI+PG  YTY+FT+  QEGTLWWH H+ WLRATVYGA++I PRLG  
Sbjct  100  TGWSDGPEFITQCPIRPGGSYTYKFTLTDQEGTLWWHGHSSWLRATVYGALIISPRLGST  159

Query  460  YPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTCHRGIT-  636
            YP+ KP  ++PILLGEWW R+   V+ QAT TGAAP+VSDA+TING PGDLY C    T 
Sbjct  160  YPYTKPHGQVPILLGEWWNRNPIDVVNQATQTGAAPSVSDAFTINGRPGDLYQCSSSDTL  219

Query  637  KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGPGQ  804
             + VK GET LLRVINAALN  LFFSV++H  TVV VDA YTKPF +NV+MLGPGQ
Sbjct  220  HISVKNGETKLLRVINAALNTDLFFSVSSHTMTVVAVDALYTKPFQTNVLMLGPGQ  275



>gb|EEC75054.1| hypothetical protein OsI_11166 [Oryza sativa Indica Group]
Length=429

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/242 (63%), Positives = 182/242 (75%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E  ++EFV+  T  KRLC T  IITVNGQFPGPT+EV +GDT+ I+ +N ARYN TLHWH
Sbjct  34   EERFYEFVVQETLVKRLCNTQKIITVNGQFPGPTIEVYDGDTVAIRAVNMARYNVTLHWH  93

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP ++TQCPI+PG  YTYRF IQ QEGTLWWHAH+ WLRATV+GA++I 
Sbjct  94   GLRQLRNGWADGPEFVTQCPIRPGGSYTYRFAIQGQEGTLWWHAHSSWLRATVHGALLIR  153

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            PR GVPYPFPKP  E PI+L EWW RD  +V+RQ+  TGA PNVSDA  ING PGD   C
Sbjct  154  PRPGVPYPFPKPHSEFPIILAEWWRRDPIAVLRQSMITGAPPNVSDAILINGQPGDFLEC  213

Query  622  HRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
                T  + V  GET LLR+INAA+N +LF S+A H  TVV  DA YTKPF + V++LGP
Sbjct  214  SAQETSIIPVAAGETTLLRIINAAMNTELFVSLAGHKMTVVAADAMYTKPFETTVVLLGP  273

Query  799  GQ  804
            GQ
Sbjct  274  GQ  275



>gb|EMS63105.1| Laccase-3 [Triticum urartu]
Length=552

 Score =   337 bits (864),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 152/253 (60%), Positives = 187/253 (74%), Gaps = 11/253 (4%)
 Frame = +1

Query  79   GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHW  258
             E  ++EFV+  T  KRLC+T  IITVNGQFPGPT+EV +GDTL IK +N A+YN TLHW
Sbjct  32   AEERFYEFVVQETVVKRLCETSKIITVNGQFPGPTIEVHDGDTLAIKAVNRAQYNVTLHW  91

Query  259  HGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVI  438
            HG+RQ+ + WADGP ++TQCPI+PG+ YTYRFT+Q+QEGTLWWHAH+ WLRATV+GA+VI
Sbjct  92   HGLRQLRNGWADGPEFVTQCPIRPGSSYTYRFTVQEQEGTLWWHAHSSWLRATVHGALVI  151

Query  439  YPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYT  618
             P+ G PYPFPKP KE P++L EWW RD  +V+RQ+  TGA PNVSDA  ING PGD   
Sbjct  152  LPKRGRPYPFPKPAKEFPVVLAEWWRRDPIAVLRQSMVTGAGPNVSDAILINGQPGDFLQ  211

Query  619  C-----------HRGITKVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTK  765
            C           H   + + V  GET LLR+INAA+N +LF S+A H  TVV  DA YTK
Sbjct  212  CSSQVKLIIGDHHAETSIIPVVAGETNLLRIINAAMNSELFVSLAGHKMTVVAADAMYTK  271

Query  766  PFSSNVIMLGPGQ  804
            PF + V++LGPGQ
Sbjct  272  PFETTVVLLGPGQ  284



>gb|EMT30315.1| Laccase-3 [Aegilops tauschii]
Length=566

 Score =   335 bits (858),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/242 (63%), Positives = 187/242 (77%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E  ++EFV+  T  KRLC+T+ IITVNGQFPGPT+EV +GDTL IK +N A+YN TLHWH
Sbjct  23   EERFYEFVVQETVVKRLCQTNKIITVNGQFPGPTIEVHDGDTLAIKAVNRAQYNVTLHWH  82

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP ++TQCPI+PG+ YTYRF +Q+QEGTLWWHAH+ WLRATV+GA+VI 
Sbjct  83   GLRQLRNGWADGPEFVTQCPIRPGSSYTYRFRVQEQEGTLWWHAHSSWLRATVHGALVIL  142

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P+ G PYPFPKP KEIP++L EWW RD  +V+RQ+  TGA PNVSDA  ING PGD   C
Sbjct  143  PKRGRPYPFPKPAKEIPVVLAEWWRRDPIAVLRQSMVTGAGPNVSDAILINGQPGDFLQC  202

Query  622  HRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
                T  + V  GET LLR+INAA+N +LF S+A H  TVV  DA YTKPF + V++LGP
Sbjct  203  SSQETSIIPVVAGETNLLRIINAAMNSELFVSLAGHKMTVVAADAMYTKPFETTVVLLGP  262

Query  799  GQ  804
            GQ
Sbjct  263  GQ  264



>gb|EMT01053.1| Laccase-3 [Aegilops tauschii]
Length=591

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 188/242 (78%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E  ++EFV+  T  KRLC+T+ IITVNGQFPGPT+EV NGDTL I+ +N A+YN TLHWH
Sbjct  23   EERFYEFVVQETVVKRLCQTNRIITVNGQFPGPTIEVHNGDTLAIRAVNMAQYNVTLHWH  82

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP ++TQCPI+PG+ YTYR+TIQ+QEGTLWWHAH+ WLRATV+GA++I 
Sbjct  83   GLRQLRNGWADGPEFVTQCPIRPGSSYTYRYTIQEQEGTLWWHAHSSWLRATVHGALIIL  142

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P+ G+PYPFPKPDKE P++L EWW RD  +V+RQ+  TGA PNVSD   ING PGD   C
Sbjct  143  PKRGMPYPFPKPDKEFPVVLAEWWRRDPIAVLRQSMVTGAPPNVSDTILINGQPGDFLPC  202

Query  622  HRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
                T  + V  GET L+R+INAA+N +LF S+A H  TVV  DA YTKPF + V++LGP
Sbjct  203  SSQETSIIPVVAGETNLVRIINAAMNSELFVSLAGHKMTVVAADAVYTKPFETTVVLLGP  262

Query  799  GQ  804
            GQ
Sbjct  263  GQ  264



>emb|CBW38080.1| laccase-like multicopper oxidase [Hordeum vulgare subsp. vulgare]
Length=592

 Score =   335 bits (858),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 152/242 (63%), Positives = 187/242 (77%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E  ++EFV+  T  KRLC+T+ IITVNGQFPGPT+EV NGDTL I+ +N A+YN TLHWH
Sbjct  23   EERFYEFVVQETVVKRLCQTNRIITVNGQFPGPTIEVHNGDTLAIRAVNMAQYNVTLHWH  82

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP ++TQCPI+PG+ YTYR+TIQ+QEGTLWWHAH+ WLRATV+GA+VI 
Sbjct  83   GLRQLRNGWADGPEFVTQCPIRPGSSYTYRYTIQEQEGTLWWHAHSSWLRATVHGALVIL  142

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P+ GVPYPFPKP KE P++L EWW RD  +V+RQ+  TGA PNVSD   ING PGD   C
Sbjct  143  PKRGVPYPFPKPHKEFPVVLAEWWRRDPIAVLRQSMVTGAPPNVSDTILINGQPGDFLPC  202

Query  622  HRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
                T  + V  GET LLR+INAA+N +LF S+A H  TVV  DA YTKPF + V++LGP
Sbjct  203  SSQETSIIPVVAGETNLLRIINAAMNSELFVSLAGHKMTVVAADAVYTKPFETTVVLLGP  262

Query  799  GQ  804
            GQ
Sbjct  263  GQ  264



>gb|EMS46935.1| Laccase-3 [Triticum urartu]
Length=600

 Score =   335 bits (858),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 188/242 (78%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E  ++EFV+  T  KRLC+T+ IITVNGQFPGPT+EV NGDTL I+ +N A+YN TLHWH
Sbjct  33   EERFYEFVVQETVVKRLCQTNRIITVNGQFPGPTIEVHNGDTLAIRAVNMAQYNVTLHWH  92

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP ++TQCPI+PG+ YTYR+TIQ+QEGTLWWHAH+ WLRATV+GA++I 
Sbjct  93   GLRQLRNGWADGPEFVTQCPIRPGSSYTYRYTIQEQEGTLWWHAHSSWLRATVHGALIIL  152

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            P+ G+PYPFPKP+KE P++L EWW RD  +V+RQ+  TGA PNVSD   ING PGD   C
Sbjct  153  PKRGMPYPFPKPNKEFPVVLAEWWRRDPIAVLRQSMVTGAPPNVSDTILINGQPGDFLPC  212

Query  622  HRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
                T  + V  GET LLR+INAA+N +LF S+A H  TVV  DA YTKPF + V++LGP
Sbjct  213  SSQETSIIPVVAGETNLLRIINAAMNSELFVSLAGHKMTVVAADAVYTKPFETTVVLLGP  272

Query  799  GQ  804
            GQ
Sbjct  273  GQ  274



>ref|XP_003558123.1| PREDICTED: laccase-3 [Brachypodium distachyon]
Length=599

 Score =   333 bits (855),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 148/243 (61%), Positives = 187/243 (77%), Gaps = 1/243 (0%)
 Frame = +1

Query  79   GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHW  258
             E  ++EFV+  T  KRLCKT  IITVNGQFPGPT+EV +GDTL I+ +N A+YN TLHW
Sbjct  29   AEERFYEFVVQETVVKRLCKTQKIITVNGQFPGPTIEVHDGDTLAIRAVNMAQYNVTLHW  88

Query  259  HGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVI  438
            HG+RQ+ + WADGP ++TQCPI+PG+ YTYR+TIQ QEGTLWWHAH+ WLRATV+GA++I
Sbjct  89   HGLRQLRNGWADGPEFVTQCPIRPGSSYTYRYTIQGQEGTLWWHAHSSWLRATVHGALII  148

Query  439  YPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYT  618
            +P+ G+PYPFPKP+KE P+LL EWW +D  +V+RQ+  TGA PN+SD   ING PGD   
Sbjct  149  HPKRGLPYPFPKPNKEFPVLLAEWWRKDPIAVIRQSMVTGAPPNISDTILINGQPGDFLE  208

Query  619  CHRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLG  795
            C    T  + V  GET LLR+INAA+N +LF S+A H  TVV  DA YT+PF + V++LG
Sbjct  209  CSSQETSIIPVVAGETNLLRIINAAMNSELFVSLAGHKMTVVAADAVYTRPFETTVVLLG  268

Query  796  PGQ  804
            PGQ
Sbjct  269  PGQ  271



>ref|NP_001049841.2| Os03g0297900 [Oryza sativa Japonica Group]
 dbj|BAF11755.2| Os03g0297900 [Oryza sativa Japonica Group]
Length=630

 Score =   333 bits (853),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 152/242 (63%), Positives = 182/242 (75%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E  ++EFV+  T  KRLC T  IITVNGQFPGPT+EV +GDT+ I+ +N ARYN TLHWH
Sbjct  34   EERFYEFVVQETLVKRLCNTQKIITVNGQFPGPTIEVYDGDTVAIRAVNMARYNVTLHWH  93

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP ++TQCPI+PG  YTYRF IQ QEGTLWWHAH+ WLRATV+GA++I 
Sbjct  94   GLRQLRNGWADGPEFVTQCPIRPGGSYTYRFAIQGQEGTLWWHAHSSWLRATVHGALLIR  153

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            PR GVPYPFPKP  E PI+L EWW RD  +V+RQ+  TGA PNVSDA  ING PGD   C
Sbjct  154  PRPGVPYPFPKPHSEFPIILAEWWRRDPIAVLRQSMITGAPPNVSDAILINGQPGDFLEC  213

Query  622  HRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
                T  + V  GET LLR+INAA+N +LF S+A H  TVV  DA YTKPF + V++LGP
Sbjct  214  SAQETSIIPVAAGETTLLRIINAAMNTELFVSLAGHKMTVVAADAMYTKPFETTVVLLGP  273

Query  799  GQ  804
            GQ
Sbjct  274  GQ  275



>ref|XP_002468016.1| hypothetical protein SORBIDRAFT_01g038130 [Sorghum bicolor]
 gb|EER95014.1| hypothetical protein SORBIDRAFT_01g038130 [Sorghum bicolor]
Length=600

 Score =   332 bits (850),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 185/242 (76%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E  ++EFV+  T  KRLCK+  I+TVNGQFPGPT+EV +GDTL IK +N A YN TLHWH
Sbjct  33   EERFYEFVVKETLVKRLCKSQKIVTVNGQFPGPTIEVYSGDTLAIKAVNLAPYNVTLHWH  92

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP ++TQCPI+PG  YTYRFT Q QEGTLWWHAH+ WLRATV+GA++I+
Sbjct  93   GLRQLRNGWADGPEFVTQCPIRPGGSYTYRFTTQGQEGTLWWHAHSSWLRATVHGALIIH  152

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            PR G+PYPFPKP  E P++L EWW R+  +V+RQ+  TGA PNVSDA  ING PGDL  C
Sbjct  153  PRRGLPYPFPKPQMEAPVILAEWWMRNPIAVLRQSMITGAPPNVSDALLINGQPGDLLPC  212

Query  622  HRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
                T  + V  GET LLR+INAA+N +LF S+A H  TVV  DA YTKPF ++V++LGP
Sbjct  213  SSQETSIIPVVAGETSLLRIINAAMNTELFVSLAGHRMTVVAADAMYTKPFETDVVLLGP  272

Query  799  GQ  804
            GQ
Sbjct  273  GQ  274



>gb|ABR17528.1| unknown [Picea sitchensis]
Length=570

 Score =   328 bits (841),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 188/239 (79%), Gaps = 2/239 (1%)
 Frame = +1

Query  94   HEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWHGIRQ  273
            + FVI A P  RLC+T+ IITVNGQFPGPTL V +GDTLV+KV+N ARY+ T+HWHG+RQ
Sbjct  34   YTFVIRAQPVTRLCQTNDIITVNGQFPGPTLNVTSGDTLVVKVLNYARYDVTIHWHGVRQ  93

Query  274  IGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIYPRLG  453
            I + WADGP +ITQCPI+PG  YTYRFT+  QEGTLWWHAH+ WLRATVYG+++IYP+ G
Sbjct  94   IRTAWADGPEFITQCPIRPGGSYTYRFTLTDQEGTLWWHAHSSWLRATVYGSLIIYPKEG  153

Query  454  VPYPFPKPDKEI-PILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTCHRG  630
              YPFP+P  E  PI+LGEWW R+   V+ QAT TGA PN+SDA+TIN  PGDLY C   
Sbjct  154  TKYPFPQPCHEPEPIILGEWWNRNPIDVVNQATQTGAPPNISDAFTINAQPGDLYPCSSS  213

Query  631  IT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGPGQ  804
             T ++ VK GE+ LLR+INAALN +LFF+VA+H+  VV VD++YTK   + V+MLGPGQ
Sbjct  214  DTYRLSVKAGESYLLRIINAALNAELFFTVADHVLMVVAVDSSYTKLLHTEVVMLGPGQ  272



>ref|XP_004302730.1| PREDICTED: laccase-17-like [Fragaria vesca subsp. vesca]
Length=591

 Score =   328 bits (842),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 155/244 (64%), Positives = 184/244 (75%), Gaps = 1/244 (0%)
 Frame = +1

Query  76   SGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLH  255
            +G T +++F I +    RLCKT SIITVNGQFPGP +  R GD LVIKV+N  + N TLH
Sbjct  36   AGVTRHYKFNIMSQSVTRLCKTKSIITVNGQFPGPRIVAREGDRLVIKVVNHVQNNVTLH  95

Query  256  WHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIV  435
            WHGIRQ+ S WADGP+YITQCPIQ G  Y Y FTI  Q GTLWWHAH  WLRAT+YG IV
Sbjct  96   WHGIRQLRSGWADGPSYITQCPIQTGQSYVYNFTITGQRGTLWWHAHISWLRATLYGPIV  155

Query  436  IYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLY  615
            I P+  VPYPFP+P KE+PI+ GEWW+ D  +V+ QA  TG+ PNVSDAYTING PG LY
Sbjct  156  ILPKKHVPYPFPQPFKEVPIIFGEWWKADTETVINQAIQTGSGPNVSDAYTINGLPGPLY  215

Query  616  TCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIML  792
             C    T K++VK G+T LLR+INAALN +LFFS+ANH FTVVE DA Y KPFS+ V+++
Sbjct  216  NCSAKDTYKLKVKPGKTYLLRLINAALNNELFFSIANHTFTVVEADAVYVKPFSTKVVLI  275

Query  793  GPGQ  804
             PGQ
Sbjct  276  TPGQ  279



>ref|XP_006651285.1| PREDICTED: laccase-5-like [Oryza brachyantha]
Length=634

 Score =   329 bits (844),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 181/242 (75%), Gaps = 1/242 (0%)
 Frame = +1

Query  82   ETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHWH  261
            E  ++EFV+  T  KRLCKT  IITVNGQFPGPT+EV +GD + I+ +N ARYN TLHWH
Sbjct  32   EERFYEFVVQETLVKRLCKTQRIITVNGQFPGPTIEVFDGDEVSIRAVNMARYNVTLHWH  91

Query  262  GIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVIY  441
            G+RQ+ + WADGP ++TQCPI+PG  YTYRF IQ QEGTLWWHAH+ WLRATV+GA++I+
Sbjct  92   GLRQLRNGWADGPEFVTQCPIRPGGSYTYRFPIQGQEGTLWWHAHSSWLRATVHGALIIH  151

Query  442  PRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYTC  621
            PR  VPYPFPKP  E PI+L EWW RD  +V+RQ+  TGA PNVSD   ING PGD   C
Sbjct  152  PRRAVPYPFPKPHSEFPIILAEWWRRDPIAVLRQSMITGAPPNVSDTILINGQPGDFLEC  211

Query  622  HRGITK-VQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLGP  798
                T  + V  GET LLR+INAA+N +LF S+A H  TVV  DA YTKPF + V++LGP
Sbjct  212  SAQETSIIPVVAGETTLLRIINAAMNTELFVSLAGHKMTVVAADAMYTKPFETTVVLLGP  271

Query  799  GQ  804
            GQ
Sbjct  272  GQ  273



>gb|AFV52381.1| laccase [Picea abies]
Length=570

 Score =   325 bits (834),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/248 (61%), Positives = 188/248 (76%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A  ++ E H++ FVI  T   RLCK ++I+TVNGQ PGPT+ V NGDT+++K  N A+YN
Sbjct  24   AAIINAEIHHYTFVIERTVVTRLCKNYTIVTVNGQLPGPTIHVHNGDTVIVKAYNRAQYN  83

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
            ATLHWHG++Q+ + WADGPAYITQCPI PG  YT RFTI  QEGTLWWH+H  WLRATV+
Sbjct  84   ATLHWHGVKQLRTGWADGPAYITQCPIPPGGHYTQRFTITGQEGTLWWHSHISWLRATVH  143

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GAIVI P+ G  YPFPKP  EIPI++GEWW +D  +V+ QA  TG APN+SDA+TING P
Sbjct  144  GAIVILPQRGSLYPFPKPRAEIPIIIGEWWNKDPITVINQAILTGGAPNLSDAFTINGQP  203

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C    T ++ VK GET LLR++NAALN   FF +A H FTVV VDA+YTKP+ ++
Sbjct  204  GDLYPCSTSETFRLPVKRGETYLLRIVNAALNTGHFFKIARHKFTVVAVDASYTKPYKTD  263

Query  781  VIMLGPGQ  804
            VI++  GQ
Sbjct  264  VIVISAGQ  271



>gb|AFV52379.1| laccase [Picea abies]
Length=569

 Score =   325 bits (833),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 151/248 (61%), Positives = 188/248 (76%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A  ++ E H++ FVI  T   RLCK ++I+TVNGQ PGPT+ V NGDT+++K  N A+YN
Sbjct  23   AAVINAEIHHYTFVIERTVVTRLCKNYTIVTVNGQLPGPTIHVHNGDTVIVKAYNRAQYN  82

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
            ATLHWHG++Q+ + WADGPAYITQCPI PG  YT RFTI  QEGTLWWH+H  WLRATV+
Sbjct  83   ATLHWHGVKQLRTGWADGPAYITQCPIPPGGHYTQRFTITGQEGTLWWHSHISWLRATVH  142

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GAIVI P+ G  YPFPKP  EIPI++GEWW +D  +V+ QA  TG APN+SDA+TING P
Sbjct  143  GAIVILPQRGSLYPFPKPRAEIPIIIGEWWNKDPITVINQAILTGGAPNLSDAFTINGQP  202

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C    T ++ VK GET LLR++NAALN   FF +A H FTVV VDA+YTKP+ ++
Sbjct  203  GDLYPCSTSETFRLPVKRGETYLLRIVNAALNTGHFFKIARHKFTVVAVDASYTKPYKTD  262

Query  781  VIMLGPGQ  804
            VI++  GQ
Sbjct  263  VIVISAGQ  270



>ref|NP_001044773.1| Os01g0842500 [Oryza sativa Japonica Group]
 dbj|BAB86452.1| putative laccase LAC5-6 [Oryza sativa Japonica Group]
 dbj|BAF06687.1| Os01g0842500 [Oryza sativa Japonica Group]
 gb|EAZ14116.1| hypothetical protein OsJ_04040 [Oryza sativa Japonica Group]
 dbj|BAG90005.1| unnamed protein product [Oryza sativa Japonica Group]
Length=577

 Score =   325 bits (834),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 184/243 (76%), Gaps = 1/243 (0%)
 Frame = +1

Query  79   GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHW  258
            G+   ++F +  T   RLC + SI+TVNGQFPGPT+  R GD +VI+VIN + YN ++HW
Sbjct  27   GDIREYQFDVKTTNVTRLCSSKSIVTVNGQFPGPTVFAREGDLVVIRVINHSPYNMSIHW  86

Query  259  HGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVI  438
            HGIRQ+ S WADGPAYITQCPIQPG  Y Y++TI  Q GTLWWHAH  WLRATVYG I+I
Sbjct  87   HGIRQLRSGWADGPAYITQCPIQPGGSYVYKYTITGQRGTLWWHAHISWLRATVYGPIII  146

Query  439  YPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYT  618
             P+ GVPYPFP PDKE+P++ GEWW+ D  +V+ QAT TG  PNVSDA+TING PG LY 
Sbjct  147  LPKAGVPYPFPAPDKEVPVVFGEWWKADTEAVISQATQTGGGPNVSDAFTINGLPGPLYN  206

Query  619  CHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLG  795
            C    T K++V+ G+T +LR+INAALN +LFFS+A H  TVV+VDA Y KPF+ + +++ 
Sbjct  207  CSAKDTFKLKVEAGKTYMLRLINAALNDELFFSIAGHTLTVVDVDAVYVKPFTVDTLLIT  266

Query  796  PGQ  804
            PGQ
Sbjct  267  PGQ  269



>gb|EEC71780.1| hypothetical protein OsI_04394 [Oryza sativa Indica Group]
Length=577

 Score =   325 bits (833),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 184/243 (76%), Gaps = 1/243 (0%)
 Frame = +1

Query  79   GETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYNATLHW  258
            G+   ++F +  T   RLC + SI+TVNGQFPGPT+  R GD +VI+VIN + YN ++HW
Sbjct  27   GDIREYQFDVKTTNVTRLCSSKSIVTVNGQFPGPTVFAREGDLVVIRVINHSPYNMSIHW  86

Query  259  HGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVYGAIVI  438
            HGIRQ+ S WADGPAYITQCPIQPG  Y Y++TI  Q GTLWWHAH  WLRATVYG I+I
Sbjct  87   HGIRQLRSGWADGPAYITQCPIQPGGSYVYKYTITGQRGTLWWHAHISWLRATVYGPIII  146

Query  439  YPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWPGDLYT  618
             P+ GVPYPFP PDKE+P++ GEWW+ D  +V+ QAT TG  PNVSDA+TING PG LY 
Sbjct  147  LPKAGVPYPFPAPDKEVPVVFGEWWKADTEAVISQATQTGGGPNVSDAFTINGLPGPLYN  206

Query  619  CHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSNVIMLG  795
            C    T K++V+ G+T +LR+INAALN +LFFS+A H  TVV+VDA Y KPF+ + +++ 
Sbjct  207  CSAKDTFKLKVEAGKTYMLRLINAALNDELFFSIAGHTLTVVDVDAVYVKPFTVDTLLIT  266

Query  796  PGQ  804
            PGQ
Sbjct  267  PGQ  269



>gb|AFV52380.1| laccase [Picea abies]
Length=570

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/248 (60%), Positives = 188/248 (76%), Gaps = 1/248 (0%)
 Frame = +1

Query  64   ATFLSGETHYHEFVIAATPEKRLCKTHSIITVNGQFPGPTLEVRNGDTLVIKVINAARYN  243
            A  ++ E H++ FVI  T   RLCK ++I+TVNGQ PGPT+ V NGDT+++K  N A++N
Sbjct  24   AAVINAEIHHYTFVIERTVVTRLCKNYTIVTVNGQLPGPTIHVHNGDTVIVKAYNRAQHN  83

Query  244  ATLHWHGIRQIGSQWADGPAYITQCPIQPGAQYTYRFTIQKQEGTLWWHAHTRWLRATVY  423
            ATLHWHG++Q+ + WADGPAYITQCPI PG  YT RFTI  QEGTLWWH+H  WLRATV+
Sbjct  84   ATLHWHGVKQLRTGWADGPAYITQCPIPPGGHYTQRFTISGQEGTLWWHSHISWLRATVH  143

Query  424  GAIVIYPRLGVPYPFPKPDKEIPILLGEWWERDIFSVMRQATFTGAAPNVSDAYTINGWP  603
            GAIVI P+ G  YPFPKP  EIPI++GEWW +D  +V+ QA  TG APN+SDA+TING P
Sbjct  144  GAIVILPQRGSLYPFPKPRAEIPIIIGEWWNKDPITVINQAILTGGAPNLSDAFTINGQP  203

Query  604  GDLYTCHRGIT-KVQVKTGETVLLRVINAALNQQLFFSVANHIFTVVEVDATYTKPFSSN  780
            GDLY C    T ++ VK GET LLR++NAALN   FF +A H FTVV VDA+YTKP+ ++
Sbjct  204  GDLYPCSTSETFRLPVKRGETYLLRIVNAALNTGHFFKIARHKFTVVAVDASYTKPYKTD  263

Query  781  VIMLGPGQ  804
            VI++  GQ
Sbjct  264  VIVISAGQ  271



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1499838010448