BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24989_g2_i1 len=1016 path=[967:0-289 1257:290-314 1282:315-478
1446:479-591 1559:592-712 1680:713-1015]

Length=1016
                                                                      Score     E

ref|XP_009774063.1|  PREDICTED: laccase-17-like                         435   1e-145   
ref|XP_009587566.1|  PREDICTED: laccase-17-like                         432   2e-144   
ref|XP_009621093.1|  PREDICTED: laccase-17-like                         431   7e-144   
ref|XP_011077639.1|  PREDICTED: laccase-17-like                         429   2e-143   
ref|XP_009796361.1|  PREDICTED: laccase-17-like                         426   6e-142   
ref|XP_011094888.1|  PREDICTED: laccase-17-like                         424   6e-141   
ref|XP_003532315.1|  PREDICTED: laccase-17-like                         420   2e-139   
gb|KHN24986.1|  Laccase-17                                              419   2e-139   
gb|KEH22816.1|  laccase/diphenol oxidase family protein                 417   2e-138   
ref|XP_006603494.1|  PREDICTED: laccase-17-like                         414   4e-138   
ref|XP_003622953.1|  Laccase                                            416   7e-138   
ref|XP_007140298.1|  hypothetical protein PHAVU_008G100400g             417   1e-137   
ref|XP_011094887.1|  PREDICTED: laccase-17-like                         415   2e-137   
emb|CDP01507.1|  unnamed protein product                                414   4e-137   
ref|XP_006602579.1|  PREDICTED: laccase-17-like isoform X2              412   1e-136   
emb|CDP06592.1|  unnamed protein product                                412   1e-136   
ref|XP_003552160.2|  PREDICTED: laccase-17-like isoform X1              412   2e-136   
gb|KHN16229.1|  Laccase-17                                              412   3e-136   
emb|CBI16199.3|  unnamed protein product                                408   3e-135   
ref|XP_008223967.1|  PREDICTED: laccase-17                              408   4e-135   
ref|XP_004492322.1|  PREDICTED: laccase-17-like                         408   5e-135   
ref|XP_002284473.1|  PREDICTED: laccase-17                              408   6e-135   Vitis vinifera
gb|KHN24984.1|  Laccase-17                                              407   1e-134   
ref|XP_007022468.1|  Laccase 17                                         407   2e-134   
ref|XP_003530894.1|  PREDICTED: laccase-17-like                         406   2e-134   
gb|KHN16225.1|  Laccase-17                                              405   3e-134   
gb|KHN16226.1|  Laccase-17                                              405   8e-134   
ref|XP_006602563.1|  PREDICTED: laccase-17-like                         405   1e-133   
ref|XP_004492318.1|  PREDICTED: laccase-17-like                         405   1e-133   
gb|KHN16224.1|  Laccase-17                                              405   5e-133   
ref|XP_011029469.1|  PREDICTED: laccase-17-like                         403   7e-133   
ref|XP_004246869.2|  PREDICTED: laccase-17-like                         402   1e-132   
emb|CAN60348.1|  hypothetical protein VITISV_005802                     400   4e-132   Vitis vinifera
ref|XP_008385215.1|  PREDICTED: laccase-17-like                         400   6e-132   
ref|XP_002317505.2|  hypothetical protein POPTR_0011s12100g             400   6e-132   Populus trichocarpa [western balsam poplar]
ref|XP_002531824.1|  laccase, putative                                  400   7e-132   Ricinus communis
ref|XP_009358279.1|  PREDICTED: laccase-17-like                         400   8e-132   
ref|XP_003632204.1|  PREDICTED: laccase-17                              400   9e-132   
ref|XP_009354529.1|  PREDICTED: laccase-17-like                         399   2e-131   
ref|XP_009597231.1|  PREDICTED: laccase-17-like                         398   3e-131   
ref|XP_010092993.1|  hypothetical protein L484_007174                   399   4e-131   
gb|EYU26609.1|  hypothetical protein MIMGU_mgv1a003496mg                398   5e-131   
ref|XP_008358049.1|  PREDICTED: laccase-17-like                         398   8e-131   
gb|EYU26602.1|  hypothetical protein MIMGU_mgv1a003840mg                397   1e-130   
gb|KDO73032.1|  hypothetical protein CISIN_1g008109mg                   397   1e-130   
ref|XP_006424707.1|  hypothetical protein CICLE_v10028090mg             397   1e-130   
ref|XP_002317504.2|  hypothetical protein POPTR_0011s12090g             397   2e-130   Populus trichocarpa [western balsam poplar]
ref|XP_007016584.1|  Laccase 17                                         396   4e-130   
ref|XP_002520231.1|  laccase, putative                                  395   4e-130   Ricinus communis
ref|XP_008463808.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-17-like    394   2e-129   
ref|XP_006341211.1|  PREDICTED: laccase-17-like                         393   2e-129   
emb|CBI30527.3|  unnamed protein product                                394   4e-129   
gb|KDP44151.1|  hypothetical protein JCGZ_05618                         393   4e-129   
ref|XP_008785574.1|  PREDICTED: laccase-17-like                         393   4e-129   
ref|XP_004148786.1|  PREDICTED: laccase-17-like                         393   4e-129   
ref|XP_002271047.2|  PREDICTED: laccase-17                              394   5e-129   Vitis vinifera
ref|XP_006370271.1|  hypothetical protein POPTR_0001s41170g             393   6e-129   
gb|KHN24985.1|  Laccase-17                                              392   7e-129   
ref|XP_008778964.1|  PREDICTED: laccase-17-like                         392   2e-128   
ref|XP_006363101.1|  PREDICTED: laccase-17-like                         390   3e-128   
gb|AES79165.2|  laccase/diphenol oxidase family protein                 391   3e-128   
ref|XP_006424671.1|  hypothetical protein CICLE_v10030166mg             390   7e-128   
ref|XP_007207546.1|  hypothetical protein PRUPE_ppa017421mg             390   7e-128   
ref|XP_007016607.1|  Laccase 17                                         390   1e-127   
ref|XP_003623041.1|  Laccase                                            389   1e-127   
ref|XP_002300066.1|  hypothetical protein POPTR_0001s35740g             389   1e-127   Populus trichocarpa [western balsam poplar]
ref|XP_011002147.1|  PREDICTED: laccase-17-like                         389   1e-127   
gb|AAB17193.1|  laccase                                                 389   1e-127   Liriodendron tulipifera
ref|XP_009354528.1|  PREDICTED: laccase-17-like                         389   2e-127   
gb|KDO73109.1|  hypothetical protein CISIN_1g047497mg                   389   2e-127   
ref|XP_002299296.1|  laccase family protein                             389   3e-127   Populus trichocarpa [western balsam poplar]
ref|XP_003622947.1|  Laccase                                            388   3e-127   
ref|XP_006341009.1|  PREDICTED: laccase-17-like                         388   3e-127   
ref|XP_006400889.1|  hypothetical protein EUTSA_v10013109mg             388   3e-127   
ref|XP_008222577.1|  PREDICTED: laccase-17-like                         388   3e-127   
ref|XP_002282823.1|  PREDICTED: laccase-17                              388   3e-127   Vitis vinifera
ref|XP_010922297.1|  PREDICTED: laccase-17-like                         388   4e-127   
gb|AAB17192.1|  laccase                                                 388   4e-127   Liriodendron tulipifera
ref|XP_008358843.1|  PREDICTED: laccase-17-like                         388   5e-127   
ref|XP_009354571.1|  PREDICTED: laccase-17-like                         387   5e-127   
ref|XP_010256874.1|  PREDICTED: laccase-17-like                         387   1e-126   
ref|XP_010455850.1|  PREDICTED: laccase-17-like                         387   1e-126   
ref|XP_009419259.1|  PREDICTED: laccase-4-like                          386   3e-126   
emb|CDY09232.1|  BnaA02g06580D                                          385   3e-126   
ref|XP_002864664.1|  hypothetical protein ARALYDRAFT_496140             385   3e-126   
ref|XP_010920538.1|  PREDICTED: laccase-4-like                          386   4e-126   
gb|AAB17194.1|  laccase                                                 385   4e-126   Liriodendron tulipifera
ref|XP_010443793.1|  PREDICTED: laccase-17                              386   4e-126   
ref|NP_200810.1|  laccase 17                                            385   5e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002278215.1|  PREDICTED: laccase-17                              385   6e-126   Vitis vinifera
ref|XP_004294637.1|  PREDICTED: laccase-17-like                         385   6e-126   
ref|XP_002282815.1|  PREDICTED: laccase-17                              385   6e-126   Vitis vinifera
ref|XP_008385213.1|  PREDICTED: laccase-17-like                         385   8e-126   
ref|XP_009416147.1|  PREDICTED: laccase-4-like                          384   1e-125   
emb|CDY31581.1|  BnaA10g12900D                                          384   1e-125   
emb|CAN60069.1|  hypothetical protein VITISV_012401                     384   1e-125   Vitis vinifera
ref|XP_009120521.1|  PREDICTED: laccase-17-like                         384   1e-125   
ref|XP_002278232.1|  PREDICTED: laccase-17-like                         384   1e-125   Vitis vinifera
ref|XP_010535559.1|  PREDICTED: laccase-17                              384   2e-125   
ref|XP_010043648.1|  PREDICTED: laccase-17-like                         384   2e-125   
ref|XP_009131958.1|  PREDICTED: laccase-17                              383   2e-125   
ref|XP_010541371.1|  PREDICTED: laccase-17-like                         384   2e-125   
ref|XP_006370270.1|  hypothetical protein POPTR_0001s41160g             384   3e-125   
emb|CDX88735.1|  BnaA03g09140D                                          383   3e-125   
ref|XP_010541373.1|  PREDICTED: laccase-17                              385   3e-125   
ref|XP_004246356.1|  PREDICTED: laccase-17-like                         383   4e-125   
gb|ACF87758.1|  unknown                                                 375   5e-125   Zea mays [maize]
gb|KFK27539.1|  hypothetical protein AALP_AA8G396300                    381   1e-124   
ref|XP_010690891.1|  PREDICTED: laccase-17-like                         380   3e-124   
ref|XP_009403441.1|  PREDICTED: laccase-4-like                          380   5e-124   
ref|XP_010483648.1|  PREDICTED: laccase-17-like                         381   6e-124   
ref|XP_006280235.1|  hypothetical protein CARUB_v10026150mg             379   2e-123   
ref|XP_010039668.1|  PREDICTED: laccase-17-like                         377   2e-123   
ref|XP_006429125.1|  hypothetical protein CICLE_v10011362mg             379   2e-123   
ref|XP_004970543.1|  PREDICTED: laccase-12/13-like                      378   3e-123   
ref|XP_008801588.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4          376   4e-123   
emb|CDX71061.1|  BnaC03g11450D                                          377   4e-123   
ref|XP_009388612.1|  PREDICTED: laccase-4-like                          376   5e-123   
ref|XP_010031544.1|  PREDICTED: laccase-17-like                         377   6e-123   
emb|CBI31631.3|  unnamed protein product                                389   1e-122   
ref|XP_009126628.1|  PREDICTED: laccase-17-like                         376   1e-122   
ref|XP_002458746.1|  hypothetical protein SORBIDRAFT_03g039520          376   2e-122   Sorghum bicolor [broomcorn]
gb|KDP35652.1|  hypothetical protein JCGZ_09090                         370   5e-122   
gb|AAC04576.1|  putative high-pI laccase                                374   7e-122   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001105875.1|  putative laccase precursor                         375   8e-122   Zea mays [maize]
gb|KDO52342.1|  hypothetical protein CISIN_1g008085mg                   374   8e-122   
ref|XP_010046415.1|  PREDICTED: laccase-17-like                         374   9e-122   
ref|XP_008665185.1|  PREDICTED: laccase-4-like                          374   9e-122   
gb|EAZ14115.1|  hypothetical protein OsJ_04039                          374   1e-121   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044772.1|  Os01g0842400                                       374   1e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010039666.1|  PREDICTED: laccase-17-like                         374   1e-121   
ref|XP_010264408.1|  PREDICTED: laccase-17-like                         374   2e-121   
ref|XP_007140300.1|  hypothetical protein PHAVU_008G1006001g            361   2e-121   
ref|XP_009595163.1|  PREDICTED: laccase-17-like                         370   2e-121   
emb|CBI31651.3|  unnamed protein product                                387   3e-121   
ref|XP_004970542.1|  PREDICTED: laccase-4-like                          373   4e-121   
gb|EEC71777.1|  hypothetical protein OsI_04389                          372   5e-121   Oryza sativa Indica Group [Indian rice]
ref|XP_002278275.1|  PREDICTED: laccase-17                              372   9e-121   Vitis vinifera
ref|XP_008349706.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-17-like    365   1e-120   
ref|XP_010106521.1|  hypothetical protein L484_025281                   371   1e-120   
ref|XP_008359106.1|  PREDICTED: laccase-17-like                         371   2e-120   
ref|XP_011042451.1|  PREDICTED: laccase-17-like                         371   2e-120   
gb|EEC74953.1|  hypothetical protein OsI_10938                          369   2e-120   Oryza sativa Indica Group [Indian rice]
ref|XP_010037821.1|  PREDICTED: laccase-17-like                         371   3e-120   
emb|CDM84967.1|  unnamed protein product                                370   3e-120   
ref|XP_002458747.1|  hypothetical protein SORBIDRAFT_03g039530          370   4e-120   Sorghum bicolor [broomcorn]
ref|NP_001049699.1|  Os03g0273200                                       369   8e-120   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010275879.1|  PREDICTED: laccase-17-like                         369   8e-120   
ref|XP_006644993.1|  PREDICTED: laccase-4-like                          369   9e-120   
ref|NP_001147942.1|  L-ascorbate oxidase precursor                      369   1e-119   Zea mays [maize]
ref|XP_008384938.1|  PREDICTED: laccase-2-like                          369   1e-119   
ref|XP_010690924.1|  PREDICTED: laccase-17-like                         369   1e-119   
gb|ACN34362.1|  unknown                                                 368   2e-119   Zea mays [maize]
ref|XP_002308164.1|  hypothetical protein POPTR_0006s08740g             368   3e-119   Populus trichocarpa [western balsam poplar]
ref|XP_011019845.1|  PREDICTED: laccase-2-like                          368   3e-119   
ref|XP_002520232.1|  laccase, putative                                  368   3e-119   Ricinus communis
ref|XP_003564592.1|  PREDICTED: laccase-4-like                          368   3e-119   
ref|NP_001131665.1|  uncharacterized protein LOC100193025 precursor     367   4e-119   Zea mays [maize]
ref|XP_010264410.1|  PREDICTED: laccase-17-like                         367   5e-119   
gb|AFW84624.1|  putative laccase family protein                         367   6e-119   
dbj|BAJ99773.1|  predicted protein                                      367   6e-119   
ref|NP_001146658.1|  uncharacterized protein LOC100280258 precursor     367   6e-119   Zea mays [maize]
ref|XP_007132049.1|  hypothetical protein PHAVU_011G062600g             367   1e-118   
ref|XP_002531565.1|  laccase, putative                                  366   1e-118   Ricinus communis
ref|XP_006649837.1|  PREDICTED: laccase-10-like                         366   1e-118   
ref|XP_004294638.1|  PREDICTED: laccase-17-like                         366   2e-118   
gb|AAB17191.1|  laccase                                                 365   2e-118   Liriodendron tulipifera
ref|XP_004984718.1|  PREDICTED: laccase-10-like                         365   2e-118   
ref|XP_010920540.1|  PREDICTED: laccase-10-like                         365   2e-118   
gb|EMT20803.1|  Laccase-4                                               365   2e-118   
gb|EMT07841.1|  Laccase-4                                               358   3e-118   
ref|XP_002465485.1|  hypothetical protein SORBIDRAFT_01g039690          365   3e-118   Sorghum bicolor [broomcorn]
ref|XP_009796024.1|  PREDICTED: laccase-2-like                          365   4e-118   
dbj|BAJ96691.1|  predicted protein                                      364   6e-118   
emb|CDM80721.1|  unnamed protein product                                364   6e-118   
dbj|BAJ84890.1|  predicted protein                                      364   6e-118   
ref|XP_003562893.1|  PREDICTED: laccase-4-like                          364   7e-118   
ref|XP_006488364.1|  PREDICTED: laccase-17-like                         364   1e-117   
ref|XP_008356891.1|  PREDICTED: laccase-2                               363   2e-117   
gb|KDO51175.1|  hypothetical protein CISIN_1g008090mg                   363   2e-117   
ref|XP_006429120.1|  hypothetical protein CICLE_v10011363mg             363   2e-117   
ref|XP_006480879.1|  PREDICTED: laccase-17-like                         362   3e-117   
ref|XP_010047833.1|  PREDICTED: laccase-17-like                         362   3e-117   
ref|XP_006644994.1|  PREDICTED: laccase-12/13-like                      362   5e-117   
ref|XP_010685719.1|  PREDICTED: laccase-17-like                         362   5e-117   
ref|XP_009782930.1|  PREDICTED: laccase-4-like                          362   8e-117   
gb|EMS50562.1|  Laccase-12/13                                           358   1e-116   
emb|CBI30530.3|  unnamed protein product                                350   1e-116   
gb|EEC71780.1|  hypothetical protein OsI_04394                          361   1e-116   Oryza sativa Indica Group [Indian rice]
emb|CDY38576.1|  BnaA05g13050D                                          354   1e-116   
ref|XP_004246355.1|  PREDICTED: laccase-4-like                          361   2e-116   
emb|CDY65666.1|  BnaC04g54790D                                          360   2e-116   
gb|AFK41498.1|  unknown                                                 352   2e-116   
emb|CAN72263.1|  hypothetical protein VITISV_037366                     360   2e-116   Vitis vinifera
ref|XP_009364426.1|  PREDICTED: laccase-2-like                          360   3e-116   
ref|XP_006424872.1|  hypothetical protein CICLE_v10028036mg             361   4e-116   
ref|XP_004961859.1|  PREDICTED: laccase-12/13-like                      360   4e-116   
ref|XP_010685718.1|  PREDICTED: laccase-17-like                         360   6e-116   
ref|XP_009602033.1|  PREDICTED: laccase-4-like                          359   9e-116   
ref|XP_009414328.1|  PREDICTED: laccase-17-like                         359   1e-115   
ref|XP_011095204.1|  PREDICTED: laccase-17-like                         358   1e-115   
ref|XP_006409959.1|  hypothetical protein EUTSA_v10016434mg             358   1e-115   
emb|CAN73336.1|  hypothetical protein VITISV_033042                     357   2e-115   Vitis vinifera
dbj|BAJ91763.1|  predicted protein                                      358   2e-115   
ref|NP_001044773.1|  Os01g0842500                                       358   2e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011089492.1|  PREDICTED: laccase-17                              357   3e-115   
gb|EYU41745.1|  hypothetical protein MIMGU_mgv1a003538mg                357   3e-115   
ref|XP_006592189.1|  PREDICTED: laccase-2-like isoform X1               358   3e-115   
ref|XP_009603099.1|  PREDICTED: laccase-2-like                          357   4e-115   
ref|XP_002881031.1|  hypothetical protein ARALYDRAFT_901874             357   4e-115   
ref|XP_006592190.1|  PREDICTED: laccase-2-like isoform X2               357   4e-115   
ref|XP_002309069.1|  hypothetical protein POPTR_0006s08780g             357   5e-115   Populus trichocarpa [western balsam poplar]
emb|CAA74105.1|  laccase                                                357   5e-115   Populus trichocarpa [western balsam poplar]
ref|XP_003564593.1|  PREDICTED: laccase-12/13-like                      357   5e-115   
gb|KHN14002.1|  Laccase-17                                              356   5e-115   
ref|XP_003568310.1|  PREDICTED: laccase-12/13-like                      356   8e-115   
ref|XP_008778578.1|  PREDICTED: laccase-10-like                         356   1e-114   
gb|KDO48719.1|  hypothetical protein CISIN_1g0085922mg                  349   1e-114   
ref|XP_003551482.1|  PREDICTED: laccase-17-like                         356   1e-114   
ref|XP_003530212.1|  PREDICTED: laccase-17-like                         356   1e-114   
ref|XP_007016364.1|  Laccase 2                                          356   2e-114   
gb|KHN40291.1|  Laccase-17                                              355   2e-114   
gb|KDP35659.1|  hypothetical protein JCGZ_09097                         355   2e-114   
ref|XP_002863053.1|  hypothetical protein ARALYDRAFT_497195             355   3e-114   
gb|EMT21652.1|  Laccase-4                                               355   4e-114   
ref|XP_006350913.1|  PREDICTED: laccase-2-like                          355   4e-114   
ref|XP_006363100.1|  PREDICTED: laccase-4-like                          355   4e-114   
gb|ABW81166.1|  unknown                                                 354   4e-114   Capsella rubella
ref|XP_008777229.1|  PREDICTED: laccase-17-like                         352   6e-114   
gb|KEH22909.1|  laccase/diphenol oxidase family protein                 354   7e-114   
ref|XP_010414436.1|  PREDICTED: laccase-2 isoform X3                    354   7e-114   
ref|XP_010414434.1|  PREDICTED: laccase-2 isoform X1                    354   7e-114   
ref|XP_009144396.1|  PREDICTED: laccase-2                               353   9e-114   
ref|XP_004241217.1|  PREDICTED: laccase-2-like                          353   1e-113   
ref|XP_006293883.1|  hypothetical protein CARUB_v10022868mg             354   1e-113   
gb|KDO37152.1|  hypothetical protein CISIN_1g040938mg                   350   1e-113   
ref|XP_006846275.1|  hypothetical protein AMTR_s00012p00248430          353   1e-113   
ref|XP_011094885.1|  PREDICTED: laccase-17-like                         353   1e-113   
ref|XP_007208016.1|  hypothetical protein PRUPE_ppa003296mg             353   1e-113   
ref|XP_009760365.1|  PREDICTED: laccase-17-like                         353   1e-113   
ref|XP_008442529.1|  PREDICTED: laccase-17-like                         352   2e-113   
ref|XP_011019838.1|  PREDICTED: laccase-17-like                         352   2e-113   
ref|XP_002313424.1|  hypothetical protein POPTR_0009s03940g             352   3e-113   Populus trichocarpa [western balsam poplar]
ref|XP_006429124.1|  hypothetical protein CICLE_v10011358mg             352   4e-113   
ref|XP_010654256.1|  PREDICTED: laccase-17-like isoform X2              352   4e-113   
ref|XP_002269038.2|  PREDICTED: laccase-17 isoform X2                   352   6e-113   Vitis vinifera
ref|XP_009375916.1|  PREDICTED: laccase-2-like                          352   7e-113   
ref|XP_010654257.1|  PREDICTED: laccase-17 isoform X1                   351   7e-113   
gb|KHN07178.1|  Laccase-17                                              350   7e-113   
ref|XP_010557244.1|  PREDICTED: laccase-2-like                          351   8e-113   
gb|KEH22917.1|  laccase/diphenol oxidase family protein                 352   9e-113   
ref|XP_009788568.1|  PREDICTED: laccase-4-like                          351   9e-113   
ref|XP_008785569.1|  PREDICTED: laccase-17-like                         351   9e-113   
ref|XP_006480875.1|  PREDICTED: laccase-17-like isoform X2              349   1e-112   
ref|XP_003558240.1|  PREDICTED: laccase-10-like                         350   1e-112   
ref|XP_009630096.1|  PREDICTED: laccase-17-like                         352   1e-112   
ref|XP_007140513.1|  hypothetical protein PHAVU_008G119000g             351   1e-112   
gb|EPS68485.1|  hypothetical protein M569_06281                         347   2e-112   
ref|NP_180477.1|  laccase 2                                             350   2e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003532290.1|  PREDICTED: laccase-17-like isoform X1              350   3e-112   
gb|ABW74558.1|  putative laccase                                        350   3e-112   Boechera divaricarpa
ref|XP_009338594.1|  PREDICTED: laccase-17-like                         350   3e-112   
ref|XP_006480874.1|  PREDICTED: laccase-17-like isoform X1              349   4e-112   
ref|XP_006341212.1|  PREDICTED: laccase-17-like                         349   5e-112   
ref|XP_004166507.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-17-like    349   6e-112   
ref|XP_004137936.1|  PREDICTED: laccase-17-like                         349   6e-112   
ref|XP_002268628.2|  PREDICTED: laccase-17-like isoform X1              348   8e-112   Vitis vinifera
ref|XP_006856866.1|  hypothetical protein AMTR_s00055p00190270          349   8e-112   
ref|XP_009345405.1|  PREDICTED: laccase-17-like                         348   9e-112   
ref|XP_004246425.1|  PREDICTED: laccase-17-like                         348   9e-112   
ref|XP_011032272.1|  PREDICTED: laccase-2-like                          348   1e-111   
ref|XP_007208011.1|  hypothetical protein PRUPE_ppa003319mg             348   1e-111   
gb|KHG14663.1|  Laccase-4                                               345   1e-111   
ref|XP_010906603.1|  PREDICTED: laccase-17-like                         348   1e-111   
ref|XP_002531562.1|  laccase, putative                                  348   1e-111   Ricinus communis
ref|XP_007026983.1|  Laccase 17 isoform 1                               347   3e-111   
ref|XP_008240736.1|  PREDICTED: laccase-17-like                         347   3e-111   
gb|KHG06904.1|  Laccase-10                                              335   3e-111   
ref|XP_007140515.1|  hypothetical protein PHAVU_008G119200g             347   3e-111   
gb|KHN40289.1|  Laccase-17                                              344   4e-111   
ref|XP_008387787.1|  PREDICTED: laccase-17-like                         347   4e-111   
ref|XP_006846265.1|  hypothetical protein AMTR_s00012p00245710          347   4e-111   
ref|XP_008803092.1|  PREDICTED: laccase-17-like                         347   4e-111   
ref|XP_004514389.1|  PREDICTED: laccase-17-like                         347   5e-111   
ref|XP_009407501.1|  PREDICTED: laccase-4-like                          346   6e-111   
ref|XP_003539077.1|  PREDICTED: laccase-2-like isoform X1               347   6e-111   
ref|XP_006590981.1|  PREDICTED: laccase-2-like isoform X2               346   8e-111   
gb|KHN14004.1|  Laccase-17                                              346   1e-110   
ref|XP_010473985.1|  PREDICTED: laccase-2-like                          352   1e-110   
ref|XP_008785568.1|  PREDICTED: laccase-17-like                         345   1e-110   
ref|XP_003552179.1|  PREDICTED: laccase-17-like                         345   1e-110   
ref|XP_011043780.1|  PREDICTED: laccase-2-like                          345   1e-110   
ref|XP_004137934.1|  PREDICTED: laccase-17-like                         345   2e-110   
ref|XP_010654259.1|  PREDICTED: laccase-2-like                          345   3e-110   
ref|XP_010683865.1|  PREDICTED: laccase-17-like                         345   3e-110   
ref|XP_002298223.2|  hypothetical protein POPTR_0001s18500g             344   3e-110   
ref|XP_008387791.1|  PREDICTED: laccase-17-like                         344   4e-110   
ref|XP_010107305.1|  hypothetical protein L484_009439                   345   4e-110   
ref|XP_008442532.1|  PREDICTED: laccase-17-like                         344   5e-110   
ref|XP_007150345.1|  hypothetical protein PHAVU_005G145800g             344   5e-110   
ref|XP_008369916.1|  PREDICTED: laccase-17-like                         344   5e-110   
gb|KDO72817.1|  hypothetical protein CISIN_1g038598mg                   338   6e-110   
gb|KHF97742.1|  Laccase-17 -like protein                                344   7e-110   
gb|ABW81073.1|  unknown                                                 343   7e-110   
ref|XP_006379352.1|  hypothetical protein POPTR_0009s15840g             343   8e-110   
ref|XP_008359730.1|  PREDICTED: laccase-17-like                         343   1e-109   
gb|EMS51326.1|  Laccase-4                                               343   1e-109   
ref|XP_002439916.1|  hypothetical protein SORBIDRAFT_09g022510          343   1e-109   
ref|XP_006583598.1|  PREDICTED: laccase-17-like                         343   1e-109   
ref|XP_009338597.1|  PREDICTED: laccase-17-like                         343   2e-109   
gb|EMS48628.1|  Laccase-12/13                                           342   2e-109   
ref|XP_010521875.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-2-like     343   2e-109   
ref|XP_010683867.1|  PREDICTED: laccase-17-like                         342   2e-109   
ref|XP_006379354.1|  hypothetical protein POPTR_0009s15860g             342   3e-109   
ref|XP_010107320.1|  hypothetical protein L484_009454                   342   3e-109   
ref|XP_004514392.1|  PREDICTED: laccase-17-like                         342   4e-109   
ref|XP_004302730.1|  PREDICTED: laccase-17-like                         342   5e-109   
ref|XP_007208294.1|  hypothetical protein PRUPE_ppa003308mg             340   1e-108   
gb|EMS51767.1|  Laccase-4                                               340   2e-108   
ref|XP_006856865.1|  hypothetical protein AMTR_s00055p00189700          340   2e-108   
ref|XP_010922291.1|  PREDICTED: laccase-17-like                         339   3e-108   
ref|XP_010922290.1|  PREDICTED: laccase-17-like                         338   8e-108   
gb|AAU44018.1|  putative laccase                                        335   8e-108   
ref|XP_004302731.1|  PREDICTED: laccase-17-like                         338   9e-108   
ref|XP_008222248.1|  PREDICTED: laccase-2                               338   1e-107   
ref|XP_006654510.1|  PREDICTED: laccase-12/13-like                      338   1e-107   
ref|XP_008240716.1|  PREDICTED: laccase-17-like                         338   1e-107   
ref|NP_001055747.1|  Os05g0458600                                       337   2e-107   
ref|XP_010245131.1|  PREDICTED: laccase-17-like                         337   6e-107   
gb|KDP42231.1|  hypothetical protein JCGZ_02961                         336   6e-107   
ref|XP_006846061.1|  hypothetical protein AMTR_s00012p00061860          335   1e-106   
ref|XP_007026974.1|  Laccase 17                                         335   1e-106   
ref|XP_009416152.1|  PREDICTED: laccase-4-like                          335   2e-106   
ref|XP_006445791.1|  hypothetical protein CICLE_v10018047mg             334   3e-106   
gb|AAL73968.1|AF465468_1  laccase LAC5-6                                334   3e-106   
ref|XP_007026975.1|  Laccase 17                                         333   6e-106   
gb|EYU41740.1|  hypothetical protein MIMGU_mgv1a026682mg                333   6e-106   
emb|CBI30528.3|  unnamed protein product                                351   1e-105   
emb|CDP09087.1|  unnamed protein product                                333   1e-105   
ref|XP_002520541.1|  laccase, putative                                  331   5e-105   
ref|XP_007026973.1|  Laccase 17                                         331   8e-105   
ref|XP_003606701.1|  Laccase                                            330   1e-104   
ref|XP_010256880.1|  PREDICTED: laccase-4-like                          330   1e-104   
ref|XP_003564594.1|  PREDICTED: putative laccase-5                      326   4e-103   
ref|XP_004507172.1|  PREDICTED: laccase-2-like                          327   5e-103   
emb|CBI30529.3|  unnamed protein product                                326   8e-103   
gb|AAK37825.1|AF132121_1  laccase                                       325   1e-102   
sp|Q0DHL5.2|LAC11_ORYSJ  RecName: Full=Putative laccase-11; AltNa...    323   3e-102   
gb|EYU41744.1|  hypothetical protein MIMGU_mgv1a025875mg                322   7e-102   
gb|KDP35658.1|  hypothetical protein JCGZ_09096                         322   2e-101   
ref|XP_006654509.1|  PREDICTED: LOW QUALITY PROTEIN: putative lac...    321   2e-101   
emb|CDM84963.1|  unnamed protein product                                322   3e-101   
emb|CDP06596.1|  unnamed protein product                                321   3e-101   
ref|XP_007140299.1|  hypothetical protein PHAVU_008G100500g             318   3e-101   
ref|XP_004970548.1|  PREDICTED: putative laccase-5-like                 320   1e-100   
gb|EMS50959.1|  Laccase-4                                               318   1e-100   
ref|XP_003566184.1|  PREDICTED: putative laccase-11                     318   4e-100   
ref|XP_007207312.1|  hypothetical protein PRUPE_ppa003714mg             316   2e-99    
emb|CAN80346.1|  hypothetical protein VITISV_003134                     318   2e-99    
ref|XP_002456622.1|  hypothetical protein SORBIDRAFT_03g039570          317   2e-99    
ref|XP_006339020.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-10-like    312   1e-98    
ref|XP_010043504.1|  PREDICTED: laccase-17                              314   2e-98    
ref|NP_001105874.1|  putative laccase precursor                         314   2e-98    
gb|AFW78258.1|  putative laccase family protein                         313   4e-98    
ref|XP_004961862.1|  PREDICTED: putative laccase-11-like                313   5e-98    
ref|XP_002441216.1|  hypothetical protein SORBIDRAFT_09g022460          310   3e-97    
gb|EMS65418.1|  Putative laccase-11                                     310   6e-97    
dbj|BAN10307.1|  laccase                                                308   2e-96    
gb|ACG47007.1|  L-ascorbate oxidase precursor                           308   5e-96    
ref|NP_001105921.1|  putative laccase precursor                         308   6e-96    
gb|EMT05481.1|  Putative laccase-11                                     305   1e-94    
gb|AAK37827.1|AF132123_1  laccase                                       302   9e-94    
gb|AAK37823.1|  laccase                                                 301   1e-93    
gb|EMT08940.1|  Laccase-4                                               294   1e-91    
emb|CAA74101.1|  laccase                                                291   1e-91    
gb|KDO52343.1|  hypothetical protein CISIN_1g008085mg                   295   2e-91    
emb|CAC14718.1|  laccase                                                290   2e-91    
gb|AAC49538.1|  diphenol oxidase                                        288   3e-90    
ref|XP_002322962.2|  laccase family protein                             290   2e-89    
ref|XP_011019227.1|  PREDICTED: laccase-4-like                          283   2e-89    
ref|XP_007026782.1|  Laccase/Diphenol oxidase family protein isof...    288   2e-89    
ref|XP_002322961.2|  hypothetical protein POPTR_0016s11950g             290   3e-89    
ref|XP_011003662.1|  PREDICTED: laccase-4-like                          290   3e-89    
emb|CDP06593.1|  unnamed protein product                                290   4e-89    
gb|AAK37828.1|AF132124_1  laccase                                       289   6e-89    
ref|XP_007026781.1|  Laccase/Diphenol oxidase family protein isof...    288   8e-89    
ref|XP_004147923.1|  PREDICTED: laccase-4-like                          288   9e-89    
gb|KDP29119.1|  hypothetical protein JCGZ_16508                         281   1e-88    
gb|EMS58360.1|  Putative laccase-5                                      287   2e-88    
ref|XP_008449180.1|  PREDICTED: laccase-4-like                          287   3e-88    
gb|KHG18161.1|  Laccase-4 -like protein                                 287   4e-88    
ref|XP_009786393.1|  PREDICTED: laccase-4-like                          286   7e-88    
ref|XP_009593041.1|  PREDICTED: laccase-4-like                          285   1e-87    
ref|XP_009593274.1|  PREDICTED: laccase-4-like                          285   1e-87    
gb|AAC49536.1|  diphenol oxidase                                        285   2e-87    
ref|XP_009624727.1|  PREDICTED: laccase-4-like                          284   3e-87    
ref|XP_004249084.1|  PREDICTED: laccase-4-like                          284   3e-87    
ref|XP_011077581.1|  PREDICTED: laccase-4-like                          284   3e-87    
ref|XP_009799024.1|  PREDICTED: laccase-4-like                          284   4e-87    
ref|XP_009597234.1|  PREDICTED: laccase-4-like                          284   4e-87    
gb|KDP24484.1|  hypothetical protein JCGZ_25048                         281   6e-87    
ref|XP_010044089.1|  PREDICTED: laccase-4-like                          283   7e-87    
gb|KHG11130.1|  Laccase-4 -like protein                                 282   8e-87    
ref|XP_002308209.2|  laccase family protein                             283   8e-87    
ref|XP_006387495.1|  hypothetical protein POPTR_0958s00200g             283   1e-86    
ref|XP_010044087.1|  PREDICTED: laccase-4-like                          283   1e-86    
ref|XP_002531561.1|  laccase, putative                                  282   2e-86    
ref|XP_010044090.1|  PREDICTED: laccase-4-like                          282   2e-86    
gb|ACN39933.1|  unknown                                                 282   2e-86    
ref|XP_010529771.1|  PREDICTED: laccase-4-like                          282   2e-86    
gb|EMS64521.1|  Laccase-4                                               286   2e-86    
gb|KCW88963.1|  hypothetical protein EUGRSUZ_A01282                     281   3e-86    
ref|XP_006349470.1|  PREDICTED: laccase-4-like                          282   3e-86    
ref|XP_009787551.1|  PREDICTED: laccase-4-like                          281   3e-86    
ref|XP_010553253.1|  PREDICTED: laccase-4                               282   3e-86    
ref|XP_010517091.1|  PREDICTED: laccase-4-like                          281   4e-86    
ref|XP_010044088.1|  PREDICTED: laccase-4-like                          281   4e-86    
ref|XP_008442464.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like     281   6e-86    
ref|XP_011019151.1|  PREDICTED: laccase-4 isoform X2                    281   6e-86    
ref|XP_011019150.1|  PREDICTED: laccase-4 isoform X1                    281   6e-86    
ref|XP_011094977.1|  PREDICTED: laccase-4-like                          281   8e-86    
ref|XP_002308208.2|  laccase family protein                             281   8e-86    
ref|XP_006429309.1|  hypothetical protein CICLE_v10011400mg             280   1e-85    
emb|CDP06511.1|  unnamed protein product                                280   1e-85    
ref|XP_010509229.1|  PREDICTED: laccase-4-like                          280   2e-85    
ref|XP_010505418.1|  PREDICTED: laccase-4                               280   2e-85    
gb|AAK37829.1|AF132125_1  laccase                                       279   3e-85    
gb|AAK37830.1|AF132126_1  laccase                                       280   3e-85    
ref|XP_004137913.1|  PREDICTED: laccase-4-like                          279   4e-85    
ref|XP_004163861.1|  PREDICTED: laccase-4-like                          279   4e-85    
ref|XP_002879726.1|  IRX12/LAC4                                         279   4e-85    
ref|XP_010041000.1|  PREDICTED: laccase-4-like                          278   7e-85    
ref|XP_006409960.1|  hypothetical protein EUTSA_v10016434mg             278   8e-85    
gb|KEH30177.1|  laccase/diphenol oxidase family protein                 278   9e-85    
ref|NP_565881.1|  laccase-4                                             278   1e-84    
gb|KCW85519.1|  hypothetical protein EUGRSUZ_B02316                     277   2e-84    
emb|CDX93330.1|  BnaC04g45660D                                          276   3e-84    
dbj|BAN10308.1|  laccase                                                276   5e-84    
ref|NP_001055746.1|  Os05g0458500                                       275   6e-84    
ref|XP_011032153.1|  PREDICTED: laccase-4-like isoform X1               275   7e-84    
ref|XP_010101806.1|  hypothetical protein L484_023595                   276   7e-84    
gb|ACJ85871.1|  unknown                                                 264   9e-84    
ref|XP_011032154.1|  PREDICTED: laccase-4-like isoform X2               275   1e-83    
ref|XP_002278638.1|  PREDICTED: laccase-4                               275   1e-83    
ref|XP_010262771.1|  PREDICTED: laccase-4-like                          275   1e-83    
emb|CDY18406.1|  BnaA04g21810D                                          275   2e-83    
emb|CDX91428.1|  BnaC04g07220D                                          274   2e-83    
emb|CDX74915.1|  BnaA05g06610D                                          274   3e-83    
ref|XP_009143427.1|  PREDICTED: laccase-4                               274   3e-83    
gb|EYU41858.1|  hypothetical protein MIMGU_mgv1a003895mg                274   4e-83    
ref|XP_004246339.1|  PREDICTED: laccase-4                               273   6e-83    
ref|XP_006293932.1|  hypothetical protein CARUB_v10022927mg             273   7e-83    
gb|KFK36706.1|  hypothetical protein AALP_AA4G158700                    273   7e-83    
ref|XP_002519529.1|  laccase, putative                                  273   7e-83    
gb|EPS60103.1|  laccase 1a                                              273   8e-83    
ref|XP_011084946.1|  PREDICTED: laccase-4-like                          273   9e-83    
ref|XP_002533894.1|  laccase, putative                                  273   9e-83    
ref|XP_002520425.1|  laccase, putative                                  273   1e-82    
ref|XP_010104682.1|  hypothetical protein L484_022065                   273   1e-82    
ref|XP_009384856.1|  PREDICTED: laccase-22-like                         272   1e-82    
ref|XP_009141718.1|  PREDICTED: laccase-4-like                          272   1e-82    
gb|EMS57359.1|  Laccase-10                                              270   1e-82    
ref|XP_004302643.1|  PREDICTED: laccase-4-like                          272   1e-82    
ref|XP_009416212.1|  PREDICTED: laccase-22-like                         272   2e-82    
gb|KDO37344.1|  hypothetical protein CISIN_1g009854mg                   271   2e-82    
ref|XP_006411009.1|  hypothetical protein EUTSA_v10016460mg             272   2e-82    
ref|XP_002280416.1|  PREDICTED: laccase-4                               271   2e-82    
ref|XP_011035200.1|  PREDICTED: laccase-4                               271   2e-82    
ref|XP_007009094.1|  Laccase/Diphenol oxidase family protein            271   2e-82    
ref|XP_010037723.1|  PREDICTED: laccase-4-like                          271   3e-82    
ref|XP_004249583.1|  PREDICTED: laccase-4-like                          271   3e-82    
ref|XP_009407561.1|  PREDICTED: laccase-22-like                         271   4e-82    
ref|XP_010067496.1|  PREDICTED: laccase-4-like                          271   4e-82    
ref|XP_006338994.1|  PREDICTED: laccase-4-like                          271   4e-82    
ref|XP_002314124.1|  hypothetical protein POPTR_0009s04720g             271   6e-82    
ref|XP_006425016.1|  hypothetical protein CICLE_v10028117mg             271   6e-82    
ref|XP_002299828.2|  hypothetical protein POPTR_0001s25580g             270   7e-82    
ref|XP_006300062.1|  hypothetical protein CARUB_v10016290mg             270   7e-82    
gb|EYU41257.1|  hypothetical protein MIMGU_mgv1a003880mg                270   8e-82    
ref|XP_006586249.1|  PREDICTED: laccase-17-like isoform X2              270   1e-81    
ref|XP_007026986.1|  Laccase 2 isoform 4                                266   1e-81    
gb|EAZ12812.1|  hypothetical protein OsJ_02731                          270   1e-81    
sp|Q8RYM9.1|LAC2_ORYSJ  RecName: Full=Laccase-2; AltName: Full=Be...    270   1e-81    
gb|EYU26646.1|  hypothetical protein MIMGU_mgv1a003805mg                270   1e-81    
ref|XP_010535416.1|  PREDICTED: laccase-16                              270   2e-81    
emb|CDP14064.1|  unnamed protein product                                269   2e-81    
gb|EMT04658.1|  Laccase-12/13                                           270   2e-81    
ref|XP_010256659.1|  PREDICTED: laccase-4                               269   2e-81    
ref|XP_009590412.1|  PREDICTED: laccase-4-like                          269   3e-81    
ref|XP_004490574.1|  PREDICTED: laccase-4-like                          269   3e-81    
gb|KHG22893.1|  Laccase-4 -like protein                                 266   3e-81    
ref|XP_006363052.1|  PREDICTED: laccase-4-like                          269   3e-81    
ref|XP_009392410.1|  PREDICTED: laccase-11                              268   5e-81    
ref|XP_010543228.1|  PREDICTED: laccase-10                              268   5e-81    
ref|XP_006878556.1|  hypothetical protein AMTR_s00011p00235480          268   5e-81    
emb|CDY08537.1|  BnaA05g27730D                                          267   7e-81    
ref|NP_001172647.1|  Os01g0844050                                       267   8e-81    
gb|EMT12966.1|  Laccase-4                                               266   8e-81    
emb|CBI17500.3|  unnamed protein product                                267   9e-81    
ref|XP_010543401.1|  PREDICTED: laccase-11-like                         268   1e-80    



>ref|XP_009774063.1| PREDICTED: laccase-17-like [Nicotiana sylvestris]
Length=581

 Score =   435 bits (1119),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 223/254 (88%), Positives = 239/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLPMFKP LP LNDTSFA+NFSKKLRSL +  +PAKVPQ VDKHFFFTVGLGT PCDKN
Sbjct  328  KKLPMFKPALPPLNDTSFATNFSKKLRSLANSQFPAKVPQNVDKHFFFTVGLGTTPCDKN  387

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTN TKF+ASINN+SFVQPTTALLQ+HF GQSN VY+P FP++PLHWFNYTGNPP
Sbjct  388  QTCQGPTNTTKFAASINNISFVQPTTALLQSHFIGQSNGVYNPYFPINPLHWFNYTGNPP  447

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMV+NGTKV+VL FNT+VEL+MQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  448  NNTMVNNGTKVLVLPFNTNVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDP  507

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNL+DPVERNTVGVPAGGWVAIRFLADNPG+WFMHCHLEVHTSWGLKMAWLVLDGKLP
Sbjct  508  TNFNLIDPVERNTVGVPAGGWVAIRFLADNPGIWFMHCHLEVHTSWGLKMAWLVLDGKLP  567

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPPSDLPKC
Sbjct  568  NQKLLPPPSDLPKC  581



>ref|XP_009587566.1| PREDICTED: laccase-17-like [Nicotiana tomentosiformis]
Length=581

 Score =   432 bits (1112),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 221/254 (87%), Positives = 237/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+FKP LP LNDTSFA+NFSKKLRSL +  +PAKVPQ VDKHFFFTVGLGT PCDKN
Sbjct  328  KKLPLFKPTLPPLNDTSFATNFSKKLRSLANSQFPAKVPQNVDKHFFFTVGLGTTPCDKN  387

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTN TKF+ASINN+SFVQPTTALLQ+HF GQSN VYSP FP++PL+WFNYTGNPP
Sbjct  388  QTCQGPTNTTKFAASINNISFVQPTTALLQSHFMGQSNSVYSPYFPINPLNWFNYTGNPP  447

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMV NGTKV+VL FNTSVEL+MQDTSILGAESHPLHLHGFNFFV GQGFGNF+  KDP
Sbjct  448  NNTMVYNGTKVLVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVAGQGFGNFDPNKDP  507

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNL+DPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP
Sbjct  508  ANFNLIDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  567

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPPSDLP+C
Sbjct  568  NQKLLPPPSDLPQC  581



>ref|XP_009621093.1| PREDICTED: laccase-17-like [Nicotiana tomentosiformis]
Length=581

 Score =   431 bits (1108),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 223/254 (88%), Positives = 236/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLPMF P LP LNDTSFA+NFSKKLRSL +  +P KVPQ VDKHFFFTVGLGT PCDKN
Sbjct  328  KKLPMFMPTLPPLNDTSFATNFSKKLRSLATSQFPTKVPQNVDKHFFFTVGLGTTPCDKN  387

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTN TKF+ASINN+SFVQPTTALLQ+HF GQSN VYSP FP +PL+WFNYTGNPP
Sbjct  388  QTCQGPTNTTKFAASINNISFVQPTTALLQSHFIGQSNGVYSPYFPNNPLNWFNYTGNPP  447

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVEL+MQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  448  NNTMVSNGTKVLVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDP  507

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNL+DPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP
Sbjct  508  ANFNLIDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  567

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPPSDLPKC
Sbjct  568  NQKLLPPPSDLPKC  581



>ref|XP_011077639.1| PREDICTED: laccase-17-like [Sesamum indicum]
Length=578

 Score =   429 bits (1104),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 218/254 (86%), Positives = 242/254 (95%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP++KPILP LNDTSFA+NF+KKLRSL +P +PA VPQ VDKHFFFTVGLGT+PCD+N
Sbjct  326  KKLPLYKPILPPLNDTSFATNFAKKLRSLATPQFPANVPQEVDKHFFFTVGLGTSPCDQN  385

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            +TCQGP N TKF+AS++N+SFVQPTTALLQAHF+GQS+ VYSP+FP++PLHWFNYTGNPP
Sbjct  386  KTCQGP-NGTKFAASVSNISFVQPTTALLQAHFTGQSSGVYSPDFPINPLHWFNYTGNPP  444

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMV NGTK+MVL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN++  +DP
Sbjct  445  NNTMVGNGTKLMVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPNEDP  504

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
            KNFNLVDP+ERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP
Sbjct  505  KNFNLVDPIERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  564

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  565  NQKLLPPPADLPKC  578



>ref|XP_009796361.1| PREDICTED: laccase-17-like [Nicotiana sylvestris]
Length=581

 Score =   426 bits (1096),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 218/254 (86%), Positives = 235/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+FKP LP LNDTSFA+NFSKKL SL +  +PAKVPQ VDKHFFFTVGLGT PCDKN
Sbjct  328  KKLPLFKPTLPPLNDTSFATNFSKKLHSLANSQFPAKVPQNVDKHFFFTVGLGTTPCDKN  387

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            Q CQGPTN TKF+ASINNVSF+QPTTALLQ+HF GQSN VYSP FP++PLHWFNYTG PP
Sbjct  388  QICQGPTNTTKFAASINNVSFIQPTTALLQSHFIGQSNGVYSPYFPINPLHWFNYTGTPP  447

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V+NGTKV+VL FNTSVEL+MQDTSILGAESHPLHLHGFNF+VVGQGFGNF+  KDP
Sbjct  448  NNTRVNNGTKVLVLPFNTSVELIMQDTSILGAESHPLHLHGFNFYVVGQGFGNFDPNKDP  507

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNL+DPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP
Sbjct  508  ANFNLIDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  567

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPPSDLP+C
Sbjct  568  NQKLLPPPSDLPQC  581



>ref|XP_011094888.1| PREDICTED: laccase-17-like [Sesamum indicum]
Length=578

 Score =   424 bits (1089),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 239/254 (94%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP++KPILPALNDT FA+NFSKKLRSL +P +PA VPQ VDK FFFTVGLGT+PCDKN
Sbjct  326  KKLPLYKPILPALNDTMFATNFSKKLRSLATPQFPANVPQKVDKQFFFTVGLGTHPCDKN  385

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            +TCQGP N TKF+A+++N+SFVQPTTALLQAH++GQS+ VYSP+FP+SP HWFNYTGNPP
Sbjct  386  RTCQGP-NGTKFAAAVSNISFVQPTTALLQAHYTGQSSGVYSPDFPISPFHWFNYTGNPP  444

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMV+NGTK+MVL FNTSVELV+QDTSILGAESHPLHLHGFNFF+VGQGFGN++   D 
Sbjct  445  NNTMVANGTKLMVLPFNTSVELVLQDTSILGAESHPLHLHGFNFFIVGQGFGNYDPNTDL  504

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
            KNFNLVDP+ERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP
Sbjct  505  KNFNLVDPIERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  564

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  565  NQKLLPPPADLPKC  578



>ref|XP_003532315.1| PREDICTED: laccase-17-like [Glycine max]
Length=579

 Score =   420 bits (1079),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 218/254 (86%), Positives = 235/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKL +FKPILPALNDTSFA+NFS KLRSL S  +PA VPQ +DKHFFFTVGLGT PC +N
Sbjct  326  KKLSLFKPILPALNDTSFATNFSNKLRSLASAQFPANVPQKIDKHFFFTVGLGTTPCSQN  385

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTN+TKF+AS+NNVSF+QPTTALLQ+HF GQSN VYSP FP+SPL  FNYTG PP
Sbjct  386  QTCQGPTNSTKFAASVNNVSFIQPTTALLQSHFFGQSNGVYSPYFPISPLIPFNYTGTPP  445

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  446  NNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDP  505

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDG+LP
Sbjct  506  ANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGELP  565

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  566  NQKLLPPPADLPKC  579



>gb|KHN24986.1| Laccase-17 [Glycine soja]
Length=579

 Score =   419 bits (1078),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 218/254 (86%), Positives = 235/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKL +FKPILPALNDTSFA+NFS KLRSL S  +PA VPQ +DKHFFFTVGLGT PC +N
Sbjct  326  KKLSLFKPILPALNDTSFATNFSNKLRSLASAQFPANVPQKIDKHFFFTVGLGTTPCSQN  385

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTN+TKF+AS+NNVSF+QPTTALLQ+HF GQSN VYSP FP+SPL  FNYTG PP
Sbjct  386  QTCQGPTNSTKFAASVNNVSFIQPTTALLQSHFFGQSNGVYSPYFPISPLIPFNYTGTPP  445

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  446  NNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDP  505

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDG+LP
Sbjct  506  ANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGELP  565

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  566  NQKLLPPPADLPKC  579



>gb|KEH22816.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=580

 Score =   417 bits (1072),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 216/254 (85%), Positives = 231/254 (91%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KK+P+FKP LPALNDTSFA+ FSKKLRSL SP +PA VPQ VDKHFFFTVGLGTNPC  N
Sbjct  328  KKIPLFKPTLPALNDTSFATKFSKKLRSLASPQFPANVPQKVDKHFFFTVGLGTNPCQSN  387

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T F+AS+NNVSF  PTTALLQ+HF+GQS  VY+P FP SPLH FNYTG PP
Sbjct  388  QTCQGP-NGTMFAASVNNVSFTMPTTALLQSHFTGQSRGVYAPYFPSSPLHPFNYTGTPP  446

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN++  KDP
Sbjct  447  NNTMVSNGTKVTVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDSNKDP  506

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
            KNFNLVDPVERNT+GVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  507  KNFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGKLP  566

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  567  NQKLLPPPADLPKC  580



>ref|XP_006603494.1| PREDICTED: laccase-17-like, partial [Glycine max]
Length=504

 Score =   414 bits (1063),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 218/254 (86%), Positives = 232/254 (91%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKL +FKPILPALNDTSFA+NF+ KL SL S  +PA VPQ VDKHFFFTVGLGT PC +N
Sbjct  251  KKLSLFKPILPALNDTSFATNFANKLHSLASAQFPANVPQKVDKHFFFTVGLGTTPCPQN  310

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTNATKF+AS+NNVSF+QPTTALLQAHF GQSN VYSP FP+SPL  FNYTG PP
Sbjct  311  QTCQGPTNATKFAASVNNVSFIQPTTALLQAHFFGQSNGVYSPYFPISPLVPFNYTGTPP  370

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  371  NNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKKDP  430

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNTVGVP+GGWVAIRFL DNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  431  VNFNLVDPVERNTVGVPSGGWVAIRFLTDNPGVWFMHCHLEVHTSWGLKMAWIVLDGKLP  490

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLP C
Sbjct  491  NQKLLPPPADLPNC  504



>ref|XP_003622953.1| Laccase [Medicago truncatula]
Length=604

 Score =   416 bits (1070),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 216/254 (85%), Positives = 231/254 (91%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KK+P+FKP LPALNDTSFA+ FSKKLRSL SP +PA VPQ VDKHFFFTVGLGTNPC  N
Sbjct  352  KKIPLFKPTLPALNDTSFATKFSKKLRSLASPQFPANVPQKVDKHFFFTVGLGTNPCQSN  411

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T F+AS+NNVSF  PTTALLQ+HF+GQS  VY+P FP SPLH FNYTG PP
Sbjct  412  QTCQGP-NGTMFAASVNNVSFTMPTTALLQSHFTGQSRGVYAPYFPSSPLHPFNYTGTPP  470

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN++  KDP
Sbjct  471  NNTMVSNGTKVTVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDSNKDP  530

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
            KNFNLVDPVERNT+GVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  531  KNFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGKLP  590

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  591  NQKLLPPPADLPKC  604



>ref|XP_007140298.1| hypothetical protein PHAVU_008G100400g [Phaseolus vulgaris]
 gb|ESW12292.1| hypothetical protein PHAVU_008G100400g [Phaseolus vulgaris]
Length=625

 Score =   417 bits (1071),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 216/254 (85%), Positives = 230/254 (91%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKL +FKPILPALNDTSFA+NF+ KLRSL S  +PA VPQ VDKHFFFTVGLGT PC KN
Sbjct  372  KKLSLFKPILPALNDTSFATNFASKLRSLASSQFPANVPQKVDKHFFFTVGLGTTPCQKN  431

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTN TKFSAS+NNVS++QPTTALLQAHF GQSN VY+ +FP  PL  FNYTG PP
Sbjct  432  QTCQGPTNTTKFSASVNNVSYIQPTTALLQAHFFGQSNGVYTTDFPTKPLVPFNYTGTPP  491

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN++  KDP
Sbjct  492  NNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPNKDP  551

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  552  AKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGKLP  611

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP DLPKC
Sbjct  612  NQKLLPPPEDLPKC  625



>ref|XP_011094887.1| PREDICTED: laccase-17-like [Sesamum indicum]
Length=583

 Score =   415 bits (1066),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 215/256 (84%), Positives = 234/256 (91%), Gaps = 3/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K+LP+FKP LPA+NDTSFA+NF+ K+RSL SP YPA VPQ VDKHFFFTVGLGT+PCD  
Sbjct  329  KRLPLFKPTLPAVNDTSFATNFTSKIRSLASPQYPANVPQNVDKHFFFTVGLGTSPCDHQ  388

Query  175  KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
               +CQGP N T+FSAS+NNVSFVQP TALLQAH SGQSN VYSP+FP+SPLHWFNYTG 
Sbjct  389  NKSSCQGP-NGTRFSASVNNVSFVQPNTALLQAHHSGQSNGVYSPDFPISPLHWFNYTGT  447

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNTMVSNGTKV+VL FNTSVE++MQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  +
Sbjct  448  PPNNTMVSNGTKVVVLPFNTSVEVIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKQ  507

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DPKNFNLVDP+ERNTVGVP GGWVAIRFLADNPGVWFMHCHLE+HTSWGLKMAWLVLDGK
Sbjct  508  DPKNFNLVDPIERNTVGVPPGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMAWLVLDGK  567

Query  715  LPNQKLLPPPSDLPKC  762
            LPNQKLLPPP DLPKC
Sbjct  568  LPNQKLLPPPKDLPKC  583



>emb|CDP01507.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   414 bits (1064),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 211/254 (83%), Positives = 233/254 (92%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+F+P LPALNDTSFA+NFS KLRSL SP YPA VP  +DK  FFTVGLGT+PCD+ 
Sbjct  332  KKLPLFRPTLPALNDTSFAANFSNKLRSLASPQYPANVPWNIDKQVFFTVGLGTSPCDQP  391

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            Q CQGP N TKF+AS+NN+SFVQPTTALLQ+HFSGQS+ VYSP+FP +PLHW NYTGNPP
Sbjct  392  QGCQGP-NGTKFAASVNNISFVQPTTALLQSHFSGQSSGVYSPDFPFNPLHWLNYTGNPP  450

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMV N TKV+V+ FNTSVEL+MQDTSILGAESHPLHLHGFNFFVVGQGFGN++  KDP
Sbjct  451  NNTMVGNATKVLVVPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPNKDP  510

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
            KNFNLVDP+ERNTVGVP+GGWVAIRFLADNPG+WFMHCHLEVHTSWGLKMAWLVLDGKLP
Sbjct  511  KNFNLVDPIERNTVGVPSGGWVAIRFLADNPGMWFMHCHLEVHTSWGLKMAWLVLDGKLP  570

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  571  NQKLLPPPADLPKC  584



>ref|XP_006602579.1| PREDICTED: laccase-17-like isoform X2 [Glycine max]
Length=580

 Score =   412 bits (1060),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 217/254 (85%), Positives = 232/254 (91%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKL +FKPILPALNDTSFA+NF+ KL SL S  +PA VPQ VDKHFFFTVGLGT PC +N
Sbjct  327  KKLSLFKPILPALNDTSFATNFANKLHSLASAQFPANVPQKVDKHFFFTVGLGTTPCPQN  386

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTNATKF+AS+NNVSF+QPTTALLQAHF GQSN VYSP FP+SPL  FNYTG PP
Sbjct  387  QTCQGPTNATKFAASVNNVSFIQPTTALLQAHFFGQSNGVYSPYFPISPLVPFNYTGTPP  446

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  447  NNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKKDP  506

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             N N VDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDG+LP
Sbjct  507  ANLNPVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGELP  566

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  567  NQKLLPPPADLPKC  580



>emb|CDP06592.1| unnamed protein product [Coffea canephora]
Length=563

 Score =   412 bits (1058),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 210/253 (83%), Positives = 231/253 (91%), Gaps = 1/253 (0%)
 Frame = +1

Query  4    KLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQ  183
            KLP+F+P LPALNDT+FA+NF  KLRSL +  YPA VPQ +D+HFFFTVGLGT+PCD+ Q
Sbjct  312  KLPLFRPTLPALNDTAFAANFLNKLRSLANRQYPANVPQNIDEHFFFTVGLGTSPCDQTQ  371

Query  184  TCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPN  363
             CQGP N TKF+AS+NN+SF QPTTALLQ+HFSGQS+ VYSP+FP +PL WFNYTGNPPN
Sbjct  372  GCQGP-NGTKFAASVNNISFAQPTTALLQSHFSGQSSGVYSPDFPYNPLRWFNYTGNPPN  430

Query  364  NTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPK  543
            NTMV N TKVMVL FNTSVEL+MQDTSILGAESHPLHLHGFNFFVVGQGFGN++  KDPK
Sbjct  431  NTMVGNATKVMVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPNKDPK  490

Query  544  NFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPN  723
            NFNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL N
Sbjct  491  NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLRN  550

Query  724  QKLLPPPSDLPKC  762
            QKLLPPP+DLPKC
Sbjct  551  QKLLPPPADLPKC  563



>ref|XP_003552160.2| PREDICTED: laccase-17-like isoform X1 [Glycine max]
Length=580

 Score =   412 bits (1059),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 217/254 (85%), Positives = 232/254 (91%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKL +FKPILPALNDTSFA+NF+ KL SL S  +PA VPQ VDKHFFFTVGLGT PC +N
Sbjct  327  KKLSLFKPILPALNDTSFATNFANKLHSLASAQFPANVPQKVDKHFFFTVGLGTTPCPQN  386

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTNATKF+AS+NNVSF+QPTTALLQAHF GQSN VYSP FP+SPL  FNYTG PP
Sbjct  387  QTCQGPTNATKFAASVNNVSFIQPTTALLQAHFFGQSNGVYSPYFPISPLVPFNYTGTPP  446

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  447  NNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKKDP  506

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             N N VDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDG+LP
Sbjct  507  ANLNPVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGELP  566

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  567  NQKLLPPPADLPKC  580



>gb|KHN16229.1| Laccase-17 [Glycine soja]
Length=580

 Score =   412 bits (1058),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 216/254 (85%), Positives = 230/254 (91%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ KPILPALNDTSFA+ F+ KLRSL S  +PA VPQ VD HFFFTVGLGT PC +N
Sbjct  327  KNLPLLKPILPALNDTSFATKFNNKLRSLASAQFPANVPQKVDTHFFFTVGLGTTPCPQN  386

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTNATKF+AS+NNVSF+QPTTALLQAHF GQSN VYSP FP+SPL  FNYTG PP
Sbjct  387  QTCQGPTNATKFAASVNNVSFIQPTTALLQAHFFGQSNGVYSPYFPISPLVPFNYTGTPP  446

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  447  NNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKKDP  506

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNTVGVP+GGWVAIRFL DNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  507  VNFNLVDPVERNTVGVPSGGWVAIRFLTDNPGVWFMHCHLEVHTSWGLKMAWIVLDGKLP  566

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLP C
Sbjct  567  NQKLLPPPADLPNC  580



>emb|CBI16199.3| unnamed protein product [Vitis vinifera]
Length=566

 Score =   408 bits (1049),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 209/254 (82%), Positives = 234/254 (92%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+FKP LP LNDTSFA+NF+ +LRSL SP +PA VPQ VD+HFFFT+GLGT+PCD+N
Sbjct  314  KKLPLFKPTLPPLNDTSFATNFTNRLRSLASPQFPANVPQKVDRHFFFTIGLGTSPCDQN  373

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKF+AS+NNVSF   TTALLQAHFSGQSN VY+P+FP++P+  FNYTG PP
Sbjct  374  QTCQGP-NGTKFAASVNNVSFASSTTALLQAHFSGQSNGVYNPDFPITPIIPFNYTGTPP  432

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT+VSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN++  KDP
Sbjct  433  NNTLVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPNKDP  492

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLE+HTSWGLKMAW+VLDGKLP
Sbjct  493  ANFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMAWVVLDGKLP  552

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  553  NQKLLPPPADLPKC  566



>ref|XP_008223967.1| PREDICTED: laccase-17, partial [Prunus mume]
Length=556

 Score =   408 bits (1048),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 217/255 (85%), Positives = 234/255 (92%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDK-  177
            KKLP+FKPILPALNDTSFA+ FSKKLRSL +  +PA VPQ VDKHFFFTVGLGTNPC+K 
Sbjct  303  KKLPLFKPILPALNDTSFATKFSKKLRSLANAQFPANVPQKVDKHFFFTVGLGTNPCNKH  362

Query  178  NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            NQTCQGP N T F+AS+NNVSFV PTTALLQAHFSGQSN VYS NFP SP+  FNYTG P
Sbjct  363  NQTCQGP-NGTMFAASVNNVSFVMPTTALLQAHFSGQSNRVYSSNFPSSPVIPFNYTGTP  421

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMVSNGTK++VL FNTSVEL+MQDTSILGAESHPLHLHG+NFFVVGQGFGNF+Q KD
Sbjct  422  PNNTMVSNGTKLVVLPFNTSVELIMQDTSILGAESHPLHLHGYNFFVVGQGFGNFDQNKD  481

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P NFNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLE+HTSWGLKMAW+VLDGKL
Sbjct  482  PANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMAWVVLDGKL  541

Query  718  PNQKLLPPPSDLPKC  762
            PNQKLLPPP+DLP C
Sbjct  542  PNQKLLPPPADLPTC  556



>ref|XP_004492322.1| PREDICTED: laccase-17-like [Cicer arietinum]
Length=580

 Score =   408 bits (1049),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 231/254 (91%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            +KLP+FKPILPALNDTSFA+ FS KL SL S  +PA VPQ VD+HFFFTVGLGTNPC  N
Sbjct  328  EKLPLFKPILPALNDTSFATKFSNKLNSLASAQFPANVPQKVDRHFFFTVGLGTNPCKNN  387

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            +TCQGP N T F+ASINNVSF+ PTTALLQ+HF GQSN VY+P FP SPLH FNYTG PP
Sbjct  388  KTCQGP-NGTMFAASINNVSFILPTTALLQSHFFGQSNGVYAPYFPNSPLHPFNYTGTPP  446

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  447  NNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDSNKDP  506

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
            KNFNLVDPVERNT+GVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGL+MAW+VLDGKLP
Sbjct  507  KNFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLRMAWIVLDGKLP  566

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  567  NQKLLPPPADLPKC  580



>ref|XP_002284473.1| PREDICTED: laccase-17 [Vitis vinifera]
Length=585

 Score =   408 bits (1049),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 209/254 (82%), Positives = 234/254 (92%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+FKP LP LNDTSFA+NF+ +LRSL SP +PA VPQ VD+HFFFT+GLGT+PCD+N
Sbjct  333  KKLPLFKPTLPPLNDTSFATNFTNRLRSLASPQFPANVPQKVDRHFFFTIGLGTSPCDQN  392

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKF+AS+NNVSF   TTALLQAHFSGQSN VY+P+FP++P+  FNYTG PP
Sbjct  393  QTCQGP-NGTKFAASVNNVSFASSTTALLQAHFSGQSNGVYNPDFPITPIIPFNYTGTPP  451

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT+VSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN++  KDP
Sbjct  452  NNTLVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPNKDP  511

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLE+HTSWGLKMAW+VLDGKLP
Sbjct  512  ANFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMAWVVLDGKLP  571

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  572  NQKLLPPPADLPKC  585



>gb|KHN24984.1| Laccase-17 [Glycine soja]
Length=559

 Score =   407 bits (1045),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 211/254 (83%), Positives = 228/254 (90%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ KPILPALNDTSFA+ F+ KLRSL S  +PA VPQ VDKHFFFTVGLGT PC +N
Sbjct  306  KNLPLLKPILPALNDTSFATKFTNKLRSLASAQFPANVPQKVDKHFFFTVGLGTTPCPQN  365

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTN+TKFSAS+NNVSF+QPTTALLQ HF GQSN VY+P+FP  PL  FNYTG PP
Sbjct  366  QTCQGPTNSTKFSASVNNVSFIQPTTALLQTHFFGQSNRVYTPDFPTKPLVPFNYTGTPP  425

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN++  KDP
Sbjct  426  NNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPNKDP  485

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNL DP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  486  ANFNLDDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLP  545

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP+DLP C
Sbjct  546  NQKLFPPPADLPMC  559



>ref|XP_007022468.1| Laccase 17 [Theobroma cacao]
 gb|EOY13993.1| Laccase 17 [Theobroma cacao]
Length=577

 Score =   407 bits (1045),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 211/254 (83%), Positives = 232/254 (91%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKPILPALNDTSFA+NF+ KLRSL S  YPA VP+ VDKHFFFTVGLGT+ C +N
Sbjct  325  KMLPLFKPILPALNDTSFATNFASKLRSLASAQYPANVPRKVDKHFFFTVGLGTSACQQN  384

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKF+AS+NNVSF  PTTALLQ+HF GQSN VY+P+FP++P+  FNYTG PP
Sbjct  385  QTCQGP-NGTKFAASVNNVSFTMPTTALLQSHFFGQSNGVYTPDFPINPIIPFNYTGTPP  443

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVEL+MQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  444  NNTMVSNGTKVVVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDP  503

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  504  ANFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGKLP  563

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  564  NQKLLPPPADLPKC  577



>ref|XP_003530894.1| PREDICTED: laccase-17-like [Glycine max]
Length=578

 Score =   406 bits (1044),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 211/254 (83%), Positives = 228/254 (90%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ KPILPALNDTSFA+ F+ KLRSL S  +PA VPQ VDKHFFFTVGLGT PC +N
Sbjct  325  KNLPLLKPILPALNDTSFATKFTNKLRSLASAQFPANVPQKVDKHFFFTVGLGTTPCPQN  384

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTN+TKFSAS+NNVSF+QPTTALLQ HF GQSN VY+P+FP  PL  FNYTG PP
Sbjct  385  QTCQGPTNSTKFSASVNNVSFIQPTTALLQTHFFGQSNRVYTPDFPTKPLVPFNYTGTPP  444

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN++  KDP
Sbjct  445  NNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPNKDP  504

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNL DP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  505  ANFNLDDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLP  564

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP+DLP C
Sbjct  565  NQKLFPPPADLPMC  578



>gb|KHN16225.1| Laccase-17, partial [Glycine soja]
Length=540

 Score =   405 bits (1040),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 210/254 (83%), Positives = 227/254 (89%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ KPILPALNDTSFA+ F+ KLRSL S  +PA VPQ VD HFFFTVGLGT PC +N
Sbjct  287  KNLPLLKPILPALNDTSFATKFNNKLRSLASAQFPANVPQKVDTHFFFTVGLGTTPCPQN  346

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTNATKF+AS+NNVSF+QPTTALLQ HF GQSN VY+ +FP  PL  FNYTG PP
Sbjct  347  QTCQGPTNATKFAASVNNVSFIQPTTALLQTHFFGQSNGVYTADFPAKPLIPFNYTGTPP  406

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFF VGQGFGNF+  KDP
Sbjct  407  NNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFAVGQGFGNFDPNKDP  466

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNL+DP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  467  ANFNLLDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLP  526

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP+DLPKC
Sbjct  527  NQKLFPPPADLPKC  540



>gb|KHN16226.1| Laccase-17 [Glycine soja]
Length=578

 Score =   405 bits (1041),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 210/254 (83%), Positives = 227/254 (89%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ KPILPALNDTSFA+ F+ KLRSL S  +PA VPQ VD HFFFTVGLGT PC +N
Sbjct  325  KNLPLLKPILPALNDTSFATKFNNKLRSLASAQFPANVPQKVDTHFFFTVGLGTTPCPQN  384

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTNATKF+AS+NNVSF+QPTTALLQ HF GQSN VY+ +FP  PL  FNYTG PP
Sbjct  385  QTCQGPTNATKFAASVNNVSFIQPTTALLQTHFFGQSNGVYTADFPAKPLIPFNYTGTPP  444

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFF VGQGFGNF+  KDP
Sbjct  445  NNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFAVGQGFGNFDPNKDP  504

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNL+DP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  505  ANFNLLDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLP  564

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP+DLPKC
Sbjct  565  NQKLFPPPADLPKC  578



>ref|XP_006602563.1| PREDICTED: laccase-17-like [Glycine max]
Length=578

 Score =   405 bits (1041),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 210/254 (83%), Positives = 227/254 (89%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ KPILPALNDTSFA+ F+ KLRSL S  +PA VPQ VD HFFFTVGLGT PC +N
Sbjct  325  KNLPLLKPILPALNDTSFATKFNNKLRSLASAQFPANVPQKVDTHFFFTVGLGTTPCPQN  384

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTNATKF+AS+NNVSF+QPTTALLQ HF GQSN VY+ +FP  PL  FNYTG PP
Sbjct  385  QTCQGPTNATKFAASVNNVSFIQPTTALLQTHFFGQSNGVYTADFPAKPLIPFNYTGTPP  444

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFF VGQGFGNF+  KDP
Sbjct  445  NNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFAVGQGFGNFDPNKDP  504

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNL+DP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  505  ANFNLLDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLP  564

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP+DLPKC
Sbjct  565  NQKLFPPPADLPKC  578



>ref|XP_004492318.1| PREDICTED: laccase-17-like [Cicer arietinum]
Length=580

 Score =   405 bits (1040),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 211/254 (83%), Positives = 228/254 (90%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            + LP+FKP+LPALNDTSFA+ F+ KLRSL S  +PA VPQ +D+HFFFTVGLGTNPC  N
Sbjct  328  ETLPLFKPVLPALNDTSFATKFTNKLRSLASAQFPANVPQKIDRHFFFTVGLGTNPCKSN  387

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T F+ASINNVSF  PTTALLQ+HF GQSN VY+P FP SPLH FNYTG PP
Sbjct  388  QTCQGP-NGTMFAASINNVSFTTPTTALLQSHFFGQSNGVYAPYFPTSPLHPFNYTGTPP  446

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF++ KDP
Sbjct  447  NNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDKNKDP  506

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
            K FNLVDPVERNTVGVP+GGWVAIRF ADNPG WFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  507  KKFNLVDPVERNTVGVPSGGWVAIRFQADNPGAWFMHCHLEVHTSWGLKMAWIVLDGKLP  566

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  567  NQKLLPPPADLPKC  580



>gb|KHN16224.1| Laccase-17 [Glycine soja]
Length=631

 Score =   405 bits (1040),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 219/275 (80%), Positives = 234/275 (85%), Gaps = 21/275 (8%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKL +FKPILPALNDTSFA+NF+ KL SL S  +PA VPQ VDKHFFFTVGLGT PC +N
Sbjct  357  KKLSLFKPILPALNDTSFATNFANKLHSLASAQFPANVPQKVDKHFFFTVGLGTTPCPQN  416

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTNATKF+AS+NNVSF+QPTTALLQAHF GQSN VYSP FP+SPL  FNYTG PP
Sbjct  417  QTCQGPTNATKFAASVNNVSFIQPTTALLQAHFFGQSNGVYSPYFPISPLVPFNYTGTPP  476

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHP---------------------LHL  477
            NNTMVSNGTKV+VL FNTSVELVMQDTSILGAESHP                     LHL
Sbjct  477  NNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNLHL  536

Query  478  HgfnffvvgqgfgnfnqTKDPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCH  657
            HGFNFFVVGQGFGNF+  KDP NFNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCH
Sbjct  537  HGFNFFVVGQGFGNFDPNKDPANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCH  596

Query  658  LEVHTSWGLKMAWLVLDGKLPNQKLLPPPSDLPKC  762
            LEVHTSWGLKMAW+VLDG+LPNQKLLPPP+DLPKC
Sbjct  597  LEVHTSWGLKMAWIVLDGELPNQKLLPPPADLPKC  631



>ref|XP_011029469.1| PREDICTED: laccase-17-like [Populus euphratica]
Length=581

 Score =   403 bits (1035),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 228/254 (90%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP++KP LP LNDTSFA+NFS KLRSL S  YPA VPQ VD+ F FTVGLGTNPC KN
Sbjct  329  KKLPLYKPNLPPLNDTSFATNFSSKLRSLASADYPANVPQKVDRQFVFTVGLGTNPCSKN  388

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T+F+AS+NNVSFV PTTALLQAH  GQS  VYSP FPVSPL  FNYTG PP
Sbjct  389  QTCQGP-NGTRFAASVNNVSFVMPTTALLQAHHFGQSKGVYSPYFPVSPLIPFNYTGTPP  447

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTK++VL FNTSVEL+MQDTSILGAESHPLHLHGFNFFVVGQ FGNF+ +KDP
Sbjct  448  NNTMVSNGTKLVVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQSFGNFDPSKDP  507

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  508  ANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLP  567

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  568  NQKLLPPPADLPKC  581



>ref|XP_004246869.2| PREDICTED: laccase-17-like [Solanum lycopersicum]
Length=568

 Score =   402 bits (1032),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 210/254 (83%), Positives = 228/254 (90%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP+LPALNDT+F +NF+ +LRSL SP YPA VPQ VD+  FFTVGLGT+PCDKN
Sbjct  316  KNLPLFKPLLPALNDTNFVTNFTNRLRSLASPQYPANVPQNVDRRLFFTVGLGTSPCDKN  375

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            +TCQGP N TKFSASINNVSFV PTTALLQ+HF GQS  VY P+FP SPL+WFNYTGNPP
Sbjct  376  KTCQGP-NGTKFSASINNVSFVLPTTALLQSHFFGQSKGVYKPDFPYSPLNWFNYTGNPP  434

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT+V+N TK+MVL FNTSVELVMQDTSILG ESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  435  NNTLVANDTKLMVLPFNTSVELVMQDTSILGLESHPLHLHGFNFFVVGQGFGNFDPKKDP  494

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLV DGKLP
Sbjct  495  SNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVQDGKLP  554

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP DLPKC
Sbjct  555  NQKLPPPPMDLPKC  568



>emb|CAN60348.1| hypothetical protein VITISV_005802 [Vitis vinifera]
Length=559

 Score =   400 bits (1028),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 207/254 (81%), Positives = 230/254 (91%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+FKP LP LNDTSFA+NF+ KLRSL SP +PA VPQ VD+HFFFTVGLG++PCD+N
Sbjct  307  KKLPLFKPTLPPLNDTSFAANFTSKLRSLASPQFPANVPQKVDRHFFFTVGLGSSPCDQN  366

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKFSAS NN+SF  PTTALLQAHF GQSN VY P+FP++P+  FNYTG PP
Sbjct  367  QTCQGP-NGTKFSASFNNISFALPTTALLQAHFFGQSNGVYKPDFPITPIIPFNYTGTPP  425

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT+VSNGTKV+VL FNTSVELV+QDTSILGAESHPLHLHGFNFFVVGQGFGN++  KDP
Sbjct  426  NNTLVSNGTKVVVLPFNTSVELVVQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPNKDP  485

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLE+HTSWGLKMAW+VLDGKLP
Sbjct  486  AKFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMAWVVLDGKLP  545

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP+DLPKC
Sbjct  546  NQKLPPPPADLPKC  559



>ref|XP_008385215.1| PREDICTED: laccase-17-like [Malus domestica]
Length=583

 Score =   400 bits (1029),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 210/255 (82%), Positives = 230/255 (90%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDK-  177
            KKLP+FKPILPALNDTSFA+ FS KLRSL +  +PA VPQ VD+HFFFT+GLGTNPC   
Sbjct  330  KKLPLFKPILPALNDTSFATKFSNKLRSLANAQFPANVPQKVDRHFFFTIGLGTNPCSSN  389

Query  178  NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            NQTCQGP N T F+AS+NNVSF  PTTALLQAHFSGQSN VYSP+FP SP+  FNYTG P
Sbjct  390  NQTCQGP-NGTMFAASVNNVSFAMPTTALLQAHFSGQSNGVYSPDFPSSPIIPFNYTGTP  448

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PN+TMV NGTK+MVL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF++ KD
Sbjct  449  PNDTMVGNGTKLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDRNKD  508

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P NFNLVDPVERNTVGVP+GGWVAIRF+ADNPGVWFMHCHLE+HTSWGLKMAWLVLDGKL
Sbjct  509  PANFNLVDPVERNTVGVPSGGWVAIRFVADNPGVWFMHCHLEIHTSWGLKMAWLVLDGKL  568

Query  718  PNQKLLPPPSDLPKC  762
            PNQ+LLPPP+DLP C
Sbjct  569  PNQRLLPPPADLPTC  583



>ref|XP_002317505.2| hypothetical protein POPTR_0011s12100g [Populus trichocarpa]
 gb|EEE98117.2| hypothetical protein POPTR_0011s12100g [Populus trichocarpa]
Length=581

 Score =   400 bits (1029),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 212/254 (83%), Positives = 229/254 (90%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP++KP LP LNDTSFA+NFS KLRSL S  +PA VPQ VD+ FFFTVGLGTNPC KN
Sbjct  329  KKLPLYKPNLPPLNDTSFATNFSSKLRSLASADFPANVPQKVDRQFFFTVGLGTNPCSKN  388

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T+F+AS+NNVSFV PTTALLQAH  GQS  VYSP FP+SPL  FNYTG PP
Sbjct  389  QTCQGP-NGTRFAASVNNVSFVMPTTALLQAHHFGQSRGVYSPYFPISPLIPFNYTGTPP  447

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTK++VL FNTSVEL+MQ TSILGAESHPLHLHGFNFFVVGQGFGNF+ +KDP
Sbjct  448  NNTMVSNGTKLVVLPFNTSVELIMQGTSILGAESHPLHLHGFNFFVVGQGFGNFDPSKDP  507

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  508  ANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLP  567

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  568  NQKLLPPPADLPKC  581



>ref|XP_002531824.1| laccase, putative [Ricinus communis]
 gb|EEF30544.1| laccase, putative [Ricinus communis]
Length=576

 Score =   400 bits (1028),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 207/254 (81%), Positives = 230/254 (91%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+FKP LPALNDT+FA+NF+ +LRSL S  +PA VPQ VDK FFFTVGLGTNPC KN
Sbjct  324  KKLPLFKPSLPALNDTAFATNFTNRLRSLASAQFPANVPQVVDKQFFFTVGLGTNPCPKN  383

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKF+ASINN+SF  PTTALLQAH+SGQS  VYSP FP+SP+  FNYTGNPP
Sbjct  384  QTCQGP-NGTKFAASINNISFAMPTTALLQAHYSGQSKGVYSPYFPISPIIPFNYTGNPP  442

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTK++VL++NTSVEL++QDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  443  NNTMVSNGTKLVVLSYNTSVELILQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKKDP  502

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              +NL+DPVERNTVGVP+GGWVAIRF ADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  503  AKYNLIDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLP  562

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP+DLPKC
Sbjct  563  NQKLRPPPADLPKC  576



>ref|XP_009358279.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
Length=583

 Score =   400 bits (1028),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 212/255 (83%), Positives = 228/255 (89%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPC-DK  177
            KKLP+FKP+LPALNDTSFA+ F  KLRSL +  +PA VPQ VDKHFFFT+GLGTNPC + 
Sbjct  330  KKLPLFKPVLPALNDTSFATKFGNKLRSLANAQFPANVPQKVDKHFFFTIGLGTNPCSNS  389

Query  178  NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            NQTCQGP N T F+AS+NNVSF  PTTALLQAHF+GQSN VYSP FP SPL  FNYTG P
Sbjct  390  NQTCQGP-NGTMFAASVNNVSFAMPTTALLQAHFTGQSNAVYSPYFPSSPLIPFNYTGTP  448

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMV NGTK+MVL FNTSVELVMQDTSILG ESHPLHLHGFNFFVVGQGFGNF++ KD
Sbjct  449  PNNTMVGNGTKLMVLPFNTSVELVMQDTSILGVESHPLHLHGFNFFVVGQGFGNFDRNKD  508

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P NFNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLE+HTSWGLKMAWLVLDGKL
Sbjct  509  PANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMAWLVLDGKL  568

Query  718  PNQKLLPPPSDLPKC  762
            PNQKLLPPP+DLP C
Sbjct  569  PNQKLLPPPADLPTC  583



>ref|XP_003632204.1| PREDICTED: laccase-17 [Vitis vinifera]
 emb|CBI16224.3| unnamed protein product [Vitis vinifera]
Length=585

 Score =   400 bits (1028),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 207/254 (81%), Positives = 230/254 (91%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+FKP LP LNDTSFA+NF+ KLRSL SP +PA VPQ VD+HFFFTVGLG++PCD+N
Sbjct  333  KKLPLFKPTLPPLNDTSFAANFTSKLRSLASPQFPANVPQKVDRHFFFTVGLGSSPCDQN  392

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKFSAS NN+SF  PTTALLQAHF GQSN VY P+FP++P+  FNYTG PP
Sbjct  393  QTCQGP-NGTKFSASFNNISFALPTTALLQAHFFGQSNGVYKPDFPITPIIPFNYTGTPP  451

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT+VSNGTKV+VL FNTSVELV+QDTSILGAESHPLHLHGFNFFVVGQGFGN++  KDP
Sbjct  452  NNTLVSNGTKVVVLPFNTSVELVVQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPNKDP  511

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLE+HTSWGLKMAW+VLDGKLP
Sbjct  512  AKFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMAWVVLDGKLP  571

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP+DLPKC
Sbjct  572  NQKLPPPPADLPKC  585



>ref|XP_009354529.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
Length=583

 Score =   399 bits (1026),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 209/255 (82%), Positives = 231/255 (91%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+FKPILPALNDTSFA+ FS KLRSL +  +PA VPQ VD+HFFFT+GLGT+PC  N
Sbjct  330  KKLPLFKPILPALNDTSFATKFSNKLRSLANAQFPANVPQKVDRHFFFTIGLGTSPCSSN  389

Query  181  -QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
             QTCQGP N T F+AS+NNVSF  PTTALLQAHFSGQSN VYSP+FP+SP+  FNYTG P
Sbjct  390  NQTCQGP-NGTMFAASVNNVSFAMPTTALLQAHFSGQSNGVYSPDFPISPIIPFNYTGTP  448

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PN+TMV +GTK+MVL +NTSVE+VMQDTSILGAESHPLHLHGFNFFVVGQGFGNF++ KD
Sbjct  449  PNDTMVGDGTKLMVLPYNTSVEVVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDRNKD  508

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P NFNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLE+HTSWGLKMAWLVLDGKL
Sbjct  509  PANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMAWLVLDGKL  568

Query  718  PNQKLLPPPSDLPKC  762
            PNQKLLPPP+DLP C
Sbjct  569  PNQKLLPPPADLPTC  583



>ref|XP_009597231.1| PREDICTED: laccase-17-like [Nicotiana tomentosiformis]
Length=568

 Score =   398 bits (1023),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 206/254 (81%), Positives = 228/254 (90%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP+LPALNDT+F +NF+ +LRSL +P +PA VP  VDKH FFTVGLGT+PCD+N
Sbjct  316  KNLPLFKPLLPALNDTTFVTNFTSRLRSLATPQFPANVPLNVDKHLFFTVGLGTSPCDQN  375

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            +TCQGP N TKFSAS+NN+SFVQPTTALLQ+HF G+S  VY P+FP SPL+WFNYTGNPP
Sbjct  376  KTCQGP-NGTKFSASVNNISFVQPTTALLQSHFLGKSKGVYKPDFPYSPLNWFNYTGNPP  434

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT+V N TK+MVL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  435  NNTLVKNDTKLMVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDGNKDP  494

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNL DP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP
Sbjct  495  ANFNLADPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  554

Query  721  NQKLLPPPSDLPKC  762
            NQKL  PP DLPKC
Sbjct  555  NQKLPLPPRDLPKC  568



>ref|XP_010092993.1| hypothetical protein L484_007174 [Morus notabilis]
 gb|EXB53231.1| hypothetical protein L484_007174 [Morus notabilis]
Length=586

 Score =   399 bits (1024),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 211/254 (83%), Positives = 226/254 (89%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKL +FKPILPALNDTSFA+ FS KLRSL S  +PA VPQ VDK FFFT+GLGT+PC  N
Sbjct  334  KKLQLFKPILPALNDTSFATKFSNKLRSLASTQFPANVPQKVDKRFFFTIGLGTSPCTHN  393

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T F+AS+NN+SF  P TALLQAHFSGQSN VYSP FP SPL  FNYTG PP
Sbjct  394  QTCQGP-NGTMFAASVNNISFALPRTALLQAHFSGQSNGVYSPKFPTSPLIPFNYTGAPP  452

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMV+NGTKV VL FNTSVELV+QDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  453  NNTMVTNGTKVAVLPFNTSVELVLQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDP  512

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGL+MAW+VLDGKLP
Sbjct  513  ANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLRMAWVVLDGKLP  572

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  573  NQKLLPPPADLPKC  586



>gb|EYU26609.1| hypothetical protein MIMGU_mgv1a003496mg [Erythranthe guttata]
Length=581

 Score =   398 bits (1023),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 203/254 (80%), Positives = 229/254 (90%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+++ ILP LNDTSF + F+KKLRSLDS  YPA VPQ VDK F FTVGLGT+PC +N
Sbjct  329  KKLPLYRSILPPLNDTSFVTKFAKKLRSLDSREYPANVPQKVDKQFLFTVGLGTSPCGQN  388

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N ++F+AS++N+SFVQ TTALLQAH++GQS+ VYSP+FP SP +WFNYTGNPP
Sbjct  389  NTCQGP-NGSRFAASVSNISFVQSTTALLQAHYTGQSSGVYSPDFPFSPKNWFNYTGNPP  447

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT+V+NGTK+MVL +N+SVELVMQDTSILGAESHPLHLHGFNFFVVG GFGN+N   DP
Sbjct  448  NNTIVANGTKLMVLPYNSSVELVMQDTSILGAESHPLHLHGFNFFVVGLGFGNYNPNTDP  507

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
            + FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDG LP
Sbjct  508  QKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGNLP  567

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPPSDLPKC
Sbjct  568  NQKLLPPPSDLPKC  581



>ref|XP_008358049.1| PREDICTED: laccase-17-like [Malus domestica]
Length=583

 Score =   398 bits (1022),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 210/255 (82%), Positives = 227/255 (89%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPC-DK  177
            KKLP+FKP +PALNDTSFA+ FS KLRSL +  +PA VPQ VDKHFFFT+GLGTNPC + 
Sbjct  330  KKLPLFKPFMPALNDTSFATKFSNKLRSLANAQFPANVPQKVDKHFFFTIGLGTNPCSNS  389

Query  178  NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            NQTCQGP N T F+AS+NNVSF  PTTALLQAHF+GQSN VYSP FP SPL  FNYTG P
Sbjct  390  NQTCQGP-NGTMFAASVNNVSFAMPTTALLQAHFTGQSNGVYSPYFPSSPLIPFNYTGTP  448

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMV NGTK+MVL FNTSVELV QDTSILG ESHPLHLHGFNFFVVGQGFGNF++ KD
Sbjct  449  PNNTMVGNGTKLMVLPFNTSVELVXQDTSILGVESHPLHLHGFNFFVVGQGFGNFDRNKD  508

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P NFNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLE+HTSWGLKMAWLVLDGKL
Sbjct  509  PANFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMAWLVLDGKL  568

Query  718  PNQKLLPPPSDLPKC  762
            PNQKLLPPP+DLP C
Sbjct  569  PNQKLLPPPADLPTC  583



>gb|EYU26602.1| hypothetical protein MIMGU_mgv1a003840mg [Erythranthe guttata]
Length=560

 Score =   397 bits (1019),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 203/254 (80%), Positives = 228/254 (90%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+++ ILP LNDTSF + F+KKLRSLDS  YPA VPQ VDK F FTVGLGT+PC  N
Sbjct  308  KKLPLYRSILPPLNDTSFVTKFAKKLRSLDSREYPANVPQKVDKQFLFTVGLGTSPCGHN  367

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N ++F+AS++N+SFVQ TTALLQAH++GQS+ VYSP+FP SP +WFNYTGNPP
Sbjct  368  NTCQGP-NGSRFAASVSNISFVQSTTALLQAHYTGQSSGVYSPDFPFSPKNWFNYTGNPP  426

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT+V+NGTK+MVL +N+SVELVMQDTSILGAESHPLHLHGFNFFVVG GFGN+N   DP
Sbjct  427  NNTIVANGTKLMVLPYNSSVELVMQDTSILGAESHPLHLHGFNFFVVGLGFGNYNPNTDP  486

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
            + FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDG LP
Sbjct  487  QKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGNLP  546

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPPSDLPKC
Sbjct  547  NQKLLPPPSDLPKC  560



>gb|KDO73032.1| hypothetical protein CISIN_1g008109mg [Citrus sinensis]
Length=577

 Score =   397 bits (1020),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 208/254 (82%), Positives = 227/254 (89%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+FKPILP LNDT+F +NF  KLRSL S  +PA VPQ VDK FFFTVGLGT+PC +N
Sbjct  325  KKLPLFKPILPPLNDTNFVTNFVNKLRSLGSAQFPANVPQNVDKRFFFTVGLGTSPCPRN  384

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T F ASINN+SFV PTTALLQAHF+GQSN VY P+FP SPL  FNYTGNPP
Sbjct  385  QTCQGP-NGTMFEASINNISFVMPTTALLQAHFTGQSNGVYVPDFPTSPLIPFNYTGNPP  443

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVS+GTK++VL FNTSVEL+MQDTSILGAE+HPLHLHG+NFFVVGQGFGNF+  KDP
Sbjct  444  NNTMVSSGTKLVVLPFNTSVELIMQDTSILGAENHPLHLHGYNFFVVGQGFGNFDPNKDP  503

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLK AWLVLDGKLP
Sbjct  504  AKFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKTAWLVLDGKLP  563

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  564  NQKLLPPPADLPKC  577



>ref|XP_006424707.1| hypothetical protein CICLE_v10028090mg [Citrus clementina]
 ref|XP_006488221.1| PREDICTED: laccase-17-like [Citrus sinensis]
 gb|ESR37947.1| hypothetical protein CICLE_v10028090mg [Citrus clementina]
Length=577

 Score =   397 bits (1020),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 208/254 (82%), Positives = 227/254 (89%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+FKPILP LNDT+F +NF  KLRSL S  +PA VPQ VDK FFFTVGLGT+PC +N
Sbjct  325  KKLPLFKPILPPLNDTNFVTNFVNKLRSLGSAQFPANVPQNVDKRFFFTVGLGTSPCPRN  384

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T F ASINN+SFV PTTALLQAHF+GQSN VY P+FP SPL  FNYTGNPP
Sbjct  385  QTCQGP-NGTMFEASINNISFVMPTTALLQAHFTGQSNGVYVPDFPTSPLIPFNYTGNPP  443

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVS+GTK++VL FNTSVEL+MQDTSILGAE+HPLHLHG+NFFVVGQGFGNF+  KDP
Sbjct  444  NNTMVSSGTKLVVLPFNTSVELIMQDTSILGAENHPLHLHGYNFFVVGQGFGNFDPNKDP  503

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLK AWLVLDGKLP
Sbjct  504  AKFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKTAWLVLDGKLP  563

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  564  NQKLLPPPADLPKC  577



>ref|XP_002317504.2| hypothetical protein POPTR_0011s12090g [Populus trichocarpa]
 gb|EEE98116.2| hypothetical protein POPTR_0011s12090g [Populus trichocarpa]
Length=581

 Score =   397 bits (1019),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 210/254 (83%), Positives = 228/254 (90%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP++KP LP LNDTSFA+NFS KLRSL S  +PA VPQ VD+ F FTVGLGTNPC KN
Sbjct  329  KKLPLYKPNLPPLNDTSFATNFSSKLRSLASADFPANVPQKVDRQFVFTVGLGTNPCSKN  388

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T+F+AS+NNVSFV P+TALLQAH  GQS  VYSP F +SPL  FNYTG PP
Sbjct  389  QTCQGP-NGTRFAASVNNVSFVMPSTALLQAHHFGQSRGVYSPYFAISPLIPFNYTGTPP  447

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTK++VL FNTSVEL+MQDTSILGAESHPLHLHGFNFFVVGQGFGNF+ +KDP
Sbjct  448  NNTMVSNGTKLVVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPSKDP  507

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  508  ANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLP  567

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  568  NQKLLPPPADLPKC  581



>ref|XP_007016584.1| Laccase 17 [Theobroma cacao]
 gb|EOY34203.1| Laccase 17 [Theobroma cacao]
Length=577

 Score =   396 bits (1017),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 209/254 (82%), Positives = 227/254 (89%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKPILPALNDTSFA+NF+ KLRSL S  YPA VPQ VDKHFFF VGLGT+PC +N
Sbjct  325  KMLPLFKPILPALNDTSFATNFANKLRSLASAQYPANVPQKVDKHFFFAVGLGTSPCQQN  384

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            +TCQGP N TK +AS+NNVSF  PTTALLQAHF GQSN VY+P+FP +P+  FNYTG  P
Sbjct  385  RTCQGP-NGTKMAASVNNVSFAMPTTALLQAHFLGQSNGVYTPDFPSNPIIPFNYTGTTP  443

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KD 
Sbjct  444  NNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKKDL  503

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP+ERNTVGVP+GGWVAIRFLADNPGVW MHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  504  ANFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWLMHCHLEVHTSWGLKMAWIVLDGKLP  563

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  564  NQKLLPPPADLPKC  577



>ref|XP_002520231.1| laccase, putative [Ricinus communis]
 gb|EEF42143.1| laccase, putative [Ricinus communis]
Length=580

 Score =   395 bits (1016),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 210/253 (83%), Positives = 226/253 (89%), Gaps = 1/253 (0%)
 Frame = +1

Query  4    KLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQ  183
            KL  FKP LP LNDTSFA+ FS +LRSLDS  +PA VPQ VDK FFFTVGLGT+PC KNQ
Sbjct  329  KLQFFKPKLPVLNDTSFATKFSSQLRSLDSAEFPANVPQKVDKQFFFTVGLGTSPCPKNQ  388

Query  184  TCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPN  363
            TCQGP N T F+AS+NNVSF  P  ALLQAHFSGQSN VY+PNFP SPL  FNYTGNPPN
Sbjct  389  TCQGP-NGTMFAASVNNVSFDMPDIALLQAHFSGQSNGVYNPNFPSSPLFPFNYTGNPPN  447

Query  364  NTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPK  543
            NTMVS+GTKV+VL FNTSVEL+MQDTSILGAESHPLHLHGFNFFVVGQGFGNF++ KDP 
Sbjct  448  NTMVSSGTKVVVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDRNKDPT  507

Query  544  NFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPN  723
             FNLVDPVERNTVGVP+GGWVA+RFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLPN
Sbjct  508  KFNLVDPVERNTVGVPSGGWVAVRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLPN  567

Query  724  QKLLPPPSDLPKC  762
            QKLLPPP+DLPKC
Sbjct  568  QKLLPPPADLPKC  580



>ref|XP_008463808.1| PREDICTED: LOW QUALITY PROTEIN: laccase-17-like [Cucumis melo]
Length=578

 Score =   394 bits (1012),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 212/257 (82%), Positives = 229/257 (89%), Gaps = 4/257 (2%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K LP++KP LP+LNDTSF +NF+KKLRSL +  +PA VPQ +DK FFFTVGLGTNPC+  
Sbjct  323  KTLPIYKPNLPSLNDTSFVTNFTKKLRSLANSQFPANVPQKIDKKFFFTVGLGTNPCNNN  382

Query  175  -KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTG  351
             KNQTCQGP N T F+ASINNVSFV P  ALLQ+H+ GQSN VYSP FP SPL  FNYTG
Sbjct  383  KKNQTCQGP-NGTMFAASINNVSFVMPNVALLQSHYKGQSNGVYSPFFPNSPLIPFNYTG  441

Query  352  NPPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqT  531
            NPPNNTMV NGTKV+VL FNTSVEL+MQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  
Sbjct  442  NPPNNTMVGNGTKVVVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPN  501

Query  532  KDPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDG  711
            KDP+NFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDG
Sbjct  502  KDPQNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDG  561

Query  712  KLPNQKLLPPPSDLPKC  762
            KLPNQKLLPPP+DLPKC
Sbjct  562  KLPNQKLLPPPADLPKC  578



>ref|XP_006341211.1| PREDICTED: laccase-17-like [Solanum tuberosum]
Length=568

 Score =   393 bits (1010),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 205/254 (81%), Positives = 227/254 (89%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP+LPALNDT+F +NF+ +LRSL SP +PA VPQ +DK  FFTVGLGT+PCD+N
Sbjct  316  KNLPLFKPLLPALNDTNFVTNFTSRLRSLASPQFPANVPQNIDKRLFFTVGLGTSPCDQN  375

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            +TCQGP N TKFSASINNVSF+ PTTALLQ+HF GQS  VY P+FP SPL+WFNYTGNPP
Sbjct  376  KTCQGP-NGTKFSASINNVSFILPTTALLQSHFFGQSKGVYKPDFPYSPLNWFNYTGNPP  434

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT+V N TK++VL FNTSVELVMQDTSILG ESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  435  NNTLVHNDTKLVVLPFNTSVELVMQDTSILGLESHPLHLHGFNFFVVGQGFGNFDPNKDP  494

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLV +GKLP
Sbjct  495  SNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVQNGKLP  554

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP DLPKC
Sbjct  555  NQKLPPPPMDLPKC  568



>emb|CBI30527.3| unnamed protein product [Vitis vinifera]
Length=586

 Score =   394 bits (1011),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 205/254 (81%), Positives = 225/254 (89%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP FKP LP  NDTSFASNFS+K+RSL S  +PAKVPQ V++ FFFTVGLGTNPC +N
Sbjct  333  KNLPFFKPALPPFNDTSFASNFSRKIRSLASAQFPAKVPQKVERRFFFTVGLGTNPCPRN  392

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKFSASINNVSFV PTTA+LQA+F GQSN VY+ +FP +P+  FNYTGNPP
Sbjct  393  QTCQGPNNRTKFSASINNVSFVLPTTAILQAYFFGQSNGVYTTDFPNNPITPFNYTGNPP  452

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTK +VL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN++  KDP
Sbjct  453  NNTMVSNGTKAVVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPNKDP  512

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKM W+VL+GKLP
Sbjct  513  AKFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMVWIVLEGKLP  572

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLP C
Sbjct  573  NQKLPPPPSDLPTC  586



>gb|KDP44151.1| hypothetical protein JCGZ_05618 [Jatropha curcas]
Length=576

 Score =   393 bits (1010),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 207/254 (81%), Positives = 225/254 (89%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP++KP+LP LNDT+FA NF++KL SL S  YPA VPQ VD+ FFFTVGLGTNPC  N
Sbjct  324  KKLPLYKPVLPPLNDTAFAINFTQKLFSLASKKYPANVPQKVDRQFFFTVGLGTNPCPHN  383

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T F+AS+NNVSF  P TALLQ+HF GQS  VY PNFP+SPL  FNYTGNPP
Sbjct  384  QTCQGP-NGTMFAASVNNVSFTMPNTALLQSHFFGQSKGVYKPNFPISPLIPFNYTGNPP  442

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTK++VL FNTSVEL++QDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  443  NNTMVSNGTKLVVLPFNTSVELILQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDP  502

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  503  AKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLP  562

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP DLPKC
Sbjct  563  NQKLLPPPVDLPKC  576



>ref|XP_008785574.1| PREDICTED: laccase-17-like [Phoenix dactylifera]
Length=584

 Score =   393 bits (1010),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 203/254 (80%), Positives = 228/254 (90%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+FKP LP+LNDT+F +NF+ +LRSL +  +PAKVP+TV++ FFFTVGLGT+PC KN
Sbjct  332  KKLPLFKPSLPSLNDTAFVANFTSRLRSLATAQFPAKVPRTVERQFFFTVGLGTSPCPKN  391

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKF+A+++N+SF  PTTALLQAHF GQS  VYSP+FP SPL  FNYTG+PP
Sbjct  392  QTCQGP-NGTKFAATVSNISFAMPTTALLQAHFFGQSKRVYSPDFPYSPLIPFNYTGSPP  450

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT+VSNGTK+MVL +NT+VELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN+N  KDP
Sbjct  451  NNTLVSNGTKLMVLPYNTTVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYNPAKDP  510

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVPAGGWVAIRF ADNPGVWFMHCHLEVHTSWGLKMAWLVLDG LP
Sbjct  511  ARFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEVHTSWGLKMAWLVLDGSLP  570

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLP+C
Sbjct  571  NQKLPPPPSDLPRC  584



>ref|XP_004148786.1| PREDICTED: laccase-17-like [Cucumis sativus]
 ref|XP_004165834.1| PREDICTED: laccase-17-like [Cucumis sativus]
 gb|KGN64741.1| hypothetical protein Csa_1G085370 [Cucumis sativus]
Length=579

 Score =   393 bits (1010),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 211/257 (82%), Positives = 228/257 (89%), Gaps = 4/257 (2%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K LP++KP LP+LNDTSF +NF+KKLRSL +  +PA VPQ +DK FFFTVGLGTNPC   
Sbjct  324  KTLPIYKPNLPSLNDTSFVTNFTKKLRSLANSQFPANVPQKIDKKFFFTVGLGTNPCSNN  383

Query  175  -KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTG  351
             KNQTCQGP N T F+ASINNVSF+ P  ALLQ+H+ GQSN VYSP FP SPL  FNYTG
Sbjct  384  KKNQTCQGP-NGTMFAASINNVSFIMPNVALLQSHYKGQSNGVYSPFFPNSPLIPFNYTG  442

Query  352  NPPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqT  531
            NPPNNTMV NGTKV+VL FNTSVEL+MQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  
Sbjct  443  NPPNNTMVGNGTKVVVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPN  502

Query  532  KDPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDG  711
            KDP+NFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDG
Sbjct  503  KDPQNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDG  562

Query  712  KLPNQKLLPPPSDLPKC  762
            KLPNQKLLPPP+DLPKC
Sbjct  563  KLPNQKLLPPPADLPKC  579



>ref|XP_002271047.2| PREDICTED: laccase-17 [Vitis vinifera]
Length=611

 Score =   394 bits (1012),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 205/254 (81%), Positives = 225/254 (89%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP FKP LP  NDTSFASNFS+K+RSL S  +PAKVPQ V++ FFFTVGLGTNPC +N
Sbjct  358  KNLPFFKPALPPFNDTSFASNFSRKIRSLASAQFPAKVPQKVERRFFFTVGLGTNPCPRN  417

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKFSASINNVSFV PTTA+LQA+F GQSN VY+ +FP +P+  FNYTGNPP
Sbjct  418  QTCQGPNNRTKFSASINNVSFVLPTTAILQAYFFGQSNGVYTTDFPNNPITPFNYTGNPP  477

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTK +VL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN++  KDP
Sbjct  478  NNTMVSNGTKAVVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPNKDP  537

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKM W+VL+GKLP
Sbjct  538  AKFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMVWIVLEGKLP  597

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLP C
Sbjct  598  NQKLPPPPSDLPTC  611



>ref|XP_006370271.1| hypothetical protein POPTR_0001s41170g [Populus trichocarpa]
 gb|ERP66840.1| hypothetical protein POPTR_0001s41170g [Populus trichocarpa]
Length=581

 Score =   393 bits (1009),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 207/254 (81%), Positives = 226/254 (89%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP +KP LP LNDTSFA+NF+ KLRSL S  +PA VPQ VD+ FFF+V LGTNPC KN
Sbjct  329  KKLPFYKPNLPPLNDTSFATNFTSKLRSLASAEFPANVPQKVDRQFFFSVSLGTNPCSKN  388

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            +TCQGP N T F+AS+NNVSFV PT ALLQAH  GQS  VYSPNFP++PL  FNYTG PP
Sbjct  389  KTCQGP-NGTMFAASVNNVSFVMPTKALLQAHHFGQSKGVYSPNFPINPLIPFNYTGTPP  447

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTK++VL FNTSVEL+MQDTSILGAESHPLHLHGFNFFVVG+GFGNF+  KDP
Sbjct  448  NNTMVSNGTKLVVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGEGFGNFDPKKDP  507

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  508  ANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLP  567

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  568  NQKLLPPPADLPKC  581



>gb|KHN24985.1| Laccase-17 [Glycine soja]
Length=555

 Score =   392 bits (1006),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 206/254 (81%), Positives = 225/254 (89%), Gaps = 5/254 (2%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ KPILPALNDTSFA+ F+ KLRSL S  +PA VPQ VDKHFFFTVGLGT PC +N
Sbjct  307  KTLPLLKPILPALNDTSFATKFTNKLRSLASSQFPANVPQKVDKHFFFTVGLGTTPCPQN  366

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTNATKF+AS+NNVS +QPTTALLQ+HF      VY+P+FP  PL  FNYTG PP
Sbjct  367  QTCQGPTNATKFAASMNNVSSIQPTTALLQSHF-----FVYTPDFPTKPLIPFNYTGTPP  421

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGT V+VL FNTSVELV+QDTSILGAESHPLHLHGFNFFVVGQGFGN++  KDP
Sbjct  422  NNTMVSNGTMVVVLPFNTSVELVVQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPKKDP  481

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
            +NFNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW VLDGKLP
Sbjct  482  ENFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWFVLDGKLP  541

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP+DLPKC
Sbjct  542  NQKLFPPPTDLPKC  555



>ref|XP_008778964.1| PREDICTED: laccase-17-like [Phoenix dactylifera]
Length=584

 Score =   392 bits (1006),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/254 (80%), Positives = 227/254 (89%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+FKP LP+LNDT+F +NF+ +LRSL +  +PAKVP+TV++ FFFTVGLGT+PC KN
Sbjct  332  KKLPLFKPSLPSLNDTAFVANFTSRLRSLATAQFPAKVPRTVERQFFFTVGLGTSPCPKN  391

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKF+A+++N+SF  PTTALLQAHF GQS  VYSP+FP SPL  FNYTG+PP
Sbjct  392  QTCQGP-NGTKFAATVSNISFAMPTTALLQAHFFGQSKRVYSPDFPYSPLIPFNYTGSPP  450

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT+VSNGTK+MVL +NT+VELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN+N  KDP
Sbjct  451  NNTLVSNGTKLMVLPYNTTVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYNPAKDP  510

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVPAGGWVAIRF ADNPGVWFMHCHLEVHTSWGLKMAWLVLDG LP
Sbjct  511  ARFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEVHTSWGLKMAWLVLDGSLP  570

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLP C
Sbjct  571  NQKLPPPPSDLPNC  584



>ref|XP_006363101.1| PREDICTED: laccase-17-like [Solanum tuberosum]
Length=569

 Score =   390 bits (1003),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 205/255 (80%), Positives = 226/255 (89%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP LP+LNDT F +NF+ KLRSL +P +PA VP  VD+H FFT+GLGT+PCD+N
Sbjct  316  KNLPIFKPSLPSLNDTIFVTNFTSKLRSLATPQFPANVPLNVDRHLFFTIGLGTSPCDQN  375

Query  181  QTCQGPTNATKFSASINNVSFVQPTT-ALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            +TCQGP N TKFSASINNVSF+ PTT ALLQ+HF GQS  VY P+FP SPLHWFNYTGNP
Sbjct  376  KTCQGP-NGTKFSASINNVSFILPTTNALLQSHFFGQSKGVYKPDFPYSPLHWFNYTGNP  434

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNT+V+N TK+MVL FNTSVELVMQDTSILG ESHPLHLHGFNFFVVGQGFGN++  KD
Sbjct  435  PNNTLVNNDTKLMVLPFNTSVELVMQDTSILGLESHPLHLHGFNFFVVGQGFGNYDPNKD  494

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P NFNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLV DGKL
Sbjct  495  PSNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVQDGKL  554

Query  718  PNQKLLPPPSDLPKC  762
            PNQKL PPP DLPKC
Sbjct  555  PNQKLPPPPMDLPKC  569



>gb|AES79165.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=580

 Score =   391 bits (1004),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 204/254 (80%), Positives = 224/254 (88%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KK P+FKPILPA NDTSFA+ FS KLRSL S  +PA VP+ +DKHFFFTVG+GTNPC  N
Sbjct  328  KKHPLFKPILPAFNDTSFATKFSNKLRSLASAQFPANVPKKIDKHFFFTVGIGTNPCQSN  387

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQG  N T F AS+NNVSF  PTTALLQ+HF GQ+N +Y+ +FP  PL+ FNYTG PP
Sbjct  388  QTCQG-LNGTMFVASMNNVSFTMPTTALLQSHFFGQNNGIYTTDFPSKPLNPFNYTGTPP  446

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN++  KDP
Sbjct  447  NNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDSNKDP  506

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
            + FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGL MAW+VLDGKLP
Sbjct  507  QKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLSMAWIVLDGKLP  566

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  567  NQKLLPPPADLPKC  580



>ref|XP_006424671.1| hypothetical protein CICLE_v10030166mg [Citrus clementina]
 ref|XP_006488193.1| PREDICTED: laccase-17-like [Citrus sinensis]
 gb|ESR37911.1| hypothetical protein CICLE_v10030166mg [Citrus clementina]
Length=580

 Score =   390 bits (1002),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 203/254 (80%), Positives = 227/254 (89%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP+LPALNDTSFA++F+ KLRSL S  +PA VPQ VD+ FFFTVGLGT+PC  N
Sbjct  328  KNLPLFKPVLPALNDTSFATSFTNKLRSLASTQFPANVPQNVDRRFFFTVGLGTSPCQSN  387

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T F AS+NN+SFV PTTALLQAHF+G+S+ VY+P+FP SPL  FNYTG PP
Sbjct  388  QTCQGP-NGTMFQASVNNISFVMPTTALLQAHFTGKSDGVYTPDFPTSPLIAFNYTGTPP  446

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTK++VL FN+SVEL+MQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  447  NNTMVSNGTKLVVLPFNSSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDP  506

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGK P
Sbjct  507  TKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGKHP  566

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP+DLP+C
Sbjct  567  NQKLPPPPADLPQC  580



>ref|XP_007207546.1| hypothetical protein PRUPE_ppa017421mg [Prunus persica]
 gb|EMJ08745.1| hypothetical protein PRUPE_ppa017421mg [Prunus persica]
Length=581

 Score =   390 bits (1002),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 206/255 (81%), Positives = 230/255 (90%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDK-  177
            KKLP+FKP LPALNDTSFA+ F+ KLRSL++  +PA VPQ VDKHFFFTVGLGTNPC + 
Sbjct  328  KKLPLFKPNLPALNDTSFATKFNDKLRSLNNARFPANVPQKVDKHFFFTVGLGTNPCSQH  387

Query  178  NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            N+TCQGP N T F+ASINN+SF  P TALLQ+HFS QSN VY+P+FP +P+  FNYTG P
Sbjct  388  NRTCQGP-NGTMFAASINNISFAMPNTALLQSHFSSQSNGVYTPDFPTNPIIPFNYTGAP  446

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PN+TMVSNGTK++VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF++ KD
Sbjct  447  PNDTMVSNGTKLVVLQFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDRNKD  506

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P  FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLE+HTSWGLKMAW+VLDGKL
Sbjct  507  PAKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMAWVVLDGKL  566

Query  718  PNQKLLPPPSDLPKC  762
            PNQKLLPPP+DLPKC
Sbjct  567  PNQKLLPPPADLPKC  581



>ref|XP_007016607.1| Laccase 17 [Theobroma cacao]
 gb|EOY34226.1| Laccase 17 [Theobroma cacao]
Length=581

 Score =   390 bits (1001),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 205/254 (81%), Positives = 223/254 (88%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K+L +FK ILPALNDTSFA+NF+ KLRSL S  +PA VPQ VDK FFFT+GLGT+PC  N
Sbjct  329  KELSLFKSILPALNDTSFATNFASKLRSLASARFPANVPQKVDKQFFFTIGLGTSPCQHN  388

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T F+AS+NNVSF  PT ALLQAHF GQSN VY+ +FP  P   FNYTG P 
Sbjct  389  QTCQGP-NGTMFAASVNNVSFAMPTKALLQAHFFGQSNGVYTTDFPSDPTIPFNYTGTPT  447

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTK++VL FNTSVEL+MQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  448  NNTMVSNGTKLVVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDP  507

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
            KNFNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  508  KNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGKLP  567

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP DLPKC
Sbjct  568  NQKLLPPPEDLPKC  581



>ref|XP_003623041.1| Laccase [Medicago truncatula]
 ref|XP_003636576.1| Laccase [Medicago truncatula]
 gb|AES79259.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=581

 Score =   389 bits (1000),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 204/255 (80%), Positives = 227/255 (89%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPC-DK  177
            KKLP+ KPILP LNDTSFA+NF+ KL SL +  +PA VPQ VDKHFFFTVGLGTNPC +K
Sbjct  328  KKLPLLKPILPQLNDTSFATNFTNKLHSLANAQFPANVPQKVDKHFFFTVGLGTNPCQNK  387

Query  178  NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            NQTCQGP N T F+AS+NNVSF+ PTTALLQ HF GQ+N +Y+ +FP  P++ FNYTG P
Sbjct  388  NQTCQGP-NGTMFAASVNNVSFIMPTTALLQTHFFGQNNGIYTTDFPSKPMNPFNYTGTP  446

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMVSNGTKV+VL FNTSVELV+QDTSILG ESHPLHLHGFNFFVVGQGFGNF+   D
Sbjct  447  PNNTMVSNGTKVVVLPFNTSVELVLQDTSILGVESHPLHLHGFNFFVVGQGFGNFDSNSD  506

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P+NFNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLE+HTSWGLKMAW+VLDGKL
Sbjct  507  PQNFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMAWIVLDGKL  566

Query  718  PNQKLLPPPSDLPKC  762
            PNQK+LPPP DLPKC
Sbjct  567  PNQKVLPPPVDLPKC  581



>ref|XP_002300066.1| hypothetical protein POPTR_0001s35740g [Populus trichocarpa]
 gb|EEE84871.1| hypothetical protein POPTR_0001s35740g [Populus trichocarpa]
Length=580

 Score =   389 bits (1000),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 202/254 (80%), Positives = 225/254 (89%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP LP LNDT+FA+NF+ KLRSL S  +PAKVPQ VD  FFFTVGLGTNPC KN
Sbjct  328  KNLPLFKPTLPPLNDTAFAANFTSKLRSLASAQFPAKVPQKVDMRFFFTVGLGTNPCPKN  387

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKF+AS+NNVSF  PTTALLQAHF G+SN VY P+FP++P+  FNYTGNPP
Sbjct  388  QTCQGP-NGTKFAASVNNVSFSLPTTALLQAHFFGKSNGVYIPDFPITPIFPFNYTGNPP  446

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVS GT+++VL FNTSVEL+MQDTSILG ESHPLHLHG+NFFVVGQGFGNF+  KDP
Sbjct  447  NNTMVSTGTRLVVLPFNTSVELIMQDTSILGVESHPLHLHGYNFFVVGQGFGNFDPNKDP  506

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVP+GGW AIRF ADNPGVWFMHCHLEVHTSWGL+MAW+VLDGKLP
Sbjct  507  AKFNLVDPVERNTVGVPSGGWAAIRFQADNPGVWFMHCHLEVHTSWGLEMAWVVLDGKLP  566

Query  721  NQKLLPPPSDLPKC  762
            NQKL+PPP+DLPKC
Sbjct  567  NQKLIPPPADLPKC  580



>ref|XP_011002147.1| PREDICTED: laccase-17-like [Populus euphratica]
Length=581

 Score =   389 bits (1000),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 202/254 (80%), Positives = 229/254 (90%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+FKP LP LNDTSFA+NF++KLRSL +  +PA VPQ +D+ FFFTVGLGT+ C +N
Sbjct  329  KKLPLFKPNLPPLNDTSFATNFTRKLRSLANAQFPANVPQKIDRQFFFTVGLGTHSCPQN  388

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T F+AS+NNVSF  PTTALLQAH  GQS  VY+P+FP++PL  FNYTGNPP
Sbjct  389  QTCQGP-NGTMFAASVNNVSFAMPTTALLQAHHFGQSKGVYTPDFPINPLTPFNYTGNPP  447

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT+VSNGTK++VL FNT+VEL+MQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  448  NNTIVSNGTKLVVLPFNTTVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDP  507

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  508  ANFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGKLP  567

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLP+C
Sbjct  568  NQKLLPPPADLPRC  581



>gb|AAB17193.1| laccase [Liriodendron tulipifera]
Length=586

 Score =   389 bits (1000),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 203/254 (80%), Positives = 224/254 (88%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+F+P LP  NDT+FA+N++++LRSL +  +PA VPQTVD+ FFFTVGLGT PC  N
Sbjct  334  KDLPLFRPSLPGFNDTTFAANYTRRLRSLANAKFPANVPQTVDRRFFFTVGLGTQPCPNN  393

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKFSASINNVS+VQPTTALLQAHF GQSN VYS NFP  P   FNYTG PP
Sbjct  394  QTCQGP-NGTKFSASINNVSYVQPTTALLQAHFFGQSNGVYSTNFPTKPPFPFNYTGTPP  452

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNT+VELV+QDTSI GAESHPLHLHG+NFFV+GQGFGN+N  KDP
Sbjct  453  NNTMVSNGTKVVVLPFNTTVELVLQDTSIQGAESHPLHLHGYNFFVIGQGFGNYNPNKDP  512

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNL+DPVERNTVGVPAGGWVAIRF ADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  513  SNFNLIDPVERNTVGVPAGGWVAIRFQADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLP  572

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLP+C
Sbjct  573  NQKLPPPPSDLPQC  586



>ref|XP_009354528.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
Length=581

 Score =   389 bits (998),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 204/255 (80%), Positives = 229/255 (90%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDK-  177
            K+LP+FKP LPALNDTSFA+ F+ KLRSL++  +PA VPQ VDK+FFFT+GLGTNPC + 
Sbjct  328  KRLPLFKPNLPALNDTSFATKFANKLRSLNTQQFPANVPQKVDKNFFFTIGLGTNPCSQN  387

Query  178  NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            NQTCQGP N T F+ASINN+SF  P TALLQ+HFSGQS+ VYSP+FP +P+  FNYTG P
Sbjct  388  NQTCQGP-NGTMFAASINNISFAMPNTALLQSHFSGQSSGVYSPDFPANPIVPFNYTGTP  446

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PN+TMVSNGTK+MVL FN+ VELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KD
Sbjct  447  PNDTMVSNGTKLMVLPFNSRVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKD  506

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PK FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLE+HTSWGLKM W+VLDGKL
Sbjct  507  PKMFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMGWVVLDGKL  566

Query  718  PNQKLLPPPSDLPKC  762
            PNQKLLPPP+DLPKC
Sbjct  567  PNQKLLPPPADLPKC  581



>gb|KDO73109.1| hypothetical protein CISIN_1g047497mg [Citrus sinensis]
Length=580

 Score =   389 bits (998),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 203/254 (80%), Positives = 226/254 (89%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP+LPALNDTSFA++F+ KLRSL S  +PA VPQ VD+ FFFTVGLGT+PC  N
Sbjct  328  KNLPLFKPVLPALNDTSFATSFTNKLRSLASTQFPANVPQNVDRRFFFTVGLGTSPCQSN  387

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T F AS+NN+SFV PTTALLQAHF+G+S  VY+P+FP SPL  FNYTG PP
Sbjct  388  QTCQGP-NGTMFQASVNNISFVMPTTALLQAHFTGKSYGVYNPDFPTSPLIAFNYTGTPP  446

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTK++VL FN+SVEL+MQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  447  NNTMVSNGTKLVVLPFNSSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDP  506

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGK P
Sbjct  507  TKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGKHP  566

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP+DLP+C
Sbjct  567  NQKLPPPPADLPQC  580



>ref|XP_002299296.1| laccase family protein [Populus trichocarpa]
 gb|EEE84101.1| laccase family protein [Populus trichocarpa]
Length=581

 Score =   389 bits (998),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 202/254 (80%), Positives = 228/254 (90%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K+LP+FKP LP LNDTSFA+ F+ KLRSL +  +PA VPQ VD+ FFFTVGLGT+ C +N
Sbjct  329  KRLPLFKPNLPPLNDTSFATKFTSKLRSLANAQFPANVPQKVDRQFFFTVGLGTHSCPQN  388

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T F+AS+NNVSF  PTTALLQAH  GQSN VY+P+FP++PL  FNYTGNPP
Sbjct  389  QTCQGP-NGTMFAASVNNVSFAMPTTALLQAHHFGQSNGVYTPDFPINPLTPFNYTGNPP  447

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTK++VL FNT+VEL+MQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  448  NNTMVSNGTKLVVLPFNTTVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDP  507

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNL+DP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  508  ANFNLIDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLP  567

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLP+C
Sbjct  568  NQKLLPPPADLPRC  581



>ref|XP_003622947.1| Laccase [Medicago truncatula]
Length=560

 Score =   388 bits (996),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 202/251 (80%), Positives = 222/251 (88%), Gaps = 1/251 (0%)
 Frame = +1

Query  10   PMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTC  189
            P+FKPILPA NDTSFA+ FS KLRSL S  +PA VP+ +DKHFFFTVG+GTNPC  NQTC
Sbjct  311  PLFKPILPAFNDTSFATKFSNKLRSLASAQFPANVPKKIDKHFFFTVGIGTNPCQSNQTC  370

Query  190  QGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNT  369
            QG  N T F AS+NNVSF  PTTALLQ+HF GQ+N +Y+ +FP  PL+ FNYTG PPNNT
Sbjct  371  QG-LNGTMFVASMNNVSFTMPTTALLQSHFFGQNNGIYTTDFPSKPLNPFNYTGTPPNNT  429

Query  370  MVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKNF  549
            MVSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN++  KDP+ F
Sbjct  430  MVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDSNKDPQKF  489

Query  550  NLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQK  729
            NLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGL MAW+VLDGKLPNQK
Sbjct  490  NLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLSMAWIVLDGKLPNQK  549

Query  730  LLPPPSDLPKC  762
            LLPPP+DLPKC
Sbjct  550  LLPPPADLPKC  560



>ref|XP_006341009.1| PREDICTED: laccase-17-like [Solanum tuberosum]
Length=568

 Score =   388 bits (997),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 204/254 (80%), Positives = 225/254 (89%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP+LPALNDT+F +NF+ +LRSL SP + A VPQ VDK  FFTVGLGT+PCD+ 
Sbjct  316  KNLPLFKPLLPALNDTNFVTNFTSRLRSLASPQFLANVPQNVDKRLFFTVGLGTSPCDQI  375

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            +TCQGP N TKFSASINNVSF+ PTTALLQ+HF GQS  VY P+FP SPL+WFNYTGNPP
Sbjct  376  KTCQGP-NGTKFSASINNVSFILPTTALLQSHFFGQSKGVYKPDFPYSPLNWFNYTGNPP  434

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT+V N TK+MVL FNTSVELVMQDTSILG ESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  435  NNTLVHNDTKLMVLPFNTSVELVMQDTSILGLESHPLHLHGFNFFVVGQGFGNFDPNKDP  494

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGL+MAWLV +GKLP
Sbjct  495  SNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLEMAWLVQNGKLP  554

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP DLPKC
Sbjct  555  NQKLPPPPMDLPKC  568



>ref|XP_006400889.1| hypothetical protein EUTSA_v10013109mg [Eutrema salsugineum]
 gb|ESQ42342.1| hypothetical protein EUTSA_v10013109mg [Eutrema salsugineum]
Length=572

 Score =   388 bits (996),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 202/256 (79%), Positives = 225/256 (88%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K LP+F P+LPALNDT+FA+ FS KLRSL+S  +PAKVP  VD+ FFFTVGLGT PC+  
Sbjct  317  KDLPLFTPVLPALNDTNFATKFSNKLRSLNSKKFPAKVPLKVDRKFFFTVGLGTKPCNHK  376

Query  175  KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
             NQTCQGPTN T F+ASI+N+SF  PT ALLQ+H+SGQS+ VYSPN+P  P+  FNYTG 
Sbjct  377  NNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSHGVYSPNYPWDPIVKFNYTGT  436

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNTMVSNGT +MVL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  K
Sbjct  437  PPNNTMVSNGTNLMVLRYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNK  496

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DPKNFNLVDP+ERNTVGVP+GGW AIRFLADNPGVWFMHCHLEVHTSWGL+MAWLVLDG 
Sbjct  497  DPKNFNLVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  556

Query  715  LPNQKLLPPPSDLPKC  762
             PNQKLLPPP+DLPKC
Sbjct  557  KPNQKLLPPPADLPKC  572



>ref|XP_008222577.1| PREDICTED: laccase-17-like [Prunus mume]
Length=581

 Score =   388 bits (997),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 206/255 (81%), Positives = 230/255 (90%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDK-  177
            KKLP+FKP LPALNDTSFA+ F+ KLRSL++  +PA VP+ VDK FFFTVGLGTNPC + 
Sbjct  328  KKLPLFKPNLPALNDTSFATKFNDKLRSLNNAQFPANVPKKVDKRFFFTVGLGTNPCSQH  387

Query  178  NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            NQTCQGP N T F+ASINN+SF  P TALLQ+HFSGQSN VY+P+FP +P+  FNYTG P
Sbjct  388  NQTCQGP-NGTMFAASINNISFAMPNTALLQSHFSGQSNGVYTPDFPTNPIIPFNYTGVP  446

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PN+TMVSNGTK++VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF++ KD
Sbjct  447  PNDTMVSNGTKLVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDRNKD  506

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P  FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLE+HTSWGLKMAW+VLDGKL
Sbjct  507  PAKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMAWVVLDGKL  566

Query  718  PNQKLLPPPSDLPKC  762
            PNQKLLPPP+DLPKC
Sbjct  567  PNQKLLPPPADLPKC  581



>ref|XP_002282823.1| PREDICTED: laccase-17 [Vitis vinifera]
Length=584

 Score =   388 bits (997),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 205/254 (81%), Positives = 224/254 (88%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP LP LNDTSFA+NF+ KLRSL +  +PA VPQ VD+ FFFTVGLGTNPC +N
Sbjct  331  KNLPLFKPTLPPLNDTSFAANFTGKLRSLANTQFPANVPQKVDQRFFFTVGLGTNPCPQN  390

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTN T FSAS+NNVSFV PTTA+LQAHF  QS  VY+ +FP +P+  FNYTG PP
Sbjct  391  QTCQGPTNITMFSASVNNVSFVLPTTAILQAHFFQQSKGVYTTDFPTTPIFPFNYTGTPP  450

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELV+QDTSILG ESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  451  NNTMVSNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHGFNFFVVGQGFGNFDSKKDP  510

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+V+DGKLP
Sbjct  511  PKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVMDGKLP  570

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  571  NQKLPPPPSDLPKC  584



>ref|XP_010922297.1| PREDICTED: laccase-17-like [Elaeis guineensis]
Length=584

 Score =   388 bits (997),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 201/254 (79%), Positives = 222/254 (87%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+F+P LP+LNDT+F +NF+ +LRSL +  +PA VPQ+VD+ FFFTVGLGT+PC KN
Sbjct  332  KKLPLFRPTLPSLNDTAFVANFTSRLRSLATAQFPANVPQSVDRRFFFTVGLGTSPCPKN  391

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKF+A+++N+SF  PTTALLQAHF GQS  VYSP+FP SPL  FNYTG PP
Sbjct  392  QTCQGP-NGTKFAATVSNISFTMPTTALLQAHFFGQSRGVYSPDFPYSPLIPFNYTGTPP  450

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGTK+MVL FN +VELVMQDTSILGAESHPLHLHGFNFFVVGQG GN+N  KDP
Sbjct  451  NNTAVSNGTKLMVLPFNATVELVMQDTSILGAESHPLHLHGFNFFVVGQGSGNYNPAKDP  510

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP ERNTVGVPAGGWVAIRF ADNPGVWFMHCHLEVHTSWGLKMAWLVLDG LP
Sbjct  511  ANFNLVDPAERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEVHTSWGLKMAWLVLDGSLP  570

Query  721  NQKLLPPPSDLPKC  762
            NQKL  PPSDLPKC
Sbjct  571  NQKLPRPPSDLPKC  584



>gb|AAB17192.1| laccase [Liriodendron tulipifera]
Length=585

 Score =   388 bits (997),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 204/254 (80%), Positives = 226/254 (89%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K+LP+F+P LP+LNDT+FA+N++K+LRSL +  +PA VPQT++K FFFTVGLG+ PC KN
Sbjct  333  KQLPLFRPSLPSLNDTAFAANYTKRLRSLANAQFPANVPQTINKSFFFTVGLGSEPCPKN  392

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKF+AS+NNVSFV PTTALLQ HF GQSN VY+ NFP +P   FNYTG PP
Sbjct  393  QTCQGP-NGTKFAASVNNVSFVMPTTALLQGHFFGQSNGVYTANFPTNPQFPFNYTGTPP  451

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FN SVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN+N  KDP
Sbjct  452  NNTMVSNGTKVVVLPFNASVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYNPNKDP  511

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNTVGVP+G WVAIRF ADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  512  SNFNLVDPVERNTVGVPSGSWVAIRFQADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLP  571

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  572  NQKLPPPPSDLPKC  585



>ref|XP_008358843.1| PREDICTED: laccase-17-like [Malus domestica]
Length=580

 Score =   388 bits (996),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 202/255 (79%), Positives = 228/255 (89%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDK-  177
            K+LP+ KP LPALNDTSFA+ F+ KLRSL++P +PA VPQ VDKHFFFT+GLGTNPC + 
Sbjct  327  KRLPLLKPNLPALNDTSFATKFANKLRSLNTPQFPANVPQKVDKHFFFTIGLGTNPCSQN  386

Query  178  NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            NQ CQGP N T F+AS+NN+SF  P TALLQ+HFSGQS+ VY+P+FP +P+  FNYTG P
Sbjct  387  NQRCQGP-NGTMFAASVNNISFAMPNTALLQSHFSGQSSGVYTPDFPTNPITPFNYTGPP  445

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PN+TMVSNGTK+MVL FN+ VELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KD
Sbjct  446  PNDTMVSNGTKLMVLPFNSRVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKD  505

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PK FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLE+HTSWGLKM W+VLDGKL
Sbjct  506  PKKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMGWVVLDGKL  565

Query  718  PNQKLLPPPSDLPKC  762
            PNQKLLPPP+DLPKC
Sbjct  566  PNQKLLPPPADLPKC  580



>ref|XP_009354571.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
Length=545

 Score =   387 bits (993),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 203/255 (80%), Positives = 228/255 (89%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD-K  177
            K+LP+FKP LPALNDTSFA+ F  KLRSL++  +PA VPQ VDK+FFFT+GLGTNPC   
Sbjct  292  KRLPLFKPKLPALNDTSFATKFGNKLRSLNTQQFPANVPQKVDKNFFFTIGLGTNPCSPN  351

Query  178  NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            NQTCQGP N T F+ASINN+SF  P TALLQ+HFSGQS+ VYSP+FP +P+  FNYTG P
Sbjct  352  NQTCQGP-NGTMFAASINNISFAMPNTALLQSHFSGQSSGVYSPDFPANPIVPFNYTGTP  410

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PN+TMVSNGTK++VL FN+ VELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF++ KD
Sbjct  411  PNDTMVSNGTKLVVLPFNSRVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDRNKD  470

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PK FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLE+HTSWGLKM W+VLDGKL
Sbjct  471  PKMFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMGWVVLDGKL  530

Query  718  PNQKLLPPPSDLPKC  762
            PNQKLLPPP+DLPKC
Sbjct  531  PNQKLLPPPADLPKC  545



>ref|XP_010256874.1| PREDICTED: laccase-17-like [Nelumbo nucifera]
Length=583

 Score =   387 bits (994),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 204/254 (80%), Positives = 225/254 (89%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKL +FKP+LP LNDTSF +NF+ +LRSL +  +PA VPQTVDK FFFTVGLGT+PC +N
Sbjct  331  KKLQLFKPVLPVLNDTSFVANFTNRLRSLATAEFPANVPQTVDKQFFFTVGLGTSPCPQN  390

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKFSAS+NNVSF  PTTALLQAHF GQ+N VY+ +FP +P   FNYTG PP
Sbjct  391  QTCQGP-NGTKFSASVNNVSFAMPTTALLQAHFLGQANGVYTTDFPTNPPLHFNYTGTPP  449

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT+V+NGTKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  450  NNTLVTNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDP  509

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNTVGVP+GGWVAIRF ADNPGVWFMHCHLEVHTSWGLKMAW+V+DGKLP
Sbjct  510  ANFNLVDPVERNTVGVPSGGWVAIRFFADNPGVWFMHCHLEVHTSWGLKMAWVVMDGKLP  569

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP DLPKC
Sbjct  570  NQKLPPPPFDLPKC  583



>ref|XP_010455850.1| PREDICTED: laccase-17-like [Camelina sativa]
Length=577

 Score =   387 bits (993),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 202/256 (79%), Positives = 226/256 (88%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K LP+FKP LPALNDT+FA+ FS KLRSL+S ++PA VP  VD+ FFFTVGLGTNPC+  
Sbjct  322  KNLPLFKPTLPALNDTNFATKFSNKLRSLNSKNFPANVPLNVDRKFFFTVGLGTNPCNHK  381

Query  175  KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
             NQTCQGPTN T F+ASI+N+SF  PT ALLQ+H+SGQS+ VYSP FP SP+  FNYTG 
Sbjct  382  NNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSHGVYSPKFPWSPIVPFNYTGT  441

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNTMVSNGT +MVL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  K
Sbjct  442  PPNNTMVSNGTNLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDANK  501

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DPKNFNLVDP+ERNT+GVP+GGW AIRFLADNPGVWFMHCHLEVHTSWGL+MAWLVLDG 
Sbjct  502  DPKNFNLVDPIERNTIGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  561

Query  715  LPNQKLLPPPSDLPKC  762
             P+QKLLPPP+DLPKC
Sbjct  562  KPDQKLLPPPADLPKC  577



>ref|XP_009419259.1| PREDICTED: laccase-4-like [Musa acuminata subsp. malaccensis]
Length=581

 Score =   386 bits (991),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 201/254 (79%), Positives = 221/254 (87%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ KP LPA NDTSFA+NF+ +LRSL +  +PA VPQTVD+ F FTVGLGT+PC KN
Sbjct  329  KNLPLHKPTLPAFNDTSFAANFTGRLRSLATTRFPANVPQTVDRRFLFTVGLGTSPCPKN  388

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKFSA++NN+SF  PTTALLQAHF GQS +VYSP+FPV PL  FNYTG PP
Sbjct  389  QTCQGP-NGTKFSATVNNISFASPTTALLQAHFFGQSRNVYSPDFPVVPLMPFNYTGTPP  447

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTK++VL FNTSVELVMQDTSILG ESHPLHLHG+NFFVVGQGFGN++   DP
Sbjct  448  NNTMVSNGTKLVVLPFNTSVELVMQDTSILGTESHPLHLHGYNFFVVGQGFGNYDPANDP  507

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDP ERNTVGVPAGGWVAIRFLADNPGVWFMHCH+E H SWGLKMAWLVLDG+LP
Sbjct  508  AKFNLVDPAERNTVGVPAGGWVAIRFLADNPGVWFMHCHIEAHMSWGLKMAWLVLDGELP  567

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  568  NQKLPPPPSDLPKC  581



>emb|CDY09232.1| BnaA02g06580D [Brassica napus]
Length=572

 Score =   385 bits (990),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 201/256 (79%), Positives = 225/256 (88%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K LP+F P+LPALNDT+FA+ FS KLRSL+S  +PA VPQ VD+ FFFTVGLGTNPC+  
Sbjct  317  KNLPLFTPVLPALNDTNFATKFSNKLRSLNSKKFPANVPQEVDRKFFFTVGLGTNPCNHK  376

Query  175  KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
             NQTCQGPTN T F+ASI+N+SF  PT ALLQ+H+SG+SN VYSPNFP SP+  FNYTG 
Sbjct  377  NNQTCQGPTNTTMFAASISNISFTLPTKALLQSHYSGRSNGVYSPNFPWSPIVPFNYTGT  436

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNTMVS GT +MVL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  K
Sbjct  437  PPNNTMVSTGTNLMVLRYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNK  496

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DPK FNLVDP+ERNTVGVP+GGW AIRFLADNPGVWFMHCHLEVHTSWGL+MAWLVLDG 
Sbjct  497  DPKKFNLVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  556

Query  715  LPNQKLLPPPSDLPKC  762
             P+QKL+PPP+DLPKC
Sbjct  557  KPDQKLIPPPADLPKC  572



>ref|XP_002864664.1| hypothetical protein ARALYDRAFT_496140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40923.1| hypothetical protein ARALYDRAFT_496140 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score =   385 bits (990),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/256 (78%), Positives = 227/256 (89%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K L +FKPILPALNDT+FA+ FS KLRSL+S ++PA VP  +D+ FFFTVGLGTNPC+  
Sbjct  322  KNLQLFKPILPALNDTNFATKFSNKLRSLNSKNFPANVPLNIDRKFFFTVGLGTNPCNHK  381

Query  175  KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
             NQTCQGPTN T F+ASI+N+SF+ PT ALLQ+H+SGQS+ VYSP FP SP+  FNYTG 
Sbjct  382  NNQTCQGPTNTTMFAASISNISFIMPTKALLQSHYSGQSHGVYSPKFPWSPIVPFNYTGT  441

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNTM+SNGT +MVL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  K
Sbjct  442  PPNNTMISNGTNLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNK  501

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DPKNFNLVDP+ERNT+GVP+GGW AIRFLADNPGVWFMHCHLEVHTSWGL+MAWLVLDG 
Sbjct  502  DPKNFNLVDPIERNTIGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  561

Query  715  LPNQKLLPPPSDLPKC  762
             P+QKLLPPP+DLPKC
Sbjct  562  KPDQKLLPPPADLPKC  577



>ref|XP_010920538.1| PREDICTED: laccase-4-like [Elaeis guineensis]
Length=584

 Score =   386 bits (991),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 202/254 (80%), Positives = 223/254 (88%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+FKP LP+LNDT F ++F++KLRSL +  YPAKVPQT+D+ FFFTVGLGT+PC KN
Sbjct  332  KKLPLFKPSLPSLNDTKFVADFTRKLRSLATTQYPAKVPQTIDRRFFFTVGLGTSPCPKN  391

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKF+A++NNVSF  PTTALLQAHF GQS  VY+P+FP+ PL   NYTG PP
Sbjct  392  QTCQGP-NGTKFAATVNNVSFSMPTTALLQAHFFGQSKGVYTPDFPIIPLMPLNYTGAPP  450

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT+VSNGT+++VL FNTSVELVMQDTSILG ESHPLHLHGFNFFVVGQGFGN +  KDP
Sbjct  451  NNTLVSNGTRLVVLPFNTSVELVMQDTSILGNESHPLHLHGFNFFVVGQGFGNHDPEKDP  510

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTV VP GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDG LP
Sbjct  511  AKFNLVDPVERNTVSVPPGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGNLP  570

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  571  NQKLPPPPSDLPKC  584



>gb|AAB17194.1| laccase [Liriodendron tulipifera]
Length=585

 Score =   385 bits (990),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 204/254 (80%), Positives = 223/254 (88%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+F+P LP LNDT+FA+N++++LRSL +  +PA VPQTVD+ FFFTVGLGT PC KN
Sbjct  333  KNLPLFRPSLPGLNDTAFAANYTRRLRSLANAQFPANVPQTVDRRFFFTVGLGTQPCPKN  392

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKF+AS+NNVSFV PTTALLQ HF GQSN VY+ NFP +P   FNYTG PP
Sbjct  393  QTCQGP-NGTKFAASVNNVSFVLPTTALLQTHFFGQSNGVYTTNFPTNPPFPFNYTGTPP  451

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELVMQDTSI GAESHPLHLHGFNFFVVGQGFGN+N  KDP
Sbjct  452  NNTMVSNGTKVVVLPFNTSVELVMQDTSIQGAESHPLHLHGFNFFVVGQGFGNYNPNKDP  511

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNL+DPVERNTVGVPAGGWVAIRF  DNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  512  SNFNLIDPVERNTVGVPAGGWVAIRFQTDNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLP  571

Query  721  NQKLLPPPSDLPKC  762
            NQKL  PPSDLPKC
Sbjct  572  NQKLPSPPSDLPKC  585



>ref|XP_010443793.1| PREDICTED: laccase-17 [Camelina sativa]
Length=611

 Score =   386 bits (992),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 202/256 (79%), Positives = 226/256 (88%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K LP+FKP LPALNDT+FA+ FS KLRSL+S ++PA VP  VD+ FFFTVGLGTNPC+  
Sbjct  356  KNLPLFKPTLPALNDTNFATKFSNKLRSLNSKNFPANVPLNVDRKFFFTVGLGTNPCNHK  415

Query  175  KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
             NQTCQGPTN T F+ASI+N+SF  PT ALLQ+H+SGQS+ VYSP FP SP+  FNYTG 
Sbjct  416  NNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSHGVYSPKFPWSPIVPFNYTGT  475

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNTMVSNGT +MVL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  K
Sbjct  476  PPNNTMVSNGTNLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNK  535

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DPKNFNLVDP+ERNT+GVP+GGW AIRFLADNPGVWFMHCHLEVHTSWGL+MAWLVLDG 
Sbjct  536  DPKNFNLVDPIERNTIGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  595

Query  715  LPNQKLLPPPSDLPKC  762
             P+QKLLPPP+DLPKC
Sbjct  596  KPDQKLLPPPADLPKC  611



>ref|NP_200810.1| laccase 17 [Arabidopsis thaliana]
 sp|Q9FJD5.1|LAC17_ARATH RecName: Full=Laccase-17; AltName: Full=Benzenediol:oxygen oxidoreductase 
17; AltName: Full=Diphenol oxidase 17; AltName: 
Full=Urishiol oxidase 17; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB08370.1| laccase (diphenol oxidase) [Arabidopsis thaliana]
 gb|AAU05482.1| At5g60020 [Arabidopsis thaliana]
 gb|AAU95426.1| At5g60020 [Arabidopsis thaliana]
 gb|AED97267.1| laccase 17 [Arabidopsis thaliana]
Length=577

 Score =   385 bits (989),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 202/256 (79%), Positives = 226/256 (88%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K L +FKPILPALNDT+FA+ FS KLRSL+S ++PA VP  VD+ FFFTVGLGTNPC+  
Sbjct  322  KNLQLFKPILPALNDTNFATKFSNKLRSLNSKNFPANVPLNVDRKFFFTVGLGTNPCNHK  381

Query  175  KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
             NQTCQGPTN T F+ASI+N+SF  PT ALLQ+H+SGQS+ VYSP FP SP+  FNYTG 
Sbjct  382  NNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSHGVYSPKFPWSPIVPFNYTGT  441

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNTMVSNGT +MVL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  K
Sbjct  442  PPNNTMVSNGTNLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNK  501

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DP+NFNLVDP+ERNTVGVP+GGW AIRFLADNPGVWFMHCHLEVHTSWGL+MAWLVLDG 
Sbjct  502  DPRNFNLVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  561

Query  715  LPNQKLLPPPSDLPKC  762
             P+QKLLPPP+DLPKC
Sbjct  562  KPDQKLLPPPADLPKC  577



>ref|XP_002278215.1| PREDICTED: laccase-17 [Vitis vinifera]
Length=584

 Score =   385 bits (989),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 202/254 (80%), Positives = 223/254 (88%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP LP LNDTSFA+NF+ KLRSL +  +PA VPQ VDK FFFTVGLGTNPC +N
Sbjct  331  KNLPLFKPTLPPLNDTSFAANFTHKLRSLANSQFPANVPQKVDKRFFFTVGLGTNPCPQN  390

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N+TKFSAS+NNVSFV PTTA+LQAHF  QSN VY+ +FP +P+  FNYTG PP
Sbjct  391  QTCQGPNNSTKFSASVNNVSFVLPTTAILQAHFFQQSNGVYTTDFPATPIFPFNYTGTPP  450

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMV+NGTKV+VL FNTSVELV+QDTSILG ESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  451  NNTMVNNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHGFNFFVVGQGFGNFDSKKDP  510

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCH EVH SWGLKM W+V+DGKLP
Sbjct  511  PKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHFEVHMSWGLKMVWMVMDGKLP  570

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLP+C
Sbjct  571  NQKLPPPPSDLPQC  584



>ref|XP_004294637.1| PREDICTED: laccase-17-like [Fragaria vesca subsp. vesca]
Length=584

 Score =   385 bits (989),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 209/258 (81%), Positives = 225/258 (87%), Gaps = 5/258 (2%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDK-  177
            KKLP+ KPILPALNDTSF + F  KLRSL++P +PA VPQ VDKH FFTVGLG+NPC + 
Sbjct  328  KKLPLHKPILPALNDTSFVTKFVSKLRSLNTPQFPANVPQKVDKHLFFTVGLGSNPCSQQ  387

Query  178  ---NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYT  348
               NQTCQGP N T F+ASINNVSF  PTTALLQ+HFSGQS  VYS +FP+SPL  FNYT
Sbjct  388  QNSNQTCQGP-NGTMFAASINNVSFTMPTTALLQSHFSGQSKGVYSSDFPISPLTPFNYT  446

Query  349  GNPPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnq  528
            G P NNT V NGTK+MVL FNTSVELV+Q TSILGAESHPLHLHGFNFFVVGQGFGNF+Q
Sbjct  447  GPPLNNTNVGNGTKLMVLPFNTSVELVLQGTSILGAESHPLHLHGFNFFVVGQGFGNFDQ  506

Query  529  TKDPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLD  708
             KDPK FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLD
Sbjct  507  NKDPKKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLD  566

Query  709  GKLPNQKLLPPPSDLPKC  762
            GKLPNQKLLPPPSDLP C
Sbjct  567  GKLPNQKLLPPPSDLPTC  584



>ref|XP_002282815.1| PREDICTED: laccase-17 [Vitis vinifera]
Length=584

 Score =   385 bits (989),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 202/254 (80%), Positives = 223/254 (88%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            + LP+FKP LP LNDTSFA+NF++KLRSL +  +PA VPQ VDK FFFTVGLGTNPC +N
Sbjct  331  ENLPLFKPTLPPLNDTSFAANFTRKLRSLANTQFPANVPQKVDKRFFFTVGLGTNPCPQN  390

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N+T FSAS+NNVSFV PTTA+LQAHF  QSN VY+ +FP +P+  FNYTG PP
Sbjct  391  QTCQGPNNSTMFSASVNNVSFVLPTTAILQAHFFQQSNGVYTTDFPATPIFPFNYTGTPP  450

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELV+QDTSILG ESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  451  NNTMVSNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHGFNFFVVGQGFGNFDAKKDP  510

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVP+GGWVAIRFLADNPGVW MHCHLEVHTSWGLKM W+V DGK+P
Sbjct  511  SKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHLEVHTSWGLKMGWIVKDGKMP  570

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  571  NQKLPPPPSDLPKC  584



>ref|XP_008385213.1| PREDICTED: laccase-17-like [Malus domestica]
Length=581

 Score =   385 bits (988),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 202/255 (79%), Positives = 228/255 (89%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDK-  177
            K+ P+FKP LPALNDTSFA+ F+ KLRSL++  +PA VPQ VDKHFFFT+GLGTNPC + 
Sbjct  328  KRHPLFKPNLPALNDTSFATKFANKLRSLNTQQFPANVPQKVDKHFFFTIGLGTNPCSQN  387

Query  178  NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            NQTCQGP N T F+ASINN+SF  P TALLQ+HFSGQS+ VYSP+FP +P+  FNYTG P
Sbjct  388  NQTCQGP-NGTMFAASINNISFAMPNTALLQSHFSGQSSGVYSPDFPANPIVPFNYTGTP  446

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PN+TMVSNGTK++VL FN+ VELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF++ KD
Sbjct  447  PNDTMVSNGTKLVVLPFNSRVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDRNKD  506

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PK FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLE+HTSWGLKM W+VLDG L
Sbjct  507  PKMFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMGWVVLDGXL  566

Query  718  PNQKLLPPPSDLPKC  762
            PNQKLLPPP+DLPKC
Sbjct  567  PNQKLLPPPADLPKC  581



>ref|XP_009416147.1| PREDICTED: laccase-4-like [Musa acuminata subsp. malaccensis]
Length=582

 Score =   384 bits (987),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 202/253 (80%), Positives = 222/253 (88%), Gaps = 1/253 (0%)
 Frame = +1

Query  4    KLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQ  183
            KLP++KP LP+LNDTSF +NF+ KLRSL +  +PA VPQ VD+  FFTVGLG++PC +NQ
Sbjct  331  KLPLYKPTLPSLNDTSFFANFTGKLRSLATARFPANVPQAVDRRVFFTVGLGSSPCPENQ  390

Query  184  TCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPN  363
             CQGP N TKFSA++NNVSF  PTTALLQAHF GQS  VY P+FPV+PL  FNYTG PPN
Sbjct  391  MCQGP-NGTKFSATVNNVSFALPTTALLQAHFLGQSRGVYMPDFPVTPLMPFNYTGTPPN  449

Query  364  NTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPK  543
            NT+V NGTK+MVL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN++  KDP 
Sbjct  450  NTLVGNGTKLMVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPAKDPT  509

Query  544  NFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPN  723
             FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDG LP+
Sbjct  510  KFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGSLPH  569

Query  724  QKLLPPPSDLPKC  762
            QKL PPPSDLPKC
Sbjct  570  QKLPPPPSDLPKC  582



>emb|CDY31581.1| BnaA10g12900D [Brassica napus]
Length=573

 Score =   384 bits (986),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 202/256 (79%), Positives = 223/256 (87%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K LP+F P+LPALNDT+FA+ FS KLRSL+S  +PA VP  VD+ FFFTVGLGT PC+  
Sbjct  318  KNLPLFAPVLPALNDTNFAAKFSNKLRSLNSKRFPANVPLKVDRKFFFTVGLGTTPCNHK  377

Query  175  KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
             NQTCQGPTN T F+ASI+N+SF  PT ALLQ+H+SGQSN VYSPNFP +P+  FNYTG 
Sbjct  378  NNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSNGVYSPNFPWNPVVPFNYTGT  437

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNTMV  GT VMVL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  K
Sbjct  438  PPNNTMVRTGTNVMVLRYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKK  497

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DPKNFNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGL+MAWLVLDG 
Sbjct  498  DPKNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  557

Query  715  LPNQKLLPPPSDLPKC  762
             P+QKLLPPP DLPKC
Sbjct  558  KPDQKLLPPPVDLPKC  573



>emb|CAN60069.1| hypothetical protein VITISV_012401 [Vitis vinifera]
Length=573

 Score =   384 bits (986),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 201/254 (79%), Positives = 225/254 (89%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP LP LNDTSFA+NF++KLRSL +  +PA VP+ VDK FFFTVGLGT+PC +N
Sbjct  320  KNLPVFKPTLPPLNDTSFAANFTRKLRSLANSQFPANVPKKVDKRFFFTVGLGTSPCPQN  379

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N+TKFSAS+NNVSFV PTTA+LQAHF  QSN VY+ +FP +P+  FNYTG PP
Sbjct  380  QTCQGPNNSTKFSASVNNVSFVLPTTAILQAHFFQQSNGVYTTDFPATPIFPFNYTGTPP  439

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTM SNGTKV+VL FNT+VELV+QDTSILG ESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  440  NNTMASNGTKVVVLPFNTTVELVLQDTSILGIESHPLHLHGFNFFVVGQGFGNFDSKKDP  499

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVP+GGWVAIRF+ADNPGVWFMHCHLEVHTSWGLKMAW+V DGKLP
Sbjct  500  PKFNLVDPVERNTVGVPSGGWVAIRFVADNPGVWFMHCHLEVHTSWGLKMAWIVKDGKLP  559

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLP+C
Sbjct  560  NQKLPPPPSDLPQC  573



>ref|XP_009120521.1| PREDICTED: laccase-17-like [Brassica rapa]
Length=573

 Score =   384 bits (986),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 202/256 (79%), Positives = 223/256 (87%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K LP+F P+LPALNDT+FA+ FS KLRSL+S  +PA VP  VD+ FFFTVGLGT PC+  
Sbjct  318  KNLPLFAPVLPALNDTNFAAKFSNKLRSLNSKRFPANVPLKVDRKFFFTVGLGTTPCNHK  377

Query  175  KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
             NQTCQGPTN T F+ASI+N+SF  PT ALLQ+H+SGQSN VYSPNFP +P+  FNYTG 
Sbjct  378  NNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSNGVYSPNFPWNPVVPFNYTGT  437

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNTMV  GT VMVL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  K
Sbjct  438  PPNNTMVRTGTNVMVLRYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKK  497

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DPKNFNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGL+MAWLVLDG 
Sbjct  498  DPKNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  557

Query  715  LPNQKLLPPPSDLPKC  762
             P+QKLLPPP DLPKC
Sbjct  558  KPDQKLLPPPVDLPKC  573



>ref|XP_002278232.1| PREDICTED: laccase-17-like [Vitis vinifera]
Length=583

 Score =   384 bits (987),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 201/254 (79%), Positives = 225/254 (89%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP LP LNDTSFA+NF++KLRSL +  +PA VP+ VDK FFFTVGLGT+PC +N
Sbjct  330  KNLPVFKPTLPPLNDTSFAANFTRKLRSLANSQFPANVPKKVDKRFFFTVGLGTSPCPQN  389

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N+TKFSAS+NNVSFV PTTA+LQAHF  QSN VY+ +FP +P+  FNYTG PP
Sbjct  390  QTCQGPNNSTKFSASVNNVSFVLPTTAILQAHFFQQSNGVYTTDFPATPIFPFNYTGTPP  449

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTM SNGTKV+VL FNT+VELV+QDTSILG ESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  450  NNTMASNGTKVVVLPFNTTVELVLQDTSILGIESHPLHLHGFNFFVVGQGFGNFDSKKDP  509

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVP+GGWVAIRF+ADNPGVWFMHCHLEVHTSWGLKMAW+V DGKLP
Sbjct  510  PKFNLVDPVERNTVGVPSGGWVAIRFVADNPGVWFMHCHLEVHTSWGLKMAWIVKDGKLP  569

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLP+C
Sbjct  570  NQKLPPPPSDLPQC  583



>ref|XP_010535559.1| PREDICTED: laccase-17 [Tarenaya hassleriana]
Length=580

 Score =   384 bits (986),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 204/255 (80%), Positives = 223/255 (87%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD-K  177
            K LP+FKP+LPALNDT+FA+ F  +LRSLDS  YPA VP+ VD+ FFFTVGLGTNPC  K
Sbjct  327  KNLPLFKPVLPALNDTNFATKFVNQLRSLDSKKYPANVPKEVDQKFFFTVGLGTNPCSTK  386

Query  178  NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            NQTCQGP N T F+ASINN+SF  PT ALLQ+H+ G+SN VY  +FP  PL  FNYTGNP
Sbjct  387  NQTCQGP-NGTMFAASINNISFTMPTAALLQSHYFGRSNGVYRTDFPFDPLFPFNYTGNP  445

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMVSNGTK++VL FNTSVELVMQDTSILG ESHPLHLHGFNFFVVGQGFGNFN  KD
Sbjct  446  PNNTMVSNGTKLLVLPFNTSVELVMQDTSILGLESHPLHLHGFNFFVVGQGFGNFNPKKD  505

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PKNFN+VDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDG  
Sbjct  506  PKNFNVVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGDK  565

Query  718  PNQKLLPPPSDLPKC  762
             NQKLLPPP+DLPKC
Sbjct  566  SNQKLLPPPADLPKC  580



>ref|XP_010043648.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
Length=585

 Score =   384 bits (986),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 202/254 (80%), Positives = 223/254 (88%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K+LP+FKP LP LNDT+FA+NF+ KLRSL +  +PA VPQ VD+ FFFTVGLGTNPC  N
Sbjct  333  KQLPLFKPTLPPLNDTAFATNFTNKLRSLATAQFPANVPQKVDQRFFFTVGLGTNPCQGN  392

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T F+A++NNVSF  PTTALLQAH++GQSN VYSP+FP  P   FN+TG PP
Sbjct  393  QTCQGP-NGTMFTAAVNNVSFTLPTTALLQAHYTGQSNGVYSPDFPNYPKTIFNFTGTPP  451

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V NGTK++VL FN SVEL+MQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  452  NNTNVGNGTKLVVLPFNASVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDP  511

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP
Sbjct  512  AKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  571

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  572  NQKLLPPPADLPKC  585



>ref|XP_009131958.1| PREDICTED: laccase-17 [Brassica rapa]
Length=573

 Score =   383 bits (984),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 201/256 (79%), Positives = 224/256 (88%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K L +F P+LPALNDT+FA+ FS KLRSL+S  +PA VP  VD+ FFFTVGLGTNPC+  
Sbjct  318  KNLQLFTPVLPALNDTNFATKFSNKLRSLNSKKFPANVPLKVDRKFFFTVGLGTNPCNHK  377

Query  175  KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
             NQTCQGPTN T F+ASI+N+SF  PT ALLQ+H+SGQSN VYSPNFP SP+  FNYTG 
Sbjct  378  NNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSNGVYSPNFPWSPIVPFNYTGT  437

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNTMVS GT +MVL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  +
Sbjct  438  PPNNTMVSTGTNLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDAKE  497

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DPKNFNLVDP+ERNTVGVP+GGW AIRFLADNPGVWFMHCHLEVHTSWGL+MAWLVLDG 
Sbjct  498  DPKNFNLVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  557

Query  715  LPNQKLLPPPSDLPKC  762
             P+QKLLPPP+DLPKC
Sbjct  558  KPDQKLLPPPADLPKC  573



>ref|XP_010541371.1| PREDICTED: laccase-17-like [Tarenaya hassleriana]
Length=582

 Score =   384 bits (985),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 202/255 (79%), Positives = 226/255 (89%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD-K  177
            K L + KP+LPALNDT+FA+ F+ KLRSL+S  +PA VP  VD+ FFFTVGLGT PC+ K
Sbjct  329  KNLQLLKPVLPALNDTNFATTFTNKLRSLNSKRFPANVPTEVDQKFFFTVGLGTKPCNQK  388

Query  178  NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            NQTCQGP N T F+AS+NN+SF+ PTTALLQ+H+SGQS+ VYSP FP  PL  FNYTGNP
Sbjct  389  NQTCQGP-NGTMFAASVNNISFIMPTTALLQSHYSGQSHGVYSPYFPHDPLIPFNYTGNP  447

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMV NGTK++VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  +D
Sbjct  448  PNNTMVGNGTKLLVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNED  507

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PKNFNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDG  
Sbjct  508  PKNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGDK  567

Query  718  PNQKLLPPPSDLPKC  762
            P+QKLLPPP+DLPKC
Sbjct  568  PDQKLLPPPADLPKC  582



>ref|XP_006370270.1| hypothetical protein POPTR_0001s41160g [Populus trichocarpa]
 gb|ERP66839.1| hypothetical protein POPTR_0001s41160g [Populus trichocarpa]
Length=581

 Score =   384 bits (985),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 200/254 (79%), Positives = 225/254 (89%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K+LP++KP LP LNDTSFA+NF+ KLRSL S  +PA VPQ VD+HFFFTVGLGTNPC KN
Sbjct  329  KRLPLYKPNLPPLNDTSFATNFTSKLRSLASAEFPANVPQKVDRHFFFTVGLGTNPCSKN  388

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T+F+AS+NNVSFV PT ALL+AH  GQS  VYSPNFP+SPL  F+YTG P 
Sbjct  389  QTCQGP-NGTRFAASVNNVSFVMPTKALLEAHHFGQSKGVYSPNFPISPLIPFDYTGTPQ  447

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVS+GTK+++L FNTSVEL+MQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  448  NNTMVSHGTKLVMLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKKDP  507

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNTVGVP+GGWVAIRFLADNPGVWF+HCH+E+H SWGL MAW+VLDGKLP
Sbjct  508  ANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFLHCHVELHMSWGLMMAWVVLDGKLP  567

Query  721  NQKLLPPPSDLPKC  762
            N +LLPPP DLPKC
Sbjct  568  NHRLLPPPVDLPKC  581



>emb|CDX88735.1| BnaA03g09140D [Brassica napus]
Length=573

 Score =   383 bits (984),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 201/256 (79%), Positives = 224/256 (88%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K L +F P+LPALNDT+FA+ FS KLRSL+S  +PA VP  VD+ FFFTVGLGTNPC+  
Sbjct  318  KNLQLFTPVLPALNDTNFATKFSNKLRSLNSKKFPANVPLKVDRKFFFTVGLGTNPCNHK  377

Query  175  KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
             NQTCQGPTN T F+ASI+N+SF  PT ALLQ+H+SGQSN VYSPNFP SP+  FNYTG 
Sbjct  378  NNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSNGVYSPNFPWSPIVPFNYTGT  437

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNTMVS GT +MVL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  +
Sbjct  438  PPNNTMVSTGTNLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDAKE  497

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DPKNFNLVDP+ERNTVGVP+GGW AIRFLADNPGVWFMHCHLEVHTSWGL+MAWLVLDG 
Sbjct  498  DPKNFNLVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  557

Query  715  LPNQKLLPPPSDLPKC  762
             P+QKLLPPP+DLPKC
Sbjct  558  KPDQKLLPPPADLPKC  573



>ref|XP_010541373.1| PREDICTED: laccase-17 [Tarenaya hassleriana]
Length=649

 Score =   385 bits (990),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 203/255 (80%), Positives = 227/255 (89%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPC-DK  177
            K L + KP+LPALNDT+FA+ F  KLRSL+S  +PA VP+ VD+ FFFTVGLGTNPC  K
Sbjct  396  KNLQLLKPVLPALNDTNFATAFINKLRSLNSKRFPATVPKEVDQKFFFTVGLGTNPCSQK  455

Query  178  NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            NQ+CQGP N T F+AS+NN+SF+ PTTALLQ+H+SGQS+ VYSP FP  PL  FNYTGNP
Sbjct  456  NQSCQGP-NGTMFAASVNNISFIMPTTALLQSHYSGQSHGVYSPYFPHDPLIPFNYTGNP  514

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMVSNGTK++VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KD
Sbjct  515  PNNTMVSNGTKLLVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKKD  574

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PKNFNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDG  
Sbjct  575  PKNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGDT  634

Query  718  PNQKLLPPPSDLPKC  762
            P+QKLLPPP+DLP+C
Sbjct  635  PDQKLLPPPADLPRC  649



>ref|XP_004246356.1| PREDICTED: laccase-17-like [Solanum lycopersicum]
Length=569

 Score =   383 bits (983),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 201/255 (79%), Positives = 225/255 (88%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K L +FKP LP+LNDT F ++F+ KLRSL +P +PA VP  VD+H FFT+GLGT+PCD+N
Sbjct  316  KNLSIFKPSLPSLNDTIFVTDFTSKLRSLATPQFPANVPLYVDRHLFFTIGLGTSPCDQN  375

Query  181  QTCQGPTNATKFSASINNVSFVQPTT-ALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            +TCQGP N TKFSASINNVSF+ PTT +LLQ+HF GQS  VY P+FP SPL+WFNYTGNP
Sbjct  376  KTCQGP-NGTKFSASINNVSFILPTTNSLLQSHFFGQSKGVYKPDFPYSPLNWFNYTGNP  434

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNT+V+N TK+MVL FNTSVELVMQDTSILG ESHPLHLHGFNFFVVGQGFGN++  KD
Sbjct  435  PNNTLVNNDTKLMVLPFNTSVELVMQDTSILGLESHPLHLHGFNFFVVGQGFGNYDPNKD  494

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P NFNLVDP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLV DGKL
Sbjct  495  PSNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVQDGKL  554

Query  718  PNQKLLPPPSDLPKC  762
            PNQKL PPP DLPKC
Sbjct  555  PNQKLPPPPMDLPKC  569



>gb|ACF87758.1| unknown [Zea mays]
Length=360

 Score =   375 bits (963),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 189/254 (74%), Positives = 218/254 (86%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            + LP+++P LP LNDTSF  NF+ KLRSL +P YPA VP+TVD+ FFF VGLGT+PC  N
Sbjct  107  EALPLYRPTLPQLNDTSFVGNFTAKLRSLATPRYPAAVPRTVDRRFFFAVGLGTHPCPAN  166

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGPTN T+F+AS+NNVSFV PT ALL +HF+G S+ VYSP+FPV+PL  FNYTG PP
Sbjct  167  ATCQGPTNTTQFAASVNNVSFVLPTKALLHSHFTGLSSGVYSPDFPVAPLAPFNYTGTPP  226

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V++GTK+MV+ +  +VELVMQ TSILG ESHPLHLHGFNFFVVGQG+GN++   DP
Sbjct  227  NNTNVASGTKLMVVPYGANVELVMQGTSILGVESHPLHLHGFNFFVVGQGYGNYDPVNDP  286

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLE HT+WGL+MAWLVLDG LP
Sbjct  287  SKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEAHTTWGLRMAWLVLDGSLP  346

Query  721  NQKLLPPPSDLPKC  762
            +QKLLPPPSDLPKC
Sbjct  347  HQKLLPPPSDLPKC  360



>gb|KFK27539.1| hypothetical protein AALP_AA8G396300 [Arabis alpina]
Length=575

 Score =   381 bits (979),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 199/256 (78%), Positives = 225/256 (88%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K L +FKP+LPALNDT+FA+ FS KLRSL+S ++PA VP  VD+ FFFTVGLGTNPC+  
Sbjct  320  KNLQLFKPVLPALNDTNFATKFSNKLRSLNSKTFPANVPLNVDRQFFFTVGLGTNPCNHK  379

Query  175  KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
             NQTCQGPTN T F+ASI+N+SF+ PT ALLQ+H+SGQS  VYSP FP +P+  FNYTG 
Sbjct  380  NNQTCQGPTNTTMFAASISNISFIMPTKALLQSHYSGQSRGVYSPQFPWNPIVPFNYTGT  439

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNT VSNGT +MVL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  K
Sbjct  440  PPNNTNVSNGTNLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNK  499

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DPKNFNLVDP+ERNT+GVP+GGW AIRFLADNPGVWFMHCHLEVHTSWGL+MAWLVLDG 
Sbjct  500  DPKNFNLVDPIERNTIGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  559

Query  715  LPNQKLLPPPSDLPKC  762
             P+QKLLPPP+DLPKC
Sbjct  560  KPDQKLLPPPADLPKC  575



>ref|XP_010690891.1| PREDICTED: laccase-17-like [Beta vulgaris subsp. vulgaris]
Length=582

 Score =   380 bits (977),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 204/259 (79%), Positives = 218/259 (84%), Gaps = 5/259 (2%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+FKP LPAL DTSF SNF+ KLRSL +  YPA VP+ VDKHFFFTVGLGTNPC KN
Sbjct  324  KKLPLFKPTLPALRDTSFVSNFTNKLRSLANAQYPANVPKNVDKHFFFTVGLGTNPCPKN  383

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSG-----QSNHVYSPNFPVSPLHWFNY  345
             TCQGPTN T F+AS+NNVSFV PT ALLQ HF       QS  V++ + P SPL  FNY
Sbjct  384  HTCQGPTNKTMFAASVNNVSFVTPTKALLQTHFIRSHSLHQSQQVFTTDLPSSPLIPFNY  443

Query  346  TGNPPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfn  525
            TG PPNNTMV NGTKVMVL FNTSVELVMQDTSILG E+HPLHLHG+NFFVVGQGFGNF+
Sbjct  444  TGTPPNNTMVMNGTKVMVLPFNTSVELVMQDTSILGVETHPLHLHGYNFFVVGQGFGNFD  503

Query  526  qTKDPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVL  705
              KDP  +NLVDPVERNTVGVP GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+V 
Sbjct  504  AKKDPAKYNLVDPVERNTVGVPVGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVE  563

Query  706  DGKLPNQKLLPPPSDLPKC  762
            DGKLPNQKL PPPSDLPKC
Sbjct  564  DGKLPNQKLPPPPSDLPKC  582



>ref|XP_009403441.1| PREDICTED: laccase-4-like [Musa acuminata subsp. malaccensis]
Length=579

 Score =   380 bits (976),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 196/254 (77%), Positives = 222/254 (87%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP++KP LPA NDTS A+NF+ KLRSL +  +PA VPQTVD+ FFFTVGLGT PC KN
Sbjct  327  KNLPLYKPTLPAFNDTSSAANFTGKLRSLATALFPANVPQTVDRRFFFTVGLGTRPCPKN  386

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T F+A++NN+SFV PTTALLQAHF+G+S+ VY+P+FPV PL  FNYTG PP
Sbjct  387  QTCQGP-NGTMFAAAVNNISFVSPTTALLQAHFTGKSSGVYTPDFPVVPLMPFNYTGAPP  445

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTK++VL FNTSVELVMQDTSILGAESHPLHLHG+NFFVVGQGFGN++   DP
Sbjct  446  NNTMVSNGTKLVVLPFNTSVELVMQDTSILGAESHPLHLHGYNFFVVGQGFGNYDPVNDP  505

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNT+GV AGGWVAIRFLADNPGVWFMHCH+E H SWGL+MAWLVL+G+LP
Sbjct  506  AKFNLVDPVERNTIGVTAGGWVAIRFLADNPGVWFMHCHIEAHMSWGLRMAWLVLNGRLP  565

Query  721  NQKLLPPPSDLPKC  762
            NQ L PPPSDLPKC
Sbjct  566  NQTLPPPPSDLPKC  579



>ref|XP_010483648.1| PREDICTED: laccase-17-like [Camelina sativa]
Length=611

 Score =   381 bits (978),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 199/252 (79%), Positives = 223/252 (88%), Gaps = 2/252 (1%)
 Frame = +1

Query  13   MFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--KNQT  186
            +FKP LPALNDT+FA+ FS KLRSL+S ++PA VP  VD+ FFFTVGLGTNPC+   NQT
Sbjct  360  VFKPTLPALNDTNFATKFSNKLRSLNSKNFPANVPLNVDRKFFFTVGLGTNPCNHKNNQT  419

Query  187  CQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNN  366
            CQGPTN T F+ASI+N+SF  PT ALLQ+H+SGQS+ VYSP FP SP+  FNYTG PPNN
Sbjct  420  CQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSHGVYSPKFPWSPIVPFNYTGTPPNN  479

Query  367  TMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKN  546
            TMVSNGT +MVL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDPKN
Sbjct  480  TMVSNGTNLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPKN  539

Query  547  FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQ  726
            FNLVDP+ERNT+GVP+GGW AIRFLADNPGVWFMHCHLEVHTSWGL+MAWLVLDG  P+Q
Sbjct  540  FNLVDPIERNTIGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGDKPDQ  599

Query  727  KLLPPPSDLPKC  762
            KLLPPP+DLPKC
Sbjct  600  KLLPPPADLPKC  611



>ref|XP_006280235.1| hypothetical protein CARUB_v10026150mg [Capsella rubella]
 gb|EOA13133.1| hypothetical protein CARUB_v10026150mg [Capsella rubella]
Length=577

 Score =   379 bits (972),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 199/256 (78%), Positives = 224/256 (88%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K L +F+P LPALNDT+FA+ FS KLRSL+S ++PA VP  VD+ FFFTVGLGTNPC+  
Sbjct  322  KNLQLFRPTLPALNDTNFATKFSNKLRSLNSKNFPANVPLNVDRKFFFTVGLGTNPCNHK  381

Query  175  KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
             NQTCQGPTN T F+ASI+N+SF  PT ALLQ+H+SGQS+ VYSP FP SP+  FNYTG 
Sbjct  382  NNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSHGVYSPKFPWSPIVPFNYTGT  441

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNT VSNGT +MVL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  K
Sbjct  442  PPNNTNVSNGTNLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNK  501

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DPKNFNLVDP+ERNT+GVP+GGW AIRFLADNPGVWFMHCHLEVHTSWGL+MAWLVLDG 
Sbjct  502  DPKNFNLVDPIERNTIGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  561

Query  715  LPNQKLLPPPSDLPKC  762
             P+QKLLPPP+DLPKC
Sbjct  562  KPDQKLLPPPADLPKC  577



>ref|XP_010039668.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
 gb|KCW45807.1| hypothetical protein EUGRSUZ_L00355 [Eucalyptus grandis]
Length=545

 Score =   377 bits (969),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 198/254 (78%), Positives = 220/254 (87%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K+LP+FKP LP LNDT+FA+NF+ KLRSL +P +PA VP  VD+ FFFTV LGT PC  N
Sbjct  293  KQLPLFKPTLPPLNDTAFATNFTTKLRSLATPQFPANVPLKVDRRFFFTVSLGTIPCQGN  352

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP   T F+A++NNVSF  PTTALLQAH++GQSN VYSP+FP  P   FN+TG PP
Sbjct  353  QTCQGPY-GTMFTAAVNNVSFTMPTTALLQAHYTGQSNGVYSPDFPSHPKSIFNFTGTPP  411

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V NGTK++VL FNTSVEL+MQDTSILGAE HPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  412  NNTNVGNGTKLVVLPFNTSVELIMQDTSILGAEGHPLHLHGFNFFVVGQGFGNFDPNKDP  471

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNTVGVP+GGWVA RFLADNPGVWFMHCHLEVH+SWGLKMAWLVLDGKLP
Sbjct  472  ANFNLVDPVERNTVGVPSGGWVATRFLADNPGVWFMHCHLEVHSSWGLKMAWLVLDGKLP  531

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  532  NQKLLPPPADLPKC  545



>ref|XP_006429125.1| hypothetical protein CICLE_v10011362mg [Citrus clementina]
 ref|XP_006480873.1| PREDICTED: laccase-17-like [Citrus sinensis]
 gb|ESR42365.1| hypothetical protein CICLE_v10011362mg [Citrus clementina]
Length=578

 Score =   379 bits (972),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 198/254 (78%), Positives = 221/254 (87%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+ KP LPALNDT+FA N++ +LRSL +  +PA VPQTVDK FFFTVGLGTNPC KN
Sbjct  326  KKLPLMKPTLPALNDTAFAFNYTTRLRSLANAQFPANVPQTVDKRFFFTVGLGTNPCPKN  385

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N+TKF+AS+NN SF+ P+TALLQAHF GQ N VY+ +FP +PL  FNYTG PP
Sbjct  386  QTCQGPNNSTKFAASVNNFSFILPSTALLQAHFFGQ-NGVYTTDFPSTPLIKFNYTGTPP  444

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V NGTK +VL FNT+VELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN++  KD 
Sbjct  445  NNTSVMNGTKAVVLPFNTTVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPRKDR  504

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
            KNFNL+DPVERNTVGVP+GGWVAIRF ADNPGVWFMHCH EVH SWGLKMAW+VLDG LP
Sbjct  505  KNFNLIDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCHFEVHISWGLKMAWIVLDGNLP  564

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP+DLPKC
Sbjct  565  NQKLPPPPADLPKC  578



>ref|XP_004970543.1| PREDICTED: laccase-12/13-like [Setaria italica]
Length=579

 Score =   378 bits (970),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 198/254 (78%), Positives = 218/254 (86%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ KP LP +NDTSF +NF+ KLRSL +  YPA VP+ VD+ FFFTVGLGT+PC  N
Sbjct  326  KNLPILKPTLPQINDTSFVANFTGKLRSLATAEYPADVPREVDRRFFFTVGLGTHPCAVN  385

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGPTN T+F+AS+NNVSFV PTTALLQAHF+G+SN VYSPNFP +PL  FNYTG PP
Sbjct  386  GTCQGPTNDTRFAASVNNVSFVLPTTALLQAHFTGRSNGVYSPNFPAAPLIPFNYTGTPP  445

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGTK++VL + TSVELVMQ TSILG ESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  446  NNTNVSNGTKLVVLPYGTSVELVMQGTSILGNESHPLHLHGFNFFVVGQGFGNFDPVKDP  505

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              +NLVDPVERNTVGVPAGGWVAIRF ADNPGVWFMHCHLEVH SWGLKMAWLVLDG  P
Sbjct  506  AQYNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEVHVSWGLKMAWLVLDGDKP  565

Query  721  NQKLLPPPSDLPKC  762
             +KLLPPPSDLPKC
Sbjct  566  KEKLLPPPSDLPKC  579



>ref|XP_008801588.1| PREDICTED: LOW QUALITY PROTEIN: laccase-4 [Phoenix dactylifera]
Length=535

 Score =   376 bits (966),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 196/249 (79%), Positives = 220/249 (88%), Gaps = 1/249 (0%)
 Frame = +1

Query  16   FKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTCQG  195
            FKP LP+LNDT+F ++F+ KLRSL +  YPAKVPQTVD+HFFFTVGLGT+PC +NQTCQG
Sbjct  288  FKPSLPSLNDTTFVASFTSKLRSLATTQYPAKVPQTVDRHFFFTVGLGTSPCPRNQTCQG  347

Query  196  PTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNTMV  375
            P N TKF+A+INNVSF  P TALLQAHF GQS  +Y+P+FP++PL  FNYTG+PPNNT+V
Sbjct  348  P-NGTKFAATINNVSFSMPATALLQAHFFGQSKGIYTPDFPITPLIPFNYTGSPPNNTLV  406

Query  376  SNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKNFNL  555
            ++GT+++VL FN SVELVMQDTSILG ESHPLHLHGFNFFVVGQGFGN +  KDP  FNL
Sbjct  407  ASGTRLVVLPFNASVELVMQDTSILGNESHPLHLHGFNFFVVGQGFGNHDPAKDPAKFNL  466

Query  556  VDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLL  735
            VDPVERNTV VP GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDG LPNQKL 
Sbjct  467  VDPVERNTVSVPPGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGNLPNQKLP  526

Query  736  PPPSDLPKC  762
            PPPSDLPKC
Sbjct  527  PPPSDLPKC  535



>emb|CDX71061.1| BnaC03g11450D [Brassica napus]
Length=573

 Score =   377 bits (969),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 199/256 (78%), Positives = 221/256 (86%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K L +F P+LPALNDT+FA+ FS KLRSL+S  YPA VP  VD+ FFFTVGLGTNPC+  
Sbjct  318  KNLQLFTPVLPALNDTNFATKFSNKLRSLNSKRYPANVPLKVDRKFFFTVGLGTNPCNHK  377

Query  175  KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
             NQTCQGPTN T F+ASI+N+SF  PT ALLQ+H+SGQSN VYSPNFP + +  FNYTG 
Sbjct  378  NNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSNGVYSPNFPWNTIVPFNYTGT  437

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNTMVS GT VMVL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  +
Sbjct  438  PPNNTMVSTGTNVMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDAKE  497

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DPK FNLVDP+ERNTVGVP+GGW AIRFLADNPGVWFMHCHLEVHTSWGL+MAWLVLDG 
Sbjct  498  DPKKFNLVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  557

Query  715  LPNQKLLPPPSDLPKC  762
              +QKLLPPP+DLPKC
Sbjct  558  KSDQKLLPPPADLPKC  573



>ref|XP_009388612.1| PREDICTED: laccase-4-like [Musa acuminata subsp. malaccensis]
Length=539

 Score =   376 bits (966),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 194/254 (76%), Positives = 219/254 (86%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K+L ++ P+LPA NDTSFA+NF+ KLRSL +  YPA VPQTVD+ FFFTVGLGT+PC  N
Sbjct  287  KELALYIPVLPAFNDTSFAANFTGKLRSLATAQYPANVPQTVDRRFFFTVGLGTDPCPTN  346

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKFS+++NN+SF +PTTALLQAHF GQS  VY+P+FP  PL  F+YTG PP
Sbjct  347  QTCQGP-NGTKFSSTVNNISFTEPTTALLQAHFFGQSEGVYTPDFPAFPLMPFDYTGTPP  405

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VS+GTK++VL FNTSVELVMQDTSILG ESHPLHLHG+NFFVVG+GFGNF+   DP
Sbjct  406  NNTNVSHGTKLLVLPFNTSVELVMQDTSILGTESHPLHLHGYNFFVVGEGFGNFDPASDP  465

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVP GGWVAIRFLADNPGVWFMHCH+E+H SWGL MAWLVLDG LP
Sbjct  466  AEFNLVDPVERNTVGVPDGGWVAIRFLADNPGVWFMHCHIEIHLSWGLTMAWLVLDGALP  525

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  526  NQKLPPPPSDLPKC  539



>ref|XP_010031544.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
 gb|KCW50887.1| hypothetical protein EUGRSUZ_J00532 [Eucalyptus grandis]
Length=585

 Score =   377 bits (969),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 200/254 (79%), Positives = 220/254 (87%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K+LP+FKP LP LNDT FA+NF+ KLRSL +P +PA VPQ VD+ FFFTVGLGT PC  N
Sbjct  333  KQLPLFKPTLPPLNDTGFATNFTNKLRSLATPQFPANVPQKVDQRFFFTVGLGTMPCQGN  392

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T F+A+INNVSF  PTTALLQAH++GQSN VYSP+FP  P   FN+TG  P
Sbjct  393  QTCQGP-NGTMFNAAINNVSFTMPTTALLQAHYTGQSNRVYSPDFPSYPKSIFNFTGTSP  451

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V NGTK++VL FN+SVEL+MQDTSILGAESHPLHLHGFNFFVVGQGFGNF+   DP
Sbjct  452  NNTNVGNGTKLVVLPFNSSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNNDP  511

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP
Sbjct  512  GKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  571

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP+DLPKC
Sbjct  572  NQKLPPPPADLPKC  585



>emb|CBI31631.3| unnamed protein product [Vitis vinifera]
Length=1050

 Score =   389 bits (1000),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 205/254 (81%), Positives = 224/254 (88%), Gaps = 0/254 (0%)
 Frame = +1

Query  1     KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
             K LP+FKP LP LNDTSFA+NF+ KLRSL +  +PA VPQ VD+ FFFTVGLGTNPC +N
Sbjct  797   KNLPLFKPTLPPLNDTSFAANFTGKLRSLANTQFPANVPQKVDQRFFFTVGLGTNPCPQN  856

Query  181   QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             QTCQGPTN T FSAS+NNVSFV PTTA+LQAHF  QS  VY+ +FP +P+  FNYTG PP
Sbjct  857   QTCQGPTNITMFSASVNNVSFVLPTTAILQAHFFQQSKGVYTTDFPTTPIFPFNYTGTPP  916

Query  361   NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
             NNTMVSNGTKV+VL FNTSVELV+QDTSILG ESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  917   NNTMVSNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHGFNFFVVGQGFGNFDSKKDP  976

Query  541   KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
               FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+V+DGKLP
Sbjct  977   PKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVMDGKLP  1036

Query  721   NQKLLPPPSDLPKC  762
             NQKL PPPSDLPKC
Sbjct  1037  NQKLPPPPSDLPKC  1050


 Score =   192 bits (489),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            + LP+FKP LP LNDTSFA+NF++KLRSL +  +PA VPQ VDK FFFTVGLGTNPC +N
Sbjct  331  ENLPLFKPTLPPLNDTSFAANFTRKLRSLANTQFPANVPQKVDKRFFFTVGLGTNPCPQN  390

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N+T FSAS+NNVSFV PTTA+LQAHF  QSN VY+ +FP +P+  FNYTG PP
Sbjct  391  QTCQGPNNSTMFSASVNNVSFVLPTTAILQAHFFQQSNGVYTTDFPATPIFPFNYTGTPP  450

Query  361  NNTMVSNGTK  390
            NNTMVSNGTK
Sbjct  451  NNTMVSNGTK  460



>ref|XP_009126628.1| PREDICTED: laccase-17-like [Brassica rapa]
Length=572

 Score =   376 bits (966),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 198/256 (77%), Positives = 220/256 (86%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K LP+F P+LPALNDT+FA+ FS KLRSL+S  +PA VPQ VD+ FFFT GLG  PC+  
Sbjct  317  KNLPLFTPVLPALNDTNFATKFSNKLRSLNSQKFPANVPQEVDRKFFFTGGLGNTPCNHK  376

Query  175  KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
             NQTC GPTN T F+ASI+N+SF  PT ALLQ+H+SG+SN VYSPNFP SP+  FNYTG 
Sbjct  377  NNQTCLGPTNTTMFAASISNISFTLPTKALLQSHYSGRSNGVYSPNFPWSPIVPFNYTGT  436

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNTMVS GT VMVL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+   
Sbjct  437  PPNNTMVSTGTNVMVLRYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKN  496

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DPK FNLVDP+ERNTVGVP+GGW AIRFLADNPGVWFMHCHLEVHTSWGL+MAWLVLDG 
Sbjct  497  DPKKFNLVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  556

Query  715  LPNQKLLPPPSDLPKC  762
             P+QKLLPPP+DLPKC
Sbjct  557  KPDQKLLPPPADLPKC  572



>ref|XP_002458746.1| hypothetical protein SORBIDRAFT_03g039520 [Sorghum bicolor]
 gb|EES03866.1| hypothetical protein SORBIDRAFT_03g039520 [Sorghum bicolor]
Length=579

 Score =   376 bits (965),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 193/254 (76%), Positives = 218/254 (86%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+++P LP LNDTSF  NF+ KL SL +P YPA VPQTVDK FFFTVGLGT+PC  N
Sbjct  326  KALPLYRPALPQLNDTSFVGNFTAKLLSLATPEYPAAVPQTVDKRFFFTVGLGTHPCPAN  385

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGPTN T+F+AS+NNVSFV PT ALL +HF+G S+ VY  +FPV+PL  FNYTG PP
Sbjct  386  TTCQGPTNTTQFAASVNNVSFVLPTKALLHSHFAGLSSGVYESDFPVAPLAPFNYTGTPP  445

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V+NGTK+MV+ + T+VELVMQ TSILG ESHPLHLHGFNFFVVGQG+GN++   DP
Sbjct  446  NNTNVANGTKLMVIPYGTNVELVMQGTSILGIESHPLHLHGFNFFVVGQGYGNYDPVNDP  505

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHT+WGL+MAWLVLDG LP
Sbjct  506  PKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTTWGLRMAWLVLDGSLP  565

Query  721  NQKLLPPPSDLPKC  762
            +QKLLPPPSDLPKC
Sbjct  566  HQKLLPPPSDLPKC  579



>gb|KDP35652.1| hypothetical protein JCGZ_09090 [Jatropha curcas]
Length=421

 Score =   370 bits (949),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 192/254 (76%), Positives = 217/254 (85%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP LP +N T F +NF+KK RSL +  +PA VPQTVD+ F+FTVGLGT+PC  N
Sbjct  168  KNLPLFKPTLPPINATGFVANFTKKFRSLANSKFPANVPQTVDRKFYFTVGLGTHPCPAN  227

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGPTN TKF+AS+NNVSFV P+TALLQ++F G SN V + +FP +P   FNYTG PP
Sbjct  228  TTCQGPTNTTKFAASVNNVSFVLPSTALLQSYFFGMSNGVLTADFPQNPPVPFNYTGTPP  287

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGT+ +VL FNTSVELVMQDTSILGAESHP HLHGFNFFVVGQGFGN++  KDP
Sbjct  288  NNTNVSNGTRTLVLRFNTSVELVMQDTSILGAESHPFHLHGFNFFVVGQGFGNYDPNKDP  347

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             +FNLVDPVERNTVGVPAGGW+AIRFLADNPGVWFMHCHLEVHTSWGL+MAW+VLDG  P
Sbjct  348  ASFNLVDPVERNTVGVPAGGWIAIRFLADNPGVWFMHCHLEVHTSWGLRMAWIVLDGPQP  407

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  408  NQKLQPPPSDLPKC  421



>gb|AAC04576.1| putative high-pI laccase, partial [Oryza sativa Japonica Group]
Length=551

 Score =   374 bits (959),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 194/254 (76%), Positives = 216/254 (85%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP LP LNDT F +NF+ KLRSL +P YPA VPQ+VDK FFFTVGLGT PC  N
Sbjct  299  KGLPLFKPTLPQLNDTDFVTNFTDKLRSLATPEYPAAVPQSVDKRFFFTVGLGTLPCPAN  358

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N T+ +AS+NNVSFV P  ALLQ+HF+G S+ VY+P+FPV+PL  FNYTG PP
Sbjct  359  MTCQGPNN-TQMAASMNNVSFVLPARALLQSHFTGLSSGVYAPDFPVAPLSPFNYTGTPP  417

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V  GTK++VL +NTSVELVMQDTSILG ESHPLHLHGFNFFV+GQGFGN++   DP
Sbjct  418  NNTNVKTGTKLLVLRYNTSVELVMQDTSILGIESHPLHLHGFNFFVIGQGFGNYDAVNDP  477

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLE HT+WGL+MAWLVLDG  P
Sbjct  478  AKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEAHTTWGLRMAWLVLDGSHP  537

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPPSDLPKC
Sbjct  538  NQKLLPPPSDLPKC  551



>ref|NP_001105875.1| putative laccase precursor [Zea mays]
 emb|CAJ30500.1| putative laccase [Zea mays]
Length=587

 Score =   375 bits (962),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 189/254 (74%), Positives = 218/254 (86%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            + LP+++P LP LNDTSF  NF+ KLRSL +P YPA VP+TVD+ FFF VGLGT+PC  N
Sbjct  334  EALPLYRPTLPQLNDTSFVGNFTAKLRSLATPRYPAAVPRTVDRRFFFAVGLGTHPCPAN  393

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGPTN T+F+AS+NNVSFV PT ALL +HF+G S+ VYSP+FPV+PL  FNYTG PP
Sbjct  394  ATCQGPTNTTQFAASVNNVSFVLPTKALLHSHFTGLSSGVYSPDFPVAPLAPFNYTGTPP  453

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V++GTK+MV+ +  +VELVMQ TSILG ESHPLHLHGFNFFVVGQG+GN++   DP
Sbjct  454  NNTNVASGTKLMVVPYGANVELVMQGTSILGVESHPLHLHGFNFFVVGQGYGNYDPVNDP  513

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLE HT+WGL+MAWLVLDG LP
Sbjct  514  SKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEAHTTWGLRMAWLVLDGSLP  573

Query  721  NQKLLPPPSDLPKC  762
            +QKLLPPPSDLPKC
Sbjct  574  HQKLLPPPSDLPKC  587



>gb|KDO52342.1| hypothetical protein CISIN_1g008085mg [Citrus sinensis]
Length=578

 Score =   374 bits (961),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 195/254 (77%), Positives = 221/254 (87%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+ KP LPALNDT+FA N++ +LRSL +  +PA VPQTV+K FFFTVGLGTNPC KN
Sbjct  326  KKLPLMKPTLPALNDTAFAFNYTTRLRSLANAQFPANVPQTVNKRFFFTVGLGTNPCPKN  385

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N+TKF+AS+NN SF+ P+TALLQAHF GQ N VY+ +FP +PL  FNYTG PP
Sbjct  386  QTCQGPNNSTKFAASVNNFSFILPSTALLQAHFFGQ-NGVYTTDFPSTPLIKFNYTGTPP  444

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V NGTKV+VL FN SVELVMQDTS LGAESHPLHLHGFNFFV+GQGFGN++ +KD 
Sbjct  445  NNTSVMNGTKVVVLPFNASVELVMQDTSTLGAESHPLHLHGFNFFVIGQGFGNYDPSKDR  504

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
            KNFNL+DPVERNTVGVP+GGWVAIRF ADNPGVWFMHCH EVH SWGLKMAW+VL+G LP
Sbjct  505  KNFNLIDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCHFEVHISWGLKMAWIVLNGNLP  564

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP+DLPKC
Sbjct  565  NQKLPPPPADLPKC  578



>ref|XP_010046415.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
 gb|KCW85638.1| hypothetical protein EUGRSUZ_B02428 [Eucalyptus grandis]
Length=585

 Score =   374 bits (961),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 196/254 (77%), Positives = 219/254 (86%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K+LP+FKP LP LNDT+FA+NF+ KLRSL +P +PA VP  VD+ FFFTV LGT PC  N
Sbjct  333  KQLPLFKPTLPPLNDTAFATNFTTKLRSLATPQFPANVPLKVDRRFFFTVSLGTIPCQGN  392

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP   T  +A++NNVSF  PTTALLQAH++GQSN VYSP+FP  P   FN+TG PP
Sbjct  393  QTCQGPY-GTMLTAAVNNVSFTMPTTALLQAHYTGQSNGVYSPDFPSHPKSIFNFTGTPP  451

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V NGTK++VL FNTSVEL+MQDTSILGAE HPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  452  NNTNVGNGTKLVVLPFNTSVELIMQDTSILGAERHPLHLHGFNFFVVGQGFGNFDPNKDP  511

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNTVGVP+GGWVA RFLADNPGVWFMHCHLEVH+SWG+KMAWLVLDGKLP
Sbjct  512  ANFNLVDPVERNTVGVPSGGWVATRFLADNPGVWFMHCHLEVHSSWGMKMAWLVLDGKLP  571

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  572  NQKLLPPPADLPKC  585



>ref|XP_008665185.1| PREDICTED: laccase-4-like [Zea mays]
 gb|ACN28855.1| unknown [Zea mays]
 tpg|DAA50674.1| TPA: putative laccase family protein [Zea mays]
 tpg|DAA56881.1| TPA: putative laccase family protein [Zea mays]
Length=585

 Score =   374 bits (961),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 189/254 (74%), Positives = 218/254 (86%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            + LP+++P LP LNDTSF  NF+ KLRSL +P YPA VP+TVD+ FFF VGLGT+PC  N
Sbjct  332  EALPLYRPTLPQLNDTSFVGNFTAKLRSLATPRYPAAVPRTVDRRFFFAVGLGTHPCPAN  391

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGPTN T+F+AS+NNVSFV PT ALL +HF+G S+ VYSP+FPV+PL  FNYTG PP
Sbjct  392  ATCQGPTNTTQFAASVNNVSFVLPTKALLHSHFTGLSSGVYSPDFPVAPLAPFNYTGTPP  451

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V++GTK+MV+ +  +VELVMQ TSILG ESHPLHLHGFNFFVVGQG+GN++   DP
Sbjct  452  NNTNVASGTKLMVVPYGANVELVMQGTSILGVESHPLHLHGFNFFVVGQGYGNYDPVNDP  511

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLE HT+WGL+MAWLVLDG LP
Sbjct  512  SKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEAHTTWGLRMAWLVLDGSLP  571

Query  721  NQKLLPPPSDLPKC  762
            +QKLLPPPSDLPKC
Sbjct  572  HQKLLPPPSDLPKC  585



>gb|EAZ14115.1| hypothetical protein OsJ_04039 [Oryza sativa Japonica Group]
Length=577

 Score =   374 bits (960),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 194/254 (76%), Positives = 216/254 (85%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP LP LNDT F +NF+ KLRSL +P YPA VPQ+VDK FFFTVGLGT PC  N
Sbjct  325  KGLPLFKPTLPQLNDTDFVTNFTDKLRSLATPEYPAAVPQSVDKRFFFTVGLGTLPCPAN  384

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N T+ +AS+NNVSFV P  ALLQ+HF+G S+ VY+P+FPV+PL  FNYTG PP
Sbjct  385  MTCQGPNN-TQMAASMNNVSFVLPARALLQSHFTGLSSGVYAPDFPVAPLSPFNYTGTPP  443

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V  GTK++VL +NTSVELVMQDTSILG ESHPLHLHGFNFFV+GQGFGN++   DP
Sbjct  444  NNTNVKTGTKLLVLRYNTSVELVMQDTSILGIESHPLHLHGFNFFVIGQGFGNYDAVNDP  503

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLE HT+WGL+MAWLVLDG  P
Sbjct  504  AKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEAHTTWGLRMAWLVLDGSHP  563

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPPSDLPKC
Sbjct  564  NQKLLPPPSDLPKC  577



>ref|NP_001044772.1| Os01g0842400 [Oryza sativa Japonica Group]
 sp|Q5N9X2.1|LAC4_ORYSJ RecName: Full=Laccase-4; AltName: Full=Benzenediol:oxygen oxidoreductase 
4; AltName: Full=Diphenol oxidase 4; AltName: Full=Urishiol 
oxidase 4; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD81734.1| putative laccase LAC5-6 [Oryza sativa Japonica Group]
 dbj|BAF06686.1| Os01g0842400 [Oryza sativa Japonica Group]
 dbj|BAG91149.1| unnamed protein product [Oryza sativa Japonica Group]
Length=579

 Score =   374 bits (961),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 194/254 (76%), Positives = 216/254 (85%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP LP LNDT F +NF+ KLRSL +P YPA VPQ+VDK FFFTVGLGT PC  N
Sbjct  327  KGLPLFKPTLPQLNDTDFVTNFTDKLRSLATPEYPAAVPQSVDKRFFFTVGLGTLPCPAN  386

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N T+ +AS+NNVSFV P  ALLQ+HF+G S+ VY+P+FPV+PL  FNYTG PP
Sbjct  387  MTCQGPNN-TQMAASMNNVSFVLPARALLQSHFTGLSSGVYAPDFPVAPLSPFNYTGTPP  445

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V  GTK++VL +NTSVELVMQDTSILG ESHPLHLHGFNFFV+GQGFGN++   DP
Sbjct  446  NNTNVKTGTKLLVLRYNTSVELVMQDTSILGIESHPLHLHGFNFFVIGQGFGNYDAVNDP  505

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLE HT+WGL+MAWLVLDG  P
Sbjct  506  AKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEAHTTWGLRMAWLVLDGSHP  565

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPPSDLPKC
Sbjct  566  NQKLLPPPSDLPKC  579



>ref|XP_010039666.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
 gb|KCW45808.1| hypothetical protein EUGRSUZ_L00359 [Eucalyptus grandis]
Length=585

 Score =   374 bits (960),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 196/254 (77%), Positives = 218/254 (86%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K+LP+FKP LP LND +FA+NF+ KLRSL +P +PA VP  VD+ FFFTV LGT PC  N
Sbjct  333  KQLPLFKPTLPPLNDRAFATNFTTKLRSLATPQFPANVPLKVDRRFFFTVSLGTIPCQGN  392

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP   T  +A++NNVSF  PTTALLQAH++GQSN VYSP+FP  P   FN+TG PP
Sbjct  393  QTCQGPY-GTMLTAAVNNVSFTMPTTALLQAHYTGQSNGVYSPDFPSHPKSIFNFTGTPP  451

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V NGTKV+VL FNTSVEL+MQDTSILGAE HPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  452  NNTNVGNGTKVVVLPFNTSVELIMQDTSILGAERHPLHLHGFNFFVVGQGFGNFDPNKDP  511

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNTVGVP+GGWVA RFLADNPGVWFMHCHLEVH+SWG+KMAWLVLDGKLP
Sbjct  512  ANFNLVDPVERNTVGVPSGGWVATRFLADNPGVWFMHCHLEVHSSWGMKMAWLVLDGKLP  571

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  572  NQKLLPPPADLPKC  585



>ref|XP_010264408.1| PREDICTED: laccase-17-like [Nelumbo nucifera]
Length=591

 Score =   374 bits (960),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 192/254 (76%), Positives = 218/254 (86%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            +KLP+F+P LP +NDTSF +NFS + RSL +  +PA VPQTVDK FFFTVGLGT+PC KN
Sbjct  338  QKLPLFRPTLPPINDTSFVANFSSRFRSLATTQFPANVPQTVDKRFFFTVGLGTSPCPKN  397

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N+TKFSASINN SF  P+TA+LQAH+ GQ   VY+ +FP +P   FNYTG PP
Sbjct  398  QTCQGPNNSTKFSASINNNSFALPSTAILQAHYFGQEKGVYTTDFPANPPFPFNYTGTPP  457

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT+VSNGTKV+VL FNTSVELV+Q TSILGAESHPLHLHGFNFFVVGQG GN++  KDP
Sbjct  458  NNTVVSNGTKVVVLPFNTSVELVLQGTSILGAESHPLHLHGFNFFVVGQGSGNYDPNKDP  517

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNT+GVP+GGWVAIRFLADNPG WFMHCH E+H SWGLKM W+VLDG+LP
Sbjct  518  PNFNLVDPVERNTIGVPSGGWVAIRFLADNPGAWFMHCHFEIHLSWGLKMVWIVLDGELP  577

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  578  NQKLPPPPSDLPKC  591



>ref|XP_007140300.1| hypothetical protein PHAVU_008G1006001g, partial [Phaseolus vulgaris]
 gb|ESW12294.1| hypothetical protein PHAVU_008G1006001g, partial [Phaseolus vulgaris]
Length=226

 Score =   361 bits (926),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 190/226 (84%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +1

Query  85   LDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTCQGPTNATKFSASINNVSFVQPTTAL  264
            L S  +PA VPQ VDKHFFFTV LGT PC KNQTCQGPTN TKFSAS+NNVS++QPTTAL
Sbjct  1    LASAQFPANVPQKVDKHFFFTVSLGTTPCQKNQTCQGPTNTTKFSASVNNVSYIQPTTAL  60

Query  265  LQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNTMVSNGTKVMVLNFNTSVELVMQDTS  444
            LQAHF GQSN VY+ +FP  PL  FNYTG PPNNTMVSNGTKV+VL FNTSVELVMQDTS
Sbjct  61   LQAHFFGQSNGVYTTDFPTKPLVPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTS  120

Query  445  ILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKNFNLVDPVERNTVGVPAGGWVAIRFLA  624
            ILGAESHPLHLHGFNFFVVGQGFGN++  KDP  FN+VDPVERNTVGVP+GGWVAIRFLA
Sbjct  121  ILGAESHPLHLHGFNFFVVGQGFGNYDPNKDPAKFNVVDPVERNTVGVPSGGWVAIRFLA  180

Query  625  DNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLLPPPSDLPKC  762
            DNPGVWFMHCHLEVHT+WGLKMAWLVLDGKLPNQKL PPP+DLPKC
Sbjct  181  DNPGVWFMHCHLEVHTTWGLKMAWLVLDGKLPNQKLFPPPADLPKC  226



>ref|XP_009595163.1| PREDICTED: laccase-17-like [Nicotiana tomentosiformis]
Length=477

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 205/242 (85%), Gaps = 3/242 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP FKP+LPALNDT+F +NF+ +LRSL +P +PA VP  VD+H FFTVGLGT+PCD N
Sbjct  227  KNLPFFKPLLPALNDTTFVTNFTSRLRSLATPQFPANVPLNVDRHLFFTVGLGTSPCDHN  286

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            +TCQGP N TKFSAS+NNVSF+QPTTALLQ+HF GQS  +Y P+FP SPL+WFNYTGNPP
Sbjct  287  KTCQGP-NGTKFSASVNNVSFIQPTTALLQSHFFGQSKGIYKPDFPYSPLNWFNYTGNPP  345

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT+V N TK+MVL FNTSVELVMQDTSILGAESHPLHLH   F     G G  N   + 
Sbjct  346  NNTLVKNDTKLMVLPFNTSVELVMQDTSILGAESHPLHLH--GFNFFVVGQGFGNFDGNT  403

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNL+DP+ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP
Sbjct  404  ANFNLIDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  463

Query  721  NQ  726
            NQ
Sbjct  464  NQ  465



>emb|CBI31651.3| unnamed protein product [Vitis vinifera]
Length=1094

 Score =   387 bits (993),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 202/254 (80%), Positives = 223/254 (88%), Gaps = 0/254 (0%)
 Frame = +1

Query  1     KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
             K LP+FKP LP LNDTSFA+NF+ KLRSL +  +PA VPQ VDK FFFTVGLGTNPC +N
Sbjct  841   KNLPLFKPTLPPLNDTSFAANFTHKLRSLANSQFPANVPQKVDKRFFFTVGLGTNPCPQN  900

Query  181   QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             QTCQGP N+TKFSAS+NNVSFV PTTA+LQAHF  QSN VY+ +FP +P+  FNYTG PP
Sbjct  901   QTCQGPNNSTKFSASVNNVSFVLPTTAILQAHFFQQSNGVYTTDFPATPIFPFNYTGTPP  960

Query  361   NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
             NNTMV+NGTKV+VL FNTSVELV+QDTSILG ESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  961   NNTMVNNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHGFNFFVVGQGFGNFDSKKDP  1020

Query  541   KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
               FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCH EVH SWGLKM W+V+DGKLP
Sbjct  1021  PKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHFEVHMSWGLKMVWMVMDGKLP  1080

Query  721   NQKLLPPPSDLPKC  762
             NQKL PPPSDLP+C
Sbjct  1081  NQKLPPPPSDLPQC  1094


 Score =   244 bits (624),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP LP LNDTSFA+NF++KLRSL +  +PA VP+ VDK FFFTVGLGT+PC +N
Sbjct  320  KNLPVFKPTLPPLNDTSFAANFTRKLRSLANSQFPANVPKKVDKRFFFTVGLGTSPCPQN  379

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N+TKFSAS+NNVSFV PTTA+LQAHF  QSN VY+ +FP +P+  FNYTG PP
Sbjct  380  QTCQGPNNSTKFSASVNNVSFVLPTTAILQAHFFQQSNGVYTTDFPATPIFPFNYTGTPP  439

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTM SNGTKV+VL FNT+VELV+QDTSILG ESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  440  NNTMASNGTKVVVLPFNTTVELVLQDTSILGIESHPLHLHGFNFFVVGQGFGNFDSKKDP  499

Query  541  KNFNL  555
              FNL
Sbjct  500  PKFNL  504



>ref|XP_004970542.1| PREDICTED: laccase-4-like [Setaria italica]
Length=582

 Score =   373 bits (957),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 191/254 (75%), Positives = 216/254 (85%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP++KP LP  NDT F  NF+ KLRSL +  YPA VP+TVDK FFFTVGLGT+PC  N
Sbjct  329  KALPLYKPTLPGFNDTDFVGNFTAKLRSLATAQYPAAVPKTVDKKFFFTVGLGTHPCPAN  388

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGPTN T+F+AS+NNVSF  PT ALL +HF+G S+ VYS +FPV+PL  FNYTG PP
Sbjct  389  TTCQGPTNTTQFAASVNNVSFALPTRALLHSHFTGLSSGVYSSDFPVAPLTPFNYTGTPP  448

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V+NGTK+MV+ + T+VELVMQ TSILG ESHPLHLHGFNFFVVGQG+GN++   DP
Sbjct  449  NNTNVANGTKLMVIPYGTNVELVMQGTSILGIESHPLHLHGFNFFVVGQGYGNYDPVNDP  508

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHT+WGL+MAWLVLDG LP
Sbjct  509  AKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTTWGLRMAWLVLDGSLP  568

Query  721  NQKLLPPPSDLPKC  762
            +QKLLPPPSDLPKC
Sbjct  569  HQKLLPPPSDLPKC  582



>gb|EEC71777.1| hypothetical protein OsI_04389 [Oryza sativa Indica Group]
Length=577

 Score =   372 bits (956),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 193/254 (76%), Positives = 216/254 (85%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP LP LNDT F +NF+ +LRSL +P YPA VPQ+VDK FFFTVGLGT PC  N
Sbjct  325  KGLPLFKPTLPQLNDTDFVTNFTDRLRSLATPEYPAAVPQSVDKRFFFTVGLGTLPCPAN  384

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N T+ +AS+NNVSFV P  ALLQ+HF+G S+ VY+P+FPV+PL  FNYTG PP
Sbjct  385  MTCQGPNN-TQMAASMNNVSFVLPARALLQSHFTGLSSGVYAPDFPVAPLWPFNYTGTPP  443

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V  GTK++VL +NTSVELVMQDTSILG ESHPLHLHGFNFFV+GQGFGN++   DP
Sbjct  444  NNTNVKTGTKLLVLRYNTSVELVMQDTSILGIESHPLHLHGFNFFVIGQGFGNYDAVNDP  503

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLE HT+WGL+MAWLVLDG  P
Sbjct  504  AKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEAHTTWGLRMAWLVLDGSHP  563

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPPSDLPKC
Sbjct  564  NQKLLPPPSDLPKC  577



>ref|XP_002278275.1| PREDICTED: laccase-17 [Vitis vinifera]
 emb|CBI31652.3| unnamed protein product [Vitis vinifera]
Length=583

 Score =   372 bits (955),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 202/254 (80%), Positives = 223/254 (88%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP LP LNDTSFA+NF++KLRSL +  +PA VP+ VDK FFFTVGLGTNPC +N
Sbjct  330  KNLPVFKPTLPPLNDTSFAANFTRKLRSLANSEFPANVPKKVDKRFFFTVGLGTNPCPQN  389

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP+N TKFSAS+NNVSFV PTTA+LQAHF  QS  VY+ +FP +P   FNYTG PP
Sbjct  390  QTCQGPSNNTKFSASVNNVSFVLPTTAILQAHFFQQSKGVYTTDFPTTPTFPFNYTGTPP  449

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELV+QDTSILG ESHPLHLHGFNFF+VGQGFGNF+  KDP
Sbjct  450  NNTMVSNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHGFNFFLVGQGFGNFDSKKDP  509

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVP+GGWVAIRF ADNPGVWFMHCHLEVHTSWGLKMAW+V DGKLP
Sbjct  510  PKFNLVDPVERNTVGVPSGGWVAIRFFADNPGVWFMHCHLEVHTSWGLKMAWIVTDGKLP  569

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLP+C
Sbjct  570  NQKLPPPPSDLPQC  583



>ref|XP_008349706.1| PREDICTED: LOW QUALITY PROTEIN: laccase-17-like [Malus domestica]
Length=376

 Score =   365 bits (936),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 192/252 (76%), Positives = 215/252 (85%), Gaps = 1/252 (0%)
 Frame = +1

Query  10   PMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTC  189
            P+F+PILP +N TSF +NF+ KLRSL +  +PA VP+TV++ FFFTVGLGTNPC KNQTC
Sbjct  125  PLFRPILPLINATSFVANFTSKLRSLANSRFPANVPKTVERRFFFTVGLGTNPCPKNQTC  184

Query  190  QGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPL-HWFNYTGNPPNN  366
            QGPTN TKF+AS+NN+SF  P+ A+LQ+HF  QSN VYS +FP   L   FNYTG PPNN
Sbjct  185  QGPTNTTKFAASMNNISFALPSIAMLQSHFFAQSNSVYSTDFPYYSLPKPFNYTGTPPNN  244

Query  367  TMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKN  546
            T VSNGTKV+VL FNTSVELVMQ TSILGAESHPLHLHGFNFFVVGQGFGNF+   DP N
Sbjct  245  TNVSNGTKVVVLKFNTSVELVMQGTSILGAESHPLHLHGFNFFVVGQGFGNFDPNNDPSN  304

Query  547  FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQ  726
            FNLVDPVERNTVGVP+GGWVAIRFLADNPGVW MHCH +VH SWGL+MAW+V DGKLPNQ
Sbjct  305  FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWVVQDGKLPNQ  364

Query  727  KLLPPPSDLPKC  762
            KL PPPSDLPKC
Sbjct  365  KLPPPPSDLPKC  376



>ref|XP_010106521.1| hypothetical protein L484_025281 [Morus notabilis]
 gb|EXC10697.1| hypothetical protein L484_025281 [Morus notabilis]
Length=577

 Score =   371 bits (953),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 193/254 (76%), Positives = 216/254 (85%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ +  LP +NDTSFASNFS K RSL +  +PA VPQTV KHFFFTVGLGTNPC KN
Sbjct  324  KNLPILRLSLPQINDTSFASNFSNKFRSLATAKFPANVPQTVQKHFFFTVGLGTNPCPKN  383

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTN++KF+AS+NNVSF+ P+ ALLQ HF  +SN V++ +FP  PL  FNYTG PP
Sbjct  384  QTCQGPTNSSKFAASVNNVSFIMPSVALLQTHFFKKSNGVFTTDFPSFPLVQFNYTGTPP  443

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGTKV+VL +NTSVELV QDT ILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  444  NNTNVSNGTKVVVLKYNTSVELVFQDTGILGAESHPLHLHGFNFFVVGQGFGNFDPNKDP  503

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNT+GVP+GGW AIRFLADNPGVWFMHCH +VH SWGL+MAW+V DGKLP
Sbjct  504  AKFNLVDPVERNTIGVPSGGWAAIRFLADNPGVWFMHCHFDVHLSWGLRMAWIVQDGKLP  563

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  564  NQKLPPPPSDLPKC  577



>ref|XP_008359106.1| PREDICTED: laccase-17-like [Malus domestica]
Length=583

 Score =   371 bits (952),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 215/239 (90%), Gaps = 2/239 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDK-  177
            KKLP+FKPILPALNDTSFA+ FS KLRSL +  +PA VPQ VD+HFFFT+GLGTNPC   
Sbjct  330  KKLPLFKPILPALNDTSFATKFSNKLRSLANAQFPANVPQKVDRHFFFTIGLGTNPCSSN  389

Query  178  NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            NQTCQGP N T F+AS+NNVSF  PTTALLQAHFSGQSN VYSP+FP SP+  FNYTG P
Sbjct  390  NQTCQGP-NGTMFAASVNNVSFAMPTTALLQAHFSGQSNGVYSPDFPSSPIIPFNYTGTP  448

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PN+TMV NGTK+MVL +NTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF++ KD
Sbjct  449  PNDTMVGNGTKLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDRNKD  508

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            P NFNLVDPVERNTVGVP+GGWVAIRF+ADNPGVWFMHCHLE+HTSWGLKMAWLVLDGK
Sbjct  509  PANFNLVDPVERNTVGVPSGGWVAIRFVADNPGVWFMHCHLEIHTSWGLKMAWLVLDGK  567



>ref|XP_011042451.1| PREDICTED: laccase-17-like [Populus euphratica]
Length=581

 Score =   371 bits (952),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 205/254 (81%), Positives = 225/254 (89%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP++KP LP L DTSFA+NF+ KLRSL S  +PA VP+ VD+ FFF+VGLGTNPC KN
Sbjct  329  KKLPLYKPNLPPLTDTSFATNFTSKLRSLASAEFPANVPRKVDRQFFFSVGLGTNPCSKN  388

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T F+AS+NNVSFV PT ALLQAH  GQS  VYSPNFP++P   FNYTG PP
Sbjct  389  QTCQGP-NGTMFAASVNNVSFVMPTKALLQAHHFGQSKGVYSPNFPINPPIPFNYTGTPP  447

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMV+NGTK++VL FN SVEL+MQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  448  NNTMVNNGTKLVVLPFNASVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDAKKDP  507

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+VLDGKLP
Sbjct  508  ANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLP  567

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLPKC
Sbjct  568  NQKLLPPPADLPKC  581



>gb|EEC74953.1| hypothetical protein OsI_10938 [Oryza sativa Indica Group]
Length=531

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 191/256 (75%), Positives = 216/256 (84%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPC--D  174
            K LP+ +P LPALNDT+FA+ F+ KLRSL  P YP+ VP+ VDK FFF VGLGT PC   
Sbjct  276  KSLPLLRPSLPALNDTAFAAGFAAKLRSLACPDYPSNVPRRVDKPFFFAVGLGTTPCPGS  335

Query  175  KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
             NQTCQGPTN TKF+ASINNVSF  PTTALLQAH++GQS  VY+ +FP SPL  FNYTG 
Sbjct  336  NNQTCQGPTNTTKFTASINNVSFDMPTTALLQAHYTGQSAGVYTADFPASPLEPFNYTGT  395

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNT VSNGT+V+VL +N SVE+V+QDTSILGAESHPLHLHGF+FFVVGQG GN++ +K
Sbjct  396  PPNNTNVSNGTRVVVLPYNASVEVVLQDTSILGAESHPLHLHGFDFFVVGQGTGNYDPSK  455

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
             P  FNLVDPV+RNTVGVPAGGWVAIRF ADNPGVWFMHCHLEVHT+WGLKMAW+V DG 
Sbjct  456  HPAEFNLVDPVQRNTVGVPAGGWVAIRFFADNPGVWFMHCHLEVHTTWGLKMAWVVNDGP  515

Query  715  LPNQKLLPPPSDLPKC  762
            LP QKL+PPPSDLP C
Sbjct  516  LPEQKLMPPPSDLPMC  531



>ref|XP_010037821.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
 gb|KCW49587.1| hypothetical protein EUGRSUZ_K03111 [Eucalyptus grandis]
Length=589

 Score =   371 bits (952),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 195/253 (77%), Positives = 218/253 (86%), Gaps = 1/253 (0%)
 Frame = +1

Query  4    KLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQ  183
            KLP+ KP LP  NDT+FA  F++KLRSL++  +PAKVPQTVDK FFFTVGLG NPC KNQ
Sbjct  338  KLPILKPTLPKFNDTAFAMKFAQKLRSLNTARFPAKVPQTVDKKFFFTVGLGVNPCPKNQ  397

Query  184  TCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPN  363
            TCQGP N T  +ASINNVSFV P+TALLQAHF  QSN VY+ +FP  P   FNYTG PP+
Sbjct  398  TCQGPNN-TMLAASINNVSFVMPSTALLQAHFFKQSNGVYTTDFPTKPPFKFNYTGTPPS  456

Query  364  NTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPK  543
            N +V++GTKV+VL FNT+VELVMQDTSI+GAESHPLHLHGFNFFVVGQGFGNF   +DPK
Sbjct  457  NMLVTSGTKVVVLPFNTTVELVMQDTSIIGAESHPLHLHGFNFFVVGQGFGNFKPKRDPK  516

Query  544  NFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPN  723
            NFNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+V+DGK   
Sbjct  517  NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVMDGKGRK  576

Query  724  QKLLPPPSDLPKC  762
            QKL PPP+DLPKC
Sbjct  577  QKLPPPPADLPKC  589



>emb|CDM84967.1| unnamed protein product [Triticum aestivum]
 emb|CDM85765.1| unnamed protein product [Triticum aestivum]
Length=571

 Score =   370 bits (950),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 189/254 (74%), Positives = 215/254 (85%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ +P LP +NDTSF SN++ KLRSL +  YPA+VPQ VD+ FFFTVGLGT+PC  N
Sbjct  318  KNLPVLRPTLPQINDTSFVSNYTAKLRSLATEEYPAEVPQEVDRQFFFTVGLGTHPCAVN  377

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGPTN ++F+A++NNVSFV PTTALLQ+H++G SN VYS NFP  P   FNYTG PP
Sbjct  378  GTCQGPTNDSRFAAAVNNVSFVLPTTALLQSHYTGMSNGVYSSNFPAVPKSPFNYTGTPP  437

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGT+++VL++  +VELVMQ TSILGAESHP HLHGFNFFVVGQGFGNF+  KDP
Sbjct  438  NNTNVSNGTRLVVLSYGDAVELVMQGTSILGAESHPFHLHGFNFFVVGQGFGNFDPVKDP  497

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              +NLVDPVERNTVGVPA GWVAIRF ADNPGVWFMHCHLEVH SWGLKMAW+V DG LP
Sbjct  498  AKYNLVDPVERNTVGVPAAGWVAIRFRADNPGVWFMHCHLEVHVSWGLKMAWVVQDGSLP  557

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPPSDLPKC
Sbjct  558  NQKLLPPPSDLPKC  571



>ref|XP_002458747.1| hypothetical protein SORBIDRAFT_03g039530 [Sorghum bicolor]
 gb|EES03867.1| hypothetical protein SORBIDRAFT_03g039530 [Sorghum bicolor]
Length=579

 Score =   370 bits (950),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 191/254 (75%), Positives = 216/254 (85%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP  KP LP +NDTSF +N++ KLRSL +  YPA VPQ VD+ FFFTVGLGT+PC  N
Sbjct  326  KNLPALKPTLPQINDTSFVANYTAKLRSLATAEYPAAVPQEVDRRFFFTVGLGTHPCAVN  385

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGPTN+++F+AS+NNVSFV PTTALLQ+HF+G+S  VYS NFP +PL  FNYTG PP
Sbjct  386  GTCQGPTNSSRFAASVNNVSFVLPTTALLQSHFAGKSKGVYSSNFPAAPLVPFNYTGTPP  445

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V+NGTK++VL +  SVELV+Q TSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  446  NNTNVANGTKLVVLPYGASVELVLQGTSILGAESHPLHLHGFNFFVVGQGFGNFDPAKDP  505

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              +NLVDPVERNTVGVPA GWVAIRF ADNPGVWFMHCHLEVH SWGLKMAWLVLDG  P
Sbjct  506  AKYNLVDPVERNTVGVPAAGWVAIRFRADNPGVWFMHCHLEVHVSWGLKMAWLVLDGDRP  565

Query  721  NQKLLPPPSDLPKC  762
            N+KLLPPPSDLP+C
Sbjct  566  NEKLLPPPSDLPRC  579



>ref|NP_001049699.1| Os03g0273200 [Oryza sativa Japonica Group]
 sp|Q10ND7.1|LAC10_ORYSJ RecName: Full=Laccase-10; AltName: Full=Benzenediol:oxygen oxidoreductase 
10; AltName: Full=Diphenol oxidase 10; AltName: 
Full=Urishiol oxidase 10; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|ABF95230.1| laccase, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11613.1| Os03g0273200 [Oryza sativa Japonica Group]
 dbj|BAG92951.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87502.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58784.1| hypothetical protein OsJ_10313 [Oryza sativa Japonica Group]
Length=578

 Score =   369 bits (948),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 191/256 (75%), Positives = 216/256 (84%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPC--D  174
            K LP+ +P LPALNDT+FA+ F+ KLRSL  P YP+ VP+ VDK FFF VGLGT PC   
Sbjct  323  KSLPLLRPSLPALNDTAFAAGFAAKLRSLACPDYPSNVPRRVDKPFFFAVGLGTTPCPGS  382

Query  175  KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
             NQTCQGPTN TKF+ASINNVSF  PTTALLQAH++GQS  VY+ +FP SPL  FNYTG 
Sbjct  383  NNQTCQGPTNTTKFTASINNVSFDMPTTALLQAHYTGQSAGVYTADFPASPLEPFNYTGT  442

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNT VSNGT+V+VL +N SVE+V+QDTSILGAESHPLHLHGF+FFVVGQG GN++ +K
Sbjct  443  PPNNTNVSNGTRVVVLPYNASVEVVLQDTSILGAESHPLHLHGFDFFVVGQGTGNYDPSK  502

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
             P  FNLVDPV+RNTVGVPAGGWVAIRF ADNPGVWFMHCHLEVHT+WGLKMAW+V DG 
Sbjct  503  HPAEFNLVDPVQRNTVGVPAGGWVAIRFFADNPGVWFMHCHLEVHTTWGLKMAWVVNDGP  562

Query  715  LPNQKLLPPPSDLPKC  762
            LP QKL+PPPSDLP C
Sbjct  563  LPEQKLMPPPSDLPMC  578



>ref|XP_010275879.1| PREDICTED: laccase-17-like [Nelumbo nucifera]
Length=584

 Score =   369 bits (948),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 196/250 (78%), Positives = 218/250 (87%), Gaps = 1/250 (0%)
 Frame = +1

Query  13   MFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTCQ  192
            + KP LP LNDT+ A+NF+K+LRSL +  +PA VPQTVD+ FFFTVGLG++PC +NQTCQ
Sbjct  336  LLKPTLPPLNDTTLATNFAKRLRSLATAQFPANVPQTVDRRFFFTVGLGSSPCPQNQTCQ  395

Query  193  GPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNTM  372
            GP N TKFSASINNVSF  P TALLQAHF GQ+  VY+ +FP +P   FNYTG PPNNT 
Sbjct  396  GP-NGTKFSASINNVSFALPNTALLQAHFFGQAKGVYTTDFPTNPPFPFNYTGTPPNNTF  454

Query  373  VSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKNFN  552
            V+N TKV+VL FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP +FN
Sbjct  455  VNNATKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPASFN  514

Query  553  LVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKL  732
            LVDPVERNTVGVP+GGWVAIRF+ADNPGVWFMHCHLEVHTSWGLKMAW V+DGKLPNQKL
Sbjct  515  LVDPVERNTVGVPSGGWVAIRFIADNPGVWFMHCHLEVHTSWGLKMAWAVMDGKLPNQKL  574

Query  733  LPPPSDLPKC  762
             PPPSDLPKC
Sbjct  575  PPPPSDLPKC  584



>ref|XP_006644993.1| PREDICTED: laccase-4-like [Oryza brachyantha]
Length=578

 Score =   369 bits (947),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 190/254 (75%), Positives = 216/254 (85%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+F+P LP LNDT F +NF+ KLRSL +  YPA VPQ+VD+ FFFTVGLGT PC  N
Sbjct  326  KGLPLFRPTLPQLNDTDFVTNFTNKLRSLATAQYPAAVPQSVDRRFFFTVGLGTLPCPAN  385

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N T+ +A++NNVSFV P+ ALLQ+HF+G S  VY+P+FPV+PL  FNYTG PP
Sbjct  386  MTCQGP-NGTQMAAAMNNVSFVLPSRALLQSHFTGLSTGVYAPDFPVAPLSPFNYTGTPP  444

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V+ GTK++VL +N SVELVMQDTSILG ESHPLHLHGFNFFVVGQGFGN++   DP
Sbjct  445  NNTNVATGTKLLVLPYNASVELVMQDTSILGIESHPLHLHGFNFFVVGQGFGNYDAVNDP  504

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHT+WGL+MAWLVLDG  P
Sbjct  505  AKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTTWGLRMAWLVLDGSQP  564

Query  721  NQKLLPPPSDLPKC  762
            +QKLLPPPSDLPKC
Sbjct  565  DQKLLPPPSDLPKC  578



>ref|NP_001147942.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG29196.1| L-ascorbate oxidase precursor [Zea mays]
Length=582

 Score =   369 bits (947),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 192/254 (76%), Positives = 216/254 (85%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP  KP LP +NDTSF +N++ +LRSL +  YPA VP+ V + FFFTVGLGT+PC  N
Sbjct  329  KNLPALKPTLPQINDTSFVANYTARLRSLATAEYPADVPREVHRRFFFTVGLGTHPCAVN  388

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGPTN+++F+AS+NNVSFV PTTALLQ+HF+G+S  VYS NFP +PL  FNYTG PP
Sbjct  389  GTCQGPTNSSRFAASVNNVSFVLPTTALLQSHFAGKSRGVYSSNFPAAPLVPFNYTGTPP  448

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGTK++VL + TSVELVMQ TSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  449  NNTNVSNGTKLVVLPYGTSVELVMQGTSILGAESHPLHLHGFNFFVVGQGFGNFDPAKDP  508

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              +NLVDPVERNTVGVPA GWVAIRF ADNPGVWFMHCHLEVH SWGLKMAWLVLDG  P
Sbjct  509  AKYNLVDPVERNTVGVPAAGWVAIRFRADNPGVWFMHCHLEVHVSWGLKMAWLVLDGDRP  568

Query  721  NQKLLPPPSDLPKC  762
            N+KLLPPPSDLPKC
Sbjct  569  NEKLLPPPSDLPKC  582



>ref|XP_008384938.1| PREDICTED: laccase-2-like [Malus domestica]
Length=585

 Score =   369 bits (947),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 192/251 (76%), Positives = 216/251 (86%), Gaps = 0/251 (0%)
 Frame = +1

Query  10   PMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTC  189
            P+F+PILP +N TSF +NF+ KLRSL +  +PA VP+TV++ FFFTVGLGTNPC KNQTC
Sbjct  335  PLFRPILPQINATSFVANFTSKLRSLANSRFPANVPKTVERRFFFTVGLGTNPCPKNQTC  394

Query  190  QGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNT  369
            QGPTN TKF+AS+NN+SF  P+ A+LQ+HF  QSN VYS +FP+ P   FNYTG PPNNT
Sbjct  395  QGPTNTTKFAASMNNISFALPSXAMLQSHFFAQSNSVYSTDFPIIPPKPFNYTGTPPNNT  454

Query  370  MVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKNF  549
             VSNGTKV+VL FNTSVELVMQ TSILGAESHPLHLHGFNFFVVGQGFGNF+   DP NF
Sbjct  455  NVSNGTKVVVLKFNTSVELVMQGTSILGAESHPLHLHGFNFFVVGQGFGNFDPNNDPSNF  514

Query  550  NLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQK  729
            NLVDPVERNTVGVP+GGWVAIRFLADNPGVW MHCH +VH SWGL+MAW+V DGKLPNQK
Sbjct  515  NLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWVVQDGKLPNQK  574

Query  730  LLPPPSDLPKC  762
            L PPPSDLPKC
Sbjct  575  LPPPPSDLPKC  585



>ref|XP_010690924.1| PREDICTED: laccase-17-like [Beta vulgaris subsp. vulgaris]
Length=582

 Score =   369 bits (947),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 199/259 (77%), Positives = 215/259 (83%), Gaps = 5/259 (2%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+FKP LPAL DTSF SNF+ KLRSL +  YPA VP+ VDKHFFFTVGLGTNPC KN
Sbjct  324  KKLPLFKPTLPALRDTSFVSNFTNKLRSLANAQYPANVPKNVDKHFFFTVGLGTNPCPKN  383

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSG-----QSNHVYSPNFPVSPLHWFNY  345
             TCQGP N T F+AS+NNVSFV PT ALLQ HF       Q   V++ + P SPL  FNY
Sbjct  384  HTCQGPNNKTMFAASVNNVSFVMPTKALLQTHFIQSHSLHQLQRVFTTDLPSSPLIPFNY  443

Query  346  TGNPPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfn  525
            TG PPNNTMV +GTKV+ + FNTSVELVMQDTSILG ESHPLHLHGFNFFVVGQGFGNF+
Sbjct  444  TGMPPNNTMVIDGTKVVAVPFNTSVELVMQDTSILGVESHPLHLHGFNFFVVGQGFGNFD  503

Query  526  qTKDPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVL  705
              KDP  +NLVDPVERNTVGVP+GGWVAIRF ADNPGVWFMHCHLEVHTSWGLKMAW+V 
Sbjct  504  AEKDPAKYNLVDPVERNTVGVPSGGWVAIRFFADNPGVWFMHCHLEVHTSWGLKMAWVVQ  563

Query  706  DGKLPNQKLLPPPSDLPKC  762
            DGKLPNQKL PPPSDLPKC
Sbjct  564  DGKLPNQKLPPPPSDLPKC  582



>gb|ACN34362.1| unknown [Zea mays]
 tpg|DAA56880.1| TPA: putative laccase family protein [Zea mays]
Length=582

 Score =   368 bits (945),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 191/254 (75%), Positives = 216/254 (85%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP  KP LP +NDTSF +N++ +LRSL +  YPA VP+ V + FFFTVGLGT+PC  N
Sbjct  329  KNLPALKPTLPQINDTSFVANYTARLRSLATAEYPADVPREVHRRFFFTVGLGTHPCAVN  388

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGPTN+++F+AS+NNVSFV PTTALLQ+HF+G+S  VYS NFP +PL  FNYTG PP
Sbjct  389  GTCQGPTNSSRFAASVNNVSFVLPTTALLQSHFAGKSRGVYSSNFPAAPLVPFNYTGTPP  448

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGTK++VL + TSVELVMQ TSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  449  NNTNVSNGTKLVVLPYGTSVELVMQGTSILGAESHPLHLHGFNFFVVGQGFGNFDPAKDP  508

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              +NLVDPVERNTVGVPA GWVAIRF ADNPGVWFMHCHLEVH SWGLKMAWLVLDG+ P
Sbjct  509  AKYNLVDPVERNTVGVPAAGWVAIRFRADNPGVWFMHCHLEVHVSWGLKMAWLVLDGERP  568

Query  721  NQKLLPPPSDLPKC  762
            N+KLLPPPSDLP C
Sbjct  569  NEKLLPPPSDLPTC  582



>ref|XP_002308164.1| hypothetical protein POPTR_0006s08740g [Populus trichocarpa]
 gb|EEE91687.1| hypothetical protein POPTR_0006s08740g [Populus trichocarpa]
Length=580

 Score =   368 bits (945),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 192/254 (76%), Positives = 216/254 (85%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP  KP LP +N T F +NF+KK RSL +  +PA VPQTVD+ FFFTVGLGTNPC KN
Sbjct  327  KKLPTLKPTLPPINATGFVANFTKKFRSLANAKFPANVPQTVDRKFFFTVGLGTNPCPKN  386

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N TKF+ASINNVSFV P+ ALLQ++F GQSN V++ +FP +P   FNYTG PP
Sbjct  387  TTCQGPNNNTKFAASINNVSFVLPSVALLQSYFFGQSNGVFTSDFPQNPTIPFNYTGTPP  446

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTK +VL FNTSVELVMQ TSI+ AESHPLHLHGFNFFVVGQGFGN++  KDP
Sbjct  447  NNTMVSNGTKAVVLTFNTSVELVMQGTSIVAAESHPLHLHGFNFFVVGQGFGNYDPNKDP  506

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP+ERNT GVPAGGW+AIRFLADNPGVWFMHCHL+VHTSWGL+MAW+VLDG  P
Sbjct  507  SNFNLVDPMERNTAGVPAGGWIAIRFLADNPGVWFMHCHLDVHTSWGLRMAWIVLDGPQP  566

Query  721  NQKLLPPPSDLPKC  762
            NQK+ PPPSDLPKC
Sbjct  567  NQKIPPPPSDLPKC  580



>ref|XP_011019845.1| PREDICTED: laccase-2-like [Populus euphratica]
Length=580

 Score =   368 bits (944),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 193/254 (76%), Positives = 216/254 (85%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP  KP LP  N T F +NF+KK RSL +  +PA VPQTVD+ FFFTVGLGT+PC KN
Sbjct  327  KKLPSLKPTLPPTNATGFVANFTKKFRSLANAKFPANVPQTVDRKFFFTVGLGTHPCPKN  386

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N TKF+ASINNVSFV P+ ALLQ++F GQSN V++ +FP +P   FNYTG PP
Sbjct  387  TTCQGPNNNTKFAASINNVSFVLPSVALLQSYFFGQSNGVFTSDFPQNPTIPFNYTGTPP  446

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTK +VL FNTSVELVMQ TSILGAESHPLHLHG+NFFVVGQGFGN++  KDP
Sbjct  447  NNTMVSNGTKTVVLAFNTSVELVMQGTSILGAESHPLHLHGYNFFVVGQGFGNYDPNKDP  506

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNT GVPAGGWVAIRFLADNPG+WFMHCHL+VHTSWGL+MAW+VLDG  P
Sbjct  507  SNFNLVDPVERNTAGVPAGGWVAIRFLADNPGLWFMHCHLDVHTSWGLRMAWIVLDGPQP  566

Query  721  NQKLLPPPSDLPKC  762
            NQK+ PPPSDLPKC
Sbjct  567  NQKIPPPPSDLPKC  580



>ref|XP_002520232.1| laccase, putative [Ricinus communis]
 gb|EEF42144.1| laccase, putative [Ricinus communis]
Length=578

 Score =   368 bits (944),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 191/254 (75%), Positives = 216/254 (85%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KK+P+FKP LPALND+SF   ++ KLRSL S  +PA VPQ +D+ FFFT+GLGT PC +N
Sbjct  326  KKIPLFKPSLPALNDSSFVMKYTNKLRSLASEEFPANVPQRIDRRFFFTIGLGTKPCPRN  385

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            +TCQGP N  KF+AS NNVSF  PT ALLQ+HF GQ+  VY+ +FP + L  FNYTGNPP
Sbjct  386  ETCQGP-NGAKFAASANNVSFTMPTKALLQSHFLGQAKGVYTLDFPRTVLFRFNYTGNPP  444

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVS GTKV+ L+FNTS+EL+MQDTSILG ESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  445  NNTMVSTGTKVVKLHFNTSIELIMQDTSILGVESHPLHLHGFNFFVVGQGFGNFDPKKDP  504

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+V DGK P
Sbjct  505  SKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVNDGKHP  564

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLP C
Sbjct  565  NQKLLPPPADLPNC  578



>ref|XP_003564592.1| PREDICTED: laccase-4-like [Brachypodium distachyon]
Length=577

 Score =   368 bits (944),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 189/254 (74%), Positives = 214/254 (84%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP+LP  NDT F +NF+ KLRSL +  YPA VPQTVDK FFFT+GLGT PC KN
Sbjct  325  KNLPLFKPMLPRFNDTKFVTNFTTKLRSLATTKYPAAVPQTVDKRFFFTIGLGTLPCPKN  384

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N T+F+A++NNVS V PT ALLQ+HF+G +  VY+ +FP  PL  FNYTG PP
Sbjct  385  MTCQGP-NGTQFAAAVNNVSLVLPTKALLQSHFTGLTTGVYASDFPAMPLSPFNYTGTPP  443

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V+ GTK++ L FNTSVELVMQDTS+LG ESHPLHLHGFN+FVVGQGFGN++  KDP
Sbjct  444  NNTNVATGTKLLALPFNTSVELVMQDTSVLGIESHPLHLHGFNYFVVGQGFGNYDSAKDP  503

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHT+WGL+MAWLV DG  P
Sbjct  504  AKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTTWGLRMAWLVHDGSKP  563

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPPSD+PKC
Sbjct  564  NQKLLPPPSDMPKC  577



>ref|NP_001131665.1| uncharacterized protein LOC100193025 precursor [Zea mays]
 gb|ACF80182.1| unknown [Zea mays]
 tpg|DAA44632.1| TPA: putative laccase family protein [Zea mays]
Length=576

 Score =   367 bits (943),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 191/254 (75%), Positives = 221/254 (87%), Gaps = 2/254 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            + LP+F+P LPALNDT+FA+N+S +LRSL +P YPA VP+ VD+ FFF VGLGTNPC  N
Sbjct  325  RSLPLFRPSLPALNDTAFAANYSARLRSLATPDYPANVPRAVDRSFFFAVGLGTNPCPVN  384

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T F+AS+NNVSF  PTTALLQAH+ G    VY+P+FPV+PL  FNYTG PP
Sbjct  385  QTCQGP-NGTMFTASMNNVSFNMPTTALLQAHY-GSVAGVYTPDFPVAPLEPFNYTGTPP  442

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VS+GTKV+VL++NTSVE+V+Q TSILGAESHPLHLHGF+FFVVGQGFGN++ +KDP
Sbjct  443  NNTNVSHGTKVVVLDYNTSVEVVLQATSILGAESHPLHLHGFDFFVVGQGFGNYDSSKDP  502

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPV+RNTVGVPAGGWVAIRF ADNPGVWFMHCHLEVHTSWGLKMAW+V DG LP
Sbjct  503  PKFNLVDPVQRNTVGVPAGGWVAIRFFADNPGVWFMHCHLEVHTSWGLKMAWVVNDGPLP  562

Query  721  NQKLLPPPSDLPKC  762
             QKL+PPP+DLPKC
Sbjct  563  EQKLMPPPADLPKC  576



>ref|XP_010264410.1| PREDICTED: laccase-17-like [Nelumbo nucifera]
Length=583

 Score =   367 bits (943),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 189/255 (74%), Positives = 219/255 (86%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K+LP+F+P LP +NDT+F +NFS ++RSL +  +PA VPQTVDK FFFTVGLG++PC KN
Sbjct  329  KQLPLFRPTLPPINDTAFVANFSSRIRSLATTQFPANVPQTVDKRFFFTVGLGSSPCPKN  388

Query  181  QTCQGPTNAT-KFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            Q+CQGP N T KF+AS+NN+SF  PTTA+LQAHF GQ   VY+ +FP++P   FNYTG P
Sbjct  389  QSCQGPNNGTRKFAASVNNISFALPTTAILQAHFFGQEKGVYTSDFPINPPFPFNYTGTP  448

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNT+VSNGTKV+VL FNTSVELVMQ TSILGAESHPLHLHGFNFFVVGQGFG+F+  KD
Sbjct  449  PNNTLVSNGTKVVVLPFNTSVELVMQGTSILGAESHPLHLHGFNFFVVGQGFGSFDPNKD  508

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P NFNLVDP ERNTVGVP+GGWVAIRFL+DNPG WFMHCH EVH SWGL+M W+VLDG+ 
Sbjct  509  PPNFNLVDPAERNTVGVPSGGWVAIRFLSDNPGAWFMHCHFEVHLSWGLRMVWIVLDGEH  568

Query  718  PNQKLLPPPSDLPKC  762
            PNQKL PPPSDLPKC
Sbjct  569  PNQKLPPPPSDLPKC  583



>gb|AFW84624.1| putative laccase family protein [Zea mays]
Length=584

 Score =   367 bits (943),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 188/254 (74%), Positives = 217/254 (85%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ +P LP LNDTSF  NF+ KLRSL +P YPA VP+TVD+ FFFTVGLGT+PC  N
Sbjct  331  KALPLHRPTLPQLNDTSFVGNFTAKLRSLATPQYPAAVPRTVDRAFFFTVGLGTHPCPGN  390

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TC GPTN T+F+A++NNVSFV PT ALL +HF+G S+ VYS +FPV+PL  FNYTG PP
Sbjct  391  ATCLGPTNTTQFAAAVNNVSFVLPTRALLHSHFAGLSSGVYSSDFPVAPLTPFNYTGTPP  450

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V++GTK+MV+ +  +VELV+Q TSILG ESHPLHLHGFNFFVVGQG+GN++   DP
Sbjct  451  NNTNVASGTKLMVVPYGANVELVLQGTSILGVESHPLHLHGFNFFVVGQGYGNYDPVNDP  510

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHT+WGL+MAWLVLDG LP
Sbjct  511  PKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTTWGLRMAWLVLDGSLP  570

Query  721  NQKLLPPPSDLPKC  762
            +QKLLPPPSDLPKC
Sbjct  571  HQKLLPPPSDLPKC  584



>dbj|BAJ99773.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=577

 Score =   367 bits (942),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 188/254 (74%), Positives = 218/254 (86%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP+LP  NDT+F +NF+ KLRSL +  YPA VPQ+VD+ FFFT+GLGT PC KN
Sbjct  325  KALPIFKPMLPYYNDTNFVTNFTTKLRSLATKQYPAAVPQSVDRRFFFTIGLGTLPCPKN  384

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N T+F+A++NNVS V P+TALLQ+HF+G ++ VY+ NFPV PL  FNYTG PP
Sbjct  385  MTCQGP-NGTQFAAAVNNVSLVLPSTALLQSHFTGLTSGVYAANFPVMPLSPFNYTGTPP  443

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V+ GTK++ ++FNTSVELVMQDTSILG ESHPLHLHGFNFFVVGQGFGN++   DP
Sbjct  444  NNTNVATGTKLLAVSFNTSVELVMQDTSILGIESHPLHLHGFNFFVVGQGFGNYDAVNDP  503

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHT+WGL+MAWLV DG  P
Sbjct  504  AKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTTWGLRMAWLVQDGSKP  563

Query  721  NQKLLPPPSDLPKC  762
            +QKLLPPPSD+PKC
Sbjct  564  SQKLLPPPSDMPKC  577



>ref|NP_001146658.1| uncharacterized protein LOC100280258 precursor [Zea mays]
 gb|ACL54479.1| unknown [Zea mays]
Length=584

 Score =   367 bits (942),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 188/254 (74%), Positives = 217/254 (85%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ +P LP LNDTSF  NF+ KLRSL +P YPA VP+TVD+ FFFTVGLGT+PC  N
Sbjct  331  KALPLHRPTLPQLNDTSFVGNFTAKLRSLATPQYPAAVPRTVDRAFFFTVGLGTHPCPGN  390

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TC GPTN T+F+A++NNVSFV PT ALL +HF+G S+ VYS +FPV+PL  FNYTG PP
Sbjct  391  ATCLGPTNTTQFAAAVNNVSFVLPTRALLHSHFAGLSSGVYSSDFPVAPLTPFNYTGTPP  450

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V++GTK+MV+ +  +VELV+Q TSILG ESHPLHLHGFNFFVVGQG+GN++   DP
Sbjct  451  NNTNVASGTKLMVVPYGANVELVLQGTSILGVESHPLHLHGFNFFVVGQGYGNYDPVNDP  510

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHT+WGL+MAWLVLDG LP
Sbjct  511  PKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTTWGLRMAWLVLDGSLP  570

Query  721  NQKLLPPPSDLPKC  762
            +QKLLPPPSDLPKC
Sbjct  571  HQKLLPPPSDLPKC  584



>ref|XP_007132049.1| hypothetical protein PHAVU_011G062600g [Phaseolus vulgaris]
 gb|ESW04043.1| hypothetical protein PHAVU_011G062600g [Phaseolus vulgaris]
Length=607

 Score =   367 bits (942),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 189/255 (74%), Positives = 218/255 (85%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K +P FKP LPA+NDTSF +NFS K RSL++  YPAKVPQ VDK FFFTVGLGT+PC KN
Sbjct  353  KNIPTFKPSLPAINDTSFVANFSSKFRSLNTAKYPAKVPQKVDKSFFFTVGLGTSPCPKN  412

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNH-VYSPNFPVSPLHWFNYTGNP  357
            QTCQGP N++KF+AS+NN+SF  P+ ALLQ HF GQ+N+ +Y+ +FP  PL  FNYTG P
Sbjct  413  QTCQGPNNSSKFAASMNNISFTLPSVALLQQHFFGQANNGIYTTDFPAVPLRTFNYTGTP  472

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNT V+NGTK +V+ FNT V++V+QDTSILGAESHPLHLHGFNF+VVGQGFGNFN   D
Sbjct  473  PNNTRVTNGTKTVVILFNTKVQVVLQDTSILGAESHPLHLHGFNFYVVGQGFGNFNPITD  532

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P NFNLVDPVERNTVGVP+GGWVAIRFLADNPGVW MHCH +VH SWGL+MAW+V DGKL
Sbjct  533  PPNFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWIVEDGKL  592

Query  718  PNQKLLPPPSDLPKC  762
            PNQKL PPP+DLPKC
Sbjct  593  PNQKLPPPPADLPKC  607



>ref|XP_002531565.1| laccase, putative [Ricinus communis]
 gb|EEF30831.1| laccase, putative [Ricinus communis]
Length=577

 Score =   366 bits (939),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 187/254 (74%), Positives = 218/254 (86%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            ++LP+FKP LP +N T F +N +++ RSL +  +PA VPQ VD+ FFFTVGLGTNPC  N
Sbjct  324  RQLPLFKPTLPPINATGFVANITRRFRSLANAKFPANVPQNVDRKFFFTVGLGTNPCPAN  383

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGPTN TKFSASINNVSF+ P+ +LLQ+++ G+SN +++ +FP +P   FNYTG PP
Sbjct  384  TTCQGPTNTTKFSASINNVSFLMPSVSLLQSYYFGKSNGIFTADFPQNPPTPFNYTGTPP  443

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGT+ ++L FNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN+N  KDP
Sbjct  444  NNTNVSNGTRALMLRFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYNSNKDP  503

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP+ERNTVGVPAGGWVAIRFLADNPGVWFMHCHL+VHTSWGL+MAWLVL+G  P
Sbjct  504  ANFNLVDPMERNTVGVPAGGWVAIRFLADNPGVWFMHCHLDVHTSWGLRMAWLVLNGPQP  563

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  564  NQKLQPPPSDLPKC  577



>ref|XP_006649837.1| PREDICTED: laccase-10-like [Oryza brachyantha]
Length=576

 Score =   366 bits (939),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 191/254 (75%), Positives = 213/254 (84%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K  P+F+P LP LNDT+FA++F+ KLRSL SP YPA VP+ VDK FFFTVGLGT PC  N
Sbjct  323  KSHPLFRPSLPVLNDTAFATSFAAKLRSLASPDYPANVPRRVDKPFFFTVGLGTTPCPGN  382

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTN TKF+A++NNVSF  PTTALLQAH+S  S  VY+ +FP  PL  FNYTG PP
Sbjct  383  QTCQGPTNTTKFTAAMNNVSFDMPTTALLQAHYSANSAGVYTADFPAVPLEPFNYTGTPP  442

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGTKV VL +N SVE  +QDTSILGAESHPLHLHGF+FFVVGQG GN++ +K P
Sbjct  443  NNTNVSNGTKVAVLPYNASVEGGVQDTSILGAESHPLHLHGFDFFVVGQGTGNYDPSKHP  502

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPV+RNTVGVPAGGWVAIRF ADNPGVWFMHCHLEVHTSWGLKMAW+V DG LP
Sbjct  503  AEFNLVDPVQRNTVGVPAGGWVAIRFFADNPGVWFMHCHLEVHTSWGLKMAWVVNDGPLP  562

Query  721  NQKLLPPPSDLPKC  762
             QKL+PPPSDLPKC
Sbjct  563  EQKLMPPPSDLPKC  576



>ref|XP_004294638.1| PREDICTED: laccase-17-like [Fragaria vesca subsp. vesca]
Length=581

 Score =   366 bits (939),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 206/258 (80%), Positives = 225/258 (87%), Gaps = 5/258 (2%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDK-  177
            KKLP+ KPILP LNDTSFA+ FS KLRSL++P +PA VPQ VDK  FFT+GLGTNPC + 
Sbjct  325  KKLPLHKPILPVLNDTSFATKFSNKLRSLNTPQFPANVPQKVDKRLFFTIGLGTNPCSQQ  384

Query  178  ---NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYT  348
               NQTCQGP N T F+ASINN+SF  P TALLQ+HF GQSN VYSP FP+SPL  FNYT
Sbjct  385  KHNNQTCQGP-NVTMFAASINNISFTMPNTALLQSHFFGQSNGVYSPYFPISPLIPFNYT  443

Query  349  GNPPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnq  528
            G   NNT VSNGTK+MVL FNTSVELV+QDTSILGAESHPLHLHGFNFFVVGQGFGN++Q
Sbjct  444  GAQLNNTNVSNGTKLMVLPFNTSVELVLQDTSILGAESHPLHLHGFNFFVVGQGFGNYDQ  503

Query  529  TKDPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLD  708
             KDPK FNL+DPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLE+HTSWGL+MAWLVLD
Sbjct  504  NKDPKKFNLIDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLRMAWLVLD  563

Query  709  GKLPNQKLLPPPSDLPKC  762
            GKLPNQKLLPPP DLPKC
Sbjct  564  GKLPNQKLLPPPLDLPKC  581



>gb|AAB17191.1| laccase [Liriodendron tulipifera]
Length=570

 Score =   365 bits (938),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 192/253 (76%), Positives = 219/253 (87%), Gaps = 1/253 (0%)
 Frame = +1

Query  4    KLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQ  183
            KL +FK  LPALNDT++A+ +S++LRSL +  +PA VPQTVDKHFFFT+GL  +PC KNQ
Sbjct  319  KLQIFKASLPALNDTAYAAKYSQRLRSLANAQFPANVPQTVDKHFFFTIGLSADPCPKNQ  378

Query  184  TCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPN  363
            TCQGP N TKFSAS+NN+SFV PTTALLQAHF GQSN VY+  FP +PL  FNYTG PPN
Sbjct  379  TCQGP-NGTKFSASMNNISFVLPTTALLQAHFFGQSNGVYNTTFPNNPLFPFNYTGTPPN  437

Query  364  NTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPK  543
            NT VS+GTKV+V+ FNTSVE+V+Q+TSILG ESH LHLHG+NFFVVGQGFGNF+  KDP 
Sbjct  438  NTFVSHGTKVVVIPFNTSVEVVLQNTSILGMESHLLHLHGYNFFVVGQGFGNFDPDKDPA  497

Query  544  NFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPN  723
             FNLVDP+ERNTVGVP+GGW AIRF ADNPGVWFMHCH +VH SWGLKMAW+VLDGKLPN
Sbjct  498  KFNLVDPIERNTVGVPSGGWAAIRFRADNPGVWFMHCHFDVHLSWGLKMAWVVLDGKLPN  557

Query  724  QKLLPPPSDLPKC  762
            QKLLPPPSDLPKC
Sbjct  558  QKLLPPPSDLPKC  570



>ref|XP_004984718.1| PREDICTED: laccase-10-like [Setaria italica]
Length=570

 Score =   365 bits (938),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 190/254 (75%), Positives = 220/254 (87%), Gaps = 2/254 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+F+P LPALNDT+FA+N+S +LRSL +P YPA VP+ VD+ FFF VGLGTNPC  N
Sbjct  319  KSLPLFRPSLPALNDTAFAANYSARLRSLATPDYPANVPRGVDRSFFFAVGLGTNPCPAN  378

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N + F+AS+NNVSF  PTTALLQAH++  +  VY+ +FPV+PL  FNYTG PP
Sbjct  379  QTCQGP-NGSMFTASMNNVSFDMPTTALLQAHYNNIAG-VYTTDFPVAPLEPFNYTGTPP  436

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGTKV+VL +NTSVE+V+QDTSILGAESHPLHLHGF+FFVVGQGFGN++ +KDP
Sbjct  437  NNTNVSNGTKVVVLQYNTSVEVVLQDTSILGAESHPLHLHGFDFFVVGQGFGNYDSSKDP  496

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPV+RNTVGVPAGGWVAIRF ADNPGVWFMHCHLEVHTSWGLKMAW+V DG LP
Sbjct  497  AKFNLVDPVQRNTVGVPAGGWVAIRFFADNPGVWFMHCHLEVHTSWGLKMAWVVNDGPLP  556

Query  721  NQKLLPPPSDLPKC  762
             QKL+PPP+DLP C
Sbjct  557  EQKLMPPPADLPMC  570



>ref|XP_010920540.1| PREDICTED: laccase-10-like [Elaeis guineensis]
Length=575

 Score =   365 bits (938),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 192/254 (76%), Positives = 217/254 (85%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ KP LP+LNDT+FA+NF+ KLRSL +  +PA VPQTVDK F+FTVGLGT+PC KN
Sbjct  323  KNLPLSKPTLPSLNDTAFAANFTGKLRSLANAQFPANVPQTVDKRFYFTVGLGTSPCPKN  382

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKF+AS+NN+SF  P+TALLQAHF GQS  VY+ +FP +P   FNYTG PP
Sbjct  383  QTCQGP-NGTKFAASVNNISFALPSTALLQAHFLGQSKGVYTTDFPSNPPFPFNYTGTPP  441

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V+NGTK +VL FN SVELVMQDTSI G ESHPLHLHGFNFFVVGQGFGN++ +KDP
Sbjct  442  NNTFVTNGTKAVVLPFNASVELVMQDTSIQGNESHPLHLHGFNFFVVGQGFGNYDPSKDP  501

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNL DP+ERNT GVPAGGWVAIRF ADNPGVWFMHCHL+VHTSWGL+MAW+V DG LP
Sbjct  502  AKFNLADPIERNTFGVPAGGWVAIRFQADNPGVWFMHCHLDVHTSWGLRMAWVVNDGPLP  561

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPPSDLPKC
Sbjct  562  NQKLLPPPSDLPKC  575



>gb|EMT20803.1| Laccase-4 [Aegilops tauschii]
Length=578

 Score =   365 bits (938),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 188/254 (74%), Positives = 215/254 (85%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP+LP  NDT+F +NF+ KLRSL +  YPA VPQ VD+ FFFT+GLGT PC KN
Sbjct  326  KALPIFKPMLPYFNDTNFVTNFTTKLRSLATKQYPAAVPQAVDRRFFFTIGLGTLPCPKN  385

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N T+F+A++NNVS V PTTALLQ+HF+G ++ VY+ NFP  PL  FNYTG PP
Sbjct  386  MTCQGP-NGTQFAAAVNNVSLVLPTTALLQSHFTGLTSGVYAANFPAMPLSPFNYTGTPP  444

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V+ GTK++ L+FNTSVELVMQDTSILG ESHPLHLHGFNFFVVGQGFGN++   DP
Sbjct  445  NNTHVATGTKLLALSFNTSVELVMQDTSILGIESHPLHLHGFNFFVVGQGFGNYDAVNDP  504

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHT+WGL+MAW V DG  P
Sbjct  505  AKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTTWGLRMAWQVQDGSKP  564

Query  721  NQKLLPPPSDLPKC  762
            +QKLLPPPSD+PKC
Sbjct  565  SQKLLPPPSDMPKC  578



>gb|EMT07841.1| Laccase-4 [Aegilops tauschii]
Length=368

 Score =   358 bits (919),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 185/247 (75%), Positives = 209/247 (85%), Gaps = 0/247 (0%)
 Frame = +1

Query  22   PILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTCQGPT  201
            P LP +NDTSF SN++ KLRSL +  YPA VPQ VD+ FFFTVGLGT+PC  N TCQGPT
Sbjct  122  PTLPQINDTSFVSNYTAKLRSLATEEYPAGVPQEVDRRFFFTVGLGTHPCAVNGTCQGPT  181

Query  202  NATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNTMVSN  381
            N ++F+A++NNVSFV PTTALLQ+H++G S+ VYS NFP  P   FNYTG PPNNT VSN
Sbjct  182  NDSRFAAAVNNVSFVLPTTALLQSHYTGMSSGVYSSNFPAVPQSPFNYTGTPPNNTNVSN  241

Query  382  GTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKNFNLVD  561
            GT+++VL++  +VELVMQ TSILGAESHP HLHGFNFFVVGQGFGNF+  KDP  +NLVD
Sbjct  242  GTRLVVLSYGDAVELVMQGTSILGAESHPFHLHGFNFFVVGQGFGNFDPAKDPAKYNLVD  301

Query  562  PVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLLPP  741
            PVERNTVGVPA GWVAIRF ADNPGVWFMHCHLEVH SWGLKMAW+V DG LPNQKLLPP
Sbjct  302  PVERNTVGVPAAGWVAIRFRADNPGVWFMHCHLEVHVSWGLKMAWVVQDGSLPNQKLLPP  361

Query  742  PSDLPKC  762
            PSDLPKC
Sbjct  362  PSDLPKC  368



>ref|XP_002465485.1| hypothetical protein SORBIDRAFT_01g039690 [Sorghum bicolor]
 gb|EER92483.1| hypothetical protein SORBIDRAFT_01g039690 [Sorghum bicolor]
Length=576

 Score =   365 bits (937),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 187/254 (74%), Positives = 218/254 (86%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+F+P LPALNDT+FA+N+S +LRSL +P +PA VP+ VD+ FFF VGLGTNPC  N
Sbjct  324  KSLPLFRPSLPALNDTAFAANYSARLRSLATPEFPATVPRAVDRSFFFAVGLGTNPCPAN  383

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTN TKF+AS+NNVSF  PTTALLQAH+   +  VY+ +FPV+PL  FNYTG  P
Sbjct  384  QTCQGPTNRTKFTASMNNVSFTMPTTALLQAHYDNIAG-VYTADFPVAPLEPFNYTGTTP  442

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VS+GTKV+VL +NTSVE+V+Q TS+LGAESHPLHLHGF+FFVVGQGFGN++ +KDP
Sbjct  443  NNTNVSSGTKVVVLEYNTSVEVVLQGTSVLGAESHPLHLHGFDFFVVGQGFGNYDSSKDP  502

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNL DPV+RNTVGVP+GGWVAIRF ADNPGVWFMHCHLEVHTSWGLKMAW+V DG LP
Sbjct  503  AKFNLDDPVQRNTVGVPSGGWVAIRFFADNPGVWFMHCHLEVHTSWGLKMAWVVNDGPLP  562

Query  721  NQKLLPPPSDLPKC  762
             QKL+PPP DLPKC
Sbjct  563  EQKLMPPPPDLPKC  576



>ref|XP_009796024.1| PREDICTED: laccase-2-like [Nicotiana sylvestris]
Length=583

 Score =   365 bits (937),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 193/254 (76%), Positives = 217/254 (85%), Gaps = 2/254 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+  P LP +N TSF +NFS K RSL +  +PA VPQ VDK FFFTVGLG+NPC KN
Sbjct  332  KNLPI--PTLPPINSTSFVANFSNKFRSLANTQFPANVPQKVDKQFFFTVGLGSNPCPKN  389

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N++KFSAS+NNVS + PTTALLQ++F  +SN VY+ NFP  PL  FNYTG PP
Sbjct  390  QTCQGPNNSSKFSASVNNVSMILPTTALLQSYFFKKSNGVYTSNFPSVPLVPFNYTGTPP  449

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGTKV+VL FNTSVELVMQDTSILGAESHPLHLHG+NF+VVGQGFGNF+  KDP
Sbjct  450  NNTHVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDP  509

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             N+NLVDPVERNT+GVP+GGWVAI FLADNPGVWFMHCH EVH SWGL+MAWLVLDG+LP
Sbjct  510  ANYNLVDPVERNTIGVPSGGWVAIHFLADNPGVWFMHCHFEVHLSWGLRMAWLVLDGELP  569

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPP+DLPKC
Sbjct  570  NQKLPPPPADLPKC  583



>dbj|BAJ96691.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=572

 Score =   364 bits (935),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 187/254 (74%), Positives = 212/254 (83%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ +P LP +NDTSF SN++ KLRSL +  YPA VPQ VD+ FFFTVGLGT+PC  N
Sbjct  319  KNLPLLRPTLPQINDTSFVSNYTDKLRSLATEEYPAAVPQEVDRRFFFTVGLGTHPCAVN  378

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGPTN ++F+A++NNVSFV PTTALLQ+H++G SN VYS NFP  P   FNYTG PP
Sbjct  379  GTCQGPTNDSRFAAAVNNVSFVLPTTALLQSHYTGMSNGVYSSNFPAVPKSPFNYTGTPP  438

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGT+++VL++  +VELVMQ TSILGAESHP HLHGFNFFVVGQGFGNF+   DP
Sbjct  439  NNTNVSNGTRLVVLSYGDAVELVMQGTSILGAESHPFHLHGFNFFVVGQGFGNFDPVHDP  498

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              +NLVDPVERNTVGVPA GWVAIRF ADNPGVWFMHCHLEVH SWGLKMAW+V DG LP
Sbjct  499  AKYNLVDPVERNTVGVPAAGWVAIRFRADNPGVWFMHCHLEVHVSWGLKMAWVVQDGSLP  558

Query  721  NQKLLPPPSDLPKC  762
             QKLLPPPSDLPKC
Sbjct  559  EQKLLPPPSDLPKC  572



>emb|CDM80721.1| unnamed protein product [Triticum aestivum]
 emb|CDM84969.1| unnamed protein product [Triticum aestivum]
Length=578

 Score =   364 bits (935),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 187/254 (74%), Positives = 216/254 (85%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP+LP  NDT+F + F+ KLRSL +  YPA VPQ+VD+ FFFT+GLGT PC KN
Sbjct  326  KALPIFKPMLPYFNDTNFVTKFTTKLRSLATKQYPAAVPQSVDRRFFFTIGLGTLPCPKN  385

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N T+F+A++NNVS V P+TALLQ+HF+G ++ VY+ NFP  PL  FNYTG PP
Sbjct  386  MTCQGP-NGTQFAAAVNNVSLVLPSTALLQSHFTGLTSGVYAANFPAMPLSPFNYTGTPP  444

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V+ GTK++ L+FNTSVELVMQDTSILG ESHPLHLHGFNFFVVGQGFGN++  KDP
Sbjct  445  NNTHVATGTKLLALSFNTSVELVMQDTSILGIESHPLHLHGFNFFVVGQGFGNYDAVKDP  504

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHT+WGL+MAW V DG  P
Sbjct  505  AKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTTWGLRMAWQVQDGSKP  564

Query  721  NQKLLPPPSDLPKC  762
            +QKLLPPPSD+PKC
Sbjct  565  SQKLLPPPSDMPKC  578



>dbj|BAJ84890.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=572

 Score =   364 bits (935),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 187/254 (74%), Positives = 212/254 (83%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ +P LP +NDTSF SN++ KLRSL +  YPA VPQ VD+ FFFTVGLGT+PC  N
Sbjct  319  KNLPLLRPTLPQINDTSFVSNYTDKLRSLATEEYPAAVPQEVDRRFFFTVGLGTHPCAVN  378

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGPTN ++F+A++NNVSFV PTTALLQ+H++G SN VYS NFP  P   FNYTG PP
Sbjct  379  GTCQGPTNDSRFAAAVNNVSFVLPTTALLQSHYTGMSNGVYSSNFPAVPKSPFNYTGTPP  438

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGT+++VL++  +VELVMQ TSILGAESHP HLHGFNFFVVGQGFGNF+   DP
Sbjct  439  NNTNVSNGTRLVVLSYGDAVELVMQGTSILGAESHPFHLHGFNFFVVGQGFGNFDPVHDP  498

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              +NLVDPVERNTVGVPA GWVAIRF ADNPGVWFMHCHLEVH SWGLKMAW+V DG LP
Sbjct  499  AKYNLVDPVERNTVGVPAAGWVAIRFRADNPGVWFMHCHLEVHVSWGLKMAWVVQDGSLP  558

Query  721  NQKLLPPPSDLPKC  762
             QKLLPPPSDLPKC
Sbjct  559  EQKLLPPPSDLPKC  572



>ref|XP_003562893.1| PREDICTED: laccase-4-like [Brachypodium distachyon]
Length=581

 Score =   364 bits (935),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 187/256 (73%), Positives = 213/256 (83%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+F+P LP  NDT   + F+ KLRSL + SYPA VPQ+VDK FFFT+GLGT PC  N
Sbjct  326  KDLPLFRPKLPRFNDTGLVTKFTAKLRSLATASYPAAVPQSVDKRFFFTIGLGTLPCPTN  385

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQ--SNHVYSPNFPVSPLHWFNYTGN  354
             TCQGPTN T+F+A++NNVS V P+TALLQ+H++G   S  VY+ NFP +PL  FNYTG 
Sbjct  386  TTCQGPTNITRFAAAVNNVSLVLPSTALLQSHYTGMGMSKGVYASNFPTAPLSTFNYTGT  445

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNT V+ GT+++VL FN SVELVMQDTSILG ESHPLHLHGFNFFVVGQGFGN++   
Sbjct  446  PPNNTNVAQGTRLLVLPFNASVELVMQDTSILGIESHPLHLHGFNFFVVGQGFGNYDVVN  505

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DP  FNLVDPVERNTV VPAGGWVAIRF+ADNPGVWFMHCHLEVHT+WGL+MAWLV DG 
Sbjct  506  DPAQFNLVDPVERNTVAVPAGGWVAIRFIADNPGVWFMHCHLEVHTTWGLRMAWLVRDGS  565

Query  715  LPNQKLLPPPSDLPKC  762
            LPNQKLLPPPSDLPKC
Sbjct  566  LPNQKLLPPPSDLPKC  581



>ref|XP_006488364.1| PREDICTED: laccase-17-like [Citrus sinensis]
Length=583

 Score =   364 bits (934),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/250 (74%), Positives = 213/250 (85%), Gaps = 1/250 (0%)
 Frame = +1

Query  13   MFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTCQ  192
            +FKP LPA+NDT+F +NFS K RSL +  +PA VPQTVDK FFFTV LG NPC KNQTCQ
Sbjct  335  LFKPSLPAINDTNFVANFSSKFRSLANAQFPANVPQTVDKRFFFTVSLGANPCPKNQTCQ  394

Query  193  GPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNTM  372
            GP N TKF+A++NNVSF  P+TALLQ++F  +S  VY+ +FP  PLH FNYTG PPNNT 
Sbjct  395  GP-NGTKFAAAVNNVSFALPSTALLQSYFFAKSKGVYTADFPQFPLHPFNYTGTPPNNTF  453

Query  373  VSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKNFN  552
            VSNGTK +V+ FNTSVELV+QDTSILGAESHPLHLHG+N +VVGQGFGNF+   DP  FN
Sbjct  454  VSNGTKALVIPFNTSVELVLQDTSILGAESHPLHLHGYNVYVVGQGFGNFDPKNDPAKFN  513

Query  553  LVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKL  732
            L+DPVERNTVGVP+GGWVAIRFLADNPGVWFMHCH +VH SWGL+MAW+VLDG+LPNQKL
Sbjct  514  LIDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHFDVHLSWGLRMAWIVLDGELPNQKL  573

Query  733  LPPPSDLPKC  762
             PPPSDLPKC
Sbjct  574  PPPPSDLPKC  583



>ref|XP_008356891.1| PREDICTED: laccase-2 [Malus domestica]
Length=584

 Score =   363 bits (932),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 190/251 (76%), Positives = 213/251 (85%), Gaps = 0/251 (0%)
 Frame = +1

Query  10   PMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTC  189
            P+F+PILP +N TSF +NF+ K RSL +  +PA VP+TV+K FFFTVGLGTNPC KNQTC
Sbjct  334  PLFRPILPQINATSFVANFTSKFRSLANSKFPANVPRTVEKRFFFTVGLGTNPCPKNQTC  393

Query  190  QGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNT  369
            QGPTN TKF+ASINN SFV P+ ALLQ+HF  QSN +Y+ +FP  P   FNYTG PPNNT
Sbjct  394  QGPTNTTKFAASINNNSFVLPSVALLQSHFFAQSNSIYTTDFPTIPPKLFNYTGTPPNNT  453

Query  370  MVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKNF  549
             VSNGTKV+VL FNTSVELV+Q TSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP NF
Sbjct  454  NVSNGTKVVVLKFNTSVELVLQGTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPPNF  513

Query  550  NLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQK  729
            NLVDPVERNT GVP+ GWVAIRFLADNPGVW MHCH ++H SWGL+MAW+V DGKLPNQK
Sbjct  514  NLVDPVERNTFGVPSRGWVAIRFLADNPGVWLMHCHFDIHLSWGLRMAWVVQDGKLPNQK  573

Query  730  LLPPPSDLPKC  762
            L PPPSDLPKC
Sbjct  574  LPPPPSDLPKC  584



>gb|KDO51175.1| hypothetical protein CISIN_1g008090mg [Citrus sinensis]
Length=578

 Score =   363 bits (931),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 190/254 (75%), Positives = 217/254 (85%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKL ++KP LP++NDTSFA NF++K RSL S  YPA VPQ VD+ FFFTVGLG+NPC KN
Sbjct  326  KKLQLYKPTLPSINDTSFAVNFTRKFRSLASVKYPANVPQIVDRKFFFTVGLGSNPCPKN  385

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N TKFSAS+NNVSFV P+TA+LQ++F GQ+N VY+ +FPV P   FNYTG PP
Sbjct  386  TTCQGP-NGTKFSASVNNVSFVLPSTAILQSYFFGQNNGVYTTDFPVKPPMPFNYTGTPP  444

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGT+ ++L FNTSVELVMQDTSILGAESHPLHLHGFNFFVVG GFGN++  KD 
Sbjct  445  NNTNVSNGTRTVLLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGLGFGNYDPDKDL  504

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP+ERNT+GVPAGGWVAIRF ADNPGVWFMHCHL+VHTSWGL+MAW+V +G  P
Sbjct  505  MNFNLVDPMERNTIGVPAGGWVAIRFFADNPGVWFMHCHLDVHTSWGLRMAWIVQNGAQP  564

Query  721  NQKLLPPPSDLPKC  762
            NQ L PPPSDLPKC
Sbjct  565  NQTLPPPPSDLPKC  578



>ref|XP_006429120.1| hypothetical protein CICLE_v10011363mg [Citrus clementina]
 gb|ESR42360.1| hypothetical protein CICLE_v10011363mg [Citrus clementina]
Length=578

 Score =   363 bits (931),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 190/254 (75%), Positives = 217/254 (85%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKL ++KP LP++NDTSFA NF++K RSL S  YPA VPQ VD+ FFFTVGLG+NPC KN
Sbjct  326  KKLQLYKPTLPSINDTSFAVNFTRKFRSLASVKYPANVPQIVDRKFFFTVGLGSNPCPKN  385

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N TKFSAS+NNVSFV P+TA+LQ++F GQ+N VY+ +FPV P   FNYTG PP
Sbjct  386  TTCQGP-NGTKFSASVNNVSFVLPSTAILQSYFFGQNNGVYTTDFPVKPPMPFNYTGTPP  444

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGT+ ++L FNTSVELVMQDTSILGAESHPLHLHGFNFFVVG GFGN++  KD 
Sbjct  445  NNTNVSNGTRTVLLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGLGFGNYDPDKDL  504

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP+ERNT+GVPAGGWVAIRF ADNPGVWFMHCHL+VHTSWGL+MAW+V +G  P
Sbjct  505  MNFNLVDPMERNTIGVPAGGWVAIRFFADNPGVWFMHCHLDVHTSWGLRMAWIVQNGAQP  564

Query  721  NQKLLPPPSDLPKC  762
            NQ L PPPSDLPKC
Sbjct  565  NQTLPPPPSDLPKC  578



>ref|XP_006480879.1| PREDICTED: laccase-17-like [Citrus sinensis]
Length=567

 Score =   362 bits (930),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 190/254 (75%), Positives = 217/254 (85%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKL ++KP LP++NDTSFA NF++K RSL S  YPA VPQ VD+ FFFTVGLG+NPC KN
Sbjct  315  KKLQLYKPTLPSINDTSFAVNFTRKFRSLASVKYPANVPQIVDRKFFFTVGLGSNPCPKN  374

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N TKFSAS+NNVSFV P+TA+LQ++F GQ+N VY+ +FPV P   FNYTG PP
Sbjct  375  TTCQGP-NGTKFSASVNNVSFVLPSTAILQSYFFGQNNGVYTTDFPVKPPMPFNYTGTPP  433

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGT+ ++L FNTSVELVMQDTSILGAESHPLHLHGFNFFVVG GFGN++  KD 
Sbjct  434  NNTNVSNGTRTVLLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGLGFGNYDPDKDL  493

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP+ERNT+GVPAGGWVAIRF ADNPGVWFMHCHL+VHTSWGL+MAW+V +G  P
Sbjct  494  MNFNLVDPMERNTIGVPAGGWVAIRFFADNPGVWFMHCHLDVHTSWGLRMAWIVQNGAQP  553

Query  721  NQKLLPPPSDLPKC  762
            NQ L PPPSDLPKC
Sbjct  554  NQTLPPPPSDLPKC  567



>ref|XP_010047833.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
 gb|KCW88962.1| hypothetical protein EUGRSUZ_A01282 [Eucalyptus grandis]
Length=571

 Score =   362 bits (930),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 190/254 (75%), Positives = 213/254 (84%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP +KP LP +N T F + F+ +LRSL S  +PA VPQ VD+ FFFTVGLGT+PC KN
Sbjct  319  KKLPQYKPTLPPMNSTGFVAKFTGQLRSLASAKFPANVPQKVDRKFFFTVGLGTSPCPKN  378

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N TKF+AS+NN+SFV P+ ALLQAHF GQSN VY+ +FP +P   FNYTG PP
Sbjct  379  TTCQGP-NGTKFAASVNNISFVLPSVALLQAHFFGQSNGVYTTDFPTNPPVQFNYTGTPP  437

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMV+NGTK +VL +NTSVELVMQDTSILG ESH LHLHGFNFFVVGQG GN+N  KDP
Sbjct  438  NNTMVTNGTKTVVLAYNTSVELVMQDTSILGTESHALHLHGFNFFVVGQGSGNYNPNKDP  497

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDP+ERNT GVP+GGWVAIRFLADNPGVWFMHCHL+VHTSWGLKMAW+VLDG  P
Sbjct  498  TKFNLVDPIERNTFGVPSGGWVAIRFLADNPGVWFMHCHLDVHTSWGLKMAWIVLDGPQP  557

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  558  NQKLPPPPSDLPKC  571



>ref|XP_006644994.1| PREDICTED: laccase-12/13-like [Oryza brachyantha]
Length=578

 Score =   362 bits (929),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 189/254 (74%), Positives = 211/254 (83%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP F+P LP +NDTSF SN++ KLRSL +  YPA VPQ VD+ FFFTVGLGT+PC  N
Sbjct  326  KNLPAFRPTLPRINDTSFVSNYTGKLRSLATAEYPANVPQQVDRRFFFTVGLGTHPCAVN  385

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N ++F+AS+NNVSFV PTTALLQ+HF+G+S  VY  NFP  P   FNYTG PP
Sbjct  386  GTCQGP-NGSRFAASVNNVSFVLPTTALLQSHFAGRSGGVYLSNFPAMPASPFNYTGTPP  444

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGT+++VL +  SVELVMQ TSILGAESHP HLHGFNFFVVGQGFGNF+   DP
Sbjct  445  NNTNVSNGTRLVVLPYGASVELVMQGTSILGAESHPFHLHGFNFFVVGQGFGNFDPVNDP  504

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              +NLVDPVERNTVGVPA GWVAIRFLADNPGVWFMHCHLEVH SWGLKMAW+V DG LP
Sbjct  505  AKYNLVDPVERNTVGVPAAGWVAIRFLADNPGVWFMHCHLEVHVSWGLKMAWVVQDGSLP  564

Query  721  NQKLLPPPSDLPKC  762
            NQK+LPPPSDLPKC
Sbjct  565  NQKILPPPSDLPKC  578



>ref|XP_010685719.1| PREDICTED: laccase-17-like [Beta vulgaris subsp. vulgaris]
Length=586

 Score =   362 bits (930),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 184/247 (74%), Positives = 214/247 (87%), Gaps = 0/247 (0%)
 Frame = +1

Query  22   PILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTCQGPT  201
            P LP++NDTSF +NF++K RSL++ +YP  VP+TVDKHFFFTVGLGTNPC KNQTCQGP 
Sbjct  340  PRLPSINDTSFVTNFTRKFRSLNNANYPTNVPKTVDKHFFFTVGLGTNPCPKNQTCQGPN  399

Query  202  NATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNTMVSN  381
            N TKF+A+INN+S   P+TALLQ+HF GQ+N VYSPNFP  PL  FNYTG PPNNT V N
Sbjct  400  NRTKFAATINNISMALPSTALLQSHFFGQNNGVYSPNFPQVPLIKFNYTGTPPNNTNVMN  459

Query  382  GTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKNFNLVD  561
            GTK++V+ +NT+VELVMQDTSI+ AESHPLHLHG++F+VVGQGFGNFN   DP N+NLVD
Sbjct  460  GTKLLVIPYNTNVELVMQDTSIISAESHPLHLHGYDFYVVGQGFGNFNPKTDPANYNLVD  519

Query  562  PVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLLPP  741
            PV RNT+GVP+GGWVAIRF ADNPGVWFMHCH EVH SWGL+MAWLVLDGKLPNQK+  P
Sbjct  520  PVARNTIGVPSGGWVAIRFRADNPGVWFMHCHFEVHISWGLRMAWLVLDGKLPNQKVPRP  579

Query  742  PSDLPKC  762
            P+DLPKC
Sbjct  580  PADLPKC  586



>ref|XP_009782930.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=579

 Score =   362 bits (928),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 190/252 (75%), Positives = 213/252 (85%), Gaps = 1/252 (0%)
 Frame = +1

Query  7    LPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQT  186
             P+ KP LP  NDT+FA++F KK+RSL +  +PA VP+ VDKHFFFTVGLG NPC KNQT
Sbjct  329  FPLLKPKLPIFNDTTFATSFVKKIRSLANGKFPANVPKKVDKHFFFTVGLGLNPCPKNQT  388

Query  187  CQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNN  366
            CQGP N TK +AS+NN+SFVQP  ALLQ+HF  QS  VY+ +FP +P   FNYTGNPPNN
Sbjct  389  CQGPNN-TKLAASVNNISFVQPNVALLQSHFFNQSKGVYTTDFPANPPFKFNYTGNPPNN  447

Query  367  TMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKN  546
              V+ GTKV+VL FNTSVELVMQDTSI+ AESHPLHLHGFNFFVVGQGFGN+N +KDP N
Sbjct  448  IFVTTGTKVVVLPFNTSVELVMQDTSIISAESHPLHLHGFNFFVVGQGFGNYNSSKDPAN  507

Query  547  FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQ  726
            FNLVDP ERNTVGVP GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+V+DGK P Q
Sbjct  508  FNLVDPAERNTVGVPPGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWMVMDGKGPKQ  567

Query  727  KLLPPPSDLPKC  762
            KL PPP+DLPKC
Sbjct  568  KLPPPPADLPKC  579



>gb|EMS50562.1| Laccase-12/13 [Triticum urartu]
Length=504

 Score =   358 bits (920),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 188/259 (73%), Positives = 210/259 (81%), Gaps = 5/259 (2%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K LP+++P LP +NDTS  SN++ KLRSL S +YPA VPQ VD+ F FTVGLGT+PC   
Sbjct  246  KSLPIYRPTLPQINDTSAVSNYTAKLRSLASAAYPAAVPQAVDREFLFTVGLGTHPCAPG  305

Query  175  ---KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNY  345
                  TCQGP    +F+ASINNVSFV PTTALLQ+H++G S  VY+ +FP +P   FNY
Sbjct  306  SPVNGSTCQGPNGTARFAASINNVSFVLPTTALLQSHYTGMSKGVYASDFPFAPPRPFNY  365

Query  346  TGNPPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfn  525
            TG PPNNT V  GTK +VL F T+VELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN++
Sbjct  366  TGTPPNNTNVMTGTKALVLPFGTAVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYD  425

Query  526  qTKDPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVL  705
              KDP  FNLVDPVERNTVGVPAGGWVAIRF ADNPGVWFMHCHLEVH SWGLKMAWLVL
Sbjct  426  PAKDPAKFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEVHMSWGLKMAWLVL  485

Query  706  DGKLPNQKLLPPPSDLPKC  762
            DG LPNQKL PPP+DLPKC
Sbjct  486  DGNLPNQKLPPPPADLPKC  504



>emb|CBI30530.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   350 bits (898),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 187/254 (74%), Positives = 212/254 (83%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            +K  + KP LP  NDT FA  FSKKLRSL S  +PAKVPQTV++ FFFTVGLG   C +N
Sbjct  9    RKPSVLKPALPMFNDTIFAMKFSKKLRSLASNKFPAKVPQTVNRRFFFTVGLGLIQCSRN  68

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            Q C GP N T  +A+INNVSFVQP+TALLQAHF G+S  VY+ +FP +P   FNYTG PP
Sbjct  69   QACPGPNN-TMVAAAINNVSFVQPSTALLQAHFFGKSKGVYTTDFPANPTFKFNYTGTPP  127

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            +N +V++GTKV+VL FNT VELV+QDTSI+GAESHPLHLHGFNF+VVGQGFGNF+  KDP
Sbjct  128  SNILVNSGTKVVVLPFNTRVELVLQDTSIIGAESHPLHLHGFNFYVVGQGFGNFDPKKDP  187

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP+ERNTVGVP+GGWVAIRF ADNPGVWFMHCHLEVHTSWGLKMAW+V DGK P
Sbjct  188  ANFNLVDPIERNTVGVPSGGWVAIRFRADNPGVWFMHCHLEVHTSWGLKMAWVVTDGKRP  247

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  248  NQKLPPPPSDLPKC  261



>gb|EEC71780.1| hypothetical protein OsI_04394 [Oryza sativa Indica Group]
Length=577

 Score =   361 bits (926),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 186/254 (73%), Positives = 213/254 (84%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ +P LP +NDTSF SN++ KLRSL +  YPA VPQ VD  FFFTVGLGT+PC  N
Sbjct  325  KNLPVLRPTLPQINDTSFVSNYTAKLRSLATAEYPANVPQQVDTRFFFTVGLGTHPCAVN  384

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N ++F+A++NNVSFV P+TALLQ+H++G+SN VY+ NFP  PL  FNYTG PP
Sbjct  385  GTCQGP-NGSRFAAAVNNVSFVLPSTALLQSHYTGRSNGVYASNFPAMPLSPFNYTGTPP  443

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGT+++VL +  SVELVMQ TS+LGAESHP HLHGFNFFVVGQGFGNF+   DP
Sbjct  444  NNTNVSNGTRLVVLPYGASVELVMQGTSVLGAESHPFHLHGFNFFVVGQGFGNFDPVNDP  503

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              +NLVDPVERNTVGVPA GWVAIRFLADNPGVWFMHCHLEVH SWGLKMAW+V DG LP
Sbjct  504  AKYNLVDPVERNTVGVPAAGWVAIRFLADNPGVWFMHCHLEVHVSWGLKMAWVVQDGSLP  563

Query  721  NQKLLPPPSDLPKC  762
            NQK+LPPPSDLPKC
Sbjct  564  NQKILPPPSDLPKC  577



>emb|CDY38576.1| BnaA05g13050D [Brassica napus]
Length=377

 Score =   354 bits (909),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 181/255 (71%), Positives = 216/255 (85%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+  P LP +N TS+A+NF+K  RSL +  +PA VP+ VDK FFFTVGLGTNPC KN
Sbjct  123  KNLPVINPSLPPINSTSYAANFTKMFRSLANSRFPANVPKIVDKKFFFTVGLGTNPCPKN  182

Query  181  QTCQGPTNATKFSASINNVSFVQP-TTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            QTCQGPTN TKF+A+INNV+F+ P TT+LLQ++FSG S  V++ NFP +P+  FNYTG P
Sbjct  183  QTCQGPTNTTKFAAAINNVTFILPNTTSLLQSYFSGMSKKVFTTNFPSAPVFPFNYTGVP  242

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMVS GTKV+VL +NT+VELV+Q TSILG E+HP+HLHG+NF+VVGQGFGNF+ T+D
Sbjct  243  PNNTMVSGGTKVVVLKYNTTVELVLQGTSILGIEAHPIHLHGYNFYVVGQGFGNFDPTRD  302

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PK +NLVDPVERNT+ VP+GGWVAIRFLADNPGVWFMHCH+E+H SWGL MAW+VLDG L
Sbjct  303  PKQYNLVDPVERNTINVPSGGWVAIRFLADNPGVWFMHCHIEIHLSWGLTMAWVVLDGDL  362

Query  718  PNQKLLPPPSDLPKC  762
            PNQKL PPPSD P C
Sbjct  363  PNQKLPPPPSDFPTC  377



>ref|XP_004246355.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=579

 Score =   361 bits (926),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 189/253 (75%), Positives = 215/253 (85%), Gaps = 1/253 (0%)
 Frame = +1

Query  4    KLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQ  183
            K P+    LP  NDT+FA++F KK+RSL +  +PA VP+ VDKHFFFTVGLG NPC KNQ
Sbjct  328  KFPLLNSKLPIFNDTTFATSFVKKIRSLANAKFPANVPKRVDKHFFFTVGLGLNPCPKNQ  387

Query  184  TCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPN  363
            TCQGP N TK +AS+NNVSFVQP  ALLQ+H+  QS  VY+ +FPV+P   FNYTGNPPN
Sbjct  388  TCQGPNN-TKLAASVNNVSFVQPNVALLQSHYFNQSKGVYTTDFPVNPPFKFNYTGNPPN  446

Query  364  NTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPK  543
            N+ V++GTKV++L FNTSVELVMQDTSI+ AESHPLHLHGFNFFVVGQGFGN+N +KDP 
Sbjct  447  NSFVTSGTKVVMLPFNTSVELVMQDTSIISAESHPLHLHGFNFFVVGQGFGNYNSSKDPA  506

Query  544  NFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPN  723
            NFNLVDP ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKM W+V DGK P 
Sbjct  507  NFNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMVWMVTDGKSPK  566

Query  724  QKLLPPPSDLPKC  762
            QKLLPPP+DLPKC
Sbjct  567  QKLLPPPADLPKC  579



>emb|CDY65666.1| BnaC04g54790D [Brassica napus]
Length=578

 Score =   360 bits (925),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 219/255 (86%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ KP LP +N TS+A+NF+K  RSL +  +PA VP+ VDK FFFTVGLGTNPC KN
Sbjct  324  KNLPVIKPFLPPINSTSYAANFTKMFRSLANSRFPANVPKIVDKKFFFTVGLGTNPCPKN  383

Query  181  QTCQGPTNATKFSASINNVSFVQP-TTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            QTCQGPTN TKF+A+INNVSF+ P TT+LLQ++FSG S  V++ NFP +P+  FNYTG P
Sbjct  384  QTCQGPTNTTKFAAAINNVSFILPNTTSLLQSYFSGMSKKVFTTNFPSTPVFPFNYTGVP  443

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMVS GTKV+VL +NT+VELV+Q TSILG E+HP+HLHG+NF+VVGQGFGNF+ T+D
Sbjct  444  PNNTMVSRGTKVVVLKYNTTVELVLQGTSILGIEAHPIHLHGYNFYVVGQGFGNFDPTRD  503

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PK +NLVDPVERNT+ VP+GGWVAIRFLADNPGVWFMHCH+E+H SWGL MAW+VLDG+L
Sbjct  504  PKQYNLVDPVERNTINVPSGGWVAIRFLADNPGVWFMHCHIEIHLSWGLTMAWVVLDGEL  563

Query  718  PNQKLLPPPSDLPKC  762
            PNQKL PPPSD PKC
Sbjct  564  PNQKLPPPPSDFPKC  578



>gb|AFK41498.1| unknown [Medicago truncatula]
Length=341

 Score =   352 bits (904),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 186/254 (73%), Positives = 209/254 (82%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K + +F+P LP  NDT FA NF+ KLRSL+S  +PAKVP+TVDKHFFFTVGLG + C KN
Sbjct  89   KTVKLFRPTLPKFNDTIFAMNFNTKLRSLNSKKFPAKVPKTVDKHFFFTVGLGISQCSKN  148

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            Q CQGP N T+ +A+INNVSFV P TALLQAHF  +S  V++ +FP +P   FNYTG PP
Sbjct  149  QACQGPNN-TRVAAAINNVSFVMPNTALLQAHFFNKSKGVFTTDFPSNPPVKFNYTGTPP  207

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
             N MV +GTKV VL +NT VELV+QDTSILGAESHPLHLHGFNFF+VGQG GNF+  KDP
Sbjct  208  KNIMVKSGTKVAVLPYNTKVELVLQDTSILGAESHPLHLHGFNFFIVGQGNGNFDPKKDP  267

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNT GVPAGGWVA+RFLADNPGVWFMHCHLEVHTSWGLKMAW+V DGK  
Sbjct  268  AKFNLVDPVERNTAGVPAGGWVALRFLADNPGVWFMHCHLEVHTSWGLKMAWIVQDGKRR  327

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  328  NQKLPPPPSDLPKC  341



>emb|CAN72263.1| hypothetical protein VITISV_037366 [Vitis vinifera]
Length=574

 Score =   360 bits (925),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 196/254 (77%), Positives = 214/254 (84%), Gaps = 10/254 (4%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+FKP LP LNDTSFA+NF+ KLRSL +  +PA VPQ VD+ FFFT          N
Sbjct  331  KNLPLFKPTLPPLNDTSFAANFTGKLRSLANTQFPANVPQKVDQRFFFT----------N  380

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGPTN T FSAS+NNVSFV PTTA+LQAHF  QS  VY+ +FP +P+  FNYTG PP
Sbjct  381  QTCQGPTNITMFSASVNNVSFVLPTTAILQAHFFQQSKGVYTTDFPTTPIFPFNYTGTPP  440

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTKV+VL FNTSVELV+QDTSILG ESHPLHLHGFNFFVVGQGFGNF+  KD 
Sbjct  441  NNTMVSNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHGFNFFVVGQGFGNFDSKKDS  500

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDPVERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+V+DGKLP
Sbjct  501  PKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVMDGKLP  560

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  561  NQKLPPPPSDLPKC  574



>ref|XP_009364426.1| PREDICTED: laccase-2-like [Pyrus x bretschneideri]
Length=584

 Score =   360 bits (924),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 191/251 (76%), Positives = 210/251 (84%), Gaps = 0/251 (0%)
 Frame = +1

Query  10   PMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTC  189
            P+F+PILP +N TSF +NF+ K RSL S  +PA VP+TV+K FFFTVGLGTNPC KNQTC
Sbjct  334  PLFRPILPQINATSFVANFTSKFRSLASSKFPANVPRTVEKRFFFTVGLGTNPCPKNQTC  393

Query  190  QGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNT  369
            QGPTN TKF+ASINN SF  P+ ALLQ+HF  QSN VY+ +FP  P   FNYTG PPNNT
Sbjct  394  QGPTNTTKFAASINNNSFALPSVALLQSHFFAQSNSVYTTDFPTIPPKPFNYTGTPPNNT  453

Query  370  MVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKNF  549
             VSNGTKV+VL FNTSVELV+Q TSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP  F
Sbjct  454  NVSNGTKVVVLKFNTSVELVLQGTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPPKF  513

Query  550  NLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQK  729
            NLVDPVERNT GVPA GW AIRFLADNPGVW MHCH +VH SWGL+MAW+V DGKLPNQK
Sbjct  514  NLVDPVERNTYGVPARGWAAIRFLADNPGVWLMHCHFDVHLSWGLRMAWVVQDGKLPNQK  573

Query  730  LLPPPSDLPKC  762
            L PPPSDLPKC
Sbjct  574  LPPPPSDLPKC  584



>ref|XP_006424872.1| hypothetical protein CICLE_v10028036mg [Citrus clementina]
 gb|ESR38112.1| hypothetical protein CICLE_v10028036mg [Citrus clementina]
Length=617

 Score =   361 bits (926),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 185/250 (74%), Positives = 212/250 (85%), Gaps = 1/250 (0%)
 Frame = +1

Query  13   MFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTCQ  192
            +FKP LPA+N T+F +NFS K RSL +  +PA VPQTVDK FFFTV LG NPC KNQTCQ
Sbjct  369  LFKPSLPAINATNFVANFSSKFRSLANAQFPANVPQTVDKRFFFTVSLGANPCPKNQTCQ  428

Query  193  GPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNTM  372
            GP N TKF+A++NNVSF  P+TALLQ++F  +S  VY+ +FP  PLH FNYTG PPNNT 
Sbjct  429  GP-NGTKFAAAVNNVSFALPSTALLQSYFFAKSKGVYTADFPQFPLHPFNYTGTPPNNTF  487

Query  373  VSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKNFN  552
            VSNGTK +V+ FNTSVELV+QDTSILGAESHPLHLHG+N +VVGQGFGNF+   DP  FN
Sbjct  488  VSNGTKALVIPFNTSVELVLQDTSILGAESHPLHLHGYNVYVVGQGFGNFDPKNDPAKFN  547

Query  553  LVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKL  732
            L+DPVERNTVGVP+GGWVAIRFLADNPGVWFMHCH +VH SWGL+MAW+VLDG+LPNQKL
Sbjct  548  LIDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHFDVHLSWGLRMAWIVLDGELPNQKL  607

Query  733  LPPPSDLPKC  762
             PPPSDLPKC
Sbjct  608  PPPPSDLPKC  617



>ref|XP_004961859.1| PREDICTED: laccase-12/13-like [Setaria italica]
Length=585

 Score =   360 bits (923),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 186/252 (74%), Positives = 215/252 (85%), Gaps = 1/252 (0%)
 Frame = +1

Query  7    LPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQT  186
            LP+F P LP +NDT+F +N++ +LRSL + +YPA VPQ++D+ FFFTVGLGT+PC  N T
Sbjct  335  LPIFAPTLPQINDTNFVANYTARLRSLATAAYPAAVPQSIDRRFFFTVGLGTHPCAVNGT  394

Query  187  CQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNN  366
            CQGP N ++F+A++NNVSFV PTTALLQAHF+G+SN VY+ +FP  PL  FNYTG PPNN
Sbjct  395  CQGP-NGSRFAAAVNNVSFVLPTTALLQAHFAGRSNGVYTTDFPAVPLMPFNYTGPPPNN  453

Query  367  TMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKN  546
            T V NGT+V+ L F T+VELV+QDTSILGAESHPLHLHGFNF+VVGQGFGNF+   DP  
Sbjct  454  TNVMNGTRVVALPFGTTVELVLQDTSILGAESHPLHLHGFNFYVVGQGFGNFDPVNDPAK  513

Query  547  FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQ  726
            FNLVDPVERNTVGVPAGGWVAIRF ADNPGVWFMHCHLEVH SWGLKMAWLV DG LPNQ
Sbjct  514  FNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEVHMSWGLKMAWLVQDGSLPNQ  573

Query  727  KLLPPPSDLPKC  762
            KL PPPSDLP+C
Sbjct  574  KLPPPPSDLPQC  585



>ref|XP_010685718.1| PREDICTED: laccase-17-like [Beta vulgaris subsp. vulgaris]
Length=593

 Score =   360 bits (923),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 184/247 (74%), Positives = 213/247 (86%), Gaps = 0/247 (0%)
 Frame = +1

Query  22   PILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTCQGPT  201
            P LP++NDTSF SNFS+K  SL++  +P  VP+TVDKHFFFTVGLGT PC KNQTCQGP 
Sbjct  347  PRLPSVNDTSFVSNFSRKFHSLNNAQFPVNVPKTVDKHFFFTVGLGTTPCPKNQTCQGPN  406

Query  202  NATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNTMVSN  381
            N TKFSA++NN+S + P+TALLQ++F GQ++ VY+ NFP  PL  FNYTG PPNNT V N
Sbjct  407  NNTKFSATVNNISMILPSTALLQSYFFGQNDGVYTTNFPQLPLKQFNYTGTPPNNTNVMN  466

Query  382  GTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKNFNLVD  561
            GTKV+V+ +NTSVEL+MQDTSI+ AESHPLHLHG+NF+VVGQGFGNFN  KDP N+NLVD
Sbjct  467  GTKVLVIPYNTSVELIMQDTSIVSAESHPLHLHGYNFYVVGQGFGNFNPNKDPANYNLVD  526

Query  562  PVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLLPP  741
            PVERNT+ VP+GGWVAIRF ADNPGVWFMHCH EVH SWGLKMAWLVLDGKLPNQK+ PP
Sbjct  527  PVERNTIAVPSGGWVAIRFRADNPGVWFMHCHFEVHISWGLKMAWLVLDGKLPNQKVPPP  586

Query  742  PSDLPKC  762
            P+DLPKC
Sbjct  587  PADLPKC  593



>ref|XP_009602033.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=579

 Score =   359 bits (921),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 187/253 (74%), Positives = 215/253 (85%), Gaps = 1/253 (0%)
 Frame = +1

Query  4    KLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQ  183
            K P+ +P LP  NDT+F +NFSKK++SL +  +PA VP+ +D  FFFTVGLG +PC +NQ
Sbjct  328  KFPVLRPTLPIFNDTNFVTNFSKKIKSLANAKFPANVPKNIDSRFFFTVGLGLHPCPQNQ  387

Query  184  TCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPN  363
            TCQGP N TKF+ASINNVSFVQP  ALLQAHF  QSN VY+ +FP +P   FNYTGNPP 
Sbjct  388  TCQGPNN-TKFAASINNVSFVQPNIALLQAHFFNQSNGVYTTDFPANPTFKFNYTGNPPT  446

Query  364  NTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPK  543
            N  V++GTKV+VL++NT VELV+QDTSILGAESHPLHLHGFNFFVVGQGFGN+N ++DP 
Sbjct  447  NIFVTSGTKVVVLSYNTRVELVLQDTSILGAESHPLHLHGFNFFVVGQGFGNYNPSQDPV  506

Query  544  NFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPN  723
            NFNLVDP ERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+V+DGK   
Sbjct  507  NFNLVDPAERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVMDGKGRK  566

Query  724  QKLLPPPSDLPKC  762
            QKL PPP+DLPKC
Sbjct  567  QKLPPPPADLPKC  579



>ref|XP_009414328.1| PREDICTED: laccase-17-like [Musa acuminata subsp. malaccensis]
Length=582

 Score =   359 bits (921),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/255 (73%), Positives = 218/255 (85%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K L +F+P LPALNDT++ +N++ KLRSL S  +PA VP+TV++ F+FTVGLGT+PC KN
Sbjct  329  KNLALFRPTLPALNDTAYTTNYTGKLRSLASAQFPANVPKTVERRFYFTVGLGTSPCAKN  388

Query  181  QTCQGPTNATKFSASINNVSFVQPTT-ALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            QTCQGP N TKF+AS+NN+SF  PT+ ALLQAH+ GQ+  VY  +FP +P   FNYTG P
Sbjct  389  QTCQGP-NGTKFAASVNNISFALPTSAALLQAHYFGQTKGVYDTDFPDTPPFPFNYTGTP  447

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PN+T V+N TKV+VL FNTSVELVMQDTSI GAESHPLHLHGFNFFVVG GFGN++ +KD
Sbjct  448  PNDTFVTNATKVVVLPFNTSVELVMQDTSIQGAESHPLHLHGFNFFVVGTGFGNYDPSKD  507

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P+ FNL DP+ERNTVGVP GGWVAIRFLADNPGVWFMHCHLEVHTSWGL+MAW+V DG L
Sbjct  508  PRRFNLADPIERNTVGVPVGGWVAIRFLADNPGVWFMHCHLEVHTSWGLRMAWVVNDGWL  567

Query  718  PNQKLLPPPSDLPKC  762
            PNQKL+PPPSDLP+C
Sbjct  568  PNQKLVPPPSDLPRC  582



>ref|XP_011095204.1| PREDICTED: laccase-17-like [Sesamum indicum]
Length=579

 Score =   358 bits (920),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 188/254 (74%), Positives = 218/254 (86%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K   +FKP LP +N T   +NF+K  RSL+SP Y A VPQTVDK FFFTVGLG++PC +N
Sbjct  327  KNKTIFKPSLPPINATGVVANFTKMFRSLNSPKYTANVPQTVDKQFFFTVGLGSSPCPQN  386

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N TKF+AS+NNVSF  PTTALLQA+FS  S  +Y+ +FP +P + FNYTG+PP
Sbjct  387  ATCQGP-NGTKFAASVNNVSFALPTTALLQAYFSKNSYGIYTTDFPSNPPNPFNYTGSPP  445

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGT+V+VL FNTSVELV+QDTSILGAESHPLHLHGFNFFVVG+GFGN++  KDP
Sbjct  446  NNTQVSNGTRVVVLPFNTSVELVLQDTSILGAESHPLHLHGFNFFVVGEGFGNYDPYKDP  505

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDPVERNT+GVP+GGWVAIRFLADNPGVWFMHCH +VHTSWGL+MAW+VLDG+LP
Sbjct  506  ANFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHFDVHTSWGLRMAWIVLDGQLP  565

Query  721  NQKLLPPPSDLPKC  762
            +QKL PPPSDLPKC
Sbjct  566  SQKLPPPPSDLPKC  579



>ref|XP_006409959.1| hypothetical protein EUTSA_v10016434mg [Eutrema salsugineum]
 gb|ESQ51412.1| hypothetical protein EUTSA_v10016434mg [Eutrema salsugineum]
Length=578

 Score =   358 bits (919),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 182/255 (71%), Positives = 218/255 (85%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ KP LP +N TS+A+NF+K  RSL S  +PA VP+TVDK +FFTVGLGTNPC KN
Sbjct  324  KNLPVIKPSLPPINSTSYAANFTKMFRSLASSRFPANVPKTVDKKYFFTVGLGTNPCPKN  383

Query  181  QTCQGPTNATKFSASINNVSFVQPT-TALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            QTCQGPTN TKF+A+INNVSF+ P  T+LLQ++F G+SN ++  NFP +P+  FNYTG P
Sbjct  384  QTCQGPTNTTKFTAAINNVSFILPNKTSLLQSYFLGKSNRIFMTNFPSAPIFPFNYTGMP  443

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMVS GTK++VL +NT+VELV+Q TSILG E+HP+HLHGFNF+VVGQGFGNF+  +D
Sbjct  444  PNNTMVSKGTKLVVLKYNTTVELVLQGTSILGIEAHPVHLHGFNFYVVGQGFGNFDPIRD  503

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PK +NL+DPVERNT+ VP+GGWVAIRFLADNPGVWFMHCH+E+H SWGL MAW+VLDG L
Sbjct  504  PKRYNLIDPVERNTINVPSGGWVAIRFLADNPGVWFMHCHIEIHLSWGLTMAWVVLDGDL  563

Query  718  PNQKLLPPPSDLPKC  762
            PNQKLLPPPSD PKC
Sbjct  564  PNQKLLPPPSDFPKC  578



>emb|CAN73336.1| hypothetical protein VITISV_033042 [Vitis vinifera]
Length=547

 Score =   357 bits (916),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 188/242 (78%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = +1

Query  37   LNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTCQGPTNATKF  216
             ++++ A+NF++KLRSL +  +PA VPQ VDK FFFTVGLGTNPC +NQTCQGP N+T F
Sbjct  306  FDNSTVAANFTRKLRSLANTQFPANVPQKVDKRFFFTVGLGTNPCPQNQTCQGPNNSTMF  365

Query  217  SASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNTMVSNGTKVM  396
            SAS+NNVSFV PTTA+LQAHF  QSN VY+ +FP +P+  FNYTG PPNNTMVSNGTKV+
Sbjct  366  SASVNNVSFVLPTTAILQAHFFQQSNGVYTTDFPATPIFPFNYTGTPPNNTMVSNGTKVV  425

Query  397  VLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKNFNLVDPVERN  576
            VL FNTSVELV+QDTSILG ESHPLHLHGFNFFVVGQGFGNF+  KDP  FNLVDPVERN
Sbjct  426  VLPFNTSVELVLQDTSILGIESHPLHLHGFNFFVVGQGFGNFDAKKDPSKFNLVDPVERN  485

Query  577  TVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLLPPPSDLP  756
            TVGVP+GGWVAIRFLADNPGVW MHCHLEVHTSWGLKM  +V DGK+PNQKL PPPSDLP
Sbjct  486  TVGVPSGGWVAIRFLADNPGVWLMHCHLEVHTSWGLKMGXIVKDGKMPNQKLPPPPSDLP  545

Query  757  KC  762
            KC
Sbjct  546  KC  547



>dbj|BAJ91763.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=583

 Score =   358 bits (919),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 188/259 (73%), Positives = 212/259 (82%), Gaps = 5/259 (2%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD--  174
            K LP+F+P LP +NDT+  +N++ KLRSL S +YPA VPQ VD+ F FTVGLGT+PC   
Sbjct  325  KNLPIFRPTLPQINDTNAVANYTAKLRSLASAAYPATVPQVVDREFLFTVGLGTHPCAPG  384

Query  175  ---KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNY  345
                  TCQGP   ++F+ASINNVSFV PTTALLQ+H++G S  VY+ NFP +P H FNY
Sbjct  385  SPVNGSTCQGPNGTSRFAASINNVSFVLPTTALLQSHYTGMSKGVYASNFPFAPPHPFNY  444

Query  346  TGNPPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfn  525
            TG PPNNT V  GTK +VL F T+VELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN++
Sbjct  445  TGTPPNNTNVMTGTKALVLPFGTAVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYD  504

Query  526  qTKDPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVL  705
              KDP  +NLVDPVERNTVGVPAGGWVAIRF ADNPGVWFMHCHLEVH SWGLKMAWLVL
Sbjct  505  PAKDPAKYNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEVHMSWGLKMAWLVL  564

Query  706  DGKLPNQKLLPPPSDLPKC  762
            DG LPNQKL PPP+DLPKC
Sbjct  565  DGNLPNQKLPPPPADLPKC  583



>ref|NP_001044773.1| Os01g0842500 [Oryza sativa Japonica Group]
 dbj|BAB86452.1| putative laccase LAC5-6 [Oryza sativa Japonica Group]
 dbj|BAF06687.1| Os01g0842500 [Oryza sativa Japonica Group]
 gb|EAZ14116.1| hypothetical protein OsJ_04040 [Oryza sativa Japonica Group]
 dbj|BAG90005.1| unnamed protein product [Oryza sativa Japonica Group]
Length=577

 Score =   358 bits (918),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 184/254 (72%), Positives = 211/254 (83%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+ +P LP +NDTSF SN++ KLRS  +  YPA VPQ VD  FFFTVGLGT+PC  N
Sbjct  325  KNLPVLRPTLPQINDTSFVSNYTAKLRSFATAEYPANVPQQVDTRFFFTVGLGTHPCAVN  384

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N ++F+A++NNVSFV P+TALLQ+H++G+SN VY+ NFP  PL  FNYTG PP
Sbjct  385  GTCQGP-NGSRFAAAVNNVSFVLPSTALLQSHYTGRSNGVYASNFPAMPLSPFNYTGTPP  443

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGT+++VL +  SVELVMQ TS+LGAESHP HLHGFNFFVVGQGFGNF+   DP
Sbjct  444  NNTNVSNGTRLVVLPYGASVELVMQGTSVLGAESHPFHLHGFNFFVVGQGFGNFDPVNDP  503

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              +NLVDPVERNTVGVPA GWVAIRFL DNPGVWFMHCHLEVH SWGLKMAW+V DG LP
Sbjct  504  AKYNLVDPVERNTVGVPAAGWVAIRFLVDNPGVWFMHCHLEVHVSWGLKMAWVVQDGSLP  563

Query  721  NQKLLPPPSDLPKC  762
            NQK+LPPPSDLPKC
Sbjct  564  NQKILPPPSDLPKC  577



>ref|XP_011089492.1| PREDICTED: laccase-17 [Sesamum indicum]
Length=578

 Score =   357 bits (917),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 188/247 (76%), Positives = 213/247 (86%), Gaps = 1/247 (0%)
 Frame = +1

Query  22   PILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTCQGPT  201
            P LP +N TSF +NFS K RSL +  +PA VPQTVDK FFFTVGLG++PC KNQTCQGP 
Sbjct  333  PTLPPINATSFVANFSSKFRSLANARFPANVPQTVDKKFFFTVGLGSSPCPKNQTCQGP-  391

Query  202  NATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNTMVSN  381
            N TKF+AS+NN+SF  PTTALLQA+FS +SN VY+ +FP  PL  FNYTG PPNNT V+N
Sbjct  392  NGTKFAASVNNISFTNPTTALLQAYFSRRSNGVYNTDFPSFPLMPFNYTGTPPNNTGVAN  451

Query  382  GTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKNFNLVD  561
            GTK++VL FN++VE+V+QDTSILGAESHPLHLHG+NFFVVGQGFGNF+  KDP NFNLVD
Sbjct  452  GTKLVVLPFNSTVEVVLQDTSILGAESHPLHLHGYNFFVVGQGFGNFDPQKDPPNFNLVD  511

Query  562  PVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLLPP  741
            PVERNT+GVP+GGW AIRF ADNPGVWFMHCH EVH SWGLKMAW+VLDGKLPNQKL PP
Sbjct  512  PVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLKMAWIVLDGKLPNQKLPPP  571

Query  742  PSDLPKC  762
            PSDLPKC
Sbjct  572  PSDLPKC  578



>gb|EYU41745.1| hypothetical protein MIMGU_mgv1a003538mg [Erythranthe guttata]
Length=579

 Score =   357 bits (917),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 182/255 (71%), Positives = 213/255 (84%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDK-  177
            +K P+FKP LPALNDT FA++F+ KLRSL +  +PA VP  +D+ FFFT+GLGT PCD+ 
Sbjct  326  RKFPVFKPTLPALNDTVFATDFASKLRSLATRQFPANVPVKIDRRFFFTIGLGTTPCDRA  385

Query  178  NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            N TC+GP  A KFSAS+NNVSFV+P TALLQ+H++G+S  VY  +FPV P  WFNYTG P
Sbjct  386  NVTCKGPKGA-KFSASVNNVSFVRPNTALLQSHYAGKSRGVYGSDFPVYPTRWFNYTGTP  444

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNT+VS GT+V VL F   VEL++QDTSILGAESHPLHLHGFNFFVVG+GFGNF+   D
Sbjct  445  PNNTVVSKGTRVEVLPFGAGVELILQDTSILGAESHPLHLHGFNFFVVGRGFGNFDPEND  504

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PKN+NLVDPVERNTV VP+GGW +IRFLADNPGVWFMHCH E H SWGL+MAWLVLDG L
Sbjct  505  PKNYNLVDPVERNTVAVPSGGWASIRFLADNPGVWFMHCHFEAHASWGLEMAWLVLDGNL  564

Query  718  PNQKLLPPPSDLPKC  762
            P QK+LPPP+DLPKC
Sbjct  565  PYQKMLPPPNDLPKC  579



>ref|XP_006592189.1| PREDICTED: laccase-2-like isoform X1 [Glycine max]
 gb|KHN32142.1| Laccase-2 [Glycine soja]
Length=590

 Score =   358 bits (918),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 186/253 (74%), Positives = 215/253 (85%), Gaps = 1/253 (0%)
 Frame = +1

Query  7    LPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQT  186
            +P  KP LPA+NDTSF +NFS K  SL++  YPAKVPQTVDK FFFT+GLGT+PC KNQT
Sbjct  338  IPTLKPSLPAINDTSFVANFSSKFLSLNTDKYPAKVPQTVDKSFFFTIGLGTSPCPKNQT  397

Query  187  CQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNH-VYSPNFPVSPLHWFNYTGNPPN  363
            CQGP N++KF+AS+NN+SF  P+ ALLQ HF GQ+N+ +Y+ +FP  PL  FNYTG PPN
Sbjct  398  CQGPNNSSKFAASMNNISFTLPSIALLQQHFFGQANNGIYTTDFPAMPLMPFNYTGTPPN  457

Query  364  NTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPK  543
            NT VSNGTK +V+ FNT V++V+QDTSILGAESHPLHLHGFNF+VVGQGFGNFN   DP 
Sbjct  458  NTRVSNGTKTVVIPFNTRVQVVLQDTSILGAESHPLHLHGFNFYVVGQGFGNFNPNTDPP  517

Query  544  NFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPN  723
             FNLVDPVERNTVGVP+GGWVAIRFLADNPGVW MHCH +VH SWGL+MAW+V DGKLPN
Sbjct  518  KFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWIVEDGKLPN  577

Query  724  QKLLPPPSDLPKC  762
            QKL PPP+DLPKC
Sbjct  578  QKLPPPPADLPKC  590



>ref|XP_009603099.1| PREDICTED: laccase-2-like [Nicotiana tomentosiformis]
Length=583

 Score =   357 bits (917),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 192/255 (75%), Positives = 218/255 (85%), Gaps = 4/255 (2%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+  P LP +N TSF +NF+ K RSL +  +PA VPQ VDKHFFFTVGLG+NPC KN
Sbjct  332  KNLPI--PTLPPINSTSFVANFTNKFRSLANARFPANVPQKVDKHFFFTVGLGSNPCPKN  389

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSP-NFPVSPLHWFNYTGNP  357
            QTCQGP N++KFSAS+NNVS + PTTALLQ++F  +SN VY+  +FP  PL  FNYTG P
Sbjct  390  QTCQGPNNSSKFSASVNNVSMILPTTALLQSYFK-KSNGVYTTDDFPSVPLVPFNYTGTP  448

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNT VSNGTKV+VL FNTSVELVMQ TSILGAESHPLHLHG+NF+VVGQGFGNF+  KD
Sbjct  449  PNNTHVSNGTKVVVLPFNTSVELVMQGTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKD  508

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P N+NLVDPVERNT+GVP+GGWVAIRFLADNPGVWFMHCH EVH SWGL+MAWLVLDG+L
Sbjct  509  PANYNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHFEVHLSWGLRMAWLVLDGEL  568

Query  718  PNQKLLPPPSDLPKC  762
            PNQKL PPP+DLPKC
Sbjct  569  PNQKLPPPPADLPKC  583



>ref|XP_002881031.1| hypothetical protein ARALYDRAFT_901874 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57290.1| hypothetical protein ARALYDRAFT_901874 [Arabidopsis lyrata subsp. 
lyrata]
Length=573

 Score =   357 bits (916),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 217/255 (85%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K L + KP LP +N TS+A+NF+K  RSL S ++P  VP+TVDK +FFTVGLGTNPC KN
Sbjct  319  KNLSIIKPSLPPINSTSYAANFTKMFRSLASSTFPVNVPKTVDKKYFFTVGLGTNPCPKN  378

Query  181  QTCQGPTNATKFSASINNVSFVQP-TTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            QTCQGPTNATKF+ASINNVSF+ P  T+LLQ++F G+SN+V+  +FP +P   FNYTG P
Sbjct  379  QTCQGPTNATKFAASINNVSFILPDKTSLLQSYFVGKSNNVFMTDFPTAPFFPFNYTGTP  438

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMVS GTKV+VL +NT+VELV+Q TSILG E+HP+HLHGFNF+VVGQGFGNFN  +D
Sbjct  439  PNNTMVSRGTKVVVLKYNTTVELVLQGTSILGIEAHPVHLHGFNFYVVGQGFGNFNPARD  498

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PK +NLVDPVERNT+ VP+GGWVAIRFLADNPGVW MHCH+E+H SWGL MAW+VLDG L
Sbjct  499  PKQYNLVDPVERNTINVPSGGWVAIRFLADNPGVWLMHCHIEIHLSWGLTMAWVVLDGDL  558

Query  718  PNQKLLPPPSDLPKC  762
            PNQKLLPPPSD PKC
Sbjct  559  PNQKLLPPPSDFPKC  573



>ref|XP_006592190.1| PREDICTED: laccase-2-like isoform X2 [Glycine max]
Length=588

 Score =   357 bits (917),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 186/253 (74%), Positives = 215/253 (85%), Gaps = 1/253 (0%)
 Frame = +1

Query  7    LPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQT  186
            +P  KP LPA+NDTSF +NFS K  SL++  YPAKVPQTVDK FFFT+GLGT+PC KNQT
Sbjct  336  IPTLKPSLPAINDTSFVANFSSKFLSLNTDKYPAKVPQTVDKSFFFTIGLGTSPCPKNQT  395

Query  187  CQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNH-VYSPNFPVSPLHWFNYTGNPPN  363
            CQGP N++KF+AS+NN+SF  P+ ALLQ HF GQ+N+ +Y+ +FP  PL  FNYTG PPN
Sbjct  396  CQGPNNSSKFAASMNNISFTLPSIALLQQHFFGQANNGIYTTDFPAMPLMPFNYTGTPPN  455

Query  364  NTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPK  543
            NT VSNGTK +V+ FNT V++V+QDTSILGAESHPLHLHGFNF+VVGQGFGNFN   DP 
Sbjct  456  NTRVSNGTKTVVIPFNTRVQVVLQDTSILGAESHPLHLHGFNFYVVGQGFGNFNPNTDPP  515

Query  544  NFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPN  723
             FNLVDPVERNTVGVP+GGWVAIRFLADNPGVW MHCH +VH SWGL+MAW+V DGKLPN
Sbjct  516  KFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWIVEDGKLPN  575

Query  724  QKLLPPPSDLPKC  762
            QKL PPP+DLPKC
Sbjct  576  QKLPPPPADLPKC  588



>ref|XP_002309069.1| hypothetical protein POPTR_0006s08780g [Populus trichocarpa]
 gb|EEE92592.1| hypothetical protein POPTR_0006s08780g [Populus trichocarpa]
Length=579

 Score =   357 bits (916),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 188/254 (74%), Positives = 215/254 (85%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+ KP LP  NDT+FA+ F KK+RSL +  +PAKVP+ VD+ FFFT+GLG+ PC +N
Sbjct  327  KKLPLLKPSLPVFNDTTFATKFVKKIRSLANARFPAKVPKKVDRRFFFTIGLGSLPCSQN  386

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            +TCQGP N T F+AS+NNVSFVQP  ALLQ+HF  +S  VY+ +FP +P   FNYTG PP
Sbjct  387  KTCQGPNN-TMFAASVNNVSFVQPNIALLQSHFLNRSKGVYTTDFPTNPPFKFNYTGTPP  445

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            +NTM + GTKV+VL FNTSVELVMQDTSI+GAESHPLHLHGFNFFVVGQGFGNF+  KDP
Sbjct  446  SNTMTAKGTKVVVLPFNTSVELVMQDTSIIGAESHPLHLHGFNFFVVGQGFGNFDPKKDP  505

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDP ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+V DGK P
Sbjct  506  VKFNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVNDGKRP  565

Query  721  NQKLLPPPSDLPKC  762
            +QKL PPPSDLPKC
Sbjct  566  SQKLPPPPSDLPKC  579



>emb|CAA74105.1| laccase [Populus trichocarpa]
Length=580

 Score =   357 bits (916),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 188/254 (74%), Positives = 212/254 (83%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP  KP LP +N T F +NF+KK RSL +  +PA VPQTVD+ FFFTVGLGTNPC KN
Sbjct  327  KKLPTLKPTLPPINATGFVANFTKKFRSLANAKFPANVPQTVDRKFFFTVGLGTNPCPKN  386

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQG  N TKF+ASINNVSFV P+ ALLQ++F    N V++ +FP +P   FNYTG PP
Sbjct  387  TTCQGTNNNTKFAASINNVSFVLPSVALLQSYFLWTVNGVFTSDFPQNPTIPFNYTGTPP  446

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMVSNGTK +VL FNTSVELVMQ TSI+ AESHPLHLHGFNFFVVGQGFGN++  KDP
Sbjct  447  NNTMVSNGTKAVVLTFNTSVELVMQGTSIVAAESHPLHLHGFNFFVVGQGFGNYDPNKDP  506

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP+ERNT GVPAGGW+AIRFLADNPGVWFMHCHL+VHTSWGL+MAW+VLDG  P
Sbjct  507  SNFNLVDPMERNTAGVPAGGWIAIRFLADNPGVWFMHCHLDVHTSWGLRMAWIVLDGPQP  566

Query  721  NQKLLPPPSDLPKC  762
            NQK+ PPPSDLPKC
Sbjct  567  NQKIPPPPSDLPKC  580



>ref|XP_003564593.1| PREDICTED: laccase-12/13-like [Brachypodium distachyon]
Length=578

 Score =   357 bits (916),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 189/255 (74%), Positives = 211/255 (83%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPC-DK  177
            K LP+FKP +P +NDTSF SNF+ KLRSL +  YPA VP+ VD+ FFFTVGLGT+PC   
Sbjct  325  KNLPLFKPTMPQINDTSFVSNFTAKLRSLANEDYPADVPREVDRRFFFTVGLGTHPCAGA  384

Query  178  NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            N TCQGP N ++F+A++NNVSFV PTTALLQ+HF+G SN VY  NFP  P   FNYTG P
Sbjct  385  NGTCQGP-NGSRFAAAVNNVSFVLPTTALLQSHFTGMSNGVYESNFPAMPSSPFNYTGTP  443

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNT VSNGTK++VL++  SVELVMQ TSILGAESHP HLHGFNFFVVGQGFGNF+   D
Sbjct  444  PNNTNVSNGTKLVVLSYGESVELVMQGTSILGAESHPFHLHGFNFFVVGQGFGNFDPMSD  503

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P  +NLVDPVERNTVGVPA GWVA+RF ADNPGVWFMHCHLEVH SWGLKMAWLV DG L
Sbjct  504  PAKYNLVDPVERNTVGVPAAGWVALRFRADNPGVWFMHCHLEVHVSWGLKMAWLVQDGSL  563

Query  718  PNQKLLPPPSDLPKC  762
             NQKLLPPPSDLPKC
Sbjct  564  SNQKLLPPPSDLPKC  578



>gb|KHN14002.1| Laccase-17 [Glycine soja]
Length=555

 Score =   356 bits (914),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 180/255 (71%), Positives = 215/255 (84%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K L + KP LP +N TSF +NF+ K RSL S  +P KVPQ VD+ FFFTVGLGTNPC KN
Sbjct  301  KNLTLLKPTLPPINATSFVANFTAKFRSLASAKFPVKVPQKVDRKFFFTVGLGTNPCPKN  360

Query  181  QTCQGPTNATKFSASINNVSFVQPTT-ALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
             TCQGP+N TKF+AS+NN+SF  P++ +++QA++S Q+N V+  +FP +PL+ FNYTG P
Sbjct  361  TTCQGPSNNTKFAASVNNISFALPSSVSIMQAYYSSQANGVFKTDFPATPLNPFNYTGTP  420

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMV+N TK++VL FNTSVELV+QDTSILGAESHPLHLHG++FFVVGQGFGN++   D
Sbjct  421  PNNTMVTNDTKLVVLKFNTSVELVLQDTSILGAESHPLHLHGYDFFVVGQGFGNYDPNND  480

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P  FNL+DPVERNT GVPAGGW+AIRF ADNPGVWFMHCHL++HTSWGL+MAWLVLDG  
Sbjct  481  PARFNLIDPVERNTAGVPAGGWIAIRFFADNPGVWFMHCHLDLHTSWGLRMAWLVLDGPE  540

Query  718  PNQKLLPPPSDLPKC  762
            PNQKL PPPSDLPKC
Sbjct  541  PNQKLQPPPSDLPKC  555



>ref|XP_003568310.1| PREDICTED: laccase-12/13-like [Brachypodium distachyon]
Length=577

 Score =   356 bits (914),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 189/256 (74%), Positives = 211/256 (82%), Gaps = 3/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDK-  177
              LP+ +P LP +NDTS  SN++ KLRSL S  YPA VPQ VD+ FFFTVGLGT+PC   
Sbjct  323  SSLPILRPTLPEINDTSVVSNYTAKLRSLASAEYPASVPQQVDREFFFTVGLGTHPCQSL  382

Query  178  -NQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
             N TCQGP N T+F+ASINN+SFV PTTALLQ+H++G SN VY+ NFP  PL  +NYTG 
Sbjct  383  INGTCQGPNN-TRFAASINNISFVLPTTALLQSHYTGMSNGVYASNFPFYPLRPWNYTGT  441

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PPNNT V NGTK +VL F  +VELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN+N + 
Sbjct  442  PPNNTNVMNGTKALVLPFGVAVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYNPSS  501

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DP  FNLVDPVERNTVGVPAGGWVAIRF ADNPGVWFMHCHLEVH SWGLKMAW+VLDG 
Sbjct  502  DPAKFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEVHMSWGLKMAWVVLDGA  561

Query  715  LPNQKLLPPPSDLPKC  762
             P+QKL PPP+DLPKC
Sbjct  562  RPDQKLPPPPADLPKC  577



>ref|XP_008778578.1| PREDICTED: laccase-10-like [Phoenix dactylifera]
Length=577

 Score =   356 bits (913),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 186/254 (73%), Positives = 214/254 (84%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K L + +P LP+LNDT+FA+NF+ KLRSL +  +PA VPQTVD+ F+FTVGLGT+PC  N
Sbjct  325  KNLTLSRPTLPSLNDTAFAANFTGKLRSLANAQFPANVPQTVDRRFYFTVGLGTSPCPTN  384

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKF+AS+NN+SF  P+TALLQAHF GQS  VY  +FP +P   FNYTG PP
Sbjct  385  QTCQGP-NGTKFAASVNNISFALPSTALLQAHFFGQSKGVYRTDFPSNPPFPFNYTGTPP  443

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NN+ V+NGTK++VL FN SVELVMQDTSI G ESHPLHLHGFNFFVVGQGFGN++  KDP
Sbjct  444  NNSFVTNGTKLVVLPFNASVELVMQDTSIQGIESHPLHLHGFNFFVVGQGFGNYDPAKDP  503

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNL DP+ERNTVGVPAGGWVAIRF ADNPGVWFMHCHL+VHT WGL+MAW+V DG LP
Sbjct  504  AKFNLADPIERNTVGVPAGGWVAIRFRADNPGVWFMHCHLDVHTVWGLRMAWVVNDGPLP  563

Query  721  NQKLLPPPSDLPKC  762
            +QKLLPPPSDLPKC
Sbjct  564  SQKLLPPPSDLPKC  577



>gb|KDO48719.1| hypothetical protein CISIN_1g0085922mg, partial [Citrus sinensis]
Length=384

 Score =   349 bits (896),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 188/256 (73%), Positives = 210/256 (82%), Gaps = 3/256 (1%)
 Frame = +1

Query  1    KKLPMFKP--ILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCD  174
            K LP+ KP  ILP  NDT+F   FSKK+RSL +  +PAKVP  VD+ FFFTVGLG +PC 
Sbjct  130  KNLPLLKPAAILPKFNDTNFVMQFSKKIRSLATAKFPAKVPMKVDRRFFFTVGLGLSPCP  189

Query  175  KNQTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGN  354
            +NQTCQGP N TK +AS+NNVSFVQP  ALLQAHF  +S  VY+ +FP +P   FNYTG 
Sbjct  190  QNQTCQGPNN-TKLAASVNNVSFVQPNVALLQAHFFNRSKGVYTTDFPANPPFKFNYTGT  248

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
            PP+N MVS+GTKV+VL FN SVE+VMQDTSI+ AESHPLHLHGFNFFVV QGFGNF+  K
Sbjct  249  PPSNIMVSSGTKVVVLPFNASVEVVMQDTSIIVAESHPLHLHGFNFFVVAQGFGNFDPNK  308

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DP  FNLVDP ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+V DGK
Sbjct  309  DPAKFNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVNDGK  368

Query  715  LPNQKLLPPPSDLPKC  762
             P QKL PPPSDLPKC
Sbjct  369  GPKQKLPPPPSDLPKC  384



>ref|XP_003551482.1| PREDICTED: laccase-17-like [Glycine max]
Length=576

 Score =   356 bits (913),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 180/255 (71%), Positives = 215/255 (84%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K L + KP LP +N TSF +NF+ K RSL S  +P KVPQ VD+ FFFTVGLGTNPC KN
Sbjct  322  KNLTLLKPTLPPINATSFVANFTAKFRSLASAKFPVKVPQKVDRKFFFTVGLGTNPCPKN  381

Query  181  QTCQGPTNATKFSASINNVSFVQPTT-ALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
             TCQGP+N TKF+AS+NN+SF  P++ +++QA++S Q+N V+  +FP +PL+ FNYTG P
Sbjct  382  TTCQGPSNNTKFAASVNNISFALPSSVSIMQAYYSSQANGVFKTDFPATPLNPFNYTGTP  441

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMV+N TK++VL FNTSVELV+QDTSILGAESHPLHLHG++FFVVGQGFGN++   D
Sbjct  442  PNNTMVTNDTKLVVLKFNTSVELVLQDTSILGAESHPLHLHGYDFFVVGQGFGNYDPNND  501

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P  FNL+DPVERNT GVPAGGW+AIRF ADNPGVWFMHCHL++HTSWGL+MAWLVLDG  
Sbjct  502  PARFNLIDPVERNTAGVPAGGWIAIRFFADNPGVWFMHCHLDLHTSWGLRMAWLVLDGPE  561

Query  718  PNQKLLPPPSDLPKC  762
            PNQKL PPPSDLPKC
Sbjct  562  PNQKLQPPPSDLPKC  576



>ref|XP_003530212.1| PREDICTED: laccase-17-like [Glycine max]
Length=579

 Score =   356 bits (913),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 179/255 (70%), Positives = 217/255 (85%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K L + KP LP +N TSF +NF+ K RSL S  +PAKVPQ VD+ FFFTVGLGT+PC KN
Sbjct  325  KNLTLLKPTLPPINATSFVANFTAKFRSLASAKFPAKVPQKVDRKFFFTVGLGTSPCPKN  384

Query  181  QTCQGPTNATKFSASINNVSFVQPTT-ALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
             TCQGP+N TKF+AS+NN+SF  P++ +++QA++SGQ+N V+  +FP +PL+ FNYTG P
Sbjct  385  TTCQGPSNNTKFAASVNNISFALPSSVSIMQAYYSGQANGVFKTDFPATPLNPFNYTGTP  444

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMV+N TK++VL FNTSVE+V+QDTSILGAESHPLHLHG++FF+VGQGFGN++   D
Sbjct  445  PNNTMVTNDTKLVVLKFNTSVEVVLQDTSILGAESHPLHLHGYDFFIVGQGFGNYDPNND  504

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P  FNL+DPVERNTVGVPAGGW+A RFLADNPGVWFMHCHL++HTSWGL+MAWLVLDG  
Sbjct  505  PAKFNLIDPVERNTVGVPAGGWIAFRFLADNPGVWFMHCHLDLHTSWGLRMAWLVLDGPG  564

Query  718  PNQKLLPPPSDLPKC  762
            P QKL PPPSDLPKC
Sbjct  565  PKQKLQPPPSDLPKC  579



>ref|XP_007016364.1| Laccase 2 [Theobroma cacao]
 gb|EOY33983.1| Laccase 2 [Theobroma cacao]
Length=585

 Score =   356 bits (913),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 184/254 (72%), Positives = 214/254 (84%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K  P+ KP LPA+N T+F + FS K RSL +  +PA VPQ VDK FFFTVGLG++PC KN
Sbjct  333  KNHPLLKPGLPAINATNFVAKFSSKFRSLATTKFPANVPQKVDKKFFFTVGLGSSPCPKN  392

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKF+AS+NN+SF  P TALLQ++F  QSN  Y+ +FP  PLH FNYTG PP
Sbjct  393  QTCQGP-NGTKFAASMNNISFALPRTALLQSYFFAQSNRGYTTDFPAFPLHPFNYTGTPP  451

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT+V+NGTKV+V+ FNTSVE+V+QDTSILGAESHPLHLHG+NF+VVGQGFGNF+  KDP
Sbjct  452  NNTLVTNGTKVVVIPFNTSVEVVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPNKDP  511

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FN+VDP ERNTVGVP+GGWVAIRF ADNPGVW MHCHL+VH SWGL+MAW+VLDG+LP
Sbjct  512  AKFNVVDPAERNTVGVPSGGWVAIRFQADNPGVWLMHCHLDVHLSWGLRMAWIVLDGELP  571

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  572  NQKLPPPPSDLPKC  585



>gb|KHN40291.1| Laccase-17 [Glycine soja]
Length=569

 Score =   355 bits (912),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 179/255 (70%), Positives = 217/255 (85%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K L + KP LP +N TSF +NF+ K RSL S  +PAKVPQ VD+ FFFTVGLGT+PC KN
Sbjct  315  KNLTLLKPTLPPINATSFVANFTAKFRSLASAKFPAKVPQKVDRKFFFTVGLGTSPCPKN  374

Query  181  QTCQGPTNATKFSASINNVSFVQPTT-ALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
             TCQGP+N TKF+AS+NN+SF  P++ +++QA++SGQ+N V+  +FP +PL+ FNYTG P
Sbjct  375  TTCQGPSNNTKFAASVNNISFALPSSVSIMQAYYSGQANGVFKTDFPATPLNPFNYTGTP  434

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMV+N TK++VL FNTSVE+V+QDTSILGAESHPLHLHG++FF+VGQGFGN++   D
Sbjct  435  PNNTMVTNDTKLVVLKFNTSVEVVLQDTSILGAESHPLHLHGYDFFIVGQGFGNYDPNND  494

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            P  FNL+DPVERNTVGVPAGGW+A RFLADNPGVWFMHCHL++HTSWGL+MAWLVLDG  
Sbjct  495  PAKFNLIDPVERNTVGVPAGGWIAFRFLADNPGVWFMHCHLDLHTSWGLRMAWLVLDGPG  554

Query  718  PNQKLLPPPSDLPKC  762
            P QKL PPPSDLPKC
Sbjct  555  PKQKLQPPPSDLPKC  569



>gb|KDP35659.1| hypothetical protein JCGZ_09097 [Jatropha curcas]
Length=574

 Score =   355 bits (911),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 186/254 (73%), Positives = 211/254 (83%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K+LP   PILPALNDT FA NFS +LRSL S  YPA VPQ VDK FFFTVGLGTNPC KN
Sbjct  322  KQLPPLNPILPALNDTPFAFNFSTRLRSLASLEYPANVPQKVDKRFFFTVGLGTNPCPKN  381

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKF+AS+NN+SF  PTTA+LQ++F   SN VYS +FP  P+  F+YTG P 
Sbjct  382  QTCQGP-NGTKFAASVNNISFAFPTTAMLQSYFFRNSNGVYSTDFPSQPIIPFDYTGTPS  440

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNTMV NGTKV+VL FNTSVE+V+QDTSILG ESHPLHLHG+NF+V+G GFGNF+   DP
Sbjct  441  NNTMVINGTKVVVLPFNTSVEVVLQDTSILGNESHPLHLHGYNFYVIGSGFGNFDPNNDP  500

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FN+VDPVERNT+GVP+GGWVA +FLADNPGVW MHCH +VH SWGL+MAW+VLDG LP
Sbjct  501  AKFNVVDPVERNTIGVPSGGWVAFQFLADNPGVWLMHCHFDVHLSWGLRMAWIVLDGNLP  560

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  561  NQKLPPPPSDLPKC  574



>ref|XP_002863053.1| hypothetical protein ARALYDRAFT_497195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39312.1| hypothetical protein ARALYDRAFT_497195 [Arabidopsis lyrata subsp. 
lyrata]
Length=574

 Score =   355 bits (910),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 182/255 (71%), Positives = 216/255 (85%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K L + KP LP +N TS+A+NF+K  RSL S ++P   P+TVDK +FFTVGLGTNPC KN
Sbjct  320  KNLSIIKPSLPPINSTSYAANFTKMFRSLASSTFPVNAPKTVDKKYFFTVGLGTNPCPKN  379

Query  181  QTCQGPTNATKFSASINNVSFVQPT-TALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            QTCQGPTNATKF+ASINNVSF+ P  T+LLQ++F G+SN+V+  +FP +P   FNYTG P
Sbjct  380  QTCQGPTNATKFAASINNVSFILPNKTSLLQSYFVGKSNNVFMTDFPTAPFFPFNYTGTP  439

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMVS GTKV+VL +NT+VELV+Q TSILG E+HP+HLHGFNF+VVGQGFGNFN  +D
Sbjct  440  PNNTMVSRGTKVVVLKYNTTVELVLQGTSILGIEAHPVHLHGFNFYVVGQGFGNFNPARD  499

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PK +NLVDPVERNT+ VP+GGWVAIRFLADNPGVW MHCH+E+H SWGL MAW+VLDG L
Sbjct  500  PKQYNLVDPVERNTINVPSGGWVAIRFLADNPGVWLMHCHIEIHLSWGLTMAWVVLDGDL  559

Query  718  PNQKLLPPPSDLPKC  762
            PNQ+LLPPPSD PKC
Sbjct  560  PNQELLPPPSDFPKC  574



>gb|EMT21652.1| Laccase-4 [Aegilops tauschii]
Length=592

 Score =   355 bits (911),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 188/268 (70%), Positives = 210/268 (78%), Gaps = 14/268 (5%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+F+P LP  NDT   +NF+ KLRSL +P YPA VPQ+VD+  FFTVGLGT PC  N
Sbjct  325  KDLPLFRPTLPRFNDTGLVTNFTSKLRSLATPQYPAAVPQSVDRRVFFTVGLGTRPCPGN  384

Query  181  QTCQ--------------GPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFP  318
                              GPTN T+F+A+INN+S V P+TALLQ+HF+G+S  VY  NFP
Sbjct  385  AARHTAVPGGRAAVGGQAGPTNTTQFAAAINNISLVLPSTALLQSHFTGKSRGVYGSNFP  444

Query  319  VSPLHWFNYTGNPPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffv  498
            V PL  FNYTG  PNNT V+ GTK++VL FN SVELVMQDTSILG ESHPLHLHGFNFFV
Sbjct  445  VLPLSQFNYTGVSPNNTNVATGTKLLVLPFNASVELVMQDTSILGIESHPLHLHGFNFFV  504

Query  499  vgqgfgnfnqTKDPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSW  678
            VGQGFGN++   DP  FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHT+W
Sbjct  505  VGQGFGNYDPVNDPMRFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTTW  564

Query  679  GLKMAWLVLDGKLPNQKLLPPPSDLPKC  762
            GL+MAWLVLDG L NQKLLPPPSDLPKC
Sbjct  565  GLRMAWLVLDGSLSNQKLLPPPSDLPKC  592



>ref|XP_006350913.1| PREDICTED: laccase-2-like [Solanum tuberosum]
Length=584

 Score =   355 bits (910),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 186/254 (73%), Positives = 215/254 (85%), Gaps = 2/254 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+  P LP +N TSF  NF+ K R+L S  +PA VP+ VDKHFFFTVGLG+NPC KN
Sbjct  333  KNLPI--PTLPPINSTSFVFNFTNKFRALASVKFPANVPRNVDKHFFFTVGLGSNPCPKN  390

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N++KF+AS+NNVS + P +ALLQ++F  +SN VY+ +FP  PL  FNYTG PP
Sbjct  391  QTCQGPNNSSKFAASVNNVSMILPNSALLQSYFFKKSNGVYTSDFPSVPLIPFNYTGTPP  450

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT VSNGTKV+VL FNTSVE+VMQDTSILGAESHPLHLHG+NF+VVGQGFGNF+   DP
Sbjct  451  NNTNVSNGTKVVVLLFNTSVEVVMQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKNDP  510

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             N+NLVDPVERNTVGVP+GGWVAIRFLADNPGVW MHCH +VH SWGL+MAW+VLDGKLP
Sbjct  511  ANYNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWIVLDGKLP  570

Query  721  NQKLLPPPSDLPKC  762
            NQKLLPPP+DLP C
Sbjct  571  NQKLLPPPADLPMC  584



>ref|XP_006363100.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=579

 Score =   355 bits (910),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 187/252 (74%), Positives = 213/252 (85%), Gaps = 1/252 (0%)
 Frame = +1

Query  7    LPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQT  186
             P+ KP LP  NDT+FA++F KK+RSL +  +PA VP+ VDK FFFTVGLG NPC KNQT
Sbjct  329  FPLLKPKLPIFNDTTFATSFVKKIRSLANAKFPANVPKKVDKQFFFTVGLGLNPCPKNQT  388

Query  187  CQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNN  366
            CQGP N TK +AS+NNVSFVQP  ALLQ+H+  QS  VY+ +FPV+P   FNYTGNPPNN
Sbjct  389  CQGPNN-TKLAASVNNVSFVQPNVALLQSHYFNQSKGVYTTDFPVNPPFKFNYTGNPPNN  447

Query  367  TMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKN  546
            + V++GTKV++L FNTSVELVMQDTSI+ AESHPLHLHGFNFFVVGQGFGN+N + DP N
Sbjct  448  SFVTSGTKVVMLPFNTSVELVMQDTSIISAESHPLHLHGFNFFVVGQGFGNYNSSNDPAN  507

Query  547  FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQ  726
            FNLVDP ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKM W+V DGK P Q
Sbjct  508  FNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMVWMVNDGKSPKQ  567

Query  727  KLLPPPSDLPKC  762
            KL PPP+DLPKC
Sbjct  568  KLPPPPADLPKC  579



>gb|ABW81166.1| unknown [Capsella rubella]
Length=573

 Score =   354 bits (909),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 216/255 (85%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K L + KP LP +N TS+A+NF+K  RSL S ++PA VP+TVDK FFFTVGLGTNPC KN
Sbjct  319  KNLSIIKPSLPPINSTSYAANFTKMFRSLASSTFPANVPKTVDKKFFFTVGLGTNPCPKN  378

Query  181  QTCQGPTNATKFSASINNVSFVQPT-TALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            QTCQGPTN TKF+ASINNVSF+ P  T+LLQ++F G+S +V+  +FP +P+  FNYTG P
Sbjct  379  QTCQGPTNTTKFAASINNVSFILPNKTSLLQSYFLGKSKNVFMTDFPTAPIFPFNYTGTP  438

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMVS GTKV+VL +NT+VELV+Q TSILG E+HP+HLHGFNFFVVGQGFGNFN   D
Sbjct  439  PNNTMVSRGTKVVVLKYNTTVELVLQGTSILGIEAHPIHLHGFNFFVVGQGFGNFNPAID  498

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PK +NLVDPVERNT+ VP+GGWVAIRFLADNPGVW MHCH+E+H SWGL MAW+VLDG L
Sbjct  499  PKQYNLVDPVERNTINVPSGGWVAIRFLADNPGVWLMHCHIEIHLSWGLTMAWVVLDGDL  558

Query  718  PNQKLLPPPSDLPKC  762
            PNQK+LPPPSD PKC
Sbjct  559  PNQKILPPPSDFPKC  573



>ref|XP_008777229.1| PREDICTED: laccase-17-like [Phoenix dactylifera]
Length=522

 Score =   352 bits (904),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 179/254 (70%), Positives = 204/254 (80%), Gaps = 7/254 (3%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+ KP LPA+NDT+ A+NFS KLRSL S  +PA VP+TVD+ F+FTVGLGT+PC +N
Sbjct  276  KKLPLLKPTLPAINDTAAAANFSSKLRSLASTQFPADVPRTVDRSFYFTVGLGTSPCPRN  335

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N TKF+ASINNVSF  P+ ALLQAH+ GQS  VY+ +FP +P   FNYTG PP
Sbjct  336  QTCQGP-NGTKFAASINNVSFAFPSMALLQAHYLGQSKGVYAADFPRNPPFPFNYTGTPP  394

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NNT V+NGTKV VL FNT+VELVMQDTSI GAESHPLHLHG NF+           TKDP
Sbjct  395  NNTFVTNGTKVAVLPFNTTVELVMQDTSIQGAESHPLHLHGNNFYPTKDP------TKDP  448

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNL+DPVERNTVGV +GGW AIRF ADNPGVW MHCH +VH SWGL+MAW+V DG LP
Sbjct  449  AKFNLLDPVERNTVGVLSGGWAAIRFRADNPGVWLMHCHFDVHLSWGLRMAWVVNDGPLP  508

Query  721  NQKLLPPPSDLPKC  762
            +QKLLPPPSDLPKC
Sbjct  509  SQKLLPPPSDLPKC  522



>gb|KEH22909.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=578

 Score =   354 bits (908),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 185/256 (72%), Positives = 214/256 (84%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K L   KP LP+LNDT+F SNF+KK RSL +  +P  VP+ VDK FFFTVGLGT PC KN
Sbjct  323  KNLRFLKPTLPSLNDTNFVSNFTKKFRSLANSKFPINVPKKVDKKFFFTVGLGTFPCPKN  382

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNH--VYSPNFPVSPLHWFNYTGN  354
             TCQGP N TKF+AS+NN SFV P+ +++QA++ G+SN   VY  +FP +PL+ FNYTG 
Sbjct  383  STCQGPNNNTKFAASVNNFSFVLPSVSIMQAYYFGKSNSNGVYKTDFPETPLNPFNYTGT  442

Query  355  PPNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTK  534
             PNNTMV+N TK++VLNFNTSVELV+QDTSILGAESHPLHLHG++FFVVGQGFGN++  K
Sbjct  443  SPNNTMVNNDTKLVVLNFNTSVELVLQDTSILGAESHPLHLHGYDFFVVGQGFGNYDANK  502

Query  535  DPKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGK  714
            DP  FNLVDPVERNTVGVPAGGWVAIRF ADNPGVWFMHCHL++HTSWGL+MAWLVLDG 
Sbjct  503  DPAKFNLVDPVERNTVGVPAGGWVAIRFFADNPGVWFMHCHLDIHTSWGLRMAWLVLDGP  562

Query  715  LPNQKLLPPPSDLPKC  762
              NQKL PPPSDLPKC
Sbjct  563  DSNQKLQPPPSDLPKC  578



>ref|XP_010414436.1| PREDICTED: laccase-2 isoform X3 [Camelina sativa]
Length=591

 Score =   354 bits (909),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 182/255 (71%), Positives = 216/255 (85%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K L + KP LP +N TS+A+NF+K  RSL S ++PA VP++VDK +FFTVGLGTNPC KN
Sbjct  337  KNLSIIKPSLPPINSTSYAANFTKMFRSLASSTFPANVPKSVDKKYFFTVGLGTNPCPKN  396

Query  181  QTCQGPTNATKFSASINNVSFVQPT-TALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            QTCQGPTN TKF+ASINNVSF+ P  T+LLQ++F+G+S  V+  +FP +P+  FNYTG P
Sbjct  397  QTCQGPTNTTKFAASINNVSFILPNKTSLLQSYFTGKSKSVFMTDFPSAPIFPFNYTGTP  456

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMVS GTKV+VL +NT+VELV+Q TSILG E+HP+HLHGFNF+VVGQGFGNFN   D
Sbjct  457  PNNTMVSRGTKVVVLKYNTTVELVLQGTSILGIEAHPIHLHGFNFYVVGQGFGNFNPASD  516

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PK +NLVDPVERNT+ VP+GGWVAIRFLADNPGVW MHCH+E+H SWGL MAW+VLDG L
Sbjct  517  PKQYNLVDPVERNTINVPSGGWVAIRFLADNPGVWLMHCHIEIHLSWGLTMAWVVLDGDL  576

Query  718  PNQKLLPPPSDLPKC  762
            PNQKLLPPPSD PKC
Sbjct  577  PNQKLLPPPSDYPKC  591



>ref|XP_010414434.1| PREDICTED: laccase-2 isoform X1 [Camelina sativa]
 ref|XP_010414435.1| PREDICTED: laccase-2 isoform X2 [Camelina sativa]
Length=585

 Score =   354 bits (909),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 182/255 (71%), Positives = 216/255 (85%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K L + KP LP +N TS+A+NF+K  RSL S ++PA VP++VDK +FFTVGLGTNPC KN
Sbjct  331  KNLSIIKPSLPPINSTSYAANFTKMFRSLASSTFPANVPKSVDKKYFFTVGLGTNPCPKN  390

Query  181  QTCQGPTNATKFSASINNVSFVQPT-TALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            QTCQGPTN TKF+ASINNVSF+ P  T+LLQ++F+G+S  V+  +FP +P+  FNYTG P
Sbjct  391  QTCQGPTNTTKFAASINNVSFILPNKTSLLQSYFTGKSKSVFMTDFPSAPIFPFNYTGTP  450

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMVS GTKV+VL +NT+VELV+Q TSILG E+HP+HLHGFNF+VVGQGFGNFN   D
Sbjct  451  PNNTMVSRGTKVVVLKYNTTVELVLQGTSILGIEAHPIHLHGFNFYVVGQGFGNFNPASD  510

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PK +NLVDPVERNT+ VP+GGWVAIRFLADNPGVW MHCH+E+H SWGL MAW+VLDG L
Sbjct  511  PKQYNLVDPVERNTINVPSGGWVAIRFLADNPGVWLMHCHIEIHLSWGLTMAWVVLDGDL  570

Query  718  PNQKLLPPPSDLPKC  762
            PNQKLLPPPSD PKC
Sbjct  571  PNQKLLPPPSDYPKC  585



>ref|XP_009144396.1| PREDICTED: laccase-2 [Brassica rapa]
Length=578

 Score =   353 bits (907),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 181/255 (71%), Positives = 216/255 (85%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K LP+  P LP +N TS+A+NF+K  RSL +  +PA VP+ VDK FFFTVGLGTNPC KN
Sbjct  324  KNLPVINPSLPPINSTSYAANFTKMFRSLANSRFPANVPKIVDKKFFFTVGLGTNPCPKN  383

Query  181  QTCQGPTNATKFSASINNVSFVQP-TTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            QTCQGPTN TKF+A+INNV+F+ P TT+LLQ++FSG S  V++ NFP +P+  FNYTG P
Sbjct  384  QTCQGPTNTTKFAAAINNVTFILPNTTSLLQSYFSGMSKKVFTTNFPSAPVFPFNYTGVP  443

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMVS GTKV+VL +NT+VELV+Q TSILG E+HP+HLHG+NF+VVGQGFGNF+ T+D
Sbjct  444  PNNTMVSGGTKVVVLKYNTTVELVLQGTSILGIEAHPIHLHGYNFYVVGQGFGNFDPTRD  503

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PK +NLVDPVERNT+ VP+GGWVAIRFLADNPGVWFMHCH+E+H SWGL MAW+VLDG L
Sbjct  504  PKQYNLVDPVERNTINVPSGGWVAIRFLADNPGVWFMHCHIEIHLSWGLTMAWVVLDGDL  563

Query  718  PNQKLLPPPSDLPKC  762
            PNQKL PPPSD P C
Sbjct  564  PNQKLPPPPSDFPTC  578



>ref|XP_004241217.1| PREDICTED: laccase-2-like [Solanum lycopersicum]
Length=576

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 181/247 (73%), Positives = 210/247 (85%), Gaps = 0/247 (0%)
 Frame = +1

Query  22   PILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTCQGPT  201
            P LP +N TSF SNF+ K R+L S  +P  VP+ VDKHFFFTVGLG+NPC KNQTCQGP 
Sbjct  330  PTLPPINSTSFVSNFTNKFRALASVKFPVNVPRNVDKHFFFTVGLGSNPCPKNQTCQGPN  389

Query  202  NATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNTMVSN  381
            N++KF+AS+NN+S + P TALLQ++F  +SN VY+ +FP  PL  FNY+G PPNNT VSN
Sbjct  390  NSSKFAASVNNISMILPNTALLQSYFFKKSNGVYTSDFPSVPLVSFNYSGTPPNNTNVSN  449

Query  382  GTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKNFNLVD  561
            GTKV+VL FNTSVE+VMQDTSILGAESHPLHLHG+NF+VVGQGFGNF+   DP  +NLVD
Sbjct  450  GTKVVVLPFNTSVEVVMQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKNDPAKYNLVD  509

Query  562  PVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLLPP  741
            PVERNTVGVP+GGWVAIRFLADNPGVW MHCH +VH SWGL+MAW+VLDGKLPNQKLLPP
Sbjct  510  PVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWIVLDGKLPNQKLLPP  569

Query  742  PSDLPKC  762
            P+DLP C
Sbjct  570  PADLPMC  576



>ref|XP_006293883.1| hypothetical protein CARUB_v10022868mg, partial [Capsella rubella]
 gb|EOA26781.1| hypothetical protein CARUB_v10022868mg, partial [Capsella rubella]
Length=593

 Score =   354 bits (908),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 216/255 (85%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K L + KP LP +N TS+A+NF+K  RSL S ++PA VP+TVDK FFFTVGLGTNPC KN
Sbjct  339  KNLSIIKPSLPPINSTSYAANFTKMFRSLASSTFPANVPKTVDKKFFFTVGLGTNPCPKN  398

Query  181  QTCQGPTNATKFSASINNVSFVQPT-TALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            QTCQGPTN TKF+ASINNVSF+ P  T+LLQ++F G+S +V+  +FP +P+  FNYTG P
Sbjct  399  QTCQGPTNTTKFAASINNVSFILPNKTSLLQSYFLGKSKNVFMTDFPTAPIFPFNYTGTP  458

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMVS GTKV+VL +NT+VELV+Q TSILG E+HP+HLHGFNFFVVGQGFGNFN   D
Sbjct  459  PNNTMVSRGTKVVVLKYNTTVELVLQGTSILGIEAHPIHLHGFNFFVVGQGFGNFNPAID  518

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PK +NLVDPVERNT+ VP+GGWVAIRFLADNPGVW MHCH+E+H SWGL MAW+VLDG L
Sbjct  519  PKQYNLVDPVERNTINVPSGGWVAIRFLADNPGVWLMHCHIEIHLSWGLTMAWVVLDGDL  578

Query  718  PNQKLLPPPSDLPKC  762
            PNQK+LPPPSD PKC
Sbjct  579  PNQKILPPPSDFPKC  593



>gb|KDO37152.1| hypothetical protein CISIN_1g040938mg, partial [Citrus sinensis]
Length=487

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 186/254 (73%), Positives = 210/254 (83%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+ KP LP  NDT+FA  FSKK+RSL +  +PAKVP+ VD+ FFFTVGLG +PC +N
Sbjct  235  KKLPLLKPALPKFNDTNFAMQFSKKIRSLATAKFPAKVPRKVDRLFFFTVGLGLSPCPQN  294

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T  +ASINNVSF QP  ALLQAHF  +S  VY+ +FP +P   FNYTG PP
Sbjct  295  QTCQGPNN-TMLAASINNVSFAQPNIALLQAHFFNKSKGVYTTDFPANPPFKFNYTGTPP  353

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            +N MVS+GT+ + L FN SVE+VMQDTSI+GAESHPLHLHGFNFFVVGQGFGNF+ +KDP
Sbjct  354  SNIMVSSGTRAVALPFNASVEVVMQDTSIIGAESHPLHLHGFNFFVVGQGFGNFDPSKDP  413

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDP ERNTVGVP+GGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V DGK P
Sbjct  414  AKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVNDGKGP  473

Query  721  NQKLLPPPSDLPKC  762
             QKL PPPSDLPKC
Sbjct  474  KQKLPPPPSDLPKC  487



>ref|XP_006846275.1| hypothetical protein AMTR_s00012p00248430 [Amborella trichopoda]
 gb|ERN07950.1| hypothetical protein AMTR_s00012p00248430 [Amborella trichopoda]
Length=580

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 187/241 (78%), Positives = 206/241 (85%), Gaps = 0/241 (0%)
 Frame = +1

Query  40   NDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTCQGPTNATKFS  219
            NDT+FA+NFS++LRSL S  +PA VPQ VDK F FTVGLGTNPC KNQTCQGP NATKF+
Sbjct  340  NDTNFATNFSRRLRSLASNQFPANVPQKVDKRFLFTVGLGTNPCPKNQTCQGPNNATKFA  399

Query  220  ASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNTMVSNGTKVMV  399
            ASINNVSF  PTTALLQAHF GQS  VY  +FP +P + FNYTG PPNNT VSNGT+V V
Sbjct  400  ASINNVSFSLPTTALLQAHFFGQSAGVYRTDFPDNPPNKFNYTGMPPNNTNVSNGTRVEV  459

Query  400  LNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKNFNLVDPVERNT  579
            L FNT VELV+QDT IL  ESHPLHLHGFNFFVVGQGFGN+N + DP NFNLVDPVERNT
Sbjct  460  LEFNTRVELVLQDTGILWVESHPLHLHGFNFFVVGQGFGNYNPSTDPANFNLVDPVERNT  519

Query  580  VGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLLPPPSDLPK  759
            +GVP+GGWVA+RFLADNPGVWFMHCH+E H SWGL+MAW+V DGKLPNQKLLPPPS LP 
Sbjct  520  IGVPSGGWVALRFLADNPGVWFMHCHIEAHISWGLRMAWVVNDGKLPNQKLLPPPSHLPA  579

Query  760  C  762
            C
Sbjct  580  C  580



>ref|XP_011094885.1| PREDICTED: laccase-17-like [Sesamum indicum]
Length=562

 Score =   353 bits (905),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 190/254 (75%), Positives = 213/254 (84%), Gaps = 2/254 (1%)
 Frame = +1

Query  4    KLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPC-DKN  180
            KLP+ KP LP  NDT+FA+NF+KKLRSL + ++PAKVPQ VD+ FFFTVGLG  PC + N
Sbjct  310  KLPLLKPSLPIFNDTTFATNFNKKLRSLANSNFPAKVPQRVDRRFFFTVGLGLIPCTNPN  369

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
             TCQGP N T  +A++NNVSFV P TALLQAHF  QS  VY+ +FP +P   FNYTGNPP
Sbjct  370  GTCQGPNN-TMLAAAVNNVSFVMPNTALLQAHFFNQSKGVYTTDFPANPPFKFNYTGNPP  428

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            +N MVS+GTKV+VL FNTSVELVMQDTSI+GAESHPLHLHGFNFFV+ QGFGNFN  KDP
Sbjct  429  SNIMVSSGTKVVVLPFNTSVELVMQDTSIIGAESHPLHLHGFNFFVLAQGFGNFNPNKDP  488

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDP ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKM W+V+DG   
Sbjct  489  AKFNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMVWIVMDGNRR  548

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  549  NQKLPPPPSDLPKC  562



>ref|XP_007208016.1| hypothetical protein PRUPE_ppa003296mg [Prunus persica]
 gb|EMJ09215.1| hypothetical protein PRUPE_ppa003296mg [Prunus persica]
Length=587

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 186/253 (74%), Positives = 214/253 (85%), Gaps = 2/253 (1%)
 Frame = +1

Query  10   PMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTC  189
            P+ +P LP +N TSF +NFS K RSL +  +PA VP+TV K FFFTVGLGTNPC KNQTC
Sbjct  335  PLLRPTLPQINATSFVANFSAKFRSLANSKFPANVPKTVRKRFFFTVGLGTNPCPKNQTC  394

Query  190  QGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNT  369
            QGP N++KF+ASINN+SF+ PTTALLQ+HF G+SN V++ +FP +PL  FNYTG P NNT
Sbjct  395  QGPNNSSKFAASINNISFILPTTALLQSHFFGKSNGVFTTDFPTNPLQPFNYTGTPSNNT  454

Query  370  --MVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPK  543
               VSNGTK +VL FNTSVE+V+Q T ILGAESHPLHLHGFNFFVVGQGFGNFN  KDP 
Sbjct  455  NINVSNGTKAVVLKFNTSVEVVLQGTGILGAESHPLHLHGFNFFVVGQGFGNFNPNKDPA  514

Query  544  NFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPN  723
            +FNLVDPVERNT+GVP+GGWVAIRFLADNPGVW +HCH +VH SWGL+MAW+V DGKLPN
Sbjct  515  SFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWLLHCHFDVHLSWGLRMAWVVQDGKLPN  574

Query  724  QKLLPPPSDLPKC  762
            QKL PPPSDLPKC
Sbjct  575  QKLPPPPSDLPKC  587



>ref|XP_009760365.1| PREDICTED: laccase-17-like [Nicotiana sylvestris]
Length=580

 Score =   353 bits (906),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 183/253 (72%), Positives = 214/253 (85%), Gaps = 1/253 (0%)
 Frame = +1

Query  4    KLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQ  183
            KL +FKP LP +  T F +NF+KK RSL S  +PA VPQTVDK F FTVGLG++PC KN 
Sbjct  329  KLKLFKPTLPNITATGFVANFTKKFRSLASAQFPANVPQTVDKRFLFTVGLGSSPCPKNT  388

Query  184  TCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPN  363
            TCQGP N TKF+AS+NNVSF  PTTALLQ+HF GQSN VY+ +FP +PL+ FNYTG PPN
Sbjct  389  TCQGP-NGTKFAASVNNVSFALPTTALLQSHFFGQSNGVYTTDFPTNPLNPFNYTGTPPN  447

Query  364  NTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPK  543
            NT+V+N TK +VL FN+SVE+V+QDT+ILGAE+HPLHLHG+NFFVVG+GFGNF+  KDP 
Sbjct  448  NTLVTNATKTVVLPFNSSVEVVLQDTNILGAENHPLHLHGYNFFVVGEGFGNFDPNKDPA  507

Query  544  NFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPN  723
            NFNL DP+ERNTVGVPAGGW+A RF ADNPGVWFMHCH +VHTSWGL+MAW+VLDG L +
Sbjct  508  NFNLKDPIERNTVGVPAGGWIAFRFFADNPGVWFMHCHFDVHTSWGLRMAWIVLDGPLQS  567

Query  724  QKLLPPPSDLPKC  762
            QKL PPPSDLPKC
Sbjct  568  QKLPPPPSDLPKC  580



>ref|XP_008442529.1| PREDICTED: laccase-17-like [Cucumis melo]
Length=572

 Score =   352 bits (904),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 185/254 (73%), Positives = 214/254 (84%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+ KP+LP  NDT+F+  F+ K+RSL +  +PAKVP  VD+ FFFTVGLG  PC KN
Sbjct  320  KKLPLHKPVLPRFNDTNFSIKFNGKIRSLANSKFPAKVPMRVDRRFFFTVGLGLLPCRKN  379

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            ++CQGP N T+FSASINNV+FVQP TALLQAHF  +SN VY+ +FPV+P   FNYTG PP
Sbjct  380  RSCQGPNN-TRFSASINNVTFVQPNTALLQAHFFNKSNGVYTTDFPVNPPIKFNYTGTPP  438

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
             N MVS+GTKV++L +NT+VELV+QDTSI+ AESHPLHLHGFNFFVVGQG GNF+  +DP
Sbjct  439  KNLMVSSGTKVVMLPYNTAVELVLQDTSIVTAESHPLHLHGFNFFVVGQGIGNFDPNRDP  498

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDP ERNTVGVP+GGWVAIRF+ADNPG WFMHCH EVHTSWGLKMAW+V DGKLP
Sbjct  499  PKFNLVDPAERNTVGVPSGGWVAIRFIADNPGAWFMHCHFEVHTSWGLKMAWIVQDGKLP  558

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  559  NQKLPPPPSDLPKC  572



>ref|XP_011019838.1| PREDICTED: laccase-17-like [Populus euphratica]
Length=579

 Score =   352 bits (904),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 185/254 (73%), Positives = 211/254 (83%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+ KP LP  NDT+FA+ F KK+RSL +  +PAKVP+ VD+ FFFT+GLG  PC +N
Sbjct  327  KKLPLLKPSLPVFNDTTFATKFVKKIRSLANARFPAKVPKKVDRRFFFTIGLGLLPCSQN  386

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            +TCQGP N T  +AS+NNVSFVQP  ALLQ+HF  +S  VY+ +FP +P   FNYTG PP
Sbjct  387  KTCQGPNN-TMLAASVNNVSFVQPNIALLQSHFLNRSKGVYTTDFPTNPPFKFNYTGTPP  445

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            +N M + GTKV+VL FNTSVELVMQDTSI+GAESHPLHLHGFNF VVGQGFGNF+  KDP
Sbjct  446  SNIMTAKGTKVVVLPFNTSVELVMQDTSIIGAESHPLHLHGFNFVVVGQGFGNFDPKKDP  505

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDP ERNTVGVP+GGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAW+V DGK P
Sbjct  506  VKFNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVNDGKRP  565

Query  721  NQKLLPPPSDLPKC  762
            +QKL PPPSDLPKC
Sbjct  566  SQKLPPPPSDLPKC  579



>ref|XP_002313424.1| hypothetical protein POPTR_0009s03940g [Populus trichocarpa]
 gb|EEE87379.1| hypothetical protein POPTR_0009s03940g [Populus trichocarpa]
Length=576

 Score =   352 bits (904),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 185/249 (74%), Positives = 213/249 (86%), Gaps = 1/249 (0%)
 Frame = +1

Query  16   FKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTCQG  195
            FKP LP +N T+  +NF++KLRSL +  +P  VPQTVDK FFFTVGLG NPC KNQTCQG
Sbjct  329  FKPTLPPINATNAVANFTRKLRSLANFQFPVNVPQTVDKKFFFTVGLGNNPCPKNQTCQG  388

Query  196  PTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNTMV  375
            P N TKFSAS+NN+S   P+TALLQ++F  +SN VY+ +FP SPLH FNYTG PPNNT V
Sbjct  389  P-NGTKFSASVNNISMALPSTALLQSYFFKKSNGVYTSDFPSSPLHPFNYTGTPPNNTFV  447

Query  376  SNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKNFNL  555
            +NGTK++VL FNT+VE+VMQ TSILGAESHPLHLHGFNF+VVG+GFGNF+   DPKNFNL
Sbjct  448  TNGTKLIVLPFNTNVEVVMQGTSILGAESHPLHLHGFNFYVVGEGFGNFDPNNDPKNFNL  507

Query  556  VDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLL  735
            VDPVERNTVGVP+GGWVAIRF ADNPGVWFMHCH +VH SWGL+MAW+VLDG LP+QKL 
Sbjct  508  VDPVERNTVGVPSGGWVAIRFHADNPGVWFMHCHFDVHLSWGLRMAWIVLDGTLPSQKLP  567

Query  736  PPPSDLPKC  762
            PPPSDLPKC
Sbjct  568  PPPSDLPKC  576



>ref|XP_006429124.1| hypothetical protein CICLE_v10011358mg [Citrus clementina]
 gb|ESR42364.1| hypothetical protein CICLE_v10011358mg [Citrus clementina]
Length=581

 Score =   352 bits (903),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 186/254 (73%), Positives = 210/254 (83%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKLP+ KP LP  NDT+FA  FSKK+RSL +  +PAKVP+ VD+ FFFTVGLG +PC +N
Sbjct  329  KKLPLLKPALPKFNDTNFAMQFSKKIRSLATAKFPAKVPRKVDRRFFFTVGLGLSPCPQN  388

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            QTCQGP N T  +ASINNVSF QP  ALLQAHF  +S  VY+ +FP +P   FNYTG PP
Sbjct  389  QTCQGPNN-TMLAASINNVSFAQPNIALLQAHFFNKSKGVYTTDFPANPPFKFNYTGTPP  447

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            +N MVS+GT+ + L FN SVE+VMQDTSI+GAESHPLHLHGFNFFVVGQGFGNF+ +KDP
Sbjct  448  SNIMVSSGTRAVALPFNASVEVVMQDTSIIGAESHPLHLHGFNFFVVGQGFGNFDPSKDP  507

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDP ERNTVGVP+GGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V DGK P
Sbjct  508  AKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVNDGKGP  567

Query  721  NQKLLPPPSDLPKC  762
             QKL PPPSDLPKC
Sbjct  568  KQKLPPPPSDLPKC  581



>ref|XP_010654256.1| PREDICTED: laccase-17-like isoform X2 [Vitis vinifera]
Length=573

 Score =   352 bits (902),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 187/254 (74%), Positives = 212/254 (83%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            +K  + KP LP  NDT FA  FSKKLRSL S  +PAKVPQTV++ FFFTVGLG   C +N
Sbjct  321  RKPSVLKPALPMFNDTIFAMKFSKKLRSLASNKFPAKVPQTVNRRFFFTVGLGLIQCSRN  380

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            Q C GP N T  +A+INNVSFVQP+TALLQAHF G+S  VY+ +FP +P   FNYTG PP
Sbjct  381  QACPGPNN-TMVAAAINNVSFVQPSTALLQAHFFGKSKGVYTTDFPANPTFKFNYTGTPP  439

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            +N +V++GTKV+VL FNT VELV+QDTSI+GAESHPLHLHGFNF+VVGQGFGNF+  KDP
Sbjct  440  SNILVNSGTKVVVLPFNTRVELVLQDTSIIGAESHPLHLHGFNFYVVGQGFGNFDPKKDP  499

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP+ERNTVGVP+GGWVAIRF ADNPGVWFMHCHLEVHTSWGLKMAW+V DGK P
Sbjct  500  ANFNLVDPIERNTVGVPSGGWVAIRFRADNPGVWFMHCHLEVHTSWGLKMAWVVTDGKRP  559

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  560  NQKLPPPPSDLPKC  573



>ref|XP_002269038.2| PREDICTED: laccase-17 isoform X2 [Vitis vinifera]
Length=577

 Score =   352 bits (902),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 187/254 (74%), Positives = 213/254 (84%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            +K  + KP LP  NDT FA  FSKKLRSL S  +PAKVPQTV++ FFFTVGLG   C +N
Sbjct  325  RKPSVLKPALPMFNDTIFAMKFSKKLRSLASNKFPAKVPQTVNRRFFFTVGLGLIQCSRN  384

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            Q C GP N T  +A+INNVSFVQP+TALLQAHF G+S  VY+ +FP +P   FNYTG PP
Sbjct  385  QACPGPNN-TMVAAAINNVSFVQPSTALLQAHFFGKSKGVYTTDFPANPPFKFNYTGTPP  443

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            +N +V++GTKV+VL FNT VELV+QDTSI+GAESHPLHLHGFNF+VVGQGFGNF+  KDP
Sbjct  444  SNILVNSGTKVVVLPFNTRVELVLQDTSIIGAESHPLHLHGFNFYVVGQGFGNFDPKKDP  503

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP+ERNTVGVP+GGWVAIRF ADNPGVWFMHCHLEVHTSWGLKMAW+V+DGK P
Sbjct  504  ANFNLVDPIERNTVGVPSGGWVAIRFHADNPGVWFMHCHLEVHTSWGLKMAWVVMDGKRP  563

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  564  NQKLPPPPSDLPKC  577



>ref|XP_009375916.1| PREDICTED: laccase-2-like [Pyrus x bretschneideri]
Length=585

 Score =   352 bits (902),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 190/251 (76%), Positives = 217/251 (86%), Gaps = 0/251 (0%)
 Frame = +1

Query  10   PMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKNQTC  189
            P+F+PILP +N TSF +NF+ KLRSL +  +PA VP+TV++ FFFT+GLGTNPC KNQTC
Sbjct  335  PLFRPILPQINATSFVANFTSKLRSLANSRFPANVPKTVERRFFFTIGLGTNPCPKNQTC  394

Query  190  QGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPPNNT  369
            QGPTN TKF+AS+NN+SF  P+ A+LQ+HF  QSN VYS +FP+ P   FNYTG PPNNT
Sbjct  395  QGPTNTTKFAASMNNISFALPSVAMLQSHFFAQSNSVYSTDFPIIPPKPFNYTGTPPNNT  454

Query  370  MVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDPKNF  549
             V+NGTKV+VL FNTSVELVMQ TSILGAESHPLHLHGFNFFVVGQGFGNF+  KDP NF
Sbjct  455  NVNNGTKVVVLKFNTSVELVMQGTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPSNF  514

Query  550  NLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQK  729
            NLVDPVERN+VGVP+GGWVAIRFLADNPGVW MHCH +VH SWGL+MAW+V DGKLPNQK
Sbjct  515  NLVDPVERNSVGVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWVVQDGKLPNQK  574

Query  730  LLPPPSDLPKC  762
            L PPPSDLPKC
Sbjct  575  LPPPPSDLPKC  585



>ref|XP_010654257.1| PREDICTED: laccase-17 isoform X1 [Vitis vinifera]
Length=577

 Score =   351 bits (901),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 187/254 (74%), Positives = 213/254 (84%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            +K  + KP LP  NDT FA  FSKKLRSL S  +PAKVPQTV++ FFFTVGLG   C +N
Sbjct  325  RKPSVLKPALPMFNDTIFAMKFSKKLRSLASNKFPAKVPQTVNRRFFFTVGLGLIQCSRN  384

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            Q C GP N T  +A+INNVSFVQP+TALLQAHF G+S  VY+ +FP +P   FNYTG PP
Sbjct  385  QACPGPNN-TMVAAAINNVSFVQPSTALLQAHFFGKSKGVYTTDFPANPPFKFNYTGTPP  443

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            +N +V++GTKV+VL FNT VELV+QDTSI+GAESHPLHLHGFNF+VVGQGFGNF+  KDP
Sbjct  444  SNILVNSGTKVVVLPFNTRVELVLQDTSIIGAESHPLHLHGFNFYVVGQGFGNFDPKKDP  503

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
             NFNLVDP+ERNTVGVP+GGWVAIRF ADNPGVWFMHCHLEVHTSWGLKMAW+V+DGK P
Sbjct  504  ANFNLVDPIERNTVGVPSGGWVAIRFHADNPGVWFMHCHLEVHTSWGLKMAWVVMDGKRP  563

Query  721  NQKLLPPPSDLPKC  762
            NQKL PPPSDLPKC
Sbjct  564  NQKLPPPPSDLPKC  577



>gb|KHN07178.1| Laccase-17, partial [Glycine soja]
Length=541

 Score =   350 bits (898),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 181/254 (71%), Positives = 210/254 (83%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            KKL + +P+LP  NDT FA  F+KK+RSL +  +PAKVP+TVDKHFFFTVGLG + C KN
Sbjct  289  KKLRLLRPVLPKFNDTVFAMKFNKKVRSLANARFPAKVPKTVDKHFFFTVGLGISSCPKN  348

Query  181  QTCQGPTNATKFSASINNVSFVQPTTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNPP  360
            Q CQGP N T+ +A++NNVSFV P  ALLQAHF  +S  VY+ +FP +P   FNYTG PP
Sbjct  349  QACQGPNN-TRVTAAVNNVSFVMPNIALLQAHFFNKSKGVYTTDFPANPPFRFNYTGTPP  407

Query  361  NNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKDP  540
            NN M+S+GTK +VL FN SVEL++QDTSI+GAESHPLHLHGFNFFVVGQG GNF+  KDP
Sbjct  408  NNIMISSGTKAVVLPFNASVELILQDTSIIGAESHPLHLHGFNFFVVGQGNGNFDPKKDP  467

Query  541  KNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLP  720
              FNLVDP ERNT+GVP+GGWVA+RF ADNPGVWFMHCHLEVHTSWGLKMAW+V DGKL 
Sbjct  468  SKFNLVDPAERNTIGVPSGGWVAVRFFADNPGVWFMHCHLEVHTSWGLKMAWIVQDGKLH  527

Query  721  NQKLLPPPSDLPKC  762
            +QKL PPPSDLPKC
Sbjct  528  HQKLPPPPSDLPKC  541



>ref|XP_010557244.1| PREDICTED: laccase-2-like [Tarenaya hassleriana]
Length=574

 Score =   351 bits (900),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 213/255 (84%), Gaps = 2/255 (1%)
 Frame = +1

Query  1    KKLPMFKPILPALNDTSFASNFSKKLRSLDSPSYPAKVPQTVDKHFFFTVGLGTNPCDKN  180
            K  P+ KP LPA+N T F +NFS   RSL S  +P  VP+TVD+ FFFTVGLGTNPC KN
Sbjct  321  KTRPVLKPALPAINATGFVANFSNMFRSLASSKFPVDVPKTVDRKFFFTVGLGTNPCPKN  380

Query  181  QTCQGPTNATKFSASINNVSFVQP-TTALLQAHFSGQSNHVYSPNFPVSPLHWFNYTGNP  357
            QTCQGP N TKF+ASINNVSFV P TT+LL+++F G+SN V++ +FP SP+  FNYTG P
Sbjct  381  QTCQGP-NGTKFAASINNVSFVLPNTTSLLRSYFFGKSNRVFTTDFPSSPIFPFNYTGMP  439

Query  358  PNNTMVSNGTKVMVLNFNTSVELVMQDTSILGAESHPLHLHgfnffvvgqgfgnfnqTKD  537
            PNNTMV+ GTKV+VL +NT+VELV QDTSILGAESHPLHLHGFNF+VVGQGFGNF+ T+D
Sbjct  440  PNNTMVARGTKVVVLKYNTTVELVFQDTSILGAESHPLHLHGFNFYVVGQGFGNFDPTRD  499

Query  538  PKNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKL  717
            PK FNL+DPVERNT  VPAGGW+A+RF ADNPGVW MHCH+E+H SWGL MAW+VLDG L
Sbjct  500  PKRFNLLDPVERNTALVPAGGWIAVRFRADNPGVWLMHCHIEIHLSWGLTMAWVVLDGDL  559

Query  718  PNQKLLPPPSDLPKC  762
            PNQKL PPPSD PKC
Sbjct  560  PNQKLPPPPSDFPKC  574



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2290717995426