BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24989_g1_i1 len=1215 path=[5319:0-1214]

Length=1215
                                                                      Score     E

emb|CDP09079.1|  unnamed protein product                                472   7e-159   
ref|XP_009790079.1|  PREDICTED: laccase-3-like                          447   4e-149   
ref|XP_004242502.1|  PREDICTED: laccase-3-like                          441   5e-147   
ref|XP_009616771.1|  PREDICTED: laccase-3-like                          439   3e-146   
ref|XP_011080832.1|  PREDICTED: laccase-3-like                          435   1e-144   
emb|CDP09253.1|  unnamed protein product                                460   1e-144   
ref|XP_006350924.1|  PREDICTED: laccase-3-like                          433   8e-144   
ref|XP_011080750.1|  PREDICTED: laccase-3-like                          429   3e-142   
ref|XP_009797628.1|  PREDICTED: laccase-3-like                          429   5e-142   
ref|XP_006350864.1|  PREDICTED: laccase-3-like                          427   2e-141   
emb|CDP09252.1|  unnamed protein product                                426   1e-140   
ref|XP_009599788.1|  PREDICTED: laccase-3-like                          424   4e-140   
ref|XP_004242503.1|  PREDICTED: laccase-3-like                          423   6e-140   
ref|XP_002277722.1|  PREDICTED: laccase-12                              411   4e-135   Vitis vinifera
ref|XP_002516345.1|  laccase, putative                                  403   6e-132   Ricinus communis
emb|CBI15873.3|  unnamed protein product                                417   7e-129   
ref|XP_010099447.1|  hypothetical protein L484_011146                   394   2e-128   
emb|CDY02043.1|  BnaC04g14580D                                          389   4e-127   
ref|XP_006355635.1|  PREDICTED: laccase-5-like                          390   5e-127   
ref|XP_009598627.1|  PREDICTED: laccase-12-like                         390   7e-127   
ref|XP_004239961.1|  PREDICTED: laccase-12-like                         390   8e-127   
ref|XP_006296399.1|  hypothetical protein CARUB_v10025575mg             389   9e-127   
gb|EYU43442.1|  hypothetical protein MIMGU_mgv1a003472mg                390   1e-126   
ref|XP_010542673.1|  PREDICTED: laccase-3-like                          388   3e-126   
gb|KDP45752.1|  hypothetical protein JCGZ_17359                         388   3e-126   
ref|XP_010521986.1|  PREDICTED: laccase-3                               387   7e-126   
ref|XP_002315131.1|  hypothetical protein POPTR_0010s19090g             387   7e-126   Populus trichocarpa [western balsam poplar]
ref|XP_010414291.1|  PREDICTED: laccase-3                               387   7e-126   
ref|XP_002881090.1|  hypothetical protein ARALYDRAFT_481932             387   8e-126   
ref|XP_010510393.1|  PREDICTED: laccase-3-like                          387   1e-125   
ref|XP_006353418.1|  PREDICTED: laccase-12-like                         387   1e-125   
ref|XP_009141050.1|  PREDICTED: laccase-3                               387   1e-125   
ref|XP_009144319.1|  PREDICTED: laccase-3                               386   1e-125   
ref|NP_180580.1|  laccase 3                                             386   2e-125   Arabidopsis thaliana [mouse-ear cress]
emb|CDX97838.1|  BnaC04g41010D                                          386   2e-125   
ref|XP_004240885.1|  PREDICTED: laccase-5-like                          386   2e-125   
emb|CDY10719.1|  BnaA05g12170D                                          384   6e-125   
ref|XP_010257021.1|  PREDICTED: laccase-12-like                         385   7e-125   
ref|XP_009763768.1|  PREDICTED: laccase-12-like                         385   8e-125   
gb|ABK92474.1|  unknown                                                 384   8e-125   Populus trichocarpa [western balsam poplar]
ref|XP_008384707.1|  PREDICTED: laccase-3-like                          384   9e-125   
ref|XP_006435828.1|  hypothetical protein CICLE_v10031070mg             384   1e-124   
gb|KDO44836.1|  hypothetical protein CISIN_1g008066mg                   384   2e-124   
ref|XP_002312186.2|  laccase family protein                             384   2e-124   Populus trichocarpa [western balsam poplar]
ref|XP_003615861.1|  Laccase-like multicopper oxidase                   383   2e-124   
ref|XP_002273875.2|  PREDICTED: laccase-12                              384   2e-124   Vitis vinifera
ref|XP_002319955.1|  laccase family protein                             383   5e-124   Populus trichocarpa [western balsam poplar]
ref|XP_006410143.1|  hypothetical protein EUTSA_v10016445mg             382   6e-124   
ref|XP_011015318.1|  PREDICTED: laccase-12-like                         382   1e-123   
gb|KHG22243.1|  Laccase-5 -like protein                                 379   1e-123   
ref|XP_010457861.1|  PREDICTED: laccase-3-like                          381   2e-123   
gb|KFK21959.1|  hypothetical protein AALP_AAs48252U000800               380   3e-123   
ref|XP_011021001.1|  PREDICTED: laccase-13-like                         380   4e-123   
ref|XP_010475452.1|  PREDICTED: laccase-3-like                          380   4e-123   
gb|KDP44695.1|  hypothetical protein JCGZ_01195                         380   4e-123   
ref|XP_009343306.1|  PREDICTED: laccase-3-like                          380   5e-123   
ref|XP_004490661.1|  PREDICTED: laccase-3-like                          379   8e-123   
ref|XP_010685887.1|  PREDICTED: laccase-3-like                          379   9e-123   
ref|XP_007146836.1|  hypothetical protein PHAVU_006G074000g             379   1e-122   
emb|CDP13965.1|  unnamed protein product                                379   2e-122   
ref|XP_009354572.1|  PREDICTED: laccase-3-like                          378   2e-122   
ref|XP_008355071.1|  PREDICTED: laccase-3-like                          378   3e-122   
ref|XP_010264533.1|  PREDICTED: laccase-12                              378   3e-122   
ref|XP_008354603.1|  PREDICTED: laccase-3-like                          377   4e-122   
gb|KHN02112.1|  Laccase-3                                               377   4e-122   
ref|XP_003552931.1|  PREDICTED: laccase-3-like                          377   5e-122   
ref|XP_004239957.1|  PREDICTED: laccase-12-like                         377   6e-122   
ref|XP_006303628.1|  hypothetical protein CARUB_v10011512mg             377   6e-122   
ref|XP_010486989.1|  PREDICTED: laccase-3-like                          377   7e-122   
ref|XP_009391695.1|  PREDICTED: laccase-3-like                          377   7e-122   
ref|XP_010031156.1|  PREDICTED: laccase-12-like                         377   1e-121   
ref|XP_006355638.1|  PREDICTED: laccase-12-like                         376   1e-121   
ref|XP_011004316.1|  PREDICTED: laccase-12-like                         376   1e-121   
ref|XP_003537321.1|  PREDICTED: laccase-3-like                          376   2e-121   
gb|KHG11797.1|  Laccase-12 -like protein                                372   3e-121   
ref|NP_196158.1|  laccase 12                                            375   3e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287390.1|  hypothetical protein CARUB_v10000596mg             375   4e-121   
ref|XP_011084865.1|  PREDICTED: laccase-12-like                         375   4e-121   
ref|XP_011041833.1|  PREDICTED: laccase-13                              376   4e-121   
gb|KDP44694.1|  hypothetical protein JCGZ_01194                         375   5e-121   
ref|XP_007008849.1|  Laccase 12                                         375   6e-121   
ref|XP_010535350.1|  PREDICTED: laccase-13                              374   8e-121   
ref|XP_004307184.1|  PREDICTED: laccase-12-like                         374   9e-121   
ref|XP_007142103.1|  hypothetical protein PHAVU_008G252800g             374   1e-120   
ref|XP_011014542.1|  PREDICTED: laccase-3-like                          375   1e-120   
gb|KHN40112.1|  Laccase-3                                               371   2e-120   
ref|XP_010491073.1|  PREDICTED: laccase-12-like                         373   2e-120   
ref|XP_002520797.1|  laccase, putative                                  373   2e-120   Ricinus communis
ref|XP_006355637.1|  PREDICTED: laccase-12-like                         373   2e-120   
ref|XP_009611705.1|  PREDICTED: laccase-12-like                         373   3e-120   
gb|KHN46117.1|  Laccase-3                                               372   3e-120   
emb|CAA74104.1|  laccase                                                373   3e-120   Populus trichocarpa [western balsam poplar]
ref|XP_004239958.1|  PREDICTED: laccase-12-like                         372   4e-120   
ref|XP_009771638.1|  PREDICTED: laccase-12-like                         373   4e-120   
gb|KDO67040.1|  hypothetical protein CISIN_1g013075mg                   366   5e-120   
ref|XP_008792257.1|  PREDICTED: laccase-3-like                          372   5e-120   
ref|XP_009763769.1|  PREDICTED: laccase-12-like                         372   5e-120   
ref|XP_010685889.1|  PREDICTED: laccase-3-like                          372   5e-120   
ref|XP_003518325.1|  PREDICTED: laccase-3-like                          372   6e-120   
ref|XP_002326089.1|  hypothetical protein POPTR_0019s14530g             372   7e-120   Populus trichocarpa [western balsam poplar]
ref|XP_011015306.1|  PREDICTED: laccase-12-like                         372   8e-120   
ref|XP_010032957.1|  PREDICTED: laccase-13                              372   1e-119   
ref|XP_010423473.1|  PREDICTED: laccase-12                              371   1e-119   
ref|XP_002315130.1|  hypothetical protein POPTR_0010s19080g             372   1e-119   Populus trichocarpa [western balsam poplar]
ref|XP_006596443.1|  PREDICTED: laccase-3-like                          371   1e-119   
ref|XP_010452444.1|  PREDICTED: laccase-12-like                         370   2e-119   
ref|XP_004239959.1|  PREDICTED: laccase-12                              370   3e-119   
gb|EPS73068.1|  hypothetical protein M569_01687                         370   3e-119   
ref|XP_002871156.1|  hypothetical protein ARALYDRAFT_487334             370   3e-119   
ref|XP_010067566.1|  PREDICTED: laccase-5                               370   4e-119   
emb|CDY04949.1|  BnaAnng01310D                                          370   4e-119   
ref|XP_009594351.1|  PREDICTED: laccase-12-like                         370   4e-119   
ref|XP_010922645.1|  PREDICTED: laccase-3-like                          370   4e-119   
ref|XP_004294763.1|  PREDICTED: laccase-3-like                          370   5e-119   
ref|XP_006355742.1|  PREDICTED: laccase-12-like                         369   8e-119   
emb|CDX70152.1|  BnaA10g25010D                                          369   8e-119   
ref|XP_010692917.1|  PREDICTED: laccase-12                              369   9e-119   
ref|XP_002520796.1|  laccase, putative                                  369   1e-118   Ricinus communis
ref|XP_004307187.1|  PREDICTED: laccase-12-like                         369   1e-118   
ref|XP_006487674.1|  PREDICTED: laccase-3-like                          367   5e-118   
ref|XP_010045386.1|  PREDICTED: laccase-3-like                          367   5e-118   
ref|XP_009788692.1|  PREDICTED: laccase-12-like                         367   6e-118   
ref|XP_009628839.1|  PREDICTED: laccase-12-like isoform X2              367   7e-118   
ref|XP_010543702.1|  PREDICTED: laccase-12                              367   8e-118   
gb|KGN65840.1|  hypothetical protein Csa_1G533470                       365   8e-118   
ref|XP_011004433.1|  PREDICTED: laccase-12-like                         367   9e-118   
ref|XP_009125599.1|  PREDICTED: laccase-12                              366   9e-118   
ref|XP_008457330.1|  PREDICTED: laccase-3                               366   1e-117   
ref|XP_006399003.1|  hypothetical protein EUTSA_v10015589mg             365   2e-117   
ref|XP_010931307.1|  PREDICTED: laccase-3-like                          365   2e-117   
ref|XP_007206448.1|  hypothetical protein PRUPE_ppa003408mg             365   2e-117   
ref|XP_004145307.1|  PREDICTED: laccase-3-like                          365   2e-117   
emb|CDY14115.1|  BnaC02g02320D                                          365   2e-117   
emb|CDX98841.1|  BnaC09g49940D                                          365   3e-117   
ref|XP_008232145.1|  PREDICTED: laccase-13                              365   3e-117   
ref|XP_009407324.1|  PREDICTED: laccase-3-like                          365   3e-117   
ref|XP_004307691.1|  PREDICTED: laccase-5-like                          365   4e-117   
ref|XP_006488594.1|  PREDICTED: laccase-3-like                          365   4e-117   
ref|XP_008799813.1|  PREDICTED: laccase-3                               365   4e-117   
ref|XP_009122149.1|  PREDICTED: laccase-12                              364   7e-117   
ref|XP_006425169.1|  hypothetical protein CICLE_v10030322mg             364   8e-117   
ref|XP_011076646.1|  PREDICTED: laccase-12                              363   2e-116   
ref|XP_007016999.1|  Laccase 3                                          362   4e-116   
ref|XP_007218932.1|  hypothetical protein PRUPE_ppa003349mg             362   4e-116   
ref|XP_009804480.1|  PREDICTED: laccase-12-like isoform X1              362   5e-116   
gb|EYU20068.1|  hypothetical protein MIMGU_mgv1a020620mg                361   5e-116   
ref|XP_010534627.1|  PREDICTED: laccase-5                               362   7e-116   
ref|XP_007163585.1|  hypothetical protein PHAVU_001G246700g             362   7e-116   
ref|XP_009386858.1|  PREDICTED: laccase-3-like                          361   1e-115   
ref|XP_008233819.1|  PREDICTED: laccase-12-like                         361   1e-115   
ref|XP_008363776.1|  PREDICTED: laccase-12-like                         361   1e-115   
ref|XP_010685886.1|  PREDICTED: laccase-3-like                          361   1e-115   
ref|XP_009343324.1|  PREDICTED: laccase-3-like                          360   2e-115   
ref|XP_004500522.1|  PREDICTED: laccase-12-like                         360   2e-115   
ref|XP_008374344.1|  PREDICTED: laccase-12-like                         360   2e-115   
ref|XP_008369303.1|  PREDICTED: laccase-12-like                         360   3e-115   
ref|XP_010087027.1|  hypothetical protein L484_012271                   360   4e-115   
ref|XP_006411293.1|  hypothetical protein EUTSA_v10016439mg             359   8e-115   
ref|XP_008363777.1|  PREDICTED: laccase-12-like                         359   9e-115   
emb|CDX93188.1|  BnaC04g47080D                                          358   9e-115   
ref|XP_006293898.1|  hypothetical protein CARUB_v10022891mg             358   1e-114   
gb|KHN48594.1|  Laccase-5                                               355   2e-114   
ref|XP_009369225.1|  PREDICTED: laccase-5-like                          357   2e-114   
gb|KHN38548.1|  Laccase-5                                               355   2e-114   
ref|XP_004500523.1|  PREDICTED: laccase-12-like                         358   2e-114   
ref|XP_008385007.1|  PREDICTED: laccase-3-like                          351   2e-114   
ref|XP_003519418.1|  PREDICTED: laccase-5-like                          357   3e-114   
ref|XP_009417976.1|  PREDICTED: laccase-3-like                          357   4e-114   
ref|XP_003544045.1|  PREDICTED: laccase-5-like                          357   5e-114   
gb|KGN45808.1|  hypothetical protein Csa_6G012820                       355   9e-114   
ref|XP_003579045.1|  PREDICTED: laccase-23-like                         356   9e-114   
ref|XP_006367545.1|  PREDICTED: laccase-5-like                          356   1e-113   
ref|XP_009141888.1|  PREDICTED: laccase-5-like                          356   1e-113   
ref|XP_002881718.1|  hypothetical protein ARALYDRAFT_903327             356   1e-113   
emb|CAN75316.1|  hypothetical protein VITISV_024159                     355   1e-113   Vitis vinifera
ref|XP_006644937.1|  PREDICTED: laccase-3-like                          355   1e-113   
ref|XP_006431538.1|  hypothetical protein CICLE_v10003240mg             355   2e-113   
ref|XP_007141728.1|  hypothetical protein PHAVU_008G220300g             357   2e-113   
emb|CDY52925.1|  BnaA04g29320D                                          355   2e-113   
ref|XP_004241090.2|  PREDICTED: laccase-12-like isoform X1              355   2e-113   
ref|XP_010322117.1|  PREDICTED: laccase-12-like isoform X2              355   2e-113   
ref|XP_002468016.1|  hypothetical protein SORBIDRAFT_01g038130          356   2e-113   Sorghum bicolor [broomcorn]
ref|XP_004138412.1|  PREDICTED: laccase-12-like                         355   2e-113   
ref|NP_001044679.1|  Os01g0827300                                       355   2e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008441484.1|  PREDICTED: laccase-12                              355   3e-113   
gb|KDO50911.1|  hypothetical protein CISIN_1g039963mg                   355   3e-113   
gb|KHN31314.1|  Laccase-5                                               352   3e-113   
ref|XP_010517456.1|  PREDICTED: laccase-5-like                          355   4e-113   
gb|KHN04792.1|  Laccase-5                                               355   5e-113   
emb|CDX74795.1|  BnaA05g05410D                                          354   6e-113   
ref|NP_181568.1|  laccase 5                                             354   6e-113   Arabidopsis thaliana [mouse-ear cress]
gb|EEC71732.1|  hypothetical protein OsI_04280                          355   7e-113   Oryza sativa Indica Group [Indian rice]
ref|XP_009143220.1|  PREDICTED: laccase-5                               353   8e-113   
ref|XP_010508873.1|  PREDICTED: laccase-5-like                          353   9e-113   
gb|AET79245.1|  multicopper oxidase                                     351   1e-112   
ref|NP_001145891.1|  putative laccase family protein precursor          354   2e-112   Zea mays [maize]
emb|CBW38080.1|  laccase-like multicopper oxidase                       353   2e-112   
ref|XP_009343323.1|  PREDICTED: laccase-3-like                          352   2e-112   
ref|XP_002312187.2|  hypothetical protein POPTR_0008s07380g             350   3e-112   Populus trichocarpa [western balsam poplar]
ref|XP_004984887.1|  PREDICTED: laccase-3-like                          353   3e-112   
ref|XP_010505765.1|  PREDICTED: laccase-5                               352   3e-112   
gb|AFV52384.1|  laccase                                                 352   3e-112   
gb|AFV52383.1|  laccase                                                 352   4e-112   
gb|KFK36912.1|  hypothetical protein AALP_AA4G189000                    352   6e-112   
ref|XP_003538485.1|  PREDICTED: laccase-5-like                          352   7e-112   
gb|EMS46935.1|  Laccase-3                                               351   1e-111   
ref|NP_001236616.1|  diphenol oxidase laccase precursor                 351   1e-111   
gb|ABR17539.1|  unknown                                                 350   2e-111   Picea sitchensis
ref|XP_008359050.1|  PREDICTED: laccase-3-like                          350   2e-111   
ref|XP_006664275.1|  PREDICTED: putative laccase-17-like                345   3e-111   
emb|CDY18869.1|  BnaC04g04810D                                          349   5e-111   
ref|XP_003616702.1|  Laccase                                            348   7e-111   
ref|XP_010452666.1|  PREDICTED: laccase-13-like isoform X2              345   9e-111   
ref|XP_003558123.1|  PREDICTED: laccase-3                               349   1e-110   
emb|CDX99004.1|  BnaC09g48310D                                          348   1e-110   
ref|XP_006828131.1|  hypothetical protein AMTR_s00023p00051360          348   2e-110   
ref|XP_008343632.1|  PREDICTED: laccase-12-like                         347   4e-110   
ref|XP_006399193.1|  hypothetical protein EUTSA_v10013732mg             340   6e-110   
ref|XP_010452665.1|  PREDICTED: laccase-13-like isoform X1              346   6e-110   
ref|XP_004978572.1|  PREDICTED: putative laccase-17-like                347   7e-110   
ref|XP_004491004.1|  PREDICTED: laccase-5-like                          346   9e-110   
ref|XP_004977611.1|  PREDICTED: laccase-23-like                         346   1e-109   
ref|NP_196330.3|  laccase 13                                            345   2e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871251.1|  laccase-13 precursor                               345   2e-109   
ref|XP_009122371.1|  PREDICTED: laccase-13 isoform X2                   342   3e-109   
ref|XP_010491316.1|  PREDICTED: laccase-13 isoform X1                   344   3e-109   
ref|XP_010491317.1|  PREDICTED: laccase-13 isoform X2                   344   4e-109   
ref|XP_002448873.1|  hypothetical protein SORBIDRAFT_05g000680          344   4e-109   Sorghum bicolor [broomcorn]
ref|XP_010423250.1|  PREDICTED: laccase-13-like isoform X2              341   4e-109   
ref|XP_009122370.1|  PREDICTED: laccase-13 isoform X1                   342   2e-108   
gb|AAK37826.1|AF132122_1  laccase                                       342   2e-108   Pinus taeda
ref|XP_006289181.1|  hypothetical protein CARUB_v10002622mg             342   2e-108   
ref|XP_010423249.1|  PREDICTED: laccase-13-like isoform X1              342   3e-108   
ref|XP_002456566.1|  hypothetical protein SORBIDRAFT_03g038550          341   5e-108   Sorghum bicolor [broomcorn]
ref|NP_001065948.1|  Os12g0108000                                       341   6e-108   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065548.2|  Os11g0108700                                       339   1e-107   Oryza sativa Japonica Group [Japonica rice]
gb|AFV52377.1|  laccase                                                 340   1e-107   
emb|CDX70010.1|  BnaA10g23590D                                          339   2e-107   
sp|Q2RBK2.1|LAC17_ORYSJ  RecName: Full=Putative laccase-17; AltNa...    338   4e-107   Oryza sativa Japonica Group [Japonica rice]
gb|ABR17528.1|  unknown                                                 338   1e-106   Picea sitchensis
ref|XP_010921047.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-3-like     338   1e-106   
gb|ACN27868.1|  unknown                                                 336   1e-106   Zea mays [maize]
gb|EMS57222.1|  Laccase-23                                              337   2e-106   
ref|XP_003600994.1|  Laccase                                            337   3e-106   
ref|NP_001148479.1|  L-ascorbate oxidase precursor                      336   4e-106   Zea mays [maize]
tpg|DAA57028.1|  TPA: putative laccase family protein                   336   4e-106   
gb|EMT30315.1|  Laccase-3                                               335   9e-106   
ref|XP_010424027.1|  PREDICTED: laccase-3-like                          335   1e-105   
gb|EMT01053.1|  Laccase-3                                               336   1e-105   
gb|AFV52378.1|  laccase                                                 333   1e-104   
ref|XP_008804167.1|  PREDICTED: laccase-3-like                          332   2e-104   
gb|EMT02387.1|  hypothetical protein F775_52333                         332   2e-104   
ref|XP_003564513.1|  PREDICTED: laccase-3                               332   2e-104   
gb|AAK37824.1|AF132120_1  laccase                                       332   3e-104   Pinus taeda
gb|AFV52382.1|  laccase                                                 331   4e-104   
gb|KFK25107.1|  hypothetical protein AALP_AA8G066900                    341   4e-103   
ref|XP_008679334.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-23-like    330   7e-103   
emb|CDM84828.1|  unnamed protein product                                326   3e-102   
gb|EMT06365.1|  Laccase-3                                               325   6e-102   
ref|XP_004970425.1|  PREDICTED: laccase-3-like                          320   1e-99    
ref|NP_001183899.1|  putative laccase family protein precursor          317   1e-98    
ref|NP_001049841.2|  Os03g0297900                                       315   5e-97    Oryza sativa Japonica Group [Japonica rice]
gb|ABF95456.1|  Multicopper oxidase family protein, expressed           315   1e-96    Oryza sativa Japonica Group [Japonica rice]
gb|EEE58886.1|  hypothetical protein OsJ_10502                          314   2e-96    Oryza sativa Japonica Group [Japonica rice]
gb|AFW64582.1|  putative laccase family protein                         306   4e-94    
ref|XP_009628838.1|  PREDICTED: laccase-12-like isoform X1              305   1e-93    
ref|XP_003600995.1|  Laccase                                            296   3e-93    
gb|ACN40347.1|  unknown                                                 300   3e-92    Picea sitchensis
gb|AFV52381.1|  laccase                                                 300   3e-92    
gb|AFV52380.1|  laccase                                                 300   3e-92    
ref|XP_006651285.1|  PREDICTED: laccase-5-like                          302   3e-92    
gb|AFV52379.1|  laccase                                                 300   4e-92    
gb|KDO67041.1|  hypothetical protein CISIN_1g013075mg                   296   4e-92    
emb|CBL95260.1|  laccase                                                300   7e-92    
gb|AES71245.2|  laccase/diphenol oxidase family protein                 296   2e-90    
ref|XP_007026834.1|  Laccase-7                                          300   3e-90    
emb|CAN78455.1|  hypothetical protein VITISV_006301                     282   3e-90    Vitis vinifera
gb|KDP24484.1|  hypothetical protein JCGZ_25048                         291   7e-90    
gb|AAK37830.1|AF132126_1  laccase                                       292   6e-89    Pinus taeda
ref|XP_007227301.1|  hypothetical protein PRUPE_ppa016865mg             291   7e-89    
ref|XP_011019227.1|  PREDICTED: laccase-4-like                          282   2e-88    
ref|XP_008218979.1|  PREDICTED: laccase-14                              289   8e-88    
ref|XP_009787131.1|  PREDICTED: laccase-7-like                          288   1e-87    
ref|XP_007134763.1|  hypothetical protein PHAVU_010G0738000g            287   1e-87    
ref|XP_004240153.1|  PREDICTED: laccase-7-like                          288   2e-87    
ref|XP_002299682.1|  laccase family protein                             287   2e-87    
ref|XP_002322961.2|  hypothetical protein POPTR_0016s11950g             287   2e-87    
ref|XP_010037756.1|  PREDICTED: laccase-7                               287   4e-87    
ref|XP_011003662.1|  PREDICTED: laccase-4-like                          286   5e-87    
ref|XP_002278638.1|  PREDICTED: laccase-4                               286   5e-87    
ref|XP_009786393.1|  PREDICTED: laccase-4-like                          286   9e-87    
ref|XP_008339252.1|  PREDICTED: laccase-14                              286   9e-87    
emb|CAA74101.1|  laccase                                                281   1e-86    
ref|XP_011094977.1|  PREDICTED: laccase-4-like                          285   1e-86    
emb|CAC14718.1|  laccase                                                280   1e-86    
ref|XP_002265344.1|  PREDICTED: laccase-14                              285   2e-86    
gb|KCW71481.1|  hypothetical protein EUGRSUZ_E00040                     284   3e-86    
gb|KDP24517.1|  hypothetical protein JCGZ_25081                         284   4e-86    
ref|XP_010037755.1|  PREDICTED: laccase-7-like                          284   4e-86    
ref|XP_010054994.1|  PREDICTED: laccase-6                               285   5e-86    
ref|XP_011077581.1|  PREDICTED: laccase-4-like                          284   5e-86    
ref|XP_002308209.2|  laccase family protein                             284   5e-86    
ref|XP_002533894.1|  laccase, putative                                  284   5e-86    
ref|XP_006387495.1|  hypothetical protein POPTR_0958s00200g             284   5e-86    
ref|XP_009799024.1|  PREDICTED: laccase-4-like                          283   7e-86    
emb|CDP06511.1|  unnamed protein product                                283   8e-86    
ref|XP_002322962.2|  laccase family protein                             283   9e-86    
ref|XP_006342285.1|  PREDICTED: laccase-7-like                          283   9e-86    
ref|XP_004137046.1|  PREDICTED: laccase-14-like                         283   1e-85    
dbj|BAD93858.1|  putative laccase                                       270   1e-85    
ref|XP_008449180.1|  PREDICTED: laccase-4-like                          282   1e-85    
gb|EPS66251.1|  hypothetical protein M569_08526                         278   2e-85    
ref|XP_010543401.1|  PREDICTED: laccase-11-like                         282   2e-85    
ref|XP_008455534.1|  PREDICTED: laccase-14                              282   2e-85    
ref|XP_002991629.1|  hypothetical protein SELMODRAFT_133734             282   2e-85    
ref|XP_009624727.1|  PREDICTED: laccase-4-like                          281   3e-85    
ref|XP_009629941.1|  PREDICTED: laccase-7-like                          282   4e-85    
ref|XP_004147923.1|  PREDICTED: laccase-4-like                          281   4e-85    
gb|AFK41498.1|  unknown                                                 275   4e-85    
ref|XP_009392410.1|  PREDICTED: laccase-11                              281   5e-85    
ref|XP_004233973.1|  PREDICTED: laccase-11                              281   5e-85    
ref|XP_002980603.1|  hypothetical protein SELMODRAFT_178349             281   6e-85    
ref|XP_004137913.1|  PREDICTED: laccase-4-like                          281   6e-85    
emb|CDY10394.1|  BnaCnng02950D                                          281   6e-85    
ref|XP_002976884.1|  hypothetical protein SELMODRAFT_105894             281   7e-85    
ref|XP_002971503.1|  hypothetical protein SELMODRAFT_95740              281   7e-85    
gb|KHG18161.1|  Laccase-4 -like protein                                 281   7e-85    
ref|XP_006347000.1|  PREDICTED: laccase-11-like                         281   7e-85    
ref|XP_004249084.1|  PREDICTED: laccase-4-like                          280   9e-85    
ref|XP_006287320.1|  hypothetical protein CARUB_v10000520mg             281   1e-84    
ref|XP_002308208.2|  laccase family protein                             280   1e-84    
gb|ACN39933.1|  unknown                                                 280   1e-84    
ref|XP_006349470.1|  PREDICTED: laccase-4-like                          280   1e-84    
ref|XP_004163861.1|  PREDICTED: laccase-4-like                          280   1e-84    
ref|XP_010553253.1|  PREDICTED: laccase-4                               280   2e-84    
gb|EYU41858.1|  hypothetical protein MIMGU_mgv1a003895mg                280   2e-84    
ref|XP_002308196.1|  laccase family protein                             280   2e-84    
ref|XP_006480933.1|  PREDICTED: laccase-7-like                          280   2e-84    
gb|AAC49536.1|  diphenol oxidase                                        280   2e-84    
ref|XP_008442464.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like     280   2e-84    
ref|XP_007026782.1|  Laccase/Diphenol oxidase family protein isof...    277   2e-84    
emb|CDX70319.1|  BnaA10g26680D                                          279   3e-84    
gb|AAK37829.1|AF132125_1  laccase                                       279   3e-84    
ref|XP_010107530.1|  hypothetical protein L484_024383                   279   3e-84    
ref|XP_009593041.1|  PREDICTED: laccase-4-like                          279   3e-84    
ref|XP_006429258.1|  hypothetical protein CICLE_v10011375mg             279   3e-84    
ref|XP_004969263.1|  PREDICTED: laccase-2-like                          279   3e-84    
ref|XP_009122722.1|  PREDICTED: laccase-11-like                         279   4e-84    
gb|KHN36103.1|  Laccase-11                                              279   4e-84    
ref|XP_003522150.1|  PREDICTED: laccase-4-like                          279   4e-84    
ref|XP_009590676.1|  PREDICTED: laccase-11-like                         278   4e-84    
ref|XP_011019151.1|  PREDICTED: laccase-4 isoform X2                    278   5e-84    
ref|XP_004302643.1|  PREDICTED: laccase-4-like                          278   5e-84    
emb|CDP06537.1|  unnamed protein product                                278   5e-84    
gb|KHG11130.1|  Laccase-4 -like protein                                 277   6e-84    
ref|XP_008236999.1|  PREDICTED: laccase-11-like                         278   6e-84    
ref|XP_011019150.1|  PREDICTED: laccase-4 isoform X1                    278   6e-84    
ref|XP_002962788.1|  hypothetical protein SELMODRAFT_165365             279   6e-84    
ref|XP_002963595.1|  hypothetical protein SELMODRAFT_80214              277   6e-84    
ref|XP_011012658.1|  PREDICTED: laccase-14                              278   6e-84    
gb|KDO50695.1|  hypothetical protein CISIN_1g036540mg                   278   7e-84    
gb|EYU26646.1|  hypothetical protein MIMGU_mgv1a003805mg                278   7e-84    
ref|XP_002981488.1|  hypothetical protein SELMODRAFT_114788             277   7e-84    
ref|XP_002519529.1|  laccase, putative                                  278   8e-84    
gb|KHN41965.1|  Laccase-11                                              276   8e-84    
emb|CDY62896.1|  BnaAnng18410D                                          278   9e-84    
ref|XP_010490794.1|  PREDICTED: laccase-11-like                         278   1e-83    
gb|KHN04832.1|  Laccase-4                                               277   1e-83    
gb|KGN54341.1|  hypothetical protein Csa_4G306850                       271   1e-83    
ref|XP_009400979.1|  PREDICTED: laccase-6                               278   1e-83    
ref|XP_007026781.1|  Laccase/Diphenol oxidase family protein isof...    277   1e-83    
ref|XP_006428774.1|  hypothetical protein CICLE_v10013446mg             278   1e-83    
ref|XP_009787551.1|  PREDICTED: laccase-4-like                          277   1e-83    
ref|XP_009125488.1|  PREDICTED: laccase-11                              277   1e-83    
gb|AES94995.2|  laccase/diphenol oxidase family protein                 277   1e-83    
ref|XP_009416152.1|  PREDICTED: laccase-4-like                          277   2e-83    
ref|XP_006429309.1|  hypothetical protein CICLE_v10011400mg             277   2e-83    
ref|XP_009764219.1|  PREDICTED: laccase-11-like                         277   2e-83    
ref|XP_007200216.1|  hypothetical protein PRUPE_ppa015544mg             277   2e-83    
ref|XP_010044090.1|  PREDICTED: laccase-4-like                          277   2e-83    
gb|KDO58025.1|  hypothetical protein CISIN_1g008351mg                   277   2e-83    
gb|EMS50562.1|  Laccase-12/13                                           275   2e-83    
ref|XP_004292037.1|  PREDICTED: laccase-11-like                         277   2e-83    
ref|XP_003612037.1|  Laccase-11                                         277   2e-83    
ref|XP_008787257.1|  PREDICTED: laccase-21-like                         277   2e-83    
gb|AAC49538.1|  diphenol oxidase                                        272   2e-83    
ref|XP_006663136.1|  PREDICTED: laccase-22-like                         277   2e-83    
ref|XP_004972357.1|  PREDICTED: laccase-2-like                          277   2e-83    
ref|XP_010452196.1|  PREDICTED: laccase-11                              277   2e-83    
ref|XP_007198990.1|  hypothetical protein PRUPE_ppa003590mg             277   3e-83    
ref|XP_002962497.1|  hypothetical protein SELMODRAFT_78002              276   3e-83    
ref|XP_003516941.1|  PREDICTED: laccase-4-like                          276   3e-83    
ref|XP_010044088.1|  PREDICTED: laccase-4-like                          276   3e-83    
ref|XP_009407501.1|  PREDICTED: laccase-4-like                          276   4e-83    
ref|XP_010037723.1|  PREDICTED: laccase-4-like                          276   4e-83    
ref|XP_009593898.1|  PREDICTED: laccase-11-like                         276   4e-83    
ref|XP_010044089.1|  PREDICTED: laccase-4-like                          276   4e-83    
ref|XP_002275392.1|  PREDICTED: laccase-11                              276   5e-83    
emb|CDY44351.1|  BnaC02g03260D                                          276   6e-83    
gb|AAK37823.1|  laccase                                                 276   6e-83    
emb|CDY21576.1|  BnaC09g47160D                                          276   6e-83    
ref|XP_010558158.1|  PREDICTED: laccase-11                              276   7e-83    
ref|XP_011035200.1|  PREDICTED: laccase-4                               275   7e-83    
ref|XP_004980096.1|  PREDICTED: laccase-22-like                         276   1e-82    
ref|XP_010101806.1|  hypothetical protein L484_023595                   275   1e-82    
ref|XP_010104682.1|  hypothetical protein L484_022065                   275   1e-82    
ref|XP_004292029.1|  PREDICTED: laccase-11-like                         275   1e-82    
ref|XP_002527888.1|  laccase, putative                                  274   2e-82    
ref|XP_003632636.1|  PREDICTED: laccase-11                              275   2e-82    
ref|XP_010937050.1|  PREDICTED: putative laccase-9                      275   2e-82    
ref|XP_004246339.1|  PREDICTED: laccase-4                               275   2e-82    
ref|XP_009793780.1|  PREDICTED: laccase-11-like                         275   2e-82    
ref|XP_009122510.1|  PREDICTED: laccase-14                              275   2e-82    
ref|XP_002276415.1|  PREDICTED: laccase-7                               274   2e-82    
emb|CDX69910.1|  BnaA10g22590D                                          275   2e-82    
emb|CDY18406.1|  BnaA04g21810D                                          274   2e-82    
ref|XP_004237852.1|  PREDICTED: laccase-14-like                         274   3e-82    
sp|Q0IQU1.2|LAC22_ORYSJ  RecName: Full=Laccase-22; AltName: Full=...    274   3e-82    
ref|XP_009782930.1|  PREDICTED: laccase-4-like                          275   3e-82    
ref|XP_002309069.1|  hypothetical protein POPTR_0006s08780g             275   3e-82    
ref|XP_008246065.1|  PREDICTED: laccase-11-like                         267   3e-82    
ref|XP_008790512.1|  PREDICTED: laccase-6-like                          274   4e-82    
ref|XP_007156959.1|  hypothetical protein PHAVU_002G031700g             274   4e-82    
ref|XP_010423743.1|  PREDICTED: laccase-11-like                         273   4e-82    
ref|XP_011094885.1|  PREDICTED: laccase-17-like                         273   4e-82    
ref|XP_010262771.1|  PREDICTED: laccase-4-like                          273   5e-82    
ref|XP_008233715.1|  PREDICTED: laccase-4-like                          273   5e-82    
ref|XP_009760909.1|  PREDICTED: laccase-7-like                          273   5e-82    
ref|XP_006363100.1|  PREDICTED: laccase-4-like                          274   5e-82    
ref|XP_003558760.1|  PREDICTED: laccase-22                              273   6e-82    
ref|XP_003593152.1|  Laccase-14                                         273   6e-82    
dbj|BAF01776.1|  laccase (diphenol oxidase)-like protein                266   6e-82    
gb|AES63403.2|  laccase/diphenol oxidase family protein                 273   7e-82    
ref|XP_010906603.1|  PREDICTED: laccase-17-like                         273   7e-82    
ref|XP_010044087.1|  PREDICTED: laccase-4-like                          273   7e-82    
ref|XP_009593896.1|  PREDICTED: laccase-11-like                         273   8e-82    
gb|KFK25239.1|  hypothetical protein AALP_AA8G086000                    266   8e-82    
ref|XP_010645777.1|  PREDICTED: laccase-15-like isoform X2              272   9e-82    
emb|CDX93330.1|  BnaC04g45660D                                          273   9e-82    
ref|XP_006411009.1|  hypothetical protein EUTSA_v10016460mg             273   9e-82    
ref|XP_009378520.1|  PREDICTED: laccase-11-like                         272   1e-81    
ref|XP_010041000.1|  PREDICTED: laccase-4-like                          272   1e-81    
ref|XP_006340638.1|  PREDICTED: laccase-11-like                         272   1e-81    
dbj|BAN10308.1|  laccase                                                272   1e-81    
gb|KEH22917.1|  laccase/diphenol oxidase family protein                 273   1e-81    
ref|XP_009593274.1|  PREDICTED: laccase-4-like                          272   2e-81    
ref|XP_011088411.1|  PREDICTED: laccase-11-like                         272   2e-81    
gb|KFK36706.1|  hypothetical protein AALP_AA4G158700                    272   2e-81    
ref|XP_010106521.1|  hypothetical protein L484_025281                   272   2e-81    
ref|XP_002305436.1|  hypothetical protein POPTR_0004s16370g             271   2e-81    
gb|KDP29119.1|  hypothetical protein JCGZ_16508                         265   2e-81    
ref|XP_003634920.2|  PREDICTED: laccase-15-like isoform X1              272   2e-81    
ref|XP_010037821.1|  PREDICTED: laccase-17-like                         272   2e-81    
gb|KHG14663.1|  Laccase-4                                               270   2e-81    
ref|XP_011019838.1|  PREDICTED: laccase-17-like                         272   3e-81    
ref|XP_009414328.1|  PREDICTED: laccase-17-like                         272   3e-81    
ref|XP_009358813.1|  PREDICTED: laccase-7-like                          271   3e-81    
ref|XP_004246355.1|  PREDICTED: laccase-4-like                          272   3e-81    
ref|XP_004305159.1|  PREDICTED: laccase-7-like                          271   4e-81    
ref|XP_009141718.1|  PREDICTED: laccase-4-like                          271   4e-81    
ref|XP_008785569.1|  PREDICTED: laccase-17-like                         271   4e-81    
gb|KHG01609.1|  Laccase-11 -like protein                                271   4e-81    
ref|XP_004302678.1|  PREDICTED: laccase-7-like                          271   4e-81    
ref|XP_002512915.1|  laccase, putative                                  271   4e-81    
ref|XP_007132049.1|  hypothetical protein PHAVU_011G062600g             272   4e-81    
ref|XP_008357173.1|  PREDICTED: laccase-11-like                         271   4e-81    
ref|XP_008452071.1|  PREDICTED: laccase-11-like                         271   5e-81    
dbj|BAJ91763.1|  predicted protein                                      271   5e-81    
emb|CDO97037.1|  unnamed protein product                                271   5e-81    
ref|XP_004147928.1|  PREDICTED: laccase-7-like                          271   5e-81    
ref|XP_004162758.1|  PREDICTED: laccase-7-like                          270   6e-81    
ref|XP_002879726.1|  IRX12/LAC4                                         270   6e-81    
gb|EMT26873.1|  Laccase-22                                              270   6e-81    
ref|XP_004300985.1|  PREDICTED: laccase-11-like                         270   6e-81    
ref|XP_002299828.2|  hypothetical protein POPTR_0001s25580g             270   6e-81    
ref|XP_002531562.1|  laccase, putative                                  271   7e-81    
ref|XP_009772835.1|  PREDICTED: laccase-11-like                         270   7e-81    
ref|XP_010683865.1|  PREDICTED: laccase-17-like                         271   7e-81    
ref|XP_006857864.1|  hypothetical protein AMTR_s00069p00085210          271   7e-81    
ref|XP_010495121.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-14-like    271   7e-81    
ref|XP_010529771.1|  PREDICTED: laccase-4-like                          270   8e-81    
ref|XP_010509229.1|  PREDICTED: laccase-4-like                          270   8e-81    
ref|XP_007156958.1|  hypothetical protein PHAVU_002G031600g             270   8e-81    
ref|XP_006488364.1|  PREDICTED: laccase-17-like                         271   9e-81    
gb|KDO37152.1|  hypothetical protein CISIN_1g040938mg                   268   1e-80    
emb|CDP02005.1|  unnamed protein product                                270   1e-80    
ref|XP_002314124.1|  hypothetical protein POPTR_0009s04720g             270   1e-80    
ref|XP_007140382.1|  hypothetical protein PHAVU_008G107100g             270   1e-80    
ref|XP_006293932.1|  hypothetical protein CARUB_v10022927mg             270   1e-80    
ref|XP_006287383.1|  hypothetical protein CARUB_v10000589mg             270   1e-80    
ref|XP_002962354.1|  hypothetical protein SELMODRAFT_404075             270   1e-80    
ref|XP_011087840.1|  PREDICTED: laccase-14                              270   1e-80    
gb|KHN41966.1|  Laccase-11                                              270   1e-80    
dbj|BAJ98144.1|  predicted protein                                      270   1e-80    
ref|XP_003516567.1|  PREDICTED: laccase-11-like                         270   2e-80    
ref|XP_008784581.1|  PREDICTED: laccase-21-like                         270   2e-80    
ref|XP_010933847.1|  PREDICTED: laccase-6-like isoform X2               268   2e-80    
ref|XP_004288102.1|  PREDICTED: laccase-15-like                         270   2e-80    
ref|XP_009788568.1|  PREDICTED: laccase-4-like                          270   2e-80    
ref|XP_003538856.1|  PREDICTED: laccase-11-like                         269   2e-80    



>emb|CDP09079.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   472 bits (1214),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 247/311 (79%), Positives = 271/311 (87%), Gaps = 3/311 (1%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+TANQRP RYYMAA AYA+A+GAPFDNTT TAVLEY T    +S +  
Sbjct  261   IMLGPGQTTDVLLTANQRPARYYMAARAYASARGAPFDNTTTTAVLEYNTARGGSSSTSR  320

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
              LLPRLPA NDTAT TAF + LRS+P+     P    I+HSLFFTVGLGFVNC PGPRCQ
Sbjct  321   PLLPRLPAFNDTATATAFENGLRSIPSEAAKVPTK--IDHSLFFTVGLGFVNCNPGPRCQ  378

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRALWQ  675
             GPN TRFAASMNNVSFVLP+R S+L AYYNNIPGI+TTDFP VPP+QFNYTGNVPR+LWQ
Sbjct  379   GPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIFTTDFPPVPPLQFNYTGNVPRSLWQ  438

Query  674   PRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASFN  495
             PRFGTK+YK+K+GS+VQIVLQDTGIFSTEDHPIHLHGYHF++VGQGFGNFNP TDPA FN
Sbjct  439   PRFGTKLYKLKYGSTVQIVLQDTGIFSTEDHPIHLHGYHFFVVGQGFGNFNPRTDPARFN  498

Query  494   LIDPPLRNTIDVPVGGWAAIRFVADNPG-VWLMHCHIDSHLTWGLAMSFLVENGITEWET  318
             L+DPP RNTIDVPVGGWA IRFVADNPG VWL HCHID+HLTWGLAMSFLVENGI E +T
Sbjct  499   LVDPPARNTIDVPVGGWAVIRFVADNPGSVWLFHCHIDAHLTWGLAMSFLVENGIGELQT  558

Query  317   VppppPDLPRC  285
             V PPP DLPRC
Sbjct  559   VEPPPADLPRC  569



>ref|XP_009790079.1| PREDICTED: laccase-3-like [Nicotiana sylvestris]
Length=575

 Score =   447 bits (1150),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 236/310 (76%), Positives = 267/310 (86%), Gaps = 4/310 (1%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTNV++TAN+ PGRYYMAASAYATA+ A FDNTT TA+LEYT   S A+  P 
Sbjct  270   IMVGPGQTTNVILTANRPPGRYYMAASAYATARNAQFDNTTTTAILEYTNLVSVANSRPS  329

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
               LP+LPA NDTAT TAFTSQLRS+P+N +  P    I+ +LFFTVGLG VNC PGPRCQ
Sbjct  330   --LPQLPAFNDTATATAFTSQLRSIPSNNVRVPNQ--IDENLFFTVGLGLVNCAPGPRCQ  385

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRALWQ  675
             GPN TRFAASMNN+SFVLP+R S+L AYY NIPGIYT DFP VPPVQF+YTGNV R LWQ
Sbjct  386   GPNNTRFAASMNNISFVLPRRTSLLQAYYQNIPGIYTLDFPPVPPVQFDYTGNVSRGLWQ  445

Query  674   PRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASFN  495
             PRFGTK++K+KFGS+VQIVLQDT IFSTEDHPIHLHGYHF++VGQGFGNFNP TD A+FN
Sbjct  446   PRFGTKLHKIKFGSTVQIVLQDTAIFSTEDHPIHLHGYHFWVVGQGFGNFNPQTDTATFN  505

Query  494   LIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWETV  315
             L+DPP+RNTIDVPVGGWA IRFVADNPGVWL HCHIDSHL WGL M+F+VENGI E +T+
Sbjct  506   LVDPPVRNTIDVPVGGWAVIRFVADNPGVWLFHCHIDSHLAWGLGMAFIVENGIGEKQTM  565

Query  314   ppppPDLPRC  285
              PPPPDLP+C
Sbjct  566   EPPPPDLPQC  575



>ref|XP_004242502.1| PREDICTED: laccase-3-like [Solanum lycopersicum]
Length=562

 Score =   441 bits (1135),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 232/310 (75%), Positives = 263/310 (85%), Gaps = 5/310 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTNV++TANQ PGRYYMAA AYAT +   FDNTT TA+LEYT   S A+  P 
Sbjct  258   IMVGPGQTTNVILTANQSPGRYYMAARAYATVRNGQFDNTTTTAILEYTNVNSGANSRP-  316

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
              LLP+LPA NDTAT TAF +QLRS+P+N         I+ +LFFTVGLG VNC PGPRCQ
Sbjct  317   -LLPQLPAFNDTATATAFANQLRSIPSNNRVPNQ---IDDNLFFTVGLGLVNCTPGPRCQ  372

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRALWQ  675
             GPN TRFAAS+NN+SFV+P+R S+L AYY NIPGIYT DFP VPPVQF+YTGNV R LWQ
Sbjct  373   GPNNTRFAASVNNISFVIPRRTSLLQAYYQNIPGIYTLDFPPVPPVQFDYTGNVSRGLWQ  432

Query  674   PRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASFN  495
             PRFGTK+YK+KFGS+VQIVLQDT IFSTEDHPIHLHGYHF++VGQGFGNFNP TD A+FN
Sbjct  433   PRFGTKLYKLKFGSNVQIVLQDTAIFSTEDHPIHLHGYHFWVVGQGFGNFNPQTDTANFN  492

Query  494   LIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWETV  315
             LIDPP+RNTIDVPVGGWA IRFVADNPGVWL+HCHIDSHL WGL M+F+VENGI E +T+
Sbjct  493   LIDPPVRNTIDVPVGGWAVIRFVADNPGVWLLHCHIDSHLAWGLGMAFIVENGIGEEQTM  552

Query  314   ppppPDLPRC  285
              PPPPDLP+C
Sbjct  553   EPPPPDLPQC  562



>ref|XP_009616771.1| PREDICTED: laccase-3-like [Nicotiana tomentosiformis]
Length=574

 Score =   439 bits (1130),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 230/310 (74%), Positives = 262/310 (85%), Gaps = 4/310 (1%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTNV++TAN+ PGRYYMAASAYATA+ A FDNTT TA+LEY      A+  P 
Sbjct  269   IMVGPGQTTNVILTANRPPGRYYMAASAYATARNAQFDNTTTTAILEYANLNPGANSRPS  328

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
               LP+LPA NDTAT TAFTSQLR +P+N +  P    I+ +LFFTVGLG VNC PGPRCQ
Sbjct  329   --LPQLPAFNDTATATAFTSQLRRIPSNNVRVPTQ--IDENLFFTVGLGLVNCAPGPRCQ  384

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRALWQ  675
             GPN TRFAASMNN+SFVLP+R S+L AYY NIPGIYT DFP VP VQF+YTGNV R LWQ
Sbjct  385   GPNNTRFAASMNNISFVLPRRTSLLQAYYQNIPGIYTLDFPPVPTVQFDYTGNVSRGLWQ  444

Query  674   PRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASFN  495
             PRFGTK++K+KFGS+VQIVLQDT IFSTEDHPIHLHGYHF++VGQGFGNFNP TD  +FN
Sbjct  445   PRFGTKLHKIKFGSAVQIVLQDTAIFSTEDHPIHLHGYHFWVVGQGFGNFNPQTDTTTFN  504

Query  494   LIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWETV  315
             L+DPP+RNTIDVPVGGWA IRFVADNPG+WL HCHIDSHL WGL M+F+VENGI E +T+
Sbjct  505   LVDPPVRNTIDVPVGGWAVIRFVADNPGLWLFHCHIDSHLAWGLGMAFIVENGIGEKQTM  564

Query  314   ppppPDLPRC  285
              PPPPDLP+C
Sbjct  565   EPPPPDLPQC  574



>ref|XP_011080832.1| PREDICTED: laccase-3-like, partial [Sesamum indicum]
Length=554

 Score =   435 bits (1118),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 229/312 (73%), Positives = 257/312 (82%), Gaps = 4/312 (1%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTTNVL+TANQ  GRYYMA  AYATAQ A FDNTT+TA+LEY +    +     
Sbjct  245   VMLGPGQTTNVLLTANQIAGRYYMATRAYATAQNAAFDNTTSTAILEYDSVPCPSKTGVA  304

Query  1034  A--LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR  861
             +  L+P LP  NDTATVTAFTSQLRSLP+     P    I+ +LFFTVGLG VNC+PGPR
Sbjct  305   SRPLMPVLPRFNDTATVTAFTSQLRSLPSKNAKVPTQ--IDENLFFTVGLGLVNCMPGPR  362

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPN TRFAASMNN+SFVLP+R S+L AYY NIPG+YT DFP VP V F+YTGNV R L
Sbjct  363   CQGPNNTRFAASMNNISFVLPRRTSLLQAYYQNIPGVYTMDFPPVPLVTFDYTGNVSRGL  422

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             WQPRFGTK+YK+KFGS+VQIVLQDT I +TEDHPIHLHGYHFY+VGQGFGNFNP  D A 
Sbjct  423   WQPRFGTKLYKLKFGSNVQIVLQDTAIVTTEDHPIHLHGYHFYVVGQGFGNFNPTVDTAG  482

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNLIDPP+RNTI+VPVGGWA IRFVADNPGVWLMHCHIDSHLTWGLAM+FLVENG  E +
Sbjct  483   FNLIDPPVRNTINVPVGGWAVIRFVADNPGVWLMHCHIDSHLTWGLAMAFLVENGPGELQ  542

Query  320   TVppppPDLPRC  285
             ++  PPPDLP C
Sbjct  543   SIEAPPPDLPPC  554



>emb|CDP09253.1| unnamed protein product [Coffea canephora]
Length=1557

 Score =   460 bits (1183),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 240/311 (77%), Positives = 263/311 (85%), Gaps = 6/311 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+ ANQR GRYYMAA AYATAQGAPFDNTT TA+LEY  + + +   P 
Sbjct  1252  IMLGPGQTTDVLLNANQRAGRYYMAARAYATAQGAPFDNTTTTAILEYRNSRTGSFSRP-  1310

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
              +LP+LPA NDTAT TAFTSQLRS+P+N         I+ SLFFTVGLGFVNC PGPRCQ
Sbjct  1311  -ILPQLPAFNDTATTTAFTSQLRSIPSNYKVPTQ---IDDSLFFTVGLGFVNCNPGPRCQ  1366

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRALWQ  675
             GPN TRFAASMNNVSFVLP R S+L AYY NIPGIYT DFP VPPVQFNYTG VPR+ WQ
Sbjct  1367  GPNNTRFAASMNNVSFVLPNRTSLLQAYYQNIPGIYTLDFPPVPPVQFNYTGTVPRSQWQ  1426

Query  674   PRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASFN  495
             P FGTK+YK+KFG++VQIVLQDTGIFSTEDHPIHLHGYHF++VGQGFGNFNP TD  +FN
Sbjct  1427  PVFGTKLYKLKFGANVQIVLQDTGIFSTEDHPIHLHGYHFFVVGQGFGNFNPQTDTGNFN  1486

Query  494   LIDPPLRNTIDVPVGGWAAIRFVADNP-GVWLMHCHIDSHLTWGLAMSFLVENGITEWET  318
             L+DPP RNTIDVPVGGWA IRFVADNP GVWL HCHIDSHLTWGLAMSF+VENG  E +T
Sbjct  1487  LVDPPSRNTIDVPVGGWAVIRFVADNPAGVWLFHCHIDSHLTWGLAMSFIVENGRGELQT  1546

Query  317   VppppPDLPRC  285
             V PPP DLPRC
Sbjct  1547  VEPPPADLPRC  1557



>ref|XP_006350924.1| PREDICTED: laccase-3-like [Solanum tuberosum]
Length=571

 Score =   433 bits (1114),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 229/317 (72%), Positives = 259/317 (82%), Gaps = 10/317 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt---tssasy  1044
             IM+GPGQTTNV++TANQ P +YYMAA AYAT +   FDNTT TA+LEY          + 
Sbjct  258   IMVGPGQTTNVILTANQSPRQYYMAARAYATVRNGQFDNTTTTAILEYKNLNSGAKYTNV  317

Query  1043  SPGA----LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC  876
             + GA    LLP+LPA NDTAT TAF +QLRS+P+N         I+ +LFFTVGLG VNC
Sbjct  318   NSGANSRPLLPQLPAFNDTATATAFANQLRSIPSNNRVPNQ---IDENLFFTVGLGLVNC  374

Query  875   IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN  696
              PGPRCQGPN TRFAASMNN+SFV P+R S+L AYY NIPGIYT DFP VPPVQF+YTGN
Sbjct  375   TPGPRCQGPNNTRFAASMNNISFVFPRRTSLLQAYYQNIPGIYTLDFPPVPPVQFDYTGN  434

Query  695   VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPG  516
             V R LWQPRFGTK+YK+KFGS+VQIVLQDT IFSTEDHPIHLHGYHF++VGQGFGNFNP 
Sbjct  435   VSRGLWQPRFGTKLYKLKFGSNVQIVLQDTAIFSTEDHPIHLHGYHFWVVGQGFGNFNPQ  494

Query  515   TDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENG  336
             TD A+FNLIDPP+RNTIDVPVGGWA IRFVADNPGVWL HCHIDSHL WGL M+F+VENG
Sbjct  495   TDSANFNLIDPPVRNTIDVPVGGWAVIRFVADNPGVWLFHCHIDSHLAWGLGMAFIVENG  554

Query  335   ITEWETVppppPDLPRC  285
             I E +T+ PPPPDLP+C
Sbjct  555   IGEKQTMEPPPPDLPQC  571



>ref|XP_011080750.1| PREDICTED: laccase-3-like [Sesamum indicum]
Length=568

 Score =   429 bits (1103),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 219/310 (71%), Positives = 255/310 (82%), Gaps = 6/310 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTNVL+TA+Q P RYYMAA AYA+ Q   FDNTT TA+L+Y T TS  S    
Sbjct  265   IMVGPGQTTNVLLTADQPPARYYMAARAYASGQNVTFDNTTTTAILDYKTATSRTS---S  321

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
              +LP+LPA NDTATVT FTSQL+ +P+          ++ +LFFT+GLG VNC PGPRCQ
Sbjct  322   PVLPQLPAFNDTATVTQFTSQLKGIPSLAKVAKN---VDENLFFTIGLGLVNCTPGPRCQ  378

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRALWQ  675
             GPN TRFAASMNNVSFVLP++ S+L AYY NIPG++TTDFP  PPV+F+YTGNV R LWQ
Sbjct  379   GPNNTRFAASMNNVSFVLPRKTSLLQAYYQNIPGVFTTDFPPSPPVKFDYTGNVSRGLWQ  438

Query  674   PRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASFN  495
             PRFGTK+YK+KFGS+VQ+VLQDT I +TEDHPIHLHGYHF++VGQGFGNFNP TD A FN
Sbjct  439   PRFGTKLYKLKFGSNVQLVLQDTAIVTTEDHPIHLHGYHFFVVGQGFGNFNPKTDTAKFN  498

Query  494   LIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWETV  315
             L+DPP+RNTIDVPVGGW  IRFVADNPGVWL HCHIDSHLTWGL MSFLVENG  + +++
Sbjct  499   LVDPPVRNTIDVPVGGWVVIRFVADNPGVWLFHCHIDSHLTWGLGMSFLVENGKGKSQSI  558

Query  314   ppppPDLPRC  285
              PPP DLP+C
Sbjct  559   EPPPADLPQC  568



>ref|XP_009797628.1| PREDICTED: laccase-3-like [Nicotiana sylvestris]
Length=570

 Score =   429 bits (1102),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 230/310 (74%), Positives = 257/310 (83%), Gaps = 4/310 (1%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTNV++TA+Q P RYYMAA AYA+AQ APFDNTT TAVLEYT   S A+  P 
Sbjct  265   IMVGPGQTTNVILTADQPPARYYMAARAYASAQNAPFDNTTTTAVLEYTNLRSGANSRP-  323

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
              LLP+ PA NDT  VT+FTSQ+RS+P N +  P    I  +LFFTVGLG V+C PGPRCQ
Sbjct  324   -LLPQFPAFNDTNAVTSFTSQMRSIPKNNIKVPNQ--INENLFFTVGLGLVSCTPGPRCQ  380

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRALWQ  675
             GPN TRFAASMNNVSFV P+R S+L AYY NIPGIYT DFP VPPV+F+YTGNV R L Q
Sbjct  381   GPNNTRFAASMNNVSFVFPRRTSLLQAYYQNIPGIYTLDFPPVPPVKFDYTGNVSRVLRQ  440

Query  674   PRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASFN  495
             P FGTK+YK+KFGS+VQIVLQDT IFS EDHPIHLHGYHF++VGQGFGNFNP TD A FN
Sbjct  441   PGFGTKLYKIKFGSNVQIVLQDTAIFSVEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFN  500

Query  494   LIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWETV  315
             L DPP+RNTIDVPVGGWA IRFVADNPGVWL HCHIDSHL WGLAMSF+VENG  E +T+
Sbjct  501   LNDPPVRNTIDVPVGGWAVIRFVADNPGVWLFHCHIDSHLAWGLAMSFIVENGKGEKQTM  560

Query  314   ppppPDLPRC  285
              PPPPDLP+C
Sbjct  561   EPPPPDLPQC  570



>ref|XP_006350864.1| PREDICTED: laccase-3-like [Solanum tuberosum]
Length=568

 Score =   427 bits (1098),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 225/310 (73%), Positives = 254/310 (82%), Gaps = 5/310 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTNV++TANQ P +YYMAA AYAT +   FDNTT TA+LEY    S A+  P 
Sbjct  264   IMVGPGQTTNVILTANQSPRQYYMAARAYATVRNGQFDNTTTTAILEYKNLNSGANSRP-  322

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
              LLP+LPA NDTAT TAF ++LR +P N         I+ +LFFTVGLG VNC  GPRCQ
Sbjct  323   -LLPQLPAFNDTATATAFANRLRGVPNNNRVPNQ---IDENLFFTVGLGLVNCTRGPRCQ  378

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRALWQ  675
             GPN TRFAASMNN+SFVLP+R S+L AYY  IPGIYT DFP VPPVQF+YTGNV R LWQ
Sbjct  379   GPNNTRFAASMNNISFVLPRRTSLLQAYYQKIPGIYTLDFPRVPPVQFDYTGNVSRGLWQ  438

Query  674   PRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASFN  495
             PRFGTK+YK+KFGS+VQIVLQDT IFSTEDHPIHLHGYHF++VGQGFGNFN  TD A+FN
Sbjct  439   PRFGTKLYKLKFGSNVQIVLQDTAIFSTEDHPIHLHGYHFWVVGQGFGNFNAQTDTANFN  498

Query  494   LIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWETV  315
             L DPP+RNTIDVPVGGW  IRFVADNPGVWL HCHIDSHL WGLAM+F+VENGI E +T+
Sbjct  499   LNDPPVRNTIDVPVGGWTVIRFVADNPGVWLFHCHIDSHLAWGLAMAFIVENGIGEKQTM  558

Query  314   ppppPDLPRC  285
              PPPPDLP+C
Sbjct  559   EPPPPDLPQC  568



>emb|CDP09252.1| unnamed protein product [Coffea canephora]
Length=589

 Score =   426 bits (1094),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 222/312 (71%), Positives = 254/312 (81%), Gaps = 4/312 (1%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTNVL+TA+Q P R YMA  AYATAQGAPFDNTTATA+LEY +    +     
Sbjct  280   IMVGPGQTTNVLLTADQPPARSYMATRAYATAQGAPFDNTTATAILEYNSIPCHSRKGSS  339

Query  1034  --ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR  861
                +LPRLP  NDTATV +FTSQ RSL ++    P    I+ +LF TVGLGF NCIP P 
Sbjct  340   YTPILPRLPPYNDTATVASFTSQFRSLSSSDAQIPTD--IDENLFITVGLGFYNCIPSPT  397

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPN TRFA+SMNNVSFVLP+RAS+L AYY +IPG+YTTDFP VPP+QF+YTGNVPRAL
Sbjct  398   CQGPNATRFASSMNNVSFVLPRRASLLQAYYQSIPGVYTTDFPPVPPIQFDYTGNVPRAL  457

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             WQP  GTK+YK+K+GS VQ+V QDTGIFSTEDHPIHLHG+ FY+VGQGFGNFNP  D  +
Sbjct  458   WQPVRGTKLYKLKYGSKVQVVFQDTGIFSTEDHPIHLHGHQFYVVGQGFGNFNPSRDSTN  517

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNLIDPP RNTI VPVGGWAAIRFVADNPGVWLMHCHID+HLTWGLAM+FLV+NG    +
Sbjct  518   FNLIDPPERNTIGVPVGGWAAIRFVADNPGVWLMHCHIDAHLTWGLAMAFLVDNGPGLLQ  577

Query  320   TVppppPDLPRC  285
             +V  PP DLP+C
Sbjct  578   SVDRPPLDLPQC  589



>ref|XP_009599788.1| PREDICTED: laccase-3-like [Nicotiana tomentosiformis]
Length=570

 Score =   424 bits (1090),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 226/310 (73%), Positives = 256/310 (83%), Gaps = 4/310 (1%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTNV++  +Q P RYYMAA AYA+AQ APFDNTT TA+LEYT   S A+  P 
Sbjct  265   IMVGPGQTTNVILATDQPPARYYMAARAYASAQNAPFDNTTTTAILEYTNLRSGANSRP-  323

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
              LLP+LPA NDT  VT+FTSQ+RS+P N +  P    I+ +LFFTVGLG V+C PGPRCQ
Sbjct  324   -LLPQLPAFNDTNIVTSFTSQMRSIPKNNIRVPNQ--IDENLFFTVGLGMVSCTPGPRCQ  380

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRALWQ  675
             GPN TRFAASMNNVSFV P+R S+L AYY NIPGIYT DFP VPPV+F+YTGNV R L Q
Sbjct  381   GPNNTRFAASMNNVSFVFPRRTSLLQAYYQNIPGIYTLDFPPVPPVKFDYTGNVSRGLRQ  440

Query  674   PRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASFN  495
             P FGTK+YK+KFGS+VQIVLQDT IFS EDHPIHLHGYHF++VGQGFGNFNP TD + FN
Sbjct  441   PGFGTKLYKIKFGSNVQIVLQDTAIFSVEDHPIHLHGYHFWVVGQGFGNFNPQTDTSKFN  500

Query  494   LIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWETV  315
             L DPP+RNTIDVPVGGWA IRFVADNPGVWL HCHIDSHL WGL MSF+VENG  E +T+
Sbjct  501   LDDPPVRNTIDVPVGGWAVIRFVADNPGVWLFHCHIDSHLAWGLGMSFIVENGKGEKQTM  560

Query  314   ppppPDLPRC  285
              PPPPDLP+C
Sbjct  561   EPPPPDLPQC  570



>ref|XP_004242503.1| PREDICTED: laccase-3-like [Solanum lycopersicum]
Length=568

 Score =   423 bits (1088),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 221/310 (71%), Positives = 252/310 (81%), Gaps = 5/310 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTNV++TANQ PGRYYMA+ AYAT +   FDNTT TA+LEY    S A+  P 
Sbjct  264   IMVGPGQTTNVILTANQSPGRYYMASRAYATVRNGQFDNTTTTAILEYKNLKSGANSRP-  322

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
              LLP+LPA NDTAT TAF ++LR  P +         I+ +LFFTVGLG VNC  GPRCQ
Sbjct  323   -LLPQLPAFNDTATATAFANRLRGTPNSNRVPNQ---IDDNLFFTVGLGLVNCTRGPRCQ  378

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRALWQ  675
             GPN TRFAAS+NNVSF+ P + S+L AYY   PGIYT DFP VPPVQF+YTGNV R LWQ
Sbjct  379   GPNNTRFAASVNNVSFIFPSKTSLLQAYYQKTPGIYTLDFPRVPPVQFDYTGNVSRGLWQ  438

Query  674   PRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASFN  495
             P FGTK+YK+KFGS+VQIVLQDT IFSTEDHPIHLHGYHF++VGQGFGNFN  TD A+FN
Sbjct  439   PTFGTKLYKLKFGSNVQIVLQDTAIFSTEDHPIHLHGYHFWVVGQGFGNFNAQTDTANFN  498

Query  494   LIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWETV  315
             L DPP+RNTIDVPVGGWA IRFVADNPGVWL+HCHIDSHL WGLAM+F+VENGI E +T+
Sbjct  499   LNDPPVRNTIDVPVGGWAVIRFVADNPGVWLLHCHIDSHLAWGLAMAFIVENGIGEKQTM  558

Query  314   ppppPDLPRC  285
              PPPPDLP+C
Sbjct  559   EPPPPDLPQC  568



>ref|XP_002277722.1| PREDICTED: laccase-12 [Vitis vinifera]
Length=574

 Score =   411 bits (1056),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 215/311 (69%), Positives = 245/311 (79%), Gaps = 5/311 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+TA+Q P RYYMAA AY +AQ APFDNTT TA+LEY     +      
Sbjct  268   MMLGPGQTTDVLLTADQPPARYYMAARAYDSAQNAPFDNTTTTAILEYKGACYTKKGQSS  327

Query  1034  A-LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRC  858
               + PRLPA NDT TVTAFTS+ +SL T+ + T     I+ SLFFT+G G  NC PGPRC
Sbjct  328   KPVFPRLPAYNDTPTVTAFTSRFKSLTTSKVPTK----IDESLFFTIGFGLFNCRPGPRC  383

Query  857   QGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRALW  678
             QGPNGTRF ASMNNVSFVLP   SIL A Y  IPG++TTDFP+ PP+QF+YTGNV RALW
Sbjct  384   QGPNGTRFGASMNNVSFVLPSSNSILQASYQGIPGVFTTDFPASPPLQFDYTGNVSRALW  443

Query  677   QPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASF  498
             QP  GTKVYK+K+GS+VQIVLQDT IFS E+HP+HLHGYHFY+V  GFGNFNP TD A F
Sbjct  444   QPVRGTKVYKLKYGSTVQIVLQDTSIFSIENHPMHLHGYHFYVVALGFGNFNPVTDTAKF  503

Query  497   NLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWET  318
             NLIDPP+RNTI VP GGWA IRFVADNPG WLMHCHID+HLTWGLAM FLVENG  E ++
Sbjct  504   NLIDPPVRNTIGVPTGGWAVIRFVADNPGTWLMHCHIDAHLTWGLAMVFLVENGAGELQS  563

Query  317   VppppPDLPRC  285
             + PPP DLP C
Sbjct  564   IEPPPADLPPC  574



>ref|XP_002516345.1| laccase, putative [Ricinus communis]
 gb|EEF46029.1| laccase, putative [Ricinus communis]
Length=577

 Score =   403 bits (1035),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 211/314 (67%), Positives = 246/314 (78%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt--tssasyS  1041
             IM+ PGQTTNVL+TA+Q PGRYYMAA AY TAQ A FDNTT TA+L+Y +    S    S
Sbjct  268   IMIAPGQTTNVLLTADQTPGRYYMAARAYNTAQNAAFDNTTTTAILQYKSAPCNSKKGKS  327

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--G  867
               A+LP+LPA NDT T TAFT+QLRS     + T     I+ +LFF VGLG +NC     
Sbjct  328   SQAILPQLPAYNDTNTATAFTAQLRSPSNVKVPTD----IDDNLFFAVGLGLINCTNPNS  383

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
             PRCQGPNGTRFAAS+NNVSFVLP R SI+ AYY   PGI+TTDFP  PP++FNY+GNVPR
Sbjct  384   PRCQGPNGTRFAASINNVSFVLPTRNSIMQAYYQGQPGIFTTDFPPAPPIKFNYSGNVPR  443

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              LWQP  GTK+YK+K+GS VQIV QDT I +TEDHP+HLHGY F +VG GFGNFNPGTD 
Sbjct  444   GLWQPVPGTKLYKLKYGSKVQIVFQDTSIVTTEDHPMHLHGYEFAVVGMGFGNFNPGTDT  503

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNLIDPPLRNTI  P GGW AIRFVADNPG+WL+HCH+DSH+TWGLAM+FLVENG+ +
Sbjct  504   AKFNLIDPPLRNTIGTPPGGWVAIRFVADNPGIWLLHCHLDSHITWGLAMAFLVENGVGK  563

Query  326   WETVppppPDLPRC  285
              ++V PPP DLP+C
Sbjct  564   LQSVQPPPLDLPQC  577



>emb|CBI15873.3| unnamed protein product [Vitis vinifera]
Length=1561

 Score =   417 bits (1072),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 215/311 (69%), Positives = 245/311 (79%), Gaps = 5/311 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+TA+Q P RYYMAA AY +AQ APFDNTT TA+LEY     +      
Sbjct  1255  MMLGPGQTTDVLLTADQPPARYYMAARAYDSAQNAPFDNTTTTAILEYKGACYTKKGQSS  1314

Query  1034  A-LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRC  858
               + PRLPA NDT TVTAFTS+ +SL T+ + T     I+ SLFFT+G G  NC PGPRC
Sbjct  1315  KPVFPRLPAYNDTPTVTAFTSRFKSLTTSKVPTK----IDESLFFTIGFGLFNCRPGPRC  1370

Query  857   QGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRALW  678
             QGPNGTRF ASMNNVSFVLP   SIL A Y  IPG++TTDFP+ PP+QF+YTGNV RALW
Sbjct  1371  QGPNGTRFGASMNNVSFVLPSSNSILQASYQGIPGVFTTDFPASPPLQFDYTGNVSRALW  1430

Query  677   QPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASF  498
             QP  GTKVYK+K+GS+VQIVLQDT IFS E+HP+HLHGYHFY+V  GFGNFNP TD A F
Sbjct  1431  QPVRGTKVYKLKYGSTVQIVLQDTSIFSIENHPMHLHGYHFYVVALGFGNFNPVTDTAKF  1490

Query  497   NLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWET  318
             NLIDPP+RNTI VP GGWA IRFVADNPG WLMHCHID+HLTWGLAM FLVENG  E ++
Sbjct  1491  NLIDPPVRNTIGVPTGGWAVIRFVADNPGTWLMHCHIDAHLTWGLAMVFLVENGAGELQS  1550

Query  317   VppppPDLPRC  285
             + PPP DLP C
Sbjct  1551  IEPPPADLPPC  1561



>ref|XP_010099447.1| hypothetical protein L484_011146 [Morus notabilis]
 gb|EXB78522.1| hypothetical protein L484_011146 [Morus notabilis]
Length=575

 Score =   394 bits (1012),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 207/312 (66%), Positives = 245/312 (79%), Gaps = 6/312 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTT++L+TA+Q+P RYYMAA AY TAQ A FDNTT TA+LEY +          
Sbjct  268   IMIGPGQTTDILLTADQKPARYYMAARAYETAQNAAFDNTTTTAILEYKSACKKGLQPSR  327

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--GPR  861
              +L +LPA NDTAT TAFT++ RS     + T     I+H+LFFTVG G  NC     PR
Sbjct  328   PILSQLPAFNDTATATAFTAKFRSPSKVDVPTQ----IDHNLFFTVGFGLNNCTRPNSPR  383

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPNGTRFAASMNNVSFV P+R S++ AYY  +PG++TTDFP VPP+QF+YTGNVPR L
Sbjct  384   CQGPNGTRFAASMNNVSFVFPRRTSLMQAYYQGVPGVFTTDFPPVPPLQFDYTGNVPRGL  443

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             WQP  GTK+YK+K+GSSVQIVLQDT I +TEDHP+HLHGYHFY+VG GFGNFNP TDPA 
Sbjct  444   WQPSTGTKLYKLKYGSSVQIVLQDTSIVTTEDHPMHLHGYHFYVVGSGFGNFNPQTDPAK  503

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNLIDPP RNTI  P GGW AIRF+ADNPG+WLMHCH+D+H+  GLAM+FLVENG+   +
Sbjct  504   FNLIDPPQRNTIGTPPGGWVAIRFIADNPGIWLMHCHLDAHIVLGLAMAFLVENGVGASQ  563

Query  320   TVppppPDLPRC  285
             +V PPP DLPRC
Sbjct  564   SVIPPPADLPRC  575



>emb|CDY02043.1| BnaC04g14580D [Brassica napus]
Length=516

 Score =   389 bits (998),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 207/315 (66%), Positives = 236/315 (75%), Gaps = 10/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTNVL+TANQRPGRYYMAA AY +A  APFDNTT TA+LEY    +      G
Sbjct  207   IMIGPGQTTNVLLTANQRPGRYYMAARAYNSAN-APFDNTTTTAILEYVNAPTRRGRGRG  265

Query  1034  AL---LPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--  870
              +    P LP  NDTAT TAFT++LR      +       I+ +LFFTVGLG +NC    
Sbjct  266   QIAPVFPVLPGFNDTATATAFTNRLRYWKRAPVPLQ----IDENLFFTVGLGLINCSNPN  321

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
              PRCQGPNGTRFAAS+NN SFVLP+R SI+ AYY  +PGI+TTDFP VPPVQF+YTGNV 
Sbjct  322   SPRCQGPNGTRFAASINNQSFVLPRRNSIMQAYYQGMPGIFTTDFPPVPPVQFDYTGNVS  381

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R LWQP  GTK YK+KF ++VQIVLQDT I + E+HP+HLHGY FY+VG GFGNFNP TD
Sbjct  382   RGLWQPVKGTKAYKLKFKANVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFGNFNPRTD  441

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
             PA FNL DPP RNTI  P GGW A+RFVADNPG W MHCHIDSHL WGLAM FLVENG  
Sbjct  442   PARFNLFDPPERNTIGTPPGGWVAVRFVADNPGAWFMHCHIDSHLGWGLAMVFLVENGRG  501

Query  329   EWETVppppPDLPRC  285
             + ++V  PP DLPRC
Sbjct  502   QLQSVQAPPLDLPRC  516



>ref|XP_006355635.1| PREDICTED: laccase-5-like [Solanum tuberosum]
Length=574

 Score =   390 bits (1002),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 201/314 (64%), Positives = 246/314 (78%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLI A+Q P RYYMAA AYA+AQGAPFDNTT TA+LEY T + S++ +  
Sbjct  265   LMLGPGQTTDVLIKADQTPSRYYMAARAYASAQGAPFDNTTTTAILEYKTASCSSNCAKT  324

Query  1034  A-LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR-  861
               + P LPA NDTAT TAFT + RS     + T     I+ +LF TVGLG  NC  G R 
Sbjct  325   KPVSPSLPAYNDTATATAFTRKFRSPRKVEVPTE----IDENLFITVGLGLENCPRGARS  380

Query  860   --CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRFAASMNNVSFVLP   S+L A++  IPG+++TDFP+VPPV+FNYTGNV R
Sbjct  381   RNCQGPNGTRFAASMNNVSFVLPSNFSLLQAHHQGIPGVFSTDFPAVPPVKFNYTGNVSR  440

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTK+YK+K+G++VQ+VLQ TGIF+ E+HPIHLHGY FYI+ +GFGNFNP TD 
Sbjct  441   SLWQPIRGTKLYKLKYGATVQVVLQGTGIFTAENHPIHLHGYDFYIIAEGFGNFNPKTDT  500

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL++PPLRNT  +PV GW  IRFVADNPGVW+MHCH+D H+TWGLAM+FLVENG++E
Sbjct  501   SKFNLVNPPLRNTASLPVNGWTVIRFVADNPGVWIMHCHLDVHITWGLAMAFLVENGVSE  560

Query  326   WETVppppPDLPRC  285
              E++  PP D P C
Sbjct  561   LESLESPPVDFPVC  574



>ref|XP_009598627.1| PREDICTED: laccase-12-like [Nicotiana tomentosiformis]
Length=578

 Score =   390 bits (1002),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 204/314 (65%), Positives = 239/314 (76%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             IMLGPGQTT+VLITANQ P RYYMAA AYA+AQGAPFDNTT TA+LEY      A     
Sbjct  269   IMLGPGQTTDVLITANQPPARYYMAARAYASAQGAPFDNTTTTAILEYKAAPCPAKGVKI  328

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR-  861
               +LP LPA NDTA+ T FTS  RS     + T     I+ +LFFTVGLG  NC  G   
Sbjct  329   NPVLPSLPAFNDTASATTFTSSFRSARKVEVPTE----IDENLFFTVGLGLNNCPAGASS  384

Query  860   --CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRF ASMNNVSFVLP   S+L A++  IPG+++TDFP+VPPV+F+YTGNV R
Sbjct  385   SSCQGPNGTRFTASMNNVSFVLPSNFSLLQAHHQGIPGVFSTDFPAVPPVKFDYTGNVSR  444

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP   TK+YK+++G+ VQIVLQ T IF+ E+HPIHLHGY FYI+ +GFGNFNP TD 
Sbjct  445   SLWQPISATKLYKLRYGARVQIVLQGTSIFTAENHPIHLHGYDFYILAEGFGNFNPQTDT  504

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPPLRNT  VPV GW+ IRFVADNPGVW+MHCH+D H+TWGLAM+FLVENG+TE
Sbjct  505   AKFNLVDPPLRNTASVPVNGWSVIRFVADNPGVWIMHCHLDVHITWGLAMAFLVENGVTE  564

Query  326   WETVppppPDLPRC  285
              E +  PP DLP C
Sbjct  565   LEALEEPPVDLPVC  578



>ref|XP_004239961.1| PREDICTED: laccase-12-like [Solanum lycopersicum]
Length=574

 Score =   390 bits (1001),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 201/314 (64%), Positives = 242/314 (77%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavle-yttttssasySP  1038
             +MLGPGQTT+VLI A+Q P RYYMAA AYA+AQGAPFDNTT TA+LE  T++ SS     
Sbjct  265   LMLGPGQTTDVLIKADQTPNRYYMAARAYASAQGAPFDNTTTTAILEYKTSSCSSNCAKT  324

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR-  861
               + P LPA NDTAT TAFT + RS     + T     I+ +LF TVGLG  NC  G R 
Sbjct  325   NPISPSLPAYNDTATATAFTRKFRSPRKVEVPTE----IDENLFITVGLGLENCPTGARS  380

Query  860   --CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRFAASMNNVSFVLP   S+L A++  IPG+++TDFP+VPPV+FNYTGNV R
Sbjct  381   RNCQGPNGTRFAASMNNVSFVLPSNFSLLQAHHQRIPGVFSTDFPAVPPVKFNYTGNVSR  440

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTK+YK+K+G+ VQ+VLQ TGIF+ E+HPIHLHGY FYI+ +GFGNFNP  D 
Sbjct  441   SLWQPIRGTKLYKLKYGAKVQVVLQGTGIFTAENHPIHLHGYDFYIIAEGFGNFNPKADT  500

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL++PPLRNT  VPV GW  IRFVADNPGVW+MHCH+D H+TWGLAM+FLVENG++E
Sbjct  501   SKFNLVNPPLRNTASVPVNGWTVIRFVADNPGVWIMHCHLDVHITWGLAMAFLVENGVSE  560

Query  326   WETVppppPDLPRC  285
              E++  PP D P C
Sbjct  561   LESLEAPPVDFPVC  574



>ref|XP_006296399.1| hypothetical protein CARUB_v10025575mg [Capsella rubella]
 gb|EOA29297.1| hypothetical protein CARUB_v10025575mg [Capsella rubella]
Length=570

 Score =   389 bits (1000),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 208/315 (66%), Positives = 237/315 (75%), Gaps = 10/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTTNVLITANQRPGRYYMAA AY +A  APFDNTT TA+LEY    +      G
Sbjct  261   IMLGPGQTTNVLITANQRPGRYYMAARAYNSAN-APFDNTTTTAILEYVNAPTRRGRGRG  319

Query  1034  AL---LPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--  870
              +    P LP  NDTAT TAFT++LR      +       I+ +LFFTVGLG +NC+   
Sbjct  320   QIAPVFPVLPGFNDTATATAFTNRLRYWKRAPVPQQ----IDENLFFTVGLGLINCVNPN  375

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
              PRCQGPNGTRFAASMNN+SFVLP+  S++ AYY  IPGI+TTDFP VPPVQ++YTGNV 
Sbjct  376   SPRCQGPNGTRFAASMNNMSFVLPRTNSVMQAYYQGIPGIFTTDFPPVPPVQYDYTGNVS  435

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             RALWQP  GTK Y++K+ + VQIVLQDT I + E+HP+HLHGY FY+VG GFGNFNP TD
Sbjct  436   RALWQPIKGTKAYQLKYKAHVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFGNFNPRTD  495

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
             PA FNL DPP RNTI  P GGW AIRFVADNPG W MHCHIDSHL WGLAM FLVENG  
Sbjct  496   PARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVFLVENGRG  555

Query  329   EWETVppppPDLPRC  285
             + ++V  PP DLPRC
Sbjct  556   QLQSVQAPPLDLPRC  570



>gb|EYU43442.1| hypothetical protein MIMGU_mgv1a003472mg [Erythranthe guttata]
Length=583

 Score =   390 bits (1001),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 202/317 (64%), Positives = 245/317 (77%), Gaps = 11/317 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttata----vleyttttssas  1047
             +MLGPGQTT+VLITANQ P RYY+AA AYA+AQGAPFDNTT TA         +TT+S  
Sbjct  270   LMLGPGQTTDVLITANQPPARYYIAARAYASAQGAPFDNTTTTAILQYKSAACSTTTSKC  329

Query  1046  ySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPG  867
              S   ++P++PA NDTATVTAFT+  RS     + T     I+H+LFFTVGLG  NC  G
Sbjct  330   VSSKPVIPKMPAFNDTATVTAFTTSFRSPRKAPVPTK----IDHNLFFTVGLGLNNCPRG  385

Query  866   PR---CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN  696
              R   CQ PNGTRFAASMNNVSFVLP   S+L A+   +PG++TTDFP+ PP++F+YTGN
Sbjct  386   ARSRNCQAPNGTRFAASMNNVSFVLPSNFSLLQAHQQGVPGVFTTDFPANPPLRFDYTGN  445

Query  695   VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPG  516
             V R+LWQP  GTKVY++K+G +VQ+VLQ T IF+ E+HPIHLHGY FYI+ +GFGNFN  
Sbjct  446   VSRSLWQPAQGTKVYRLKYGETVQLVLQGTSIFTAENHPIHLHGYDFYIIAEGFGNFNAK  505

Query  515   TDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENG  336
              D A FNL+DPPLRNT  VPVGGW+ IRFVADNPGVWLMHCH+D H+TWGLAM+FLVENG
Sbjct  506   RDTAKFNLVDPPLRNTASVPVGGWSVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENG  565

Query  335   ITEWETVppppPDLPRC  285
             + + +T+ PPP DLP+C
Sbjct  566   VGKLQTLEPPPADLPKC  582



>ref|XP_010542673.1| PREDICTED: laccase-3-like [Tarenaya hassleriana]
Length=564

 Score =   388 bits (996),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 237/312 (76%), Gaps = 11/312 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +M+ PGQTTNVL+TANQRPGRYY+AA AY +A  APFDNTT TA+LEY            
Sbjct  262   VMIAPGQTTNVLLTANQRPGRYYIAARAYNSAN-APFDNTTTTAILEYVNAPRRT----A  316

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--GPR  861
              + PRLP  NDTATVTAFT++LRS+    L       I+ +LFFTVGLG +NC     PR
Sbjct  317   HVFPRLPGFNDTATVTAFTNRLRSVRREGLPLE----IDENLFFTVGLGLINCSNPNSPR  372

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPNGTRFAASMNNVSFVLP R S++ AYY    G++TTDFP VPPV+F+YTGNV R L
Sbjct  373   CQGPNGTRFAASMNNVSFVLPSRNSLMQAYYQGKRGVFTTDFPPVPPVKFDYTGNVSRGL  432

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             WQP  GTKVYK+K+ + VQIVLQDT I + E+HP+HLHGY FY+VG GFGNF+P  DPA 
Sbjct  433   WQPSRGTKVYKLKYKAKVQIVLQDTSIVTAENHPMHLHGYQFYVVGSGFGNFDPKRDPAK  492

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL+DPP RNTI  P GGW A+RF+ADNPG+W MHCHIDSHL WGLAM+ LVENG  E +
Sbjct  493   FNLVDPPERNTIGTPPGGWVAMRFIADNPGIWFMHCHIDSHLGWGLAMALLVENGKGELQ  552

Query  320   TVppppPDLPRC  285
             TV PPP DLPRC
Sbjct  553   TVQPPPLDLPRC  564



>gb|KDP45752.1| hypothetical protein JCGZ_17359 [Jatropha curcas]
Length=570

 Score =   388 bits (997),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 204/314 (65%), Positives = 238/314 (76%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             I++ PGQTT VL+TA+Q PGRYYMAA AY  AQ APFDNTT TA+L+YT+   +      
Sbjct  261   IVISPGQTTTVLLTADQTPGRYYMAARAYHPAQNAPFDNTTTTAILQYTSAPCNTKKGKS  320

Query  1034  A--LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--G  867
                +LP+LPA NDT TVTAFT QLRS     +       I+ +LFFTVGLG +NC     
Sbjct  321   LPPILPQLPAYNDTNTVTAFTGQLRSPQKVEVPIQ----IDENLFFTVGLGLINCTNPNS  376

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
             PRCQGPNGTRF AS+NNVSFVLP R S++ AYY   PGI+TTDFP VPP+QF+YTGNV R
Sbjct  377   PRCQGPNGTRFTASINNVSFVLPTRNSLMQAYYQGQPGIFTTDFPPVPPLQFDYTGNVSR  436

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              LW P   TK+YK+K+GS VQIV QDT I + +DHP+HLHGYHF +VG GFGNFNPGTD 
Sbjct  437   GLWTPVKRTKLYKLKYGSKVQIVFQDTSIVTPDDHPMHLHGYHFAVVGTGFGNFNPGTDT  496

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
               FNLIDPP RNTI  P GGW AIRFVADNPG+WL+HCH+DSHLTWGLAMSFLVENG  +
Sbjct  497   VKFNLIDPPFRNTIGAPPGGWVAIRFVADNPGIWLLHCHLDSHLTWGLAMSFLVENGAGQ  556

Query  326   WETVppppPDLPRC  285
              ++V PPP DLP+C
Sbjct  557   LQSVQPPPLDLPQC  570



>ref|XP_010521986.1| PREDICTED: laccase-3 [Tarenaya hassleriana]
Length=565

 Score =   387 bits (994),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 239/312 (77%), Gaps = 11/312 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +M+ PGQT NVL+TA+QRPGRYY+AA AY +A  APFDNTT TA+LEY  T         
Sbjct  263   VMIAPGQTMNVLLTADQRPGRYYIAARAYNSAN-APFDNTTTTAILEYVNTPRRT----A  317

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--GPR  861
                PRLP  NDTAT TAFT++LRS+    L       I+ +LFFTVGLG +NC     PR
Sbjct  318   PTFPRLPGFNDTATATAFTNRLRSMRREGLPLE----IDENLFFTVGLGLINCTNPNSPR  373

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPNGTRFAASMNNVSFVLP+R S++ AYY   PG++T DFP VPPV+F+YTGNV R L
Sbjct  374   CQGPNGTRFAASMNNVSFVLPRRNSLMQAYYQGTPGVFTVDFPPVPPVKFDYTGNVSRGL  433

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             WQPR GTKVYK+++ + VQIVLQDT I + E+HP+HLHGY FY+VG GFGNF+P  DPA+
Sbjct  434   WQPRRGTKVYKLRYKARVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFGNFDPKRDPAN  493

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL+DPP RNTI  P GGW AIRF+ADNPG+W MHCHIDSHL WGLAM+FLV+NG  E +
Sbjct  494   FNLVDPPERNTIGTPPGGWVAIRFIADNPGIWFMHCHIDSHLGWGLAMAFLVKNGKGELQ  553

Query  320   TVppppPDLPRC  285
             TV PPP DLPRC
Sbjct  554   TVQPPPLDLPRC  565



>ref|XP_002315131.1| hypothetical protein POPTR_0010s19090g [Populus trichocarpa]
 gb|EEF01302.1| hypothetical protein POPTR_0010s19090g [Populus trichocarpa]
Length=575

 Score =   387 bits (995),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 201/313 (64%), Positives = 240/313 (77%), Gaps = 7/313 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VLI+ +Q PGRYYMAA AY +AQ APFDNTT TA+LEY +    A  +  
Sbjct  267   IMLGPGQTTDVLISGDQLPGRYYMAARAYQSAQNAPFDNTTTTAILEYKSALCPAKCTTK  326

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR--  861
              ++PRLPA NDTATVTAF+  LRS     + T     I+ +LFFT+GLG  NC    R  
Sbjct  327   PVMPRLPAYNDTATVTAFSGSLRSPRKVEVPTD----IDENLFFTIGLGLNNCPKNSRAR  382

Query  860   -CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRA  684
              CQGPNGTRF ASMNNVSFV P   ++L AY   +PGIYTTDFP+ PPV+F+YTGNV R+
Sbjct  383   RCQGPNGTRFTASMNNVSFVFPSNIALLQAYQQKVPGIYTTDFPAKPPVKFDYTGNVSRS  442

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             L+QP  GTK+YK+K+GS VQIVLQDT I + E+HPIHLHGY FYI+ +GFGNFNP T  +
Sbjct  443   LFQPVRGTKLYKLKYGSRVQIVLQDTSIVTPENHPIHLHGYDFYIIAEGFGNFNPKTHKS  502

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FNL+DPP+RNT+ VP  GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVE+GI E 
Sbjct  503   KFNLVDPPMRNTVAVPSNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGIGEL  562

Query  323   ETVppppPDLPRC  285
             ++V PPP DLP C
Sbjct  563   QSVEPPPADLPIC  575



>ref|XP_010414291.1| PREDICTED: laccase-3 [Camelina sativa]
 ref|XP_010469882.1| PREDICTED: laccase-3 [Camelina sativa]
Length=572

 Score =   387 bits (994),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 207/317 (65%), Positives = 236/317 (74%), Gaps = 12/317 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             IMLGPGQTTNVLITANQRPGRYYMAA AY +A  APFDNTT TA+L+Y    +       
Sbjct  261   IMLGPGQTTNVLITANQRPGRYYMAARAYNSA-NAPFDNTTTTAILQYVNAPTRRGRGRG  319

Query  1037  ----GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP  870
                   + P LP  NDTAT TAFT++LR      +       I+ +LFFTVGLG +NC  
Sbjct  320   RGQMAPVFPVLPGFNDTATATAFTNRLRYWKRAPVPQQ----IDENLFFTVGLGLINCAN  375

Query  869   --GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN  696
                PRCQGPNGTRFAAS+NN+SFVLP+R S++ AYY  +PGI+TTDFP VPPVQF+YTGN
Sbjct  376   PNSPRCQGPNGTRFAASINNMSFVLPRRNSVMQAYYQGMPGIFTTDFPPVPPVQFDYTGN  435

Query  695   VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPG  516
             V RALWQP  GTK YK+K+ ++VQIVLQDT I + E+HP+HLHGY FY+VG GFGNFNP 
Sbjct  436   VSRALWQPIKGTKAYKLKYRANVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFGNFNPR  495

Query  515   TDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENG  336
             TDPA FNL DPP RNTI  P GGW AIRFVADNPG W MHCHIDSHL WGLAM FLVENG
Sbjct  496   TDPARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVFLVENG  555

Query  335   ITEWETVppppPDLPRC  285
                 ++V  PP DLPRC
Sbjct  556   RGRLQSVQAPPLDLPRC  572



>ref|XP_002881090.1| hypothetical protein ARALYDRAFT_481932 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57349.1| hypothetical protein ARALYDRAFT_481932 [Arabidopsis lyrata subsp. 
lyrata]
Length=570

 Score =   387 bits (994),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 204/315 (65%), Positives = 237/315 (75%), Gaps = 10/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTN+L+TANQRPGRYYMAA AY +A  APFDNTT TA+L+Y    +      G
Sbjct  261   IMIGPGQTTNLLLTANQRPGRYYMAARAYNSAN-APFDNTTTTAILQYVNAPTRRGRGRG  319

Query  1034  AL---LPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--  870
              +    P LP  NDTAT TAFT++LR      +       ++ +LFFTVGLG +NC    
Sbjct  320   QIAPVFPVLPGFNDTATATAFTNRLRYWKRAPVPQQ----VDENLFFTVGLGLINCSNPN  375

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
              PRCQGPNGTRFAASMNN+SFVLP+R S++ AYY  +PGI+TTDFP VPPVQF+YTGNV 
Sbjct  376   SPRCQGPNGTRFAASMNNMSFVLPRRNSVMQAYYQGMPGIFTTDFPPVPPVQFDYTGNVS  435

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R LWQP  GTK YK+K+ ++VQIVLQDT I + E+HP+HLHGY FY+VG GFGNFNP TD
Sbjct  436   RGLWQPIKGTKAYKLKYKANVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFGNFNPRTD  495

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
             PA FNL DPP RNTI  P GGW AIRFVADNPG W MHCHIDSHL WGLAM FLVENG  
Sbjct  496   PARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVFLVENGRG  555

Query  329   EWETVppppPDLPRC  285
             + ++V  PP DLPRC
Sbjct  556   QLQSVQAPPLDLPRC  570



>ref|XP_010510393.1| PREDICTED: laccase-3-like [Camelina sativa]
Length=572

 Score =   387 bits (993),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 207/317 (65%), Positives = 236/317 (74%), Gaps = 12/317 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             IMLGPGQTTNVLITANQRPGRYYMAA AY +A  APFDNTT TA+L+Y    +       
Sbjct  261   IMLGPGQTTNVLITANQRPGRYYMAARAYNSA-NAPFDNTTTTAILQYVNAPTRRGRGRG  319

Query  1037  ----GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP  870
                   + P LP  NDTAT TAFT++LR      +       I+ +LFFTVGLG +NC  
Sbjct  320   RGQMAPVFPVLPGFNDTATATAFTNRLRYWKRAPVPQQ----IDENLFFTVGLGLINCAN  375

Query  869   --GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN  696
                PRCQGPNGTRFAAS+NN+SFVLP+R S++ AYY  +PGI+TTDFP VPPVQF+YTGN
Sbjct  376   PNSPRCQGPNGTRFAASINNMSFVLPRRNSVMQAYYQGMPGIFTTDFPPVPPVQFDYTGN  435

Query  695   VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPG  516
             V RALWQP  GTK YK+K+ ++VQIVLQDT I + E+HP+HLHGY FY+VG GFGNFNP 
Sbjct  436   VSRALWQPIKGTKAYKLKYRANVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFGNFNPR  495

Query  515   TDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENG  336
             TDPA FNL DPP RNTI  P GGW AIRFVADNPG W MHCHIDSHL WGLAM FLVENG
Sbjct  496   TDPARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVFLVENG  555

Query  335   ITEWETVppppPDLPRC  285
                 ++V  PP DLPRC
Sbjct  556   RGRLQSVQAPPLDLPRC  572



>ref|XP_006353418.1| PREDICTED: laccase-12-like [Solanum tuberosum]
Length=567

 Score =   387 bits (993),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 204/314 (65%), Positives = 233/314 (74%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             +MLGPGQTT+VLITANQ P RYYMAA AYA+AQGAPFDNTT TA+LEY      A     
Sbjct  258   LMLGPGQTTDVLITANQPPARYYMAARAYASAQGAPFDNTTTTAILEYKAAPCPAKGVKI  317

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR-  861
                 P LPA NDTAT TAFTS  RS     + T     I+  LFFTVGLG  NC  G   
Sbjct  318   NPAFPSLPAFNDTATATAFTSSFRSARKVQVPTE----IDEDLFFTVGLGLNNCPAGASS  373

Query  860   --CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRF ASMNNVSFVLP   S+L A++  IPG+++TDFPS PPV+F+YTGNV R
Sbjct  374   SSCQGPNGTRFTASMNNVSFVLPSNFSLLQAHHQGIPGVFSTDFPSSPPVKFDYTGNVSR  433

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              LWQP   TKVYK+ +G+ VQIVLQ T I + E+HPIHLHGY FYI+ +GFGNFNP TD 
Sbjct  434   TLWQPLSATKVYKLSYGARVQIVLQGTSIVTAENHPIHLHGYDFYILAEGFGNFNPQTDT  493

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPPLRNT  VPV GW+ IRFVADNPG+WLMHCH+D H+TWGLAM+FLVENG+TE
Sbjct  494   SKFNLVDPPLRNTASVPVNGWSVIRFVADNPGIWLMHCHLDVHITWGLAMAFLVENGVTE  553

Query  326   WETVppppPDLPRC  285
              E V  PP DLP C
Sbjct  554   LEAVEEPPVDLPVC  567



>ref|XP_009141050.1| PREDICTED: laccase-3 [Brassica rapa]
 emb|CDY29689.1| BnaA04g17380D [Brassica napus]
Length=570

 Score =   387 bits (993),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 206/315 (65%), Positives = 236/315 (75%), Gaps = 10/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTNVL+TANQRPGRYYMAA AY +A  APFDNTT TA+LEY    +      G
Sbjct  261   IMIGPGQTTNVLLTANQRPGRYYMAARAYNSAN-APFDNTTTTAILEYVNAPTRRGRGRG  319

Query  1034  AL---LPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--  870
              +    P LP  NDTAT TAFT++LR      +       ++ +LFFTVGLG  NC    
Sbjct  320   QIAPVFPVLPGFNDTATATAFTNRLRYWKRAPVPLQ----VDENLFFTVGLGLTNCSNPN  375

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
              PRCQGPNGTRFAAS+NN SFVLP+R SI+ AYY  +PGI+TTDFP VPPVQF+YTGNV 
Sbjct  376   SPRCQGPNGTRFAASINNQSFVLPRRNSIMQAYYQGMPGIFTTDFPPVPPVQFDYTGNVS  435

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R LWQP  GTK YK+K+ ++VQIVLQDT I +TE+HP+HLHGY FY+VG GFGNFNP TD
Sbjct  436   RGLWQPVKGTKAYKLKYRANVQIVLQDTSIVTTENHPMHLHGYQFYVVGSGFGNFNPRTD  495

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
             PA FNL DPP RNT+  P GGW AIRFVADNPG W MHCHIDSHL WGLAM FLVENG  
Sbjct  496   PARFNLYDPPERNTVGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVFLVENGRG  555

Query  329   EWETVppppPDLPRC  285
             + ++V  PP DLPRC
Sbjct  556   QLQSVQAPPLDLPRC  570



>ref|XP_009144319.1| PREDICTED: laccase-3 [Brassica rapa]
Length=570

 Score =   386 bits (992),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 206/315 (65%), Positives = 236/315 (75%), Gaps = 10/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTNVL+TANQRPGRYYMAA AY +A  APFDNTT TA+LEY    +      G
Sbjct  261   IMIGPGQTTNVLLTANQRPGRYYMAARAYNSAN-APFDNTTTTAILEYVNAPTRRGRGRG  319

Query  1034  AL---LPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--  870
              +    P LP  NDTAT TAFT++LR      +       ++ +LFFTVGLG +NC    
Sbjct  320   QIAPGFPVLPGFNDTATATAFTNRLRYWKRAPVPLQ----VDENLFFTVGLGLINCSNPN  375

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
              PRCQGPNGTRFAAS+NN SFVLP+R SI+ AYY  +PGI+TTDFP VPPVQF+YTGNV 
Sbjct  376   SPRCQGPNGTRFAASINNQSFVLPRRNSIMQAYYQGMPGIFTTDFPPVPPVQFDYTGNVS  435

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R LWQP  GTK YK+K+ ++VQIVLQDT I + E+HP+HLHGY FY+VG GFGNFNP TD
Sbjct  436   RGLWQPVKGTKAYKLKYKANVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFGNFNPRTD  495

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
             PA FNL DPP RNTI  P GGW AIRFVADNPG W MHCHIDSHL WGLAM FLVENG  
Sbjct  496   PARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVFLVENGRG  555

Query  329   EWETVppppPDLPRC  285
             + ++V  PP DLPRC
Sbjct  556   QLQSVQAPPLDLPRC  570



>ref|NP_180580.1| laccase 3 [Arabidopsis thaliana]
 sp|Q56YT0.2|LAC3_ARATH RecName: Full=Laccase-3; AltName: Full=Benzenediol:oxygen oxidoreductase 
3; AltName: Full=Diphenol oxidase 3; AltName: Full=Urishiol 
oxidase 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC16927.1| putative laccase [Arabidopsis thaliana]
 gb|AAM14916.1| putative laccase [Arabidopsis thaliana]
 gb|AEC08358.1| laccase 3 [Arabidopsis thaliana]
Length=570

 Score =   386 bits (992),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 205/315 (65%), Positives = 235/315 (75%), Gaps = 10/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTNVL+TANQRPGRYYMAA AY +A  APFDNTT TA+L+Y    +      G
Sbjct  261   IMIGPGQTTNVLLTANQRPGRYYMAARAYNSAN-APFDNTTTTAILQYVNAPTRRGRGRG  319

Query  1034  AL---LPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--  870
              +    P LP  NDTAT TAFT++LR      +       ++ +LFFTVGLG +NC    
Sbjct  320   QIAPVFPVLPGFNDTATATAFTNRLRYWKRAPVPQQ----VDENLFFTVGLGLINCANPN  375

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
              PRCQGPNGTRFAASMNN+SFVLP+  S++ AYY   PGI+TTDFP VPPVQF+YTGNV 
Sbjct  376   SPRCQGPNGTRFAASMNNMSFVLPRSNSVMQAYYQGTPGIFTTDFPPVPPVQFDYTGNVS  435

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R LWQP  GTK YK+K+ S+VQIVLQDT I + E+HP+HLHGY FY+VG GFGNFNP TD
Sbjct  436   RGLWQPIKGTKAYKLKYKSNVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFGNFNPRTD  495

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
             PA FNL DPP RNTI  P GGW AIRFVADNPG W MHCHIDSHL WGLAM FLVENG  
Sbjct  496   PARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVFLVENGRG  555

Query  329   EWETVppppPDLPRC  285
             + ++V  PP DLPRC
Sbjct  556   QLQSVQAPPLDLPRC  570



>emb|CDX97838.1| BnaC04g41010D [Brassica napus]
Length=570

 Score =   386 bits (992),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 206/315 (65%), Positives = 236/315 (75%), Gaps = 10/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTNVL+TANQRPGRYYMAA AY +A  APFDNTT TA+LEY    +      G
Sbjct  261   IMIGPGQTTNVLLTANQRPGRYYMAARAYNSAN-APFDNTTTTAILEYVNAPTRRGRGRG  319

Query  1034  ALLPR---LPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--  870
              ++P    LP  NDTAT TAFT++LR      +       +  +LFFTVGLG  NC    
Sbjct  320   QIVPVFPVLPGFNDTATATAFTNRLRYWKRARVPLQ----VNENLFFTVGLGLTNCSNPN  375

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
              PRCQGPNGTRFAAS+NN SFVLP+R SI+ AYY  +PGI+TTDFP VPPVQF+YTGNV 
Sbjct  376   SPRCQGPNGTRFAASINNQSFVLPRRNSIMQAYYQGMPGIFTTDFPPVPPVQFDYTGNVS  435

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R LWQP  GTK YK+K+ ++VQIVLQDT I +TE+HP+HLHGY FY+VG GFGNFNP TD
Sbjct  436   RGLWQPVKGTKAYKLKYRANVQIVLQDTSIVTTENHPMHLHGYQFYVVGSGFGNFNPRTD  495

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
             PA FNL DPP RNT+  P GGW AIRFVADNPG W MHCHIDSHL WGLAM FLVENG  
Sbjct  496   PARFNLYDPPERNTVGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVFLVENGRG  555

Query  329   EWETVppppPDLPRC  285
             + ++V  PP DLPRC
Sbjct  556   QLQSVQAPPLDLPRC  570



>ref|XP_004240885.1| PREDICTED: laccase-5-like [Solanum lycopersicum]
Length=567

 Score =   386 bits (991),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 235/314 (75%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             +MLGPG+TT+VLITANQ P RYYMAA AYA+AQGAPFDNTT TA+LEY      A     
Sbjct  258   LMLGPGETTDVLITANQPPARYYMAARAYASAQGAPFDNTTTTAILEYKAAPCPAKGVKI  317

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR-  861
                 P LPA NDTAT TAFTS  RS     + T     I+ +LFFTVGLG  NC  G   
Sbjct  318   NPAFPSLPAFNDTATATAFTSSFRSASKVEVPTE----IDENLFFTVGLGLNNCPAGASS  373

Query  860   --CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNG RF ASMNNVSFVLP   S+L A++  IPG+++TDFPS PPV+F+YTGNV R
Sbjct  374   SSCQGPNGMRFTASMNNVSFVLPSNFSLLQAHHQGIPGVFSTDFPSSPPVKFDYTGNVSR  433

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP   TKVYK+K+G+ VQIVLQ T I + E+HPIHLHGY FYI+ +GFGNFNP TD 
Sbjct  434   SLWQPISATKVYKLKYGARVQIVLQGTSIVTAENHPIHLHGYDFYILAEGFGNFNPQTDT  493

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPPLRNT  VPV GW+ IRFVADNPG+WLMHCH+D H+TWGLAM+FLVENG+TE
Sbjct  494   SKFNLVDPPLRNTASVPVNGWSVIRFVADNPGIWLMHCHLDVHITWGLAMAFLVENGVTE  553

Query  326   WETVppppPDLPRC  285
              E +  PP DLP C
Sbjct  554   LEAIEEPPVDLPVC  567



>emb|CDY10719.1| BnaA05g12170D [Brassica napus]
Length=543

 Score =   384 bits (986),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 205/315 (65%), Positives = 235/315 (75%), Gaps = 10/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTNVL+TANQRPGRYYMAA AY +A  APFDNTT TA+LEY    +      G
Sbjct  234   IMIGPGQTTNVLLTANQRPGRYYMAARAYNSAN-APFDNTTTTAILEYVNAPTRRGRGCG  292

Query  1034  AL---LPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--  870
              +    P LP  NDTAT TAFT++LR      +       ++ +LFFTVGLG +NC    
Sbjct  293   QIAPVFPVLPGFNDTATATAFTNRLRYWKRAPVPLQ----VDENLFFTVGLGLINCSNPN  348

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
              PRCQGPNGTRFAAS+NN SFVLP+R SI+ AYY  +PGI+TTDFP VPPVQF+YTGNV 
Sbjct  349   SPRCQGPNGTRFAASINNQSFVLPRRNSIMQAYYQGMPGIFTTDFPPVPPVQFDYTGNVS  408

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R LWQP  GTK YK+K+ ++VQIVLQDT I + E+HP+HLHGY FY+VG GFGNFN  TD
Sbjct  409   RGLWQPVKGTKAYKLKYKANVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFGNFNRRTD  468

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
             PA FNL DPP RNTI  P GGW AIRFVADNPG W MHCHIDSHL WGLAM FLVENG  
Sbjct  469   PARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVFLVENGRG  528

Query  329   EWETVppppPDLPRC  285
             + ++V  PP DLPRC
Sbjct  529   QLQSVQAPPLDLPRC  543



>ref|XP_010257021.1| PREDICTED: laccase-12-like [Nelumbo nucifera]
Length=575

 Score =   385 bits (988),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 207/314 (66%), Positives = 237/314 (75%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             +MLGPGQTT+VLI  NQ PGRYY+AA AY +AQ A FDNTT TA+LEY +          
Sbjct  266   LMLGPGQTTDVLINTNQPPGRYYIAARAYQSAQNAAFDNTTPTAILEYKSAPCPKKGLSV  325

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPG---  867
               + P LPA NDT T TAF + L+S     + T     I+ +LFFTVGLG  NC P    
Sbjct  326   QPVFPLLPAYNDTPTATAFAAGLKSPSKVDVPTD----IDENLFFTVGLGLFNCPPRFSR  381

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
              RCQGPNGTRF ASMNNVSFVLP   SIL AY   IPG+YTTDFP+VPPVQF+YTGNV R
Sbjct  382   SRCQGPNGTRFTASMNNVSFVLPSNFSILQAYQQGIPGVYTTDFPAVPPVQFDYTGNVSR  441

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             ALWQP  GTKVYK+KFGS VQ+VLQ T IFS E+HPIH+HGY FYIV +GFGNFNP TD 
Sbjct  442   ALWQPVPGTKVYKLKFGSRVQLVLQGTSIFSAENHPIHIHGYDFYIVAEGFGNFNPQTDT  501

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVENG+ E
Sbjct  502   AKFNLVDPPMRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDIHITWGLAMAFLVENGVGE  561

Query  326   WETVppppPDLPRC  285
              +++ PPP DLP C
Sbjct  562   LQSLEPPPADLPPC  575



>ref|XP_009763768.1| PREDICTED: laccase-12-like [Nicotiana sylvestris]
Length=574

 Score =   385 bits (988),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 239/314 (76%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavle-yttttssasySP  1038
             +MLGPGQTT+VLI A+Q+P +YYMAA AYA+AQGAPFDNTT TA+LE  T + SS     
Sbjct  265   LMLGPGQTTDVLIKADQQPAKYYMAARAYASAQGAPFDNTTTTAILEYKTASCSSNCAKT  324

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPG---  867
              A+ P LPA NDT T TAFT++ RS     +       I+ +LFFTVGLG  NC  G   
Sbjct  325   NAVFPSLPAYNDTVTATAFTTKFRSPRKVEVPKE----IDENLFFTVGLGLDNCPRGASS  380

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRF ASMNNVSFVLP   S+L A++  IPG+++TDFP+ PPV+F+YTGNV R
Sbjct  381   SNCQGPNGTRFTASMNNVSFVLPSNFSLLQAHHQGIPGVFSTDFPAKPPVKFDYTGNVSR  440

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTK+YK+K+G+ VQ+VLQ T IF+ E+HPIHLHGY FYI+ +GFGNFNP  D 
Sbjct  441   SLWQPIRGTKLYKLKYGARVQVVLQGTSIFTAENHPIHLHGYDFYIIAEGFGNFNPKRDA  500

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
               FN++DPPLRNT  VPV GWA IRFVADNPGVWLMHCH+D H+ WGLAM+FLVENGI+E
Sbjct  501   TKFNIVDPPLRNTASVPVNGWAVIRFVADNPGVWLMHCHLDVHIGWGLAMAFLVENGISE  560

Query  326   WETVppppPDLPRC  285
              E++  PP DLP C
Sbjct  561   VESLEAPPVDLPVC  574



>gb|ABK92474.1| unknown [Populus trichocarpa]
Length=550

 Score =   384 bits (985),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 200/313 (64%), Positives = 238/313 (76%), Gaps = 7/313 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VLI+ +Q PGRYYMAA AY +AQ APFDNTT TA+LEY +    A  +  
Sbjct  242   IMLGPGQTTDVLISGDQLPGRYYMAARAYQSAQNAPFDNTTTTAILEYKSVLCPAKCTKK  301

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
               +P LPA NDTATVTAF+   RS     + T     I+ +LFFT+GLG  NC       
Sbjct  302   PFMPPLPAYNDTATVTAFSRSFRSPRKVEVPTD----IDENLFFTIGLGLNNCPKNFRAR  357

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRA  684
             RCQGPNGTRF ASMNNVSFV P +AS+L AY   IPG++TTDFP+ P V+F+YTGNV R+
Sbjct  358   RCQGPNGTRFTASMNNVSFVFPSKASLLQAYKQKIPGVFTTDFPAKPQVKFDYTGNVSRS  417

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             L+QP  GTK+YK+K+GS VQIVLQDT I + E+HPIHLHGY FYI+ +GFGNFNP TD +
Sbjct  418   LFQPARGTKLYKLKYGSRVQIVLQDTSIVTPENHPIHLHGYDFYIIAEGFGNFNPKTDKS  477

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FNL+DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVE GI   
Sbjct  478   KFNLVDPPMRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEEGIGIL  537

Query  323   ETVppppPDLPRC  285
             ++V PPP DLP C
Sbjct  538   QSVEPPPADLPIC  550



>ref|XP_008384707.1| PREDICTED: laccase-3-like [Malus domestica]
Length=567

 Score =   384 bits (987),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 211/312 (68%), Positives = 246/312 (79%), Gaps = 7/312 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTT+VL+TA+QRP RYYMAA AYATAQ APFDNTT TA+LEY    SS      
Sbjct  261   IMIGPGQTTDVLLTADQRPARYYMAARAYATAQNAPFDNTTTTAILEYKNAASSNQGL-A  319

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC-IP-GPR  861
              + P LPA NDTAT TA+T+Q++S     + T     I+  LFFTVGLG  NC +P  PR
Sbjct  320   PVFPTLPAYNDTATATAYTAQIKSPSQVRVPTQ----IDEYLFFTVGLGLYNCTVPNSPR  375

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPN TRFAASMNNVSFVLP+  S++ A Y  +PG++TTDFP +PPVQFNYTGNVPR L
Sbjct  376   CQGPNNTRFAASMNNVSFVLPRTNSLMQAAYYGVPGVFTTDFPPIPPVQFNYTGNVPRGL  435

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             W PR GTK+Y++K+ ++VQIVLQDT I +TEDHP+HLHGYHFY++G GFGN+NP TDPA 
Sbjct  436   WSPRRGTKLYRLKYCANVQIVLQDTSIVTTEDHPMHLHGYHFYVIGSGFGNYNPSTDPAR  495

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNLIDPP RNTI  P GGW AIRF ADNPGVWLMHCH+DSHL  GLAM+FLVENGI   +
Sbjct  496   FNLIDPPQRNTIGTPPGGWVAIRFKADNPGVWLMHCHLDSHLFLGLAMAFLVENGIGPLQ  555

Query  320   TVppppPDLPRC  285
             +V PPPPDLPRC
Sbjct  556   SVIPPPPDLPRC  567



>ref|XP_006435828.1| hypothetical protein CICLE_v10031070mg [Citrus clementina]
 ref|XP_006486242.1| PREDICTED: laccase-5-like [Citrus sinensis]
 gb|ESR49068.1| hypothetical protein CICLE_v10031070mg [Citrus clementina]
Length=579

 Score =   384 bits (987),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 202/315 (64%), Positives = 241/315 (77%), Gaps = 9/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VLI  +Q P RYY+AA AYA+A  APFDNTT TA+LEY +    A     
Sbjct  269   IMLGPGQTTDVLIKGDQPPSRYYLAARAYASAPSAPFDNTTTTAILEYKSAPCPAKKGLS  328

Query  1034  A--LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IP  870
                ++P+LPA NDTATVTAFT + RS     + T     I+ SLFFTVGLG  NC     
Sbjct  329   IRPVMPQLPAFNDTATVTAFTKKFRSPQKVEVPTD----IDESLFFTVGLGLNNCPRNFG  384

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
               RCQGPNGTRF ASMNNVSFVLP   S+L A+++ IPG++TTDFP+ PP +F+YTGNV 
Sbjct  385   SSRCQGPNGTRFTASMNNVSFVLPSNFSLLQAHHHGIPGVFTTDFPANPPFKFDYTGNVS  444

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R+LWQP  GTK+YK+++GS VQIVLQDT IF+ E+HPIH+HGY FYI+ +GFGNFNP TD
Sbjct  445   RSLWQPVPGTKLYKLEYGSRVQIVLQDTSIFTPENHPIHIHGYDFYIIAEGFGNFNPKTD  504

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
              + FNL+DPPLRNT+ VPVGGWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVENG+T
Sbjct  505   TSKFNLVDPPLRNTVGVPVGGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGVT  564

Query  329   EWETVppppPDLPRC  285
             E E +  PP D P C
Sbjct  565   ELEKLEAPPLDYPVC  579



>gb|KDO44836.1| hypothetical protein CISIN_1g008066mg [Citrus sinensis]
Length=579

 Score =   384 bits (986),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 204/315 (65%), Positives = 242/315 (77%), Gaps = 9/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VLI  +Q P RYY+AA AYA+A  APFDNTT TA+LEY +    A     
Sbjct  269   IMLGPGQTTDVLIKGDQPPSRYYLAARAYASAPNAPFDNTTTTAILEYKSAPCPAKKGLS  328

Query  1034  A--LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IP  870
                ++P LPA NDTATVTAFT +LRS     + T     I+ SLFFTVGLG  NC     
Sbjct  329   IRPVMPPLPAFNDTATVTAFTKKLRSPQKVEVPTD----IDESLFFTVGLGLNNCPRNFR  384

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
               RCQGPNGTRF ASMNNVSFVLP   S+L A+++ IPG++TTDFP+ PP +F+YTGNV 
Sbjct  385   SSRCQGPNGTRFTASMNNVSFVLPSNFSLLQAHHHGIPGVFTTDFPANPPFKFDYTGNVS  444

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R+LWQP  GTK+YK+++GS VQIVLQDT IF+ E+HPIH+HGY FYI+ +GFGNFNP TD
Sbjct  445   RSLWQPVPGTKLYKLEYGSRVQIVLQDTSIFTPENHPIHIHGYDFYIIAEGFGNFNPKTD  504

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
              + FNL+DPPLRNT+ VPVGGWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVENG+T
Sbjct  505   TSKFNLVDPPLRNTVGVPVGGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGVT  564

Query  329   EWETVppppPDLPRC  285
             E E +  PPPD P C
Sbjct  565   ELEKLEAPPPDYPVC  579



>ref|XP_002312186.2| laccase family protein [Populus trichocarpa]
 gb|EEE89553.2| laccase family protein [Populus trichocarpa]
Length=574

 Score =   384 bits (985),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 200/313 (64%), Positives = 238/313 (76%), Gaps = 7/313 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VLI+ +Q PGRYYMAA AY +AQ APFDNTT TA+LEY +    A  +  
Sbjct  266   IMLGPGQTTDVLISGDQLPGRYYMAARAYQSAQNAPFDNTTTTAILEYKSVLCPAKCTKK  325

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
               +P LPA NDTATVTAF+   RS     + T     I+ +LFFT+GLG  NC       
Sbjct  326   PFMPPLPAYNDTATVTAFSRSFRSPRKVEVPTD----IDENLFFTIGLGLNNCPKNFRAR  381

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRA  684
             RCQGPNGTRF ASMNNVSFV P +AS+L AY   IPG++TTDFP+ P V+F+YTGNV R+
Sbjct  382   RCQGPNGTRFTASMNNVSFVFPSKASLLQAYKQKIPGVFTTDFPAKPQVKFDYTGNVSRS  441

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             L+QP  GTK+YK+K+GS VQIVLQDT I + E+HPIHLHGY FYI+ +GFGNFNP TD +
Sbjct  442   LFQPARGTKLYKLKYGSRVQIVLQDTSIVTPENHPIHLHGYDFYIIAEGFGNFNPKTDKS  501

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FNL+DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVE GI   
Sbjct  502   KFNLVDPPMRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEEGIGIL  561

Query  323   ETVppppPDLPRC  285
             ++V PPP DLP C
Sbjct  562   QSVEPPPADLPIC  574



>ref|XP_003615861.1| Laccase-like multicopper oxidase [Medicago truncatula]
 gb|AES98819.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=560

 Score =   383 bits (983),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 200/312 (64%), Positives = 240/312 (77%), Gaps = 11/312 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +M+GPGQT NVL+TA+Q PGRYYMAA AY TA  A FDNTT TA+LEY     S      
Sbjct  258   LMIGPGQTINVLVTADQPPGRYYMAARAYQTAMNAAFDNTTTTAILEYRNRPPSR-----  312

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--GPR  861
              +LP LP  NDTAT TAFTS++R L    +       ++ SL FTVGLG +NC     PR
Sbjct  313   PILPVLPFFNDTATSTAFTSRIRGLSKIKVFQN----VDVSLLFTVGLGLINCTNPNSPR  368

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPNGTRFAAS+NN SFVLP+  S++ AYYN +PGI+TTDFP VPP+QFNYTGNVPR L
Sbjct  369   CQGPNGTRFAASINNNSFVLPRTTSLMQAYYNGVPGIFTTDFPPVPPIQFNYTGNVPRGL  428

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             W PR GTK++K+K+GS+VQIVLQDT I + EDHP+H+HG+HF++VG GFGNFNP TDPA+
Sbjct  429   WTPRKGTKLFKLKYGSNVQIVLQDTSIVTVEDHPMHVHGFHFFVVGSGFGNFNPRTDPAT  488

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL+DPP+RNTI  P GGW AIRF ADNPG+W +HCHIDSHL WGL  + LVENG+   +
Sbjct  489   FNLVDPPVRNTIGTPPGGWVAIRFKADNPGIWFLHCHIDSHLNWGLGTALLVENGVGPLQ  548

Query  320   TVppppPDLPRC  285
             +V PPPPDLP+C
Sbjct  549   SVIPPPPDLPQC  560



>ref|XP_002273875.2| PREDICTED: laccase-12 [Vitis vinifera]
 emb|CBI25418.3| unnamed protein product [Vitis vinifera]
Length=577

 Score =   384 bits (985),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 200/315 (63%), Positives = 238/315 (76%), Gaps = 9/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleytttt--ssasyS  1041
             IMLGPGQTT+VLIT +Q P RYYMAA AY +AQGAPFDNTT TA+LEY +    +    S
Sbjct  267   IMLGPGQTTDVLITGDQPPARYYMAARAYQSAQGAPFDNTTTTAILEYKSAPCPAKKGVS  326

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP---  870
                + P LPA NDTATVTAF+   RS     + T     I+ SLFFTVGLG   C P   
Sbjct  327   TTPVFPSLPAFNDTATVTAFSKSFRSPAKVEVPTD----IDESLFFTVGLGLNRCPPKFK  382

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
               +CQGPNGTRF ASMNNVSFVLP   S+L A+   IPG++TTD+P+ PPV+F+YTGNV 
Sbjct  383   SSQCQGPNGTRFTASMNNVSFVLPSNFSLLQAHQQGIPGVFTTDYPAAPPVKFDYTGNVS  442

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R+LWQP  GTK+YK+K+GS VQ+VLQ T IF+ E+HPIHLHGY FYI+ +GFGNFNP TD
Sbjct  443   RSLWQPVPGTKLYKLKYGSRVQVVLQGTSIFTAENHPIHLHGYDFYIIAEGFGNFNPSTD  502

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
              + FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVENG+ 
Sbjct  503   TSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGVG  562

Query  329   EWETVppppPDLPRC  285
               +++  PP DLP C
Sbjct  563   ALQSIETPPADLPLC  577



>ref|XP_002319955.1| laccase family protein [Populus trichocarpa]
 gb|EEE95878.1| laccase family protein [Populus trichocarpa]
Length=576

 Score =   383 bits (983),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 201/314 (64%), Positives = 238/314 (76%), Gaps = 9/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+ PGQTT+VL+TA+Q PG YYMAA AY +A  APFDNTT TA+LEY T   +A     
Sbjct  268   IMIAPGQTTDVLLTADQTPGHYYMAARAYNSAN-APFDNTTTTAILEYKTAPRNAKKGKQ  326

Query  1034  A--LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--G  867
             +  + PRLP  NDT +  AFTS+LRS     +       I+ +LFFTVGLG +NC     
Sbjct  327   STPIFPRLPGFNDTNSAIAFTSRLRSPSKVKVPLQ----IDENLFFTVGLGLINCTNPNS  382

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
             PRCQGPNGTRFAAS+NN+SFVLP+R S++ AYY   PGI+TTDFP VPPV+F+YTGNV R
Sbjct  383   PRCQGPNGTRFAASINNMSFVLPKRNSLMQAYYQGQPGIFTTDFPPVPPVKFDYTGNVSR  442

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              LWQP   TK+YK+KFG+ VQIVLQDT I + EDHP+HLHGYHF ++G GFGNFNP TDP
Sbjct  443   GLWQPVKSTKLYKLKFGAKVQIVLQDTSIVTVEDHPMHLHGYHFAVIGSGFGNFNPQTDP  502

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNLIDPP RNTI  P GGW AIRF ADNPG+W MHCH+DSHL WGL M+FLVENG+ +
Sbjct  503   ARFNLIDPPYRNTIGTPPGGWVAIRFEADNPGIWFMHCHLDSHLNWGLGMAFLVENGVGK  562

Query  326   WETVppppPDLPRC  285
              ++V PPP DLPRC
Sbjct  563   LQSVQPPPLDLPRC  576



>ref|XP_006410143.1| hypothetical protein EUTSA_v10016445mg [Eutrema salsugineum]
 gb|ESQ51596.1| hypothetical protein EUTSA_v10016445mg [Eutrema salsugineum]
Length=570

 Score =   382 bits (982),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 204/315 (65%), Positives = 234/315 (74%), Gaps = 10/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTNVL+TANQRPGRYYMAA AY +A  APFDNTT TA+LEY    +      G
Sbjct  261   IMIGPGQTTNVLLTANQRPGRYYMAARAYNSAN-APFDNTTTTAILEYVNAPTRRGRGRG  319

Query  1034  AL---LPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--  870
              +    P LP  NDTAT TAFT++LR      +       ++ +LF TVGLG +NC    
Sbjct  320   QIAPVFPVLPGFNDTATATAFTNRLRYWKRAPVPLQ----VDDNLFLTVGLGLINCTNPN  375

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
              PRCQGPNGTRFAAS+NN SFVLP+R SI+ AYY  +PGI+TTDFP  PPVQF+YTGNV 
Sbjct  376   SPRCQGPNGTRFAASINNQSFVLPRRNSIMQAYYQGMPGIFTTDFPPFPPVQFDYTGNVS  435

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R LWQP  GTKVYK+K+ ++VQIV QDT I + E+HP+HLHGY FY+VG GFGNFNP TD
Sbjct  436   RGLWQPVKGTKVYKLKYKANVQIVFQDTSIVTPENHPMHLHGYQFYVVGSGFGNFNPRTD  495

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
             PA FNL DPP RNTI  P GGW AIRFVADNPG W MHCHIDSHL WGLAM FLVENG  
Sbjct  496   PARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVFLVENGRG  555

Query  329   EWETVppppPDLPRC  285
             + ++V  PP DLPRC
Sbjct  556   QLQSVQAPPLDLPRC  570



>ref|XP_011015318.1| PREDICTED: laccase-12-like [Populus euphratica]
 ref|XP_011035866.1| PREDICTED: laccase-12-like [Populus euphratica]
Length=583

 Score =   382 bits (981),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/313 (63%), Positives = 240/313 (77%), Gaps = 7/313 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VLI+ +Q PGRYY+AA AY + Q APFDNTTATA+LEY +    A  +  
Sbjct  275   IMLGPGQTTDVLISGDQLPGRYYIAARAYQSTQNAPFDNTTATAILEYKSALCPAKCTTK  334

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
              ++PRLPA NDTATVTAFT  LRS     + T     I+ +LFFT+GLG  NC       
Sbjct  335   PVMPRLPAYNDTATVTAFTRSLRSPRKVDVPTD----IDENLFFTIGLGLNNCPKNFRAR  390

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRA  684
             RCQGPNGTRF AS+NNVSFV P   ++L AY   +PGIYTTDFP+ PPV+F+YTGNV R+
Sbjct  391   RCQGPNGTRFTASINNVSFVFPSNIALLQAYRQKVPGIYTTDFPAKPPVKFDYTGNVSRS  450

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             L+QP  GTK+YK+K+GS VQIVLQDT I + E+HP+HLHGY FY++ +GFGNFNP T  +
Sbjct  451   LFQPVRGTKLYKLKYGSRVQIVLQDTSIVTPENHPMHLHGYDFYVIAEGFGNFNPKTHKS  510

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FNL+DPP+RNT+ VP  GWA IRFVADNPGVW+MHCH+D H+TWGLAM+FLVE+GI E 
Sbjct  511   KFNLVDPPMRNTVAVPTNGWAVIRFVADNPGVWIMHCHLDVHITWGLAMAFLVEDGIGEL  570

Query  323   ETVppppPDLPRC  285
             ++V PPP DLP C
Sbjct  571   QSVEPPPADLPIC  583



>gb|KHG22243.1| Laccase-5 -like protein [Gossypium arboreum]
Length=483

 Score =   379 bits (972),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 198/316 (63%), Positives = 239/316 (76%), Gaps = 10/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt---tssasy  1044
             IMLGPGQTT+VLI  NQ P RYYMAA AY +AQ APFDNTT TA+LEY +          
Sbjct  172   IMLGPGQTTDVLIQGNQLPARYYMAARAYQSAQNAPFDNTTTTAILEYKSAPCPAKKGIN  231

Query  1043  SPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---I  873
              P  ++P LPA NDT TVT+F+  LRS     + T     I+ SLFFTVGLG  NC    
Sbjct  232   GPKPIMPSLPAYNDTNTVTSFSQSLRSPRKVEVPTE----IDESLFFTVGLGLNNCPPNF  287

Query  872   PGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
             P  RCQGPNGTRF ASMNNVSFV PQ  S+L A+ + IPG++TTDFP+ PP++F+YTGNV
Sbjct  288   PSSRCQGPNGTRFTASMNNVSFVFPQNFSLLQAHQHGIPGVFTTDFPATPPLKFDYTGNV  347

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              ++L+QP  GTK+YK+K+GS VQIVLQDT I + E+HPIHLHGY FYIV +GFGNF+P T
Sbjct  348   SQSLYQPVPGTKLYKLKYGSKVQIVLQDTSIVTPENHPIHLHGYDFYIVAEGFGNFDPKT  407

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D + FNL+DPP RNT+ VPV GWA IRFVADNPGVW+MHCH+D H+TWGLAM+F+VENG+
Sbjct  408   DTSKFNLVDPPQRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDVHITWGLAMAFVVENGL  467

Query  332   TEWETVppppPDLPRC  285
              E +++  PPPDLP C
Sbjct  468   GELQSLQAPPPDLPIC  483



>ref|XP_010457861.1| PREDICTED: laccase-3-like [Camelina sativa]
Length=571

 Score =   381 bits (979),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 205/312 (66%), Positives = 232/312 (74%), Gaps = 8/312 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTTNVLITANQRPGRYYMAA AY +A  APFDNTT TA+LEY    S       
Sbjct  266   VMLGPGQTTNVLITANQRPGRYYMAARAYNSAN-APFDNTTTTAILEYVNAPSGRGQI-T  323

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--GPR  861
              + P LP  NDTAT TAF ++LR      +       I+ +LFF VGLG +NC     PR
Sbjct  324   PVFPVLPGFNDTATATAFVNRLRYYKRAPVPLK----IDENLFFAVGLGLINCTNQNSPR  379

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPNGTRFAASMNNVSFVLP+  S++ AYY  IPGI T DFP VPPVQF+YTGNV R L
Sbjct  380   CQGPNGTRFAASMNNVSFVLPRTNSVMQAYYQGIPGIITADFPPVPPVQFDYTGNVSRGL  439

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             WQP   TK YK+K+ ++VQIVLQDT I + E+HP+HLHGY FY+VG GFGNF+P  DPAS
Sbjct  440   WQPVKATKAYKLKYKANVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFGNFDPKRDPAS  499

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL DPP RNTI  P GGW AIRFVADNPG W MHCHIDSHL WGLAM FLVENG+ + +
Sbjct  500   FNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVFLVENGVGQLQ  559

Query  320   TVppppPDLPRC  285
             +V PPP DLPRC
Sbjct  560   SVQPPPLDLPRC  571



>gb|KFK21959.1| hypothetical protein AALP_AAs48252U000800 [Arabis alpina]
Length=570

 Score =   380 bits (976),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 202/315 (64%), Positives = 233/315 (74%), Gaps = 10/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTNVL+TANQRPGRYYMAA AY +A  APFDNTT TA+ EY    +      G
Sbjct  261   IMVGPGQTTNVLLTANQRPGRYYMAARAYNSA-NAPFDNTTTTAIFEYINAPTRRGRGRG  319

Query  1034  AL---LPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--  870
              +    P LP  NDTAT TA+ ++LR      +       I+ +LFFTVGLG  NC    
Sbjct  320   QIAPVFPVLPGFNDTATATAYVNRLRYWKQAPVPLQ----IDENLFFTVGLGLTNCSNPN  375

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
              PRCQGPNGTRFAAS+NN SFVLP+R S++ AYY  +PGI+TTDFP VPPVQF+YTGNV 
Sbjct  376   SPRCQGPNGTRFAASINNQSFVLPRRNSVMQAYYQGMPGIFTTDFPPVPPVQFDYTGNVS  435

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R LWQP  GTK YK+K+ ++VQIVLQDT I + E+HP+HLHGY FY+VG GFGNFNP TD
Sbjct  436   RGLWQPVKGTKAYKLKYNANVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFGNFNPRTD  495

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
             PA FNL DPP +NTI  P GGW AIRFVADNPG W MHCHIDSHL WGLAM FLVENG  
Sbjct  496   PARFNLFDPPEKNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVFLVENGRG  555

Query  329   EWETVppppPDLPRC  285
             + ++V  PP DLPRC
Sbjct  556   QLQSVQAPPLDLPRC  570



>ref|XP_011021001.1| PREDICTED: laccase-13-like [Populus euphratica]
Length=576

 Score =   380 bits (977),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 201/314 (64%), Positives = 238/314 (76%), Gaps = 9/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+ PGQTT+VL+TA+Q PG+YYMAA AY +A  APFDNTT TA+LEY T   +A     
Sbjct  268   IMISPGQTTDVLLTADQTPGQYYMAAHAYNSAN-APFDNTTTTAILEYKTAPCNAKKGKQ  326

Query  1034  A--LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--G  867
             +  + PRLP  NDT +  AFTS LRS     +       I+ +LFFTVGLG +NC     
Sbjct  327   STPIFPRLPGFNDTNSAIAFTSGLRSPSKVKVPLQ----IDENLFFTVGLGLINCPNPNS  382

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
             PRCQGPNGTRFAAS+NNVSFVLP+R S++ AYY   PGI+TTDFP VPPV+F+YTGNV R
Sbjct  383   PRCQGPNGTRFAASINNVSFVLPKRNSLMQAYYQGQPGIFTTDFPPVPPVKFDYTGNVSR  442

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              LWQP   TK+YK+KFG+ VQIV QDT I + EDHP+HLHGYHF ++G GFGNFNP TDP
Sbjct  443   GLWQPVKATKLYKLKFGAKVQIVFQDTSIVTVEDHPMHLHGYHFAVIGSGFGNFNPQTDP  502

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNLIDPP RNTI  P GGW AIRF ADNPG+WL+HCH+DSHL WGL M+FLVENG+ +
Sbjct  503   ARFNLIDPPYRNTIGAPPGGWVAIRFEADNPGIWLLHCHLDSHLNWGLGMAFLVENGVGK  562

Query  326   WETVppppPDLPRC  285
              ++V PPP DLPRC
Sbjct  563   LQSVQPPPLDLPRC  576



>ref|XP_010475452.1| PREDICTED: laccase-3-like [Camelina sativa]
Length=568

 Score =   380 bits (976),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 231/312 (74%), Gaps = 8/312 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTTNVLITANQRPGRYYMAA AY +A  APFDNTT TA+LEY            
Sbjct  263   VMLGPGQTTNVLITANQRPGRYYMAARAYNSAN-APFDNTTTTAILEYVNAPRGRGQV-T  320

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--GPR  861
              + P LP  NDTAT TAF ++LR      +       I+ +LFF VGLG +NC     PR
Sbjct  321   PVFPVLPGFNDTATATAFVNRLRYWKRAPVPLQ----IDENLFFAVGLGLINCTNPNSPR  376

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPNGTRFAASMNNVSFVLP+  S++ AYY  IPGI T DFP VPPVQF+YTGNV R L
Sbjct  377   CQGPNGTRFAASMNNVSFVLPRTNSVMQAYYQGIPGIITADFPPVPPVQFDYTGNVSRGL  436

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             WQP   TK YK+K+ ++VQIVLQDT I + E+HP+HLHGY FY+VG GFGNF+P  DPAS
Sbjct  437   WQPVKATKAYKLKYKANVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFGNFDPKRDPAS  496

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL DPP RNTI  P GGW AIRFVADNPG W MHCHIDSHL WGLAM FLVENG+ + +
Sbjct  497   FNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVFLVENGVGQLQ  556

Query  320   TVppppPDLPRC  285
             +V PPP DLPRC
Sbjct  557   SVQPPPLDLPRC  568



>gb|KDP44695.1| hypothetical protein JCGZ_01195 [Jatropha curcas]
Length=576

 Score =   380 bits (976),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 200/314 (64%), Positives = 237/314 (75%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VLI+ +Q P RYY+AA AY +AQ APFDNTT TA+LEY +    A     
Sbjct  267   IMLGPGQTTDVLISGDQPPARYYLAARAYQSAQNAPFDNTTTTAILEYNSAPCPAKCLTS  326

Query  1034  A-LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPG  867
               ++P+LPA NDTAT TAF+   +SL    + T     I+HSLFFTVGLG  NC      
Sbjct  327   KPIMPQLPAYNDTATATAFSQSQKSLRKVEVPTK----IDHSLFFTVGLGLNNCPKNFRA  382

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
              RCQGPNGTRF ASMNNVSFV P   S+L AY  NIPG++TTDFP+ PPV F++TGNV R
Sbjct  383   RRCQGPNGTRFTASMNNVSFVFPSSFSLLQAYKQNIPGVFTTDFPARPPVNFDFTGNVSR  442

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTK+YK+K+G SVQIVLQDT I + E+HPIHLHGY FYIV +GFGNFNP TD 
Sbjct  443   SLWQPVPGTKLYKLKYGESVQIVLQDTSIVTPENHPIHLHGYDFYIVAEGFGNFNPKTDR  502

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPP+RNT  VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+F+VE+G+ E
Sbjct  503   AKFNLVDPPMRNTAAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFIVEDGVGE  562

Query  326   WETVppppPDLPRC  285
              + +  PP DLP C
Sbjct  563   LQKLESPPLDLPIC  576



>ref|XP_009343306.1| PREDICTED: laccase-3-like [Pyrus x bretschneideri]
Length=567

 Score =   380 bits (975),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 208/312 (67%), Positives = 243/312 (78%), Gaps = 7/312 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+ L+TA+QRP RYYMAA AY TAQ APFDNTT TA+LEY    SS      
Sbjct  261   IMLGPGQTTDALLTADQRPARYYMAARAYQTAQNAPFDNTTTTAILEYKNAASSNQGL-A  319

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC-IP-GPR  861
              + P LPA NDTAT TA+T+Q++S     + T     I+  LFFTVGLG  NC +P  PR
Sbjct  320   PVFPTLPAYNDTATATAYTAQVKSPSQVRVPTQ----IDEYLFFTVGLGLYNCTVPNSPR  375

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPN TRFAASMNNVSFVLP+  S++ A Y  +PG++TTDFP +PPVQFNYTGNVPR L
Sbjct  376   CQGPNNTRFAASMNNVSFVLPRTNSLMQAAYYGVPGVFTTDFPPIPPVQFNYTGNVPRGL  435

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             W PR GTK+Y++K+G++VQIVLQDT I + E+HP+HLHGYHFY++G GFGN+NP TDPA 
Sbjct  436   WSPRRGTKLYRLKYGANVQIVLQDTNIVTIEEHPMHLHGYHFYVIGSGFGNYNPSTDPAR  495

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL DPP RNTI  P GGW AIRF ADNPGVWLMHCH+DSHL  GLAM+FLVENGI   +
Sbjct  496   FNLFDPPQRNTIGTPPGGWVAIRFKADNPGVWLMHCHLDSHLFLGLAMAFLVENGIEPLQ  555

Query  320   TVppppPDLPRC  285
             +V PPPPDLPRC
Sbjct  556   SVIPPPPDLPRC  567



>ref|XP_004490661.1| PREDICTED: laccase-3-like [Cicer arietinum]
Length=573

 Score =   379 bits (974),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 196/314 (62%), Positives = 240/314 (76%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +M+GPGQT NVL+TA+Q PGRYYMAA AY TA  A FDNTT T++LEY +   +      
Sbjct  264   LMIGPGQTINVLVTADQPPGRYYMAARAYQTAMNATFDNTTTTSILEYKSAACNNRNRQC  323

Query  1034  A--LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--G  867
             +  +LP LPA NDT T TAFTS++R L    +        + SL FTVGLG +NC     
Sbjct  324   SRPILPILPAFNDTPTSTAFTSRIRGLSKVKVFQN----FDVSLLFTVGLGLINCTNPNS  379

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
             PRCQGPNGTRFAAS+NN SFVLP+  S++ AYY  +PG++TTDFP VPP+QFNYTGNVPR
Sbjct  380   PRCQGPNGTRFAASINNNSFVLPRTTSLMQAYYQGVPGVFTTDFPPVPPIQFNYTGNVPR  439

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              LW PR GT+++++K+GS VQIVLQDT I +TEDHP+H+HG+HF++VG GFGNFNP TDP
Sbjct  440   GLWTPRKGTRLFRLKYGSYVQIVLQDTSIVTTEDHPMHVHGFHFFVVGSGFGNFNPRTDP  499

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
               FNL+DPP+RNTI  P GGW AIRFVADNPG+W +HCHIDSHL WGLA + LVENG+  
Sbjct  500   FRFNLVDPPVRNTIGTPPGGWVAIRFVADNPGIWFLHCHIDSHLNWGLATALLVENGVGP  559

Query  326   WETVppppPDLPRC  285
              ++V PPPPDLP+C
Sbjct  560   LQSVIPPPPDLPQC  573



>ref|XP_010685887.1| PREDICTED: laccase-3-like [Beta vulgaris subsp. vulgaris]
Length=563

 Score =   379 bits (973),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 197/311 (63%), Positives = 238/311 (77%), Gaps = 10/311 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +M+GPGQTTNVLITANQ PGRYY+AA+AY++A G  FDNTT TA+LEYT+   S      
Sbjct  262   VMIGPGQTTNVLITANQPPGRYYIAATAYSSAPGVAFDNTTTTAILEYTSRRFSR-----  316

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCI-PGPRC  858
              +LP+LPA NDT T  +FT+Q RS+    +       I+ +LFFT+ LG +NC  P  RC
Sbjct  317   PVLPQLPAWNDTNTANSFTAQFRSISRGKVPLQ----IDQNLFFTINLGSINCSRPSFRC  372

Query  857   QGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRALW  678
             Q PN TRF ASMNNVSFVLP+R SIL A Y N PG++TTDFP VPP+QF+YTGNV R LW
Sbjct  373   QAPNNTRFTASMNNVSFVLPRRNSILQAMYQNTPGVFTTDFPPVPPLQFDYTGNVSRGLW  432

Query  677   QPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASF  498
              P  GTK+YK+KFGS VQI+LQ+T I + EDHP+HLHGYHF++VG G GNFNP TDPA F
Sbjct  433   TPTRGTKLYKLKFGSHVQIILQNTNIVTVEDHPMHLHGYHFFVVGTGKGNFNPQTDPARF  492

Query  497   NLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWET  318
             NL+DPP+RNT+    GGW AIRF+ADNPGVWLMHCH+D H+ WGLAM FLVENG+ E +T
Sbjct  493   NLVDPPVRNTVGTTPGGWVAIRFIADNPGVWLMHCHLDVHIGWGLAMVFLVENGVGELQT  552

Query  317   VppppPDLPRC  285
             +  PP DLP+C
Sbjct  553   LEAPPRDLPQC  563



>ref|XP_007146836.1| hypothetical protein PHAVU_006G074000g [Phaseolus vulgaris]
 gb|ESW18830.1| hypothetical protein PHAVU_006G074000g [Phaseolus vulgaris]
Length=573

 Score =   379 bits (973),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/312 (63%), Positives = 240/312 (77%), Gaps = 6/312 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +M+GPGQT NVL+TA+Q  G YYMAA AY +A  APFDNTT TA+LEY +T       P 
Sbjct  266   LMIGPGQTFNVLVTADQPQGHYYMAARAYESAVNAPFDNTTTTAILEYRSTRRRNQNRPR  325

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--GPR  861
              +LP LPA NDTAT TAFT+++R L    + T     ++ +L+F VGLG +NC     PR
Sbjct  326   PVLPTLPAFNDTATSTAFTARIRGLAGVKVFTK----VDVNLYFIVGLGLINCTDPNSPR  381

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPNGTRF ASMNN+SFVLP+  S++ AYY  IPG++TTDFP +PP+QF+YTGNVPR L
Sbjct  382   CQGPNGTRFTASMNNISFVLPKTTSLMQAYYEGIPGVFTTDFPPIPPLQFDYTGNVPRGL  441

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             W P  GTK+YKVK+GS VQIVLQDT I +TE+HP+H+HG+HF++VG GFGNFNP TDP  
Sbjct  442   WTPSRGTKLYKVKYGSRVQIVLQDTSIVTTEEHPMHVHGFHFFVVGSGFGNFNPATDPLK  501

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL+DPP+RNTI  P GGW AIRFVADNPG+W +HCHIDSH  WGL M+ LVENG+   +
Sbjct  502   FNLVDPPVRNTIGTPPGGWVAIRFVADNPGIWFIHCHIDSHQNWGLGMALLVENGVGLSQ  561

Query  320   TVppppPDLPRC  285
             +V PPPPDLP+C
Sbjct  562   SVIPPPPDLPQC  573



>emb|CDP13965.1| unnamed protein product [Coffea canephora]
Length=571

 Score =   379 bits (972),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 234/314 (75%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             +MLGPGQTT+VLIT +Q P RYY+AA AYA+AQGAPFDNTT TA+LEY T    A     
Sbjct  262   LMLGPGQTTDVLITTDQPPARYYIAARAYASAQGAPFDNTTTTAILEYKTAPCPAKGVSI  321

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGP--  864
               +LP LPA NDTAT TAF+   RS     + T     I+ SLFFTVGLG  NC PG   
Sbjct  322   KPILPSLPAFNDTATATAFSKSFRSPRKVPVPTD----IDESLFFTVGLGLQNCPPGASS  377

Query  863   -RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRF ASMNNVSFVLP   S+L ++   IPG++TTDFP+ PPVQF+YTGNV R
Sbjct  378   QNCQGPNGTRFTASMNNVSFVLPSSFSLLQSHQQGIPGVFTTDFPAAPPVQFDYTGNVSR  437

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP   TKVYK+K+G+ VQ+VLQ T IF+ E+HPIHLHGY FY++ +GFGNFNP TD 
Sbjct  438   SLWQPVRATKVYKLKYGARVQLVLQGTSIFTAENHPIHLHGYDFYLIAEGFGNFNPKTDT  497

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPPLRNT  VPV GW+ IRFVADNPGVWL+HCH+D H+TWGLAM+F+VE+G   
Sbjct  498   AKFNLVDPPLRNTASVPVQGWSVIRFVADNPGVWLLHCHLDVHITWGLAMAFIVEDGAGL  557

Query  326   WETVppppPDLPRC  285
              E +   P DLP C
Sbjct  558   LEKLEEAPADLPVC  571



>ref|XP_009354572.1| PREDICTED: laccase-3-like [Pyrus x bretschneideri]
Length=569

 Score =   378 bits (971),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 203/313 (65%), Positives = 239/313 (76%), Gaps = 7/313 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+TA+Q P RYY+AA AY TAQ APFDNTT TA+LEY     S +  P 
Sbjct  261   IMLGPGQTTDVLVTADQPPARYYVAARAYQTAQNAPFDNTTTTAILEYKNAACSKNGKPL  320

Query  1034  ALLPRLPAN-NDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC-IP-GP  864
             A L       NDTAT TAFT+QL+S     +       I+ +L+F VGLG  NC +P  P
Sbjct  321   APLLPRLPAYNDTATSTAFTAQLKSPSQVKVPMQ----IDENLYFIVGLGLNNCTVPNSP  376

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRA  684
             RCQGPN TRFAASMNNVSFV P+  S++ A Y+ +PG++TTDFP VPPVQFNYTGNVPR 
Sbjct  377   RCQGPNNTRFAASMNNVSFVFPRSTSLMQAAYSGVPGVFTTDFPPVPPVQFNYTGNVPRG  436

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             LW PR GTK+YK+K+ ++VQIVLQDT I +TEDHP+HLHGYHFY++G GFGN+NP TDPA
Sbjct  437   LWSPRRGTKLYKLKYDANVQIVLQDTSIVTTEDHPMHLHGYHFYVIGSGFGNYNPRTDPA  496

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FNL+DPP RNTI  P GGW AIRF ADNPGVWLMHCH+D+HL  GLAM+FLVENG    
Sbjct  497   KFNLVDPPQRNTIGTPPGGWVAIRFKADNPGVWLMHCHLDAHLFLGLAMAFLVENGNGPL  556

Query  323   ETVppppPDLPRC  285
             ++V PPP DLPRC
Sbjct  557   QSVIPPPADLPRC  569



>ref|XP_008355071.1| PREDICTED: laccase-3-like [Malus domestica]
Length=568

 Score =   378 bits (970),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 205/313 (65%), Positives = 239/313 (76%), Gaps = 7/313 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+TANQ P RYY+AA AY TAQ APFDNTT TA+LEY     S +  P 
Sbjct  260   IMLGPGQTTDVLVTANQPPARYYVAARAYQTAQNAPFDNTTTTAILEYKNAACSKNGKPL  319

Query  1034  ALLPRLPAN-NDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC-IP-GP  864
             A L       NDTAT TAFT+QL+S     + T     I+ +L+F VGLG  NC +P  P
Sbjct  320   APLLPRLPAYNDTATSTAFTAQLKSPSQVKVPTQ----IDENLYFIVGLGLNNCTVPNSP  375

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRA  684
             RCQGPN TRFAASMNNVSFV P+  S++ A Y+ +PG++TTDFP VPPVQFNYTGNVPR 
Sbjct  376   RCQGPNNTRFAASMNNVSFVFPRSTSLMQAAYSGVPGVFTTDFPPVPPVQFNYTGNVPRG  435

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             LW PR GTK+YK+K+G++VQIVLQDT I +TEDHP+HLHGYHFY++G GFGN+NP TDPA
Sbjct  436   LWSPRRGTKLYKLKYGANVQIVLQDTSIVTTEDHPMHLHGYHFYVIGSGFGNYNPRTDPA  495

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FNL DPP RNTI  P GGW AIRF ADNPGVWLMHCH+D+HL  GLAM+FLV NG    
Sbjct  496   KFNLXDPPQRNTIGTPPGGWVAIRFKADNPGVWLMHCHLDAHLFLGLAMAFLVXNGNGPL  555

Query  323   ETVppppPDLPRC  285
             ++V PPP DLPRC
Sbjct  556   QSVIPPPADLPRC  568



>ref|XP_010264533.1| PREDICTED: laccase-12 [Nelumbo nucifera]
Length=578

 Score =   378 bits (970),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 204/314 (65%), Positives = 237/314 (75%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             +MLGPGQTT+VLITANQ PGRYY+AA AY +AQGA FDNTT TA+LEY +          
Sbjct  269   LMLGPGQTTDVLITANQPPGRYYIAARAYQSAQGAAFDNTTTTAILEYKSAPCPKKGLTL  328

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPG---  867
               + P LPA NDT T TAF ++ RS     + T     I+ +LFFTVGLG  NC PG   
Sbjct  329   QPVFPSLPAYNDTTTATAFAAKFRSPSKVDIPTD----IDENLFFTVGLGLFNCPPGFSQ  384

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
              RCQGPNGTRF ASMNNVS VLP   SIL AY   +PG+YTTDFP VPPVQF+YTGNV R
Sbjct  385   SRCQGPNGTRFTASMNNVSLVLPSSFSILQAYQQGVPGVYTTDFPPVPPVQFDYTGNVSR  444

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             ALWQP  GTK+YK+K+GS VQ+VLQDT I + E+HPIH+HGY FYI+ +GFGNFNP TD 
Sbjct  445   ALWQPISGTKLYKLKYGSKVQLVLQDTSIVTAENHPIHIHGYDFYIIAEGFGNFNPQTDT  504

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVENG  E
Sbjct  505   AKFNLVDPPMRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGEGE  564

Query  326   WETVppppPDLPRC  285
              +++  PP DLP C
Sbjct  565   LQSLQSPPADLPPC  578



>ref|XP_008354603.1| PREDICTED: laccase-3-like [Malus domestica]
Length=568

 Score =   377 bits (969),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 205/313 (65%), Positives = 239/313 (76%), Gaps = 7/313 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+TANQ P RYY+AA AY TAQ APFDNTT TA+LEY     S +  P 
Sbjct  260   IMLGPGQTTDVLVTANQPPARYYVAARAYQTAQNAPFDNTTTTAILEYKNAACSKNGKPL  319

Query  1034  ALLPRLPAN-NDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC-IP-GP  864
             A L       NDTAT TAFT+QL+S     + T     I+ +L+F VGLG  NC +P  P
Sbjct  320   APLLPRLPAYNDTATSTAFTAQLKSPSQVKVPTQ----IDENLYFIVGLGLNNCTVPNSP  375

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRA  684
             RCQGPN TRFAASMNNVSFV P+  S++ A Y+ +PG++TTDFP VPPVQFNYTGNVPR 
Sbjct  376   RCQGPNNTRFAASMNNVSFVFPRSTSLMQAAYSGVPGVFTTDFPPVPPVQFNYTGNVPRG  435

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             LW PR GTK+YK+K+G++VQIVLQDT I +TEDHP+HLHGYHFY++G GFGN+NP TDPA
Sbjct  436   LWSPRRGTKLYKLKYGANVQIVLQDTSIVTTEDHPMHLHGYHFYVIGSGFGNYNPRTDPA  495

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FNL DPP RNTI  P GGW AIRF ADNPGVWLMHCH+D+HL  GLAM+FLV NG    
Sbjct  496   KFNLXDPPQRNTIGTPPGGWVAIRFKADNPGVWLMHCHLDAHLFLGLAMAFLVXNGNGPL  555

Query  323   ETVppppPDLPRC  285
             ++V PPP DLPRC
Sbjct  556   QSVIPPPADLPRC  568



>gb|KHN02112.1| Laccase-3 [Glycine soja]
Length=573

 Score =   377 bits (969),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 194/312 (62%), Positives = 238/312 (76%), Gaps = 6/312 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +M+GPGQT NV++TA+Q PG YY+AA AY +A  APFDNTT TA+LEY +T         
Sbjct  266   LMIGPGQTFNVIVTADQPPGFYYVAAHAYESAVNAPFDNTTTTAILEYRSTRRRNQNRSR  325

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--GPR  861
              +LP LPA NDT T TAFT+++R L    +       ++ +L+F VGLG +NC     PR
Sbjct  326   PVLPALPAFNDTPTATAFTARIRGLTRVRVFKK----VDVNLYFIVGLGLINCTNPNSPR  381

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPNGTRF ASMNNVSFVLP   S++ AYY  IPG++TTDFP VPP+QF+YTGNVP+ L
Sbjct  382   CQGPNGTRFTASMNNVSFVLPSTTSLMQAYYEGIPGVFTTDFPPVPPLQFDYTGNVPQGL  441

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             W P  GTK+YKVK+GS VQIVLQDT I +TE+HP+H+HG+HF++VG GFGNFNP TDP  
Sbjct  442   WTPSRGTKLYKVKYGSKVQIVLQDTSIVTTEEHPMHVHGFHFFVVGSGFGNFNPATDPLK  501

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL+DPP+RNTI  P GGW AIRFVADNPG+W +HCHIDSHL WGL M+ LVENG+   +
Sbjct  502   FNLVDPPVRNTIGTPPGGWVAIRFVADNPGIWFVHCHIDSHLNWGLGMALLVENGVGLSQ  561

Query  320   TVppppPDLPRC  285
             +V PPPPDLP+C
Sbjct  562   SVLPPPPDLPQC  573



>ref|XP_003552931.1| PREDICTED: laccase-3-like [Glycine max]
Length=573

 Score =   377 bits (969),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 195/312 (63%), Positives = 237/312 (76%), Gaps = 6/312 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +M+GPGQT NV++TA+Q PG YYMAA AY +A  APFDNTT TA+LEY +T         
Sbjct  266   LMIGPGQTFNVIVTADQPPGFYYMAAHAYESAVNAPFDNTTTTAILEYRSTRRRNQNRSR  325

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--GPR  861
              +LP LPA NDT T TAFT+++R L    +       ++ +L+F VGLG +NC     PR
Sbjct  326   PVLPALPAFNDTPTATAFTARIRGLTRVRVFKK----VDVNLYFIVGLGLINCTNPNSPR  381

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPNGTRF ASMNNVSFVLP   S++ AYY  IPG++TTDFP VPP+QF+YTGNVP  L
Sbjct  382   CQGPNGTRFTASMNNVSFVLPSTTSLMQAYYEGIPGVFTTDFPPVPPLQFDYTGNVPPGL  441

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             W P  GTK+YKVK+GS VQIVLQDT I +TE+HP+H+HG+HF++VG GFGNFNP TDP  
Sbjct  442   WTPSRGTKLYKVKYGSKVQIVLQDTSIVTTEEHPMHVHGFHFFVVGSGFGNFNPATDPLK  501

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL+DPP+RNTI  P GGW AIRFVADNPG+W +HCHIDSHL WGL M+ LVENG+   +
Sbjct  502   FNLVDPPVRNTIGTPPGGWVAIRFVADNPGIWFVHCHIDSHLNWGLGMALLVENGVGLSQ  561

Query  320   TVppppPDLPRC  285
             +V PPPPDLP+C
Sbjct  562   SVLPPPPDLPQC  573



>ref|XP_004239957.1| PREDICTED: laccase-12-like [Solanum lycopersicum]
Length=574

 Score =   377 bits (968),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 200/314 (64%), Positives = 243/314 (77%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavle-yttttssasySP  1038
             +MLGPGQTT+VLI A+Q P RYYMAA AYA+AQGAPFDNTTATA+LE   ++ SS   + 
Sbjct  265   LMLGPGQTTDVLIKADQTPSRYYMAARAYASAQGAPFDNTTATAILEYKKSSCSSNCTTT  324

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPG  867
               + P LPA NDT T TAFT++ RS     + T     I+ +LF TVGLG  NC    P 
Sbjct  325   NPIFPLLPAYNDTTTATAFTTKFRSPRKVEVPTE----IDENLFITVGLGLENCPTGAPS  380

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRFAASMNN+SFVLP   S+L A++  IPG+++TDFPSVPPV+FNYTGNV R
Sbjct  381   SNCQGPNGTRFAASMNNISFVLPSNFSLLQAHHQRIPGVFSTDFPSVPPVKFNYTGNVSR  440

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTK+YK+K+G+ VQ+VLQ TGIF+ E+HPIHLHGY FYI+ +GFGNFNP TD 
Sbjct  441   SLWQPIRGTKLYKLKYGAKVQVVLQGTGIFTAENHPIHLHGYDFYIIAEGFGNFNPKTDT  500

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNLI+PPLRNT  VPV GW  IRF+ADNPGVW+MHCH+D H+TWGLAM+FLVENG++E
Sbjct  501   SKFNLINPPLRNTASVPVNGWTVIRFIADNPGVWIMHCHLDVHITWGLAMAFLVENGVSE  560

Query  326   WETVppppPDLPRC  285
              E++  PP D P C
Sbjct  561   LESLEAPPVDFPVC  574



>ref|XP_006303628.1| hypothetical protein CARUB_v10011512mg [Capsella rubella]
 gb|EOA36526.1| hypothetical protein CARUB_v10011512mg [Capsella rubella]
Length=574

 Score =   377 bits (968),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 232/312 (74%), Gaps = 8/312 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTTNVLITANQRPGRYY+AA AY +A  A FDNTT TA++EY    S       
Sbjct  269   VMLGPGQTTNVLITANQRPGRYYIAARAYNSANAA-FDNTTTTAIIEYVNAPSGQGQI-T  326

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--GPR  861
              + P LP  NDTAT TAF ++LR      +       I+ +LFF VGLG +NC     PR
Sbjct  327   PVFPVLPGFNDTATATAFVNRLRYWTRAPVPLE----IDENLFFAVGLGLINCANPNSPR  382

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPNGTRFAASMNNVSFVLP+  S++ AYY  IPGI T+DFP VPPVQF+YTGNV R L
Sbjct  383   CQGPNGTRFAASMNNVSFVLPRTNSVMQAYYQGIPGIITSDFPPVPPVQFDYTGNVSRGL  442

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             WQP   TK YK+K+ ++VQIVLQDT I + E+HP+HLHGY FY+VG GFGNF+P  DPAS
Sbjct  443   WQPVKATKAYKLKYKANVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFGNFDPKRDPAS  502

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL DPP RNTI  P GGW AIRFVADNPG W MHCHIDSHL WGLAM FLVENGI + +
Sbjct  503   FNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVFLVENGIGQLQ  562

Query  320   TVppppPDLPRC  285
             +V PPP DLPRC
Sbjct  563   SVQPPPLDLPRC  574



>ref|XP_010486989.1| PREDICTED: laccase-3-like [Camelina sativa]
Length=571

 Score =   377 bits (968),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 231/312 (74%), Gaps = 8/312 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTTNVLITANQRPGRYYMAA AY +A  APFDNTT TA+LEY    S       
Sbjct  266   VMLGPGQTTNVLITANQRPGRYYMAARAYNSAN-APFDNTTTTAILEYVNRPSGRGQI-T  323

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--GPR  861
              + P L   NDTAT TAF ++LR      +       I+ +LFF VGLG +NC     PR
Sbjct  324   PVFPVLAGFNDTATATAFFNRLRYYKRAPVPLQ----IDENLFFAVGLGLINCTNPNSPR  379

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPNGTRFAASMNNVSFVLP+  S++ AYY  IPGI T DFP VPPVQF+YTGNV R L
Sbjct  380   CQGPNGTRFAASMNNVSFVLPRTNSVMQAYYQGIPGIITADFPPVPPVQFDYTGNVSRGL  439

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             WQP   TK YK+K+ ++VQIVLQDT I + E+HP+HLHGY FY+VG GFGNF+P  DPAS
Sbjct  440   WQPVKATKAYKLKYKANVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFGNFDPKRDPAS  499

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL DPP RNTI  P GGW AIRFVADNPG W MHCHIDSHL WGLAM FLVENG+ + +
Sbjct  500   FNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVFLVENGVGQLQ  559

Query  320   TVppppPDLPRC  285
             +V PPP DLPRC
Sbjct  560   SVQPPPLDLPRC  571



>ref|XP_009391695.1| PREDICTED: laccase-3-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   377 bits (967),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 199/313 (64%), Positives = 240/313 (77%), Gaps = 7/313 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +ML PGQTT+VL+TA+Q  GRYYMAA AYA+A+G  FDNTT TA+LEYT +       PG
Sbjct  258   LMLAPGQTTDVLLTADQPAGRYYMAAHAYASARGVAFDNTTTTAILEYTNSGCPTKNRPG  317

Query  1034  AL--LPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR  861
              L   P LPA NDT T TAF + +RS     + +P    I+H LFFTVGLG  NC PG R
Sbjct  318   VLPAFPVLPAFNDTPTATAFAAGIRSPRPVKIPSP----IDHHLFFTVGLGLFNCPPGRR  373

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPRA  684
             C GPNGTRF ASMNNVSF LP R SIL AY+  + G++TTDFP+ PPVQF+YT  N+ RA
Sbjct  374   CGGPNGTRFGASMNNVSFQLPTRISILQAYHLGVRGVFTTDFPAAPPVQFDYTAANISRA  433

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             LWQP  GTK+Y +K+GS VQ+VLQ T IF+ E+HP+H+HGYHFY++  GFGNF+P  D A
Sbjct  434   LWQPVPGTKLYPLKYGSVVQLVLQGTNIFAGEEHPMHIHGYHFYVLATGFGNFDPARDAA  493

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
             SFNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVENG+ + 
Sbjct  494   SFNLVDPPLRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGVGKL  553

Query  323   ETVppppPDLPRC  285
             +++ PPP DLPRC
Sbjct  554   QSLEPPPADLPRC  566



>ref|XP_010031156.1| PREDICTED: laccase-12-like [Eucalyptus grandis]
 gb|KCW50425.1| hypothetical protein EUGRSUZ_J00166 [Eucalyptus grandis]
Length=570

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 195/314 (62%), Positives = 241/314 (77%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VLIT +Q PGRYYM A  Y +AQGAPFDNTT TA+L+Y +       +P 
Sbjct  261   IMLGPGQTTDVLITGDQPPGRYYMVAQPYQSAQGAPFDNTTTTAILDYISAPCPFRGTPS  320

Query  1034  A-LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP---G  867
               ++P LPA NDTATVTAFT  LRS     + T     I+ +LFFTVGLG  NC P    
Sbjct  321   TPVMPTLPAFNDTATVTAFTQNLRSPDNVSVPTD----IDENLFFTVGLGLFNCPPNLSS  376

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
              +CQGPNGTRFA+SMNN+SFVLP   SIL AY+  IPG++TTDFP+VPPV F+YTGNV +
Sbjct  377   DQCQGPNGTRFASSMNNMSFVLPSTYSILQAYHQGIPGVFTTDFPAVPPVAFDYTGNVSQ  436

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTKVY++++GS+VQIVLQDT I S E+HPIHLHGY+FY++  GFGNF+P T  
Sbjct  437   SLWQPVPGTKVYELEYGSNVQIVLQDTSIVSGENHPIHLHGYNFYVIAVGFGNFDPATHT  496

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
               FNL+DPP+RNT+ VPV GWA IRF+ADNPGVW+MHCH+D H+TWGLAM+FLV++G+  
Sbjct  497   KEFNLVDPPMRNTVGVPVNGWAVIRFLADNPGVWIMHCHLDVHITWGLAMAFLVKDGVGG  556

Query  326   WETVppppPDLPRC  285
              +++  PP DLP C
Sbjct  557   LQSLESPPEDLPPC  570



>ref|XP_006355638.1| PREDICTED: laccase-12-like [Solanum tuberosum]
Length=574

 Score =   376 bits (966),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 199/314 (63%), Positives = 243/314 (77%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavle-yttttssasySP  1038
             +MLGPGQTT+VLI A+Q P RYYMAA AYA+AQGAPFDNTT TA+LE  T + SS   + 
Sbjct  265   LMLGPGQTTDVLIKADQTPSRYYMAARAYASAQGAPFDNTTTTAILEYNTASCSSNCTTT  324

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPG  867
               +LP LPA NDT T TAFT++ RS     + T     I+ +LF TVGLG  NC   +P 
Sbjct  325   NPILPSLPAYNDTTTATAFTTKFRSPRKVEVPTE----IDENLFITVGLGLENCPTGVPS  380

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNG+RFAASMNNVSFVLP   S+L A++  IPG+++TDFP+VPPV+FNYTGNV R
Sbjct  381   SNCQGPNGSRFAASMNNVSFVLPSNFSLLQAHHQGIPGVFSTDFPAVPPVKFNYTGNVSR  440

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTK+YK+ +G+ VQ+VLQ TGIF+ E+HPIHLHGY FYI+ +GFGNFNP TD 
Sbjct  441   SLWQPIRGTKLYKLNYGARVQVVLQGTGIFTAENHPIHLHGYDFYIIAEGFGNFNPKTDT  500

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPPLRNT  +PV GW  IRFVADNPGVW+MHCH+D H+TWGLAM+FLVENG++E
Sbjct  501   SKFNLVDPPLRNTASLPVKGWTVIRFVADNPGVWIMHCHLDVHITWGLAMAFLVENGVSE  560

Query  326   WETVppppPDLPRC  285
              E++  PP D P C
Sbjct  561   LESLEAPPVDFPVC  574



>ref|XP_011004316.1| PREDICTED: laccase-12-like [Populus euphratica]
Length=575

 Score =   376 bits (966),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 196/313 (63%), Positives = 237/313 (76%), Gaps = 7/313 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VLI+ +Q PGRYYMAA AY +AQ APFDNTT TA+LEY +    A  +  
Sbjct  267   IMLGPGQTTDVLISGDQLPGRYYMAARAYQSAQNAPFDNTTTTAILEYKSVLCPAKCTKK  326

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
               +P LPA NDTATVTAF+   RS     + T     I+ +LFFT+GLG  NC       
Sbjct  327   PFMPPLPAYNDTATVTAFSRSFRSPRKVDVPTD----IDENLFFTIGLGLNNCPKNFRAR  382

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRA  684
             RCQGPNGTRF ASMNNVSFV P +AS+L AY   IPG++TTDFP+ P V+F+YTGNV R+
Sbjct  383   RCQGPNGTRFTASMNNVSFVFPSKASLLQAYKQKIPGVFTTDFPANPQVKFDYTGNVSRS  442

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             L+QP  GTK+YK+K+GS VQ+VLQDT I + E+HPIHLHGY FY++ +GFGNFN  TD +
Sbjct  443   LFQPLPGTKLYKLKYGSRVQVVLQDTSIVTPENHPIHLHGYDFYVIAEGFGNFNHKTDKS  502

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FNL+DPP+RNT+ VPV GWA IRFVADNPGVW+MHCH+D H+TWGLAM+FLVE GI   
Sbjct  503   KFNLVDPPMRNTVAVPVNGWAVIRFVADNPGVWIMHCHLDVHITWGLAMAFLVEEGIGIL  562

Query  323   ETVppppPDLPRC  285
             ++V PPP DLP C
Sbjct  563   QSVEPPPADLPIC  575



>ref|XP_003537321.1| PREDICTED: laccase-3-like [Glycine max]
 gb|KHN22790.1| Laccase-3 [Glycine soja]
Length=573

 Score =   376 bits (965),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 193/312 (62%), Positives = 236/312 (76%), Gaps = 6/312 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +M+GPGQT NV++TA+Q  G YYMAA AY +A  APFDNTT TA+LEY +T         
Sbjct  266   LMIGPGQTFNVIVTADQPLGLYYMAARAYESAANAPFDNTTTTAILEYRSTRRRNQNRSR  325

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--GPR  861
              +LP LPA NDT T TAFT+++R L    +       ++ +L+  VGLG +NC     PR
Sbjct  326   PILPALPAFNDTPTATAFTARIRGLTRVRVFKK----VDVNLYVIVGLGLINCTNPNSPR  381

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPNGTRF ASMNNVSFVLP   S++ AYY  IPG++TTDFP +PP+QF+YTGNVPR L
Sbjct  382   CQGPNGTRFTASMNNVSFVLPSTTSLMQAYYEGIPGVFTTDFPPIPPLQFDYTGNVPRGL  441

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             W P  GTK+YKVK+GS VQIVLQDT I +TE+HP+H+HG+HF++VG GFGNFNP TDP  
Sbjct  442   WTPSRGTKLYKVKYGSKVQIVLQDTSIVTTEEHPMHVHGFHFFVVGSGFGNFNPTTDPQK  501

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL+DPP+RNTI  P GGW AIRFVADNPG+W +HCHIDSHL WGL M+ LVENG+   +
Sbjct  502   FNLVDPPVRNTIGTPPGGWVAIRFVADNPGIWFVHCHIDSHLNWGLGMALLVENGVGLSQ  561

Query  320   TVppppPDLPRC  285
             +V PPPPDLP+C
Sbjct  562   SVLPPPPDLPQC  573



>gb|KHG11797.1| Laccase-12 -like protein [Gossypium arboreum]
Length=478

 Score =   372 bits (956),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 196/313 (63%), Positives = 233/313 (74%), Gaps = 9/313 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLG GQTT+VLI A+QRP RYYMAA AY +AQ  PFDNTT TA+LEY ++    +  P 
Sbjct  172   LMLGAGQTTDVLIKADQRPVRYYMAARAYQSAQNVPFDNTTTTAILEYKSSKKGNA--PK  229

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPG---P  864
              ++P LPA NDT TVTAF+   RS     + T     I  SLFFT+GLG  NC P     
Sbjct  230   PIMPSLPAYNDTNTVTAFSRSFRSPRKVQVPTE----INESLFFTIGLGLNNCPPNFRRS  285

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRA  684
             RCQGPNGTR AASMNNVSF+LP+  S+L A+   IPG++TTDFP  PPV+F+YTGNV R 
Sbjct  286   RCQGPNGTRLAASMNNVSFMLPRSISLLQAHQQGIPGVFTTDFPGTPPVKFDYTGNVSRT  345

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             L+QP  GTK+YK+KFGS VQ+VLQ T I + E+HPIHLHGY FYI+  GFGNFNP  D +
Sbjct  346   LFQPITGTKLYKLKFGSRVQVVLQGTSIIAPENHPIHLHGYDFYIIADGFGNFNPKRDTS  405

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FNL+DPPLRNT+ VP  GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVENG  E 
Sbjct  406   KFNLVDPPLRNTVAVPANGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGFGEL  465

Query  323   ETVppppPDLPRC  285
             +++P PP DLP C
Sbjct  466   QSLPAPPSDLPLC  478



>ref|NP_196158.1| laccase 12 [Arabidopsis thaliana]
 sp|Q9FLB5.1|LAC12_ARATH RecName: Full=Laccase-12; AltName: Full=Benzenediol:oxygen oxidoreductase 
12; AltName: Full=Diphenol oxidase 12; AltName: 
Full=Urishiol oxidase 12; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09982.1| laccase (diphenol oxidase) [Arabidopsis thaliana]
 gb|AED90868.1| laccase 12 [Arabidopsis thaliana]
Length=565

 Score =   375 bits (963),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 197/314 (63%), Positives = 244/314 (78%), Gaps = 12/314 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+TA+Q P RYY+AA AY +AQ APFDNTT TA+L+Y  TT+++     
Sbjct  260   LMLGPGQTTDVLLTADQPPKRYYIAARAYQSAQNAPFDNTTTTAILQYKKTTTTSK----  315

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
              ++P LPA NDT TVT+F+ + +SL   ++       I+ +LFFT+GLG  NC    P  
Sbjct  316   PIMPVLPAFNDTNTVTSFSRKFKSLRNVVVPKT----IDDNLFFTIGLGLDNCPKKFPKS  371

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN-VPR  687
             RCQG NGTRF ASMNNVSFVLP   S+L A+ N IPG++TTDFPS PPV+F+YTGN + R
Sbjct  372   RCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPSKPPVKFDYTGNNISR  431

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             AL+QP  GTK+YK+K+GS VQ+VLQDT I ++E+HPIHLHGY FYIVG+GFGNFNP  D 
Sbjct  432   ALFQPVKGTKLYKLKYGSRVQVVLQDTNIVTSENHPIHLHGYDFYIVGEGFGNFNPKKDT  491

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+ WGLAM+FLV+NG+ E
Sbjct  492   SKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLAMAFLVDNGVGE  551

Query  326   WETVppppPDLPRC  285
              ET+  PP DLP C
Sbjct  552   LETLEAPPHDLPIC  565



>ref|XP_006287390.1| hypothetical protein CARUB_v10000596mg [Capsella rubella]
 gb|EOA20288.1| hypothetical protein CARUB_v10000596mg [Capsella rubella]
Length=563

 Score =   375 bits (962),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 199/314 (63%), Positives = 240/314 (76%), Gaps = 14/314 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+TA+Q P RYY+AA AY +AQ APFDNTT T +L+Y  TTS       
Sbjct  260   LMLGPGQTTDVLLTADQPPKRYYIAARAYQSAQNAPFDNTTTTGILQYKKTTSP------  313

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
              +LP LPA NDT TVT+F+ + +SL   ++       I+  LFFTVGLG  NC    P  
Sbjct  314   PILPVLPAFNDTNTVTSFSRKFKSLRNVVVPKT----IDDDLFFTVGLGLDNCPKNFPKS  369

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN-VPR  687
             RCQG NGTRF ASMNNVSFVLP   S+L A+ N IPG++TTDFP+ PPVQF+YTGN + R
Sbjct  370   RCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPAKPPVQFDYTGNNISR  429

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             AL+QP  GTK+YK+K+GS VQ+VLQDT I ++E+HPIHLHGY FYIVG+GFGNFNP  D 
Sbjct  430   ALFQPVKGTKLYKLKYGSRVQVVLQDTNIVTSENHPIHLHGYDFYIVGEGFGNFNPKKDT  489

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+ WGLAM+FLV+NG+ E
Sbjct  490   SKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLAMAFLVDNGVGE  549

Query  326   WETVppppPDLPRC  285
              ET+  PP DLP C
Sbjct  550   LETLEAPPHDLPVC  563



>ref|XP_011084865.1| PREDICTED: laccase-12-like [Sesamum indicum]
Length=580

 Score =   375 bits (963),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 204/313 (65%), Positives = 244/313 (78%), Gaps = 7/313 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLITA+Q P RYY+AA AYA+AQGAPFDNTT TA+LEY +    A     
Sbjct  272   LMLGPGQTTDVLITADQPPARYYIAARAYASAQGAPFDNTTTTAILEYESAGCPAKCVVK  331

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR--  861
              ++P +PA NDTAT TAFT++ RS     +       I+H+LFFTVGLG  NC PG R  
Sbjct  332   PVMPAMPAFNDTATATAFTTRFRSPRRVPVPNN----IDHNLFFTVGLGLNNCPPGARPR  387

Query  860   -CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRA  684
              CQGPNGTRFAASMNNVSFVLP   S+L A+   IPG++TTDFP+ PPVQF+YTGNV R+
Sbjct  388   NCQGPNGTRFAASMNNVSFVLPSNFSLLQAHQQGIPGVFTTDFPANPPVQFDYTGNVSRS  447

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             LWQP  GTKVYK+K+G +VQ+VLQ T IF+ E+HPIHLHG+ FYI+ +GFGNFNP  D A
Sbjct  448   LWQPVRGTKVYKLKYGETVQLVLQGTSIFTAENHPIHLHGFDFYIIAEGFGNFNPSRDTA  507

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FNL+DPPLRNT  +PVGGW  IRFVADNPGVWL+HCH+D H+TWGLAM+FLVENG+ E 
Sbjct  508   KFNLVDPPLRNTASLPVGGWTVIRFVADNPGVWLLHCHLDVHITWGLAMAFLVENGVGEL  567

Query  323   ETVppppPDLPRC  285
             +T+ PPP DLP C
Sbjct  568   QTLEPPPADLPVC  580



>ref|XP_011041833.1| PREDICTED: laccase-13 [Populus euphratica]
Length=611

 Score =   376 bits (966),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 199/314 (63%), Positives = 238/314 (76%), Gaps = 9/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+ PGQTT+VL+TA+Q PG YYMAA AY +A  APFDNTT TA+LEY +   +A+    
Sbjct  303   IMIAPGQTTDVLLTADQTPGHYYMAAHAYNSAN-APFDNTTTTAILEYKSAPCNANKGKS  361

Query  1034  A--LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--G  867
             +  + P+LP  NDT++  AFTS LRS     +       I+ +LFFTVGLG +NC     
Sbjct  362   STPIFPQLPGFNDTSSAIAFTSSLRSPSKVNVPLQ----IDENLFFTVGLGLINCTNPNS  417

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
             PRCQGPNGTRFAAS+NNVSFVLP R S++ AYY   PG++TTDFP VPPV+F+YTGNV R
Sbjct  418   PRCQGPNGTRFAASINNVSFVLPTRNSLMQAYYQGQPGVFTTDFPPVPPVKFDYTGNVSR  477

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              LWQP   TK+YK+KFG+ VQIV QDT I + EDHP+HLHG+HF +VG GFGNFNP TDP
Sbjct  478   GLWQPVKATKLYKLKFGAKVQIVFQDTSIVTVEDHPMHLHGHHFAVVGSGFGNFNPQTDP  537

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNLIDPP RNTI  P GGW AIR VADNPG+WL+HCH+DSHL WGLAM+FLVENG  E
Sbjct  538   AKFNLIDPPYRNTIGNPPGGWVAIRLVADNPGIWLLHCHLDSHLNWGLAMAFLVENGGGE  597

Query  326   WETVppppPDLPRC  285
              ++V PPP DLP+C
Sbjct  598   LQSVQPPPLDLPQC  611



>gb|KDP44694.1| hypothetical protein JCGZ_01194 [Jatropha curcas]
Length=582

 Score =   375 bits (963),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 200/316 (63%), Positives = 239/316 (76%), Gaps = 10/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLI+ NQ   RYYMAA AY +AQ APFDNTT TA+LEY +   +A     
Sbjct  271   LMLGPGQTTDVLISGNQPSARYYMAARAYQSAQNAPFDNTTTTAILEYKSAPCAAKNCAA  330

Query  1034  A--LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP---  870
             A  ++P LPA NDTATVTAF+   RSL    + T     I+ +LFFTVGLG  NC P   
Sbjct  331   AKPIMPPLPAYNDTATVTAFSKSFRSLNKAFVPTE----IDENLFFTVGLGLNNCPPNFN  386

Query  869   -GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
                +CQGPNGTRF ASMNNVSF LP   S+L A+   +PG++TTDFP+ PP++F+YTGNV
Sbjct  387   KASQCQGPNGTRFTASMNNVSFQLPSTVSLLQAHQLRVPGVFTTDFPANPPLKFDYTGNV  446

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R+LWQP   TKVYK+K+GS VQ+VLQDT I ++E+HPIHLHGY FYIV +GFGNFNP T
Sbjct  447   SRSLWQPVPATKVYKLKYGSRVQLVLQDTSIVTSENHPIHLHGYDFYIVAEGFGNFNPQT  506

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D + FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAMSFLVENG+
Sbjct  507   DTSKFNLVDPPLRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMSFLVENGV  566

Query  332   TEWETVppppPDLPRC  285
                E++  PP DLP C
Sbjct  567   GLLESIEAPPEDLPPC  582



>ref|XP_007008849.1| Laccase 12 [Theobroma cacao]
 gb|EOY17659.1| Laccase 12 [Theobroma cacao]
Length=573

 Score =   375 bits (962),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 199/315 (63%), Positives = 236/315 (75%), Gaps = 9/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleytttt--ssasyS  1041
             IMLGPGQTT+VLI  +Q P +YYMAA AY +AQ APFDNTT TA+LEY +    +    +
Sbjct  263   IMLGPGQTTDVLIRGDQAPAQYYMAARAYQSAQNAPFDNTTTTAILEYKSAPCPAKKGLA  322

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPG--  867
             P  ++P LPA NDT TVTAF+   RS     + T     I+ SLFFTVGLG  NC P   
Sbjct  323   PKPIMPSLPAYNDTNTVTAFSRSFRSPQKVEVPTD----IDESLFFTVGLGLNNCPPNFH  378

Query  866   -PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
               RCQGPNGTRF ASMNNVSFVLP   S+L A+   IPG++TTDFP  PPV F+YTGNV 
Sbjct  379   KSRCQGPNGTRFTASMNNVSFVLPGNFSLLQAHQQGIPGVFTTDFPGTPPVIFDYTGNVS  438

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             ++L+QP  GTK+YK+K+GS VQIV+QDT I + E+HPIHLHGY FYI+ +GFGNFNP  D
Sbjct  439   QSLFQPVTGTKLYKLKYGSRVQIVIQDTSIVTPENHPIHLHGYDFYIIAEGFGNFNPQKD  498

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
              + FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVENG  
Sbjct  499   TSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGFG  558

Query  329   EWETVppppPDLPRC  285
             E +T+  PPPDLP C
Sbjct  559   ELQTLQAPPPDLPIC  573



>ref|XP_010535350.1| PREDICTED: laccase-13 [Tarenaya hassleriana]
Length=573

 Score =   374 bits (961),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 196/320 (61%), Positives = 235/320 (73%), Gaps = 15/320 (5%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleytt--------tt  1059
             IM+GPGQTT+VL+TA+Q P  YYMAA AY +A  A FDNTT TA+LEY +         +
Sbjct  259   IMIGPGQTTDVLLTADQPPANYYMAAHAYNSANAA-FDNTTTTAILEYKSAPCVAQKGKS  317

Query  1058  ssasySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVN  879
              +++++   + P+LP  NDTAT T FT+Q++S     +       I+  LFFTVGLG  N
Sbjct  318   QASTFTSSTIFPQLPGFNDTATATTFTNQIKSPSKVEVPLD----IDEYLFFTVGLGLFN  373

Query  878   CIP--GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNY  705
             C+    PRCQGPNGTRF ASMNNVSF+ P+R SI+ AYY   PG++T DFP+VPP++F+Y
Sbjct  374   CLNPNSPRCQGPNGTRFTASMNNVSFIFPRRNSIMQAYYQGTPGVFTMDFPAVPPLKFDY  433

Query  704   TGNVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNF  525
             TGNV R LWQP  GTK YK+K+ S VQIVLQDT I +TE+HP+HLHGY FY+VG GFGNF
Sbjct  434   TGNVSRGLWQPVRGTKAYKLKYKSKVQIVLQDTSIVTTENHPMHLHGYEFYVVGSGFGNF  493

Query  524   NPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLV  345
             NP TD  SFNL+DPP RNTI  P GGW AIRFVADNPG WLMHCHIDSHL WGLAM FLV
Sbjct  494   NPRTDSTSFNLVDPPRRNTIGTPPGGWVAIRFVADNPGAWLMHCHIDSHLAWGLAMVFLV  553

Query  344   ENGITEWETVppppPDLPRC  285
             ENG  E + V  PP DLP+C
Sbjct  554   ENGAGELQAVQSPPLDLPQC  573



>ref|XP_004307184.1| PREDICTED: laccase-12-like [Fragaria vesca subsp. vesca]
Length=575

 Score =   374 bits (961),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 194/316 (61%), Positives = 233/316 (74%), Gaps = 10/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleytttt---ssasy  1044
             +MLGPGQTT+VLI+ +Q+P RYYMAA AY +AQ APFDNTT TA+LEY +     +++  
Sbjct  264   LMLGPGQTTDVLISGDQQPSRYYMAAHAYFSAQNAPFDNTTTTAILEYKSVRCNNTTSCK  323

Query  1043  SPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---I  873
                 ++P+LPA NDT T   FT   RS     + T     I+ +LFFT+GLG   C    
Sbjct  324   KSKPIMPQLPAFNDTNTAEVFTRSFRSPRKVEVPTE----IDENLFFTIGLGLNKCPKHF  379

Query  872   PGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
                RCQGPNGTRFAASMNNVSFVLP   SIL AY  NIPG+YT+DFP+ PP +F+YTGNV
Sbjct  380   RSRRCQGPNGTRFAASMNNVSFVLPNNMSILQAYQQNIPGVYTSDFPANPPKKFDYTGNV  439

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R+LWQP FGTK YK+K+GS VQ+VLQDT I + E+HPIHLHGY FYI+ QGFGNFN  T
Sbjct  440   SRSLWQPSFGTKGYKLKYGSRVQVVLQDTSIVTPENHPIHLHGYDFYILAQGFGNFNAKT  499

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D   FNL+DPPLRNT+ VP  GWA IRFVADNPG WL+HCH+D H+ WGL M FLV+NG+
Sbjct  500   DTKKFNLVDPPLRNTVSVPANGWAVIRFVADNPGAWLLHCHLDVHINWGLGMFFLVDNGV  559

Query  332   TEWETVppppPDLPRC  285
              E +T+ PPP DLPRC
Sbjct  560   GELQTIEPPPADLPRC  575



>ref|XP_007142103.1| hypothetical protein PHAVU_008G252800g [Phaseolus vulgaris]
 gb|ESW14097.1| hypothetical protein PHAVU_008G252800g [Phaseolus vulgaris]
Length=573

 Score =   374 bits (960),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 200/312 (64%), Positives = 241/312 (77%), Gaps = 6/312 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +M+GPGQT NVL+TA+Q PGRYYMAA AY TA  A FDNTT TA+LEY + +      P 
Sbjct  266   LMIGPGQTINVLVTADQTPGRYYMAARAYQTAMNAAFDNTTTTAILEYKSASCGNGQVPR  325

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--GPR  861
              +LP LPA NDTAT TA+T+ +R L    + T     ++ SL+F VGLG +NC     PR
Sbjct  326   PILPVLPAFNDTATATAYTAGIRGLSKIKVFTK----VDVSLYFVVGLGLINCTNPNSPR  381

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPNGTRFAAS+NN SFVLP   S++ AYY  IPGI+TTDFP VPP+QFNYTGNVPR L
Sbjct  382   CQGPNGTRFAASINNNSFVLPTTTSLMQAYYQGIPGIFTTDFPPVPPLQFNYTGNVPRGL  441

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             W P  GTK++KVK+GS++QIVLQDT I +TEDHP+H+HG+HF++VG GFGNFNP TDPA 
Sbjct  442   WTPVRGTKLFKVKYGSTLQIVLQDTSIVTTEDHPMHVHGFHFFVVGSGFGNFNPATDPAR  501

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL+DPP+RNTI  P GGW AIRFVADNPG+W +HCHIDSHL WGL  + LVENG+   +
Sbjct  502   FNLVDPPVRNTIGTPPGGWVAIRFVADNPGIWFLHCHIDSHLNWGLGTALLVENGVGPSQ  561

Query  320   TVppppPDLPRC  285
             +V PPPPDLP+C
Sbjct  562   SVIPPPPDLPQC  573



>ref|XP_011014542.1| PREDICTED: laccase-3-like [Populus euphratica]
Length=631

 Score =   375 bits (964),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 238/314 (76%), Gaps = 9/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+ PGQTT+VL+TA+Q PG YYMAA AY +A  APFDNTT TA+LEY +   +A+    
Sbjct  323   IMIAPGQTTDVLLTADQTPGHYYMAAHAYNSAN-APFDNTTTTAILEYKSAPCNANKGRS  381

Query  1034  A--LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--G  867
             +  + P+LP  NDT +  AFTS LRS     +       I+ +LFFTVGLG +NC     
Sbjct  382   STPIFPQLPGFNDTNSAIAFTSSLRSPSKVNVPLQ----IDENLFFTVGLGLINCTNPNS  437

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
             PRCQGPNGTRFAAS+NNVSFVLP R S++ AYY   PG++TTDFP VPPV+F+YTGNV R
Sbjct  438   PRCQGPNGTRFAASINNVSFVLPTRNSLMQAYYQGQPGVFTTDFPPVPPVKFDYTGNVSR  497

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              LWQP   TK+YK+KFG+ VQIV QDT I + E+HP+HLHG+HF +VG GFGNFNP TDP
Sbjct  498   GLWQPVKATKLYKLKFGAKVQIVFQDTSIVTVENHPMHLHGHHFAVVGSGFGNFNPQTDP  557

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNLIDPP RNTI  P GGW AIR VADNPG+WL+HCH+DSHL WGLAM+FLVENG+ E
Sbjct  558   AKFNLIDPPYRNTIGNPPGGWVAIRLVADNPGIWLLHCHLDSHLNWGLAMAFLVENGVGE  617

Query  326   WETVppppPDLPRC  285
              ++V PPP DLP+C
Sbjct  618   LQSVQPPPLDLPQC  631



>gb|KHN40112.1| Laccase-3 [Glycine soja]
Length=490

 Score =   371 bits (952),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 201/314 (64%), Positives = 244/314 (78%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssas--yS  1041
             +M+GPGQT NVL+TA+Q PGRYYMAA AY TA  A FDNTT TA+LEY + + S      
Sbjct  181   LMIGPGQTINVLVTADQTPGRYYMAARAYQTAMNAAFDNTTTTAILEYKSASCSKKNGQL  240

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--G  867
             P  +LP LPA NDTAT TA+T+ +R L    + T     ++ +L+F VGLG +NC     
Sbjct  241   PRPILPVLPAFNDTATATAYTTGIRGLSKINVFTK----VDVNLYFIVGLGLINCTNPNS  296

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
             PRCQGPNGTRFAAS+NN SFVLP   S++ AYYN IPG++TTDFP VPP+QFNYTGNVPR
Sbjct  297   PRCQGPNGTRFAASINNHSFVLPTTTSLMQAYYNGIPGVFTTDFPPVPPLQFNYTGNVPR  356

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              LW P  GTK++K+K+GS+VQIVLQDT I +TEDHP+H+HG+HF++VG GFGNFNP TDP
Sbjct  357   GLWTPARGTKLFKLKYGSNVQIVLQDTSIVTTEDHPMHIHGFHFFVVGSGFGNFNPATDP  416

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPP+RNTI  P GGW AIRFVADNPG+W +HCHIDSHL WGLA + LVENG+  
Sbjct  417   ARFNLVDPPVRNTIGTPPGGWVAIRFVADNPGIWFLHCHIDSHLNWGLATALLVENGVGP  476

Query  326   WETVppppPDLPRC  285
              ++V PPPPDLP+C
Sbjct  477   SQSVIPPPPDLPQC  490



>ref|XP_010491073.1| PREDICTED: laccase-12-like [Camelina sativa]
Length=565

 Score =   373 bits (958),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 242/314 (77%), Gaps = 12/314 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+ A+Q+P RYY+AA AY +AQ APFDNTT TA+L+Y  TT+S+     
Sbjct  260   LMLGPGQTTDVLLNADQQPKRYYIAARAYQSAQNAPFDNTTTTAILQYKNTTTSSP----  315

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
              +LP LPA NDT TVT+F+ + +SL   ++       I+  LFFTVGLG  NC    P  
Sbjct  316   PILPVLPAFNDTNTVTSFSRKFKSLRNVVVPKT----IDDGLFFTVGLGLDNCPKNFPKS  371

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN-VPR  687
             RCQG NGTRF ASMNNVSFVLP   S+L A+ N IPG++TTDFP+ PPV+F+YTGN + R
Sbjct  372   RCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPAKPPVKFDYTGNNISR  431

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             AL+QP  GTK+Y +K+GS VQ+VLQDT I ++E+HPIHLHGY FYIVG+GFGNFNP  D 
Sbjct  432   ALFQPVKGTKLYNLKYGSRVQVVLQDTNIVTSENHPIHLHGYDFYIVGEGFGNFNPKKDT  491

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+ WGLAM+FLVENG+ E
Sbjct  492   SKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLAMAFLVENGVGE  551

Query  326   WETVppppPDLPRC  285
              ET+  PP DLP C
Sbjct  552   LETLEAPPHDLPVC  565



>ref|XP_002520797.1| laccase, putative [Ricinus communis]
 gb|EEF41506.1| laccase, putative [Ricinus communis]
Length=581

 Score =   373 bits (958),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 195/316 (62%), Positives = 239/316 (76%), Gaps = 10/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt--tssasyS  1041
             +MLGPGQTT+VLI+ +Q+P RYYMAA AY +AQ A FDNTT TA+LEY +    +    S
Sbjct  270   LMLGPGQTTDVLISGDQKPARYYMAARAYQSAQNAQFDNTTTTAILEYKSAPCAAKNCSS  329

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP---  870
                ++P LPA NDTATVTAF++  RS    ++ T     ++ +LFFTVGLG   C P   
Sbjct  330   NKPIMPPLPAYNDTATVTAFSTSFRSRNKVLVPTE----VDENLFFTVGLGLNTCPPNFN  385

Query  869   -GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
                +CQGPNGTRFAASMNNVSF LP   SIL A+   IP ++TTDFP+ PP++F+YTGNV
Sbjct  386   KSSQCQGPNGTRFAASMNNVSFQLPSNFSILQAHQLGIPRVFTTDFPASPPLKFDYTGNV  445

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R+LWQ   GTKVYK+K+GS VQIVLQDT I ++E+HPIHLHGY FYI+ +GFGNFNP T
Sbjct  446   SRSLWQAVAGTKVYKLKYGSRVQIVLQDTSIVTSENHPIHLHGYDFYIIAEGFGNFNPQT  505

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D + FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVENG+
Sbjct  506   DTSKFNLVDPPLRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGV  565

Query  332   TEWETVppppPDLPRC  285
                +++  PP DLP C
Sbjct  566   GVLQSIEAPPEDLPPC  581



>ref|XP_006355637.1| PREDICTED: laccase-12-like [Solanum tuberosum]
Length=573

 Score =   373 bits (958),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 200/314 (64%), Positives = 245/314 (78%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             +MLGPGQTT+VLI A+Q P RYYMAA AYA+AQGAPFDNTT TA+LEY T++ S++    
Sbjct  264   LMLGPGQTTDVLIKADQPPSRYYMAARAYASAQGAPFDNTTTTAILEYKTSSCSSNCVKT  323

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR-  861
               + P LPA NDTAT TAFT++ RS     +       I+ +LFFTVGLG  NC  G R 
Sbjct  324   NPVFPSLPAYNDTATATAFTTKFRSPRKVEVPKE----IDENLFFTVGLGLNNCPRGARS  379

Query  860   --CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRF ASMNN+SFVLP   S+L A++N IPG+++TDFP+VPPV+F+YTGNV R
Sbjct  380   KNCQGPNGTRFTASMNNISFVLPSNFSLLQAHHNGIPGVFSTDFPAVPPVKFDYTGNVSR  439

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTK+YK+K+G+ VQ+VLQ T I + E+HPIHLHGY FYI+ +GFGNFNP  D 
Sbjct  440   SLWQPIRGTKLYKLKYGARVQVVLQGTNISTAENHPIHLHGYDFYIIAEGFGNFNPKRDA  499

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPPLRNT  VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVENG+++
Sbjct  500   SKFNLVDPPLRNTASVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGVSQ  559

Query  326   WETVppppPDLPRC  285
              E++  PP DLP C
Sbjct  560   LESLETPPVDLPVC  573



>ref|XP_009611705.1| PREDICTED: laccase-12-like [Nicotiana tomentosiformis]
Length=574

 Score =   373 bits (957),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 244/314 (78%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             +MLGPGQTT+VLITA+Q+P RYYMAA AYA+AQGA FDNTT TA+LEY T + S++    
Sbjct  265   LMLGPGQTTDVLITADQQPARYYMAARAYASAQGAAFDNTTTTAILEYKTASCSSNCVKT  324

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR-  861
               + P LPA NDTAT TAFT++ RS     + T     I+ +LFFTVGLG  NC  G R 
Sbjct  325   NPVSPSLPAYNDTATATAFTTKFRSPRKVEVPTE----IDENLFFTVGLGLNNCPRGARS  380

Query  860   --CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRF ASMNNVSFVLP   S+L A++  IPG+++TDFP+ PPV+F+YTGNV R
Sbjct  381   RNCQGPNGTRFTASMNNVSFVLPSNYSLLQAHHQGIPGVFSTDFPAKPPVKFDYTGNVSR  440

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTK+YK+K+G+ VQ+VLQ T IF+ E+HPIHLHGY FYI+ +GFGNFNP  D 
Sbjct  441   SLWQPIRGTKLYKLKYGARVQVVLQGTSIFTAENHPIHLHGYDFYIIAEGFGNFNPKRDT  500

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPPLRNT  VPV GWA IRFVADNPGVWLMHCH+D H+ WGLAM+F+VENG+TE
Sbjct  501   AKFNLVDPPLRNTASVPVNGWAVIRFVADNPGVWLMHCHLDVHIGWGLAMAFIVENGVTE  560

Query  326   WETVppppPDLPRC  285
              E++  PP DLP C
Sbjct  561   LESLEAPPVDLPVC  574



>gb|KHN46117.1| Laccase-3, partial [Glycine soja]
Length=537

 Score =   372 bits (954),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 203/314 (65%), Positives = 243/314 (77%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssas--yS  1041
             +M+GPGQT NVL+TA+Q PGRYYMAA AY TA  A FDNTT TA+LEY + T S      
Sbjct  228   LMIGPGQTINVLVTADQTPGRYYMAARAYQTAMNAAFDNTTTTAILEYKSATCSKKNGQL  287

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--G  867
             P  +LP LPA NDTAT TA+T+ +R L    + T     ++ SL+F VGLG +NC     
Sbjct  288   PRPILPVLPAFNDTATATAYTAGIRGLSKINVFTN----VDVSLYFIVGLGLINCTNPNS  343

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
             PRCQGPNGTRFAAS+NN SFVLP   S++ AYYN IPG++TTDFP VPPVQFNYTGNVPR
Sbjct  344   PRCQGPNGTRFAASINNHSFVLPTTTSLMQAYYNGIPGVFTTDFPPVPPVQFNYTGNVPR  403

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              LW P  GTK++K+K+GS+VQIVLQDT I +TEDHP+H+HG+HF++VG GFGNFNP TDP
Sbjct  404   GLWTPARGTKLFKLKYGSNVQIVLQDTSIVTTEDHPMHVHGFHFFVVGSGFGNFNPATDP  463

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPP+RNTI  P GGW AIRFVADNPG+W +HCHIDSHL WGL  + LVENG+  
Sbjct  464   ARFNLVDPPVRNTIGTPPGGWVAIRFVADNPGIWFLHCHIDSHLNWGLGTALLVENGVGP  523

Query  326   WETVppppPDLPRC  285
              ++V PPPPDLP+C
Sbjct  524   SQSVIPPPPDLPQC  537



>emb|CAA74104.1| laccase [Populus trichocarpa]
 emb|CAC14720.1| laccase [Populus trichocarpa]
Length=574

 Score =   373 bits (957),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 198/313 (63%), Positives = 236/313 (75%), Gaps = 8/313 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VLI+ +Q PGRYYMAA AY +AQ APFDNTT TA+LEY +    A  +  
Sbjct  267   IMLGPGQTTDVLISGDQLPGRYYMAARAYQSAQNAPFDNTTTTAILEYKSVLCPAKCTKK  326

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
               +P LPA NDTATVTAF+   RS     + T     I+ +LFFT+GLG  NC       
Sbjct  327   PFMPPLPAYNDTATVTAFSRSFRSPRKVEVPTD----IDENLFFTIGLGLNNCPKNFRAR  382

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRA  684
             RCQGPNGTRF ASMN VSFV   +AS+L AY   IPG++TTDFP+ P V+F+YTGNV R+
Sbjct  383   RCQGPNGTRFTASMNMVSFVF-FKASLLQAYKQKIPGVFTTDFPAKPQVKFDYTGNVSRS  441

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             L+QP  GTK+YK+K+GS VQIVLQDT I + E+HPIHLHGY FYI+ +GFGNFNP TD +
Sbjct  442   LFQPARGTKLYKLKYGSRVQIVLQDTSIVTPENHPIHLHGYDFYIIAEGFGNFNPKTDKS  501

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FNL+DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVE GI   
Sbjct  502   KFNLVDPPMRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEEGIGIL  561

Query  323   ETVppppPDLPRC  285
             ++V PPP DLP C
Sbjct  562   QSVEPPPADLPIC  574



>ref|XP_004239958.1| PREDICTED: laccase-12-like [Solanum lycopersicum]
Length=570

 Score =   372 bits (956),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 237/314 (75%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLI A+Q+P RYYMAA AYA+AQ APFD+TT TA+LEY T + S +    
Sbjct  261   LMLGPGQTTDVLIKADQQPARYYMAARAYASAQDAPFDDTTTTAILEYNTASCSTNCVKT  320

Query  1034  A-LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPG  867
               + P LPA NDT+T T F+++ RS     +       I+ +LFFTVGLG  NC    P 
Sbjct  321   KPVFPSLPAYNDTSTATTFSTKFRSPRRVEVPKE----IDENLFFTVGLGLENCPRGAPS  376

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGP+GTRF ASMNNVSF LP   S+L A+Y  I G+++TDFP+VPPV+F+YTGNV  
Sbjct  377   SYCQGPSGTRFTASMNNVSFTLPSNNSLLQAHYQGISGVFSTDFPAVPPVKFDYTGNVSG  436

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTK+YK+K+G+ VQ+VLQ T IFS E+HP+HLHGY FYI+ +GFGNFNP TD 
Sbjct  437   SLWQPIRGTKLYKLKYGAKVQVVLQGTSIFSAENHPMHLHGYDFYIIAEGFGNFNPKTDT  496

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
               FNLIDPPLRNT  VPV GW  IRF+A+NPGVWLMHCH+D H+TWGLAM+FLVENG+ E
Sbjct  497   FKFNLIDPPLRNTASVPVNGWTVIRFIANNPGVWLMHCHLDVHITWGLAMAFLVENGVCE  556

Query  326   WETVppppPDLPRC  285
              E++ PPP DLP C
Sbjct  557   SESLEPPPLDLPVC  570



>ref|XP_009771638.1| PREDICTED: laccase-12-like [Nicotiana sylvestris]
Length=578

 Score =   373 bits (957),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 203/314 (65%), Positives = 238/314 (76%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             IMLGPGQTT+VLITANQ P RYYMA  AYA+AQGAPFDNTT TA+LEY      A     
Sbjct  269   IMLGPGQTTDVLITANQPPARYYMAVRAYASAQGAPFDNTTTTAILEYKAAPCPAKGVKI  328

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPG---  867
               +LP LPA NDTAT T FTS  RS     + T     I+ +LFFTVGLG  NC  G   
Sbjct  329   NPILPSLPAFNDTATATTFTSSFRSARKVDVPTE----IDENLFFTVGLGLNNCPAGASS  384

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRF ASMNNVSFVLP   S+L A++  IPG+++TDFP+VPPV+F+YTGNV R
Sbjct  385   SSCQGPNGTRFTASMNNVSFVLPSNFSLLQAHHQGIPGVFSTDFPAVPPVKFDYTGNVSR  444

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP   TK+YK+K+G+ VQIVLQ T IF+ E+HPIHLHGY FYI+ +GFGNFNP TD 
Sbjct  445   SLWQPISATKLYKLKYGARVQIVLQGTSIFTAENHPIHLHGYDFYILAEGFGNFNPQTDT  504

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPPLRNT  VPV GW+ IRFVADNPGVW+MHCH+D H+TWGLAM+FLV+NG+T+
Sbjct  505   AKFNLVDPPLRNTASVPVNGWSVIRFVADNPGVWIMHCHLDVHITWGLAMAFLVQNGVTQ  564

Query  326   WETVppppPDLPRC  285
              E +  PP DLP C
Sbjct  565   LEALEEPPVDLPVC  578



>gb|KDO67040.1| hypothetical protein CISIN_1g013075mg [Citrus sinensis]
Length=381

 Score =   366 bits (939),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 203/316 (64%), Positives = 239/316 (76%), Gaps = 11/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt----tssas  1047
             IM+ PGQTTNVL+TA+Q P RYYMAA AY TA  A FDNTT TA+LEY +         S
Sbjct  71    IMIAPGQTTNVLLTADQPPARYYMAAHAYNTANAA-FDNTTTTAILEYKSAPFNGKKGKS  129

Query  1046  ySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP-  870
              S   + P LP  NDTAT TAFT++++SL    + T    +I+ +LFFTVGLG +NC   
Sbjct  130   RSSAPIFPILPGFNDTATATAFTARIKSLHQVQVPT----VIDENLFFTVGLGLINCSNP  185

Query  869   -GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
               PRCQGPNGTRFAAS+NN+SFV P+R S++ AY    PGI+TTDFP VPP+ F+YTGNV
Sbjct  186   NSPRCQGPNGTRFAASINNISFVFPRRNSLMQAYIQGQPGIFTTDFPPVPPIIFDYTGNV  245

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R LWQPR  TK+YK+KFGS VQIV QDT I S EDHP+HLHG+ FY+VG G GNFNP T
Sbjct  246   SRGLWQPRKRTKLYKLKFGSRVQIVFQDTSIVSVEDHPMHLHGHEFYVVGSGLGNFNPST  305

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D A FNLIDPP RNTI  P GGW A+RFVA+NPG+WL+HCHIDSHLTWGLAM+FLVENG+
Sbjct  306   DTAKFNLIDPPRRNTIGTPPGGWVAVRFVAENPGIWLLHCHIDSHLTWGLAMAFLVENGV  365

Query  332   TEWETVppppPDLPRC  285
              + +TV PPP DLPRC
Sbjct  366   GKLQTVQPPPLDLPRC  381



>ref|XP_008792257.1| PREDICTED: laccase-3-like [Phoenix dactylifera]
Length=576

 Score =   372 bits (956),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 196/314 (62%), Positives = 236/314 (75%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+T +Q P RYYMAA AYA+AQG PFDNTT TA+L+Y    S A    G
Sbjct  267   LMLGPGQTTDVLVTMDQPPSRYYMAARAYASAQGVPFDNTTTTAILDYDCGCSVAKPRQG  326

Query  1034  AL---LPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGP  864
                   P LPA NDTAT  AF++ L+SL    +       ++ +LFFTVGLG  NC PG 
Sbjct  327   IAQPAFPILPAYNDTATAAAFSTGLKSLKKVDIPGR----VDENLFFTVGLGLFNCRPGK  382

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPR  687
             RC GPNGTRF ASMNN SFVLP   SIL A+++ +PG++T DFP+ PPVQF+YT  NV R
Sbjct  383   RCGGPNGTRFGASMNNFSFVLPANFSILQAHHHRMPGVFTADFPAQPPVQFDYTAANVSR  442

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP   TKVYK+K+GS VQ+VLQ T IF+ E+HPIHLHGY FYI+ QGFGNFN   D 
Sbjct  443   SLWQPVAATKVYKLKYGSVVQLVLQGTNIFAAENHPIHLHGYDFYILAQGFGNFNAAKDA  502

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVE+G+ E
Sbjct  503   AKFNLVDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGLGE  562

Query  326   WETVppppPDLPRC  285
              +++ PPP DLP C
Sbjct  563   LQSLEPPPADLPIC  576



>ref|XP_009763769.1| PREDICTED: laccase-12-like [Nicotiana sylvestris]
Length=574

 Score =   372 bits (956),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 242/314 (77%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavle-yttttssasySP  1038
             +MLGPGQTT+VLITA+Q+P RYYMAA AYA+AQG PFDNTT TA+LE  T + SS     
Sbjct  265   LMLGPGQTTDVLITADQQPARYYMAARAYASAQGNPFDNTTTTAILEYKTASCSSNCVKT  324

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR-  861
               + P LPA NDTAT TAFT++ RS     + T     I+ +LFFTVGLG  NC  G R 
Sbjct  325   NPVSPSLPAFNDTATATAFTTKFRSPRKVEVPTE----IDENLFFTVGLGLNNCPRGARS  380

Query  860   --CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRF ASMNNVSFVLP   S+L A+   IPG+++TDFP+ PPV+F+YTGNV R
Sbjct  381   RNCQGPNGTRFTASMNNVSFVLPSNYSLLQAHQQGIPGVFSTDFPANPPVKFDYTGNVSR  440

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTK+YK+K+G+ VQ+VLQ T IF+ E+HPIHLHGY FYI+ +GFGNFNP TD 
Sbjct  441   SLWQPTRGTKLYKLKYGARVQVVLQGTSIFTAENHPIHLHGYDFYIIAEGFGNFNPKTDT  500

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPPLRNT  VPV GWA IRFVADNPGVWLMHCH+D H+ WGLAM+F+VENG+T+
Sbjct  501   AKFNLVDPPLRNTASVPVKGWAVIRFVADNPGVWLMHCHLDVHIGWGLAMAFIVENGVTQ  560

Query  326   WETVppppPDLPRC  285
              E++  PP DLP C
Sbjct  561   LESLEAPPVDLPVC  574



>ref|XP_010685889.1| PREDICTED: laccase-3-like [Beta vulgaris subsp. vulgaris]
Length=569

 Score =   372 bits (955),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 193/311 (62%), Positives = 236/311 (76%), Gaps = 5/311 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+ PGQTTNVL+TANQ PGRYYMAA+AYA+A G  FDNTT TA+LEY +  S       
Sbjct  263   IMIAPGQTTNVLVTANQPPGRYYMAATAYASAPGVAFDNTTTTAILEYNSCKSKKGSPMK  322

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCI-PGPRC  858
              +LP+LPA NDT T  +FT+Q R + T  +       I+ +LFFT+ LG +NC  P  RC
Sbjct  323   PILPQLPAWNDTNTANSFTAQFRGISTGKVPLE----IDENLFFTINLGVINCARPSFRC  378

Query  857   QGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRALW  678
             QGPN TRF ASMNNVSFV P++ SIL A Y N PG++TTDFP VPPVQF+YTGNV + LW
Sbjct  379   QGPNNTRFTASMNNVSFVFPKKNSILQALYQNTPGVFTTDFPPVPPVQFDYTGNVSQQLW  438

Query  677   QPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASF  498
              P  GTK+YK+KFGS VQI+LQ+T I + EDHP+HLHGYHF++VG G GNF+P  DPA+F
Sbjct  439   TPVRGTKLYKLKFGSHVQIILQNTNISAIEDHPMHLHGYHFFVVGGGKGNFDPKRDPANF  498

Query  497   NLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWET  318
             NL+DPP+RNT+    GGW AIRFVADNPGVWLMHCH+D H+ WGLAM+FLVENG+ +  +
Sbjct  499   NLVDPPVRNTVGTTPGGWVAIRFVADNPGVWLMHCHLDVHIGWGLAMAFLVENGVGKLNS  558

Query  317   VppppPDLPRC  285
             +  PPP LP+C
Sbjct  559   IEAPPPMLPQC  569



>ref|XP_003518325.1| PREDICTED: laccase-3-like [Glycine max]
Length=575

 Score =   372 bits (955),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 203/314 (65%), Positives = 243/314 (77%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssas--yS  1041
             +M+GPGQT NVL+TA+Q PGRYYMAA AY TA  A FDNTT TA+LEY + T S      
Sbjct  266   LMIGPGQTINVLVTADQTPGRYYMAARAYQTAMNAAFDNTTTTAILEYKSATCSKKNGQL  325

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--G  867
             P  +LP LPA NDTAT TA+T+ +R L    + T     ++ SL+F VGLG +NC     
Sbjct  326   PRPILPVLPAFNDTATATAYTAGIRGLSKINVFTN----VDVSLYFIVGLGLINCTNPNS  381

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
             PRCQGPNGTRFAAS+NN SFVLP   S++ AYYN IPG++TTDFP VPPVQFNYTGNVPR
Sbjct  382   PRCQGPNGTRFAASINNHSFVLPTTTSLMQAYYNGIPGVFTTDFPPVPPVQFNYTGNVPR  441

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              LW P  GTK++K+K+GS+VQIVLQDT I +TEDHP+H+HG+HF++VG GFGNFNP TDP
Sbjct  442   GLWTPARGTKLFKLKYGSNVQIVLQDTSIVTTEDHPMHVHGFHFFVVGSGFGNFNPATDP  501

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPP+RNTI  P GGW AIRFVADNPG+W +HCHIDSHL WGL  + LVENG+  
Sbjct  502   ARFNLVDPPVRNTIGTPPGGWVAIRFVADNPGIWFLHCHIDSHLNWGLGTALLVENGVGP  561

Query  326   WETVppppPDLPRC  285
              ++V PPPPDLP+C
Sbjct  562   SQSVIPPPPDLPQC  575



>ref|XP_002326089.1| hypothetical protein POPTR_0019s14530g [Populus trichocarpa]
 gb|EEF00471.1| hypothetical protein POPTR_0019s14530g [Populus trichocarpa]
Length=576

 Score =   372 bits (955),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 197/314 (63%), Positives = 237/314 (75%), Gaps = 9/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+ PGQTTNVL+TA+Q PG YYMAA AY +A  APFDNTT TA+LEY +   +A+    
Sbjct  268   IMIAPGQTTNVLLTADQTPGHYYMAAHAYNSAN-APFDNTTTTAILEYKSAPCNANKGKS  326

Query  1034  A--LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--G  867
             +  + P+LP  NDT +  AFTS LRS     +       I+ +LFFTVG G +NC     
Sbjct  327   STPIFPQLPGFNDTNSAIAFTSSLRSPSKVNVPLQ----IDENLFFTVGFGLINCTNPNS  382

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
             PRCQGPNGTRFAAS+NNVSFVLP R S++ AYY   PG++TTDFP VPPV+F+YTGNV R
Sbjct  383   PRCQGPNGTRFAASINNVSFVLPTRNSLMQAYYQGQPGVFTTDFPPVPPVKFDYTGNVSR  442

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              LWQP   TK+YK+KFG+ VQIV QDT I + EDHP+HLHG++F +VG GFGNFNP TDP
Sbjct  443   GLWQPVKATKLYKLKFGAKVQIVFQDTSIVTVEDHPMHLHGHNFAVVGSGFGNFNPQTDP  502

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNLI+PP RNTI  P GGW AIRFVADNPG+WL+HCH+DSHL WGLAM+FLVENG+  
Sbjct  503   AKFNLINPPYRNTIGNPPGGWVAIRFVADNPGIWLLHCHLDSHLNWGLAMAFLVENGVGN  562

Query  326   WETVppppPDLPRC  285
              ++V PPP DLP+C
Sbjct  563   LQSVQPPPLDLPQC  576



>ref|XP_011015306.1| PREDICTED: laccase-12-like [Populus euphratica]
 ref|XP_011035865.1| PREDICTED: laccase-12-like [Populus euphratica]
Length=582

 Score =   372 bits (955),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 195/316 (62%), Positives = 240/316 (76%), Gaps = 10/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLI+ +Q P RYYMAA AY +AQ APFDNTT TA+LEY ++  +A     
Sbjct  271   LMLGPGQTTDVLISGDQNPSRYYMAARAYQSAQNAPFDNTTTTAILEYKSSLCAAKNCSS  330

Query  1034  --ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP---  870
                ++P LP+ NDTATVTAFTS  +S     + T     I+ SLFFTVGLG   C P   
Sbjct  331   NKPIMPPLPSFNDTATVTAFTSSFKSTDKTFVPTD----IDESLFFTVGLGLNPCPPNFN  386

Query  869   -GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
                +CQGPNGTRF ASMNNVSFVLP   S+L A++  I G++TTDFP+ PP +F+YTGNV
Sbjct  387   KSRQCQGPNGTRFTASMNNVSFVLPSNFSLLQAHHQRIQGVFTTDFPANPPRKFDYTGNV  446

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R+L+ P  GTK+Y++K+GS VQIVLQDT I ++E+HPIHLHGY FYI+ QGFGN+NP T
Sbjct  447   SRSLFTPVPGTKLYRLKYGSRVQIVLQDTSIVTSENHPIHLHGYDFYIIAQGFGNYNPRT  506

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             DP+ FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLA +FLVENG+
Sbjct  507   DPSKFNLVDPPLRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLATAFLVENGV  566

Query  332   TEWETVppppPDLPRC  285
              E +++  PP DLP C
Sbjct  567   GELQSIESPPEDLPLC  582



>ref|XP_010032957.1| PREDICTED: laccase-13 [Eucalyptus grandis]
 gb|KCW52465.1| hypothetical protein EUGRSUZ_J01857 [Eucalyptus grandis]
Length=575

 Score =   372 bits (954),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 209/312 (67%), Positives = 237/312 (76%), Gaps = 6/312 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTT+VL TA+Q P RYYMAASAY TAQ A FDNTT TAVLEY + T SA     
Sbjct  268   IMIGPGQTTDVLFTADQSPSRYYMAASAYDTAQNAAFDNTTTTAVLEYGSETCSARRQSS  327

Query  1034  -ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCI-PGPR  861
               LLP+LPA NDTAT TAFT+ LRS     +       I+ +LFF VGLG +NC+ P P 
Sbjct  328   QVLLPQLPAFNDTATATAFTAGLRSPSKVGVPNN----IDENLFFAVGLGLINCLLPSPS  383

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPN TRFAASMNNVSFV P   S++ AYY  + GI+T DFP VPPV+F+YTGNV RAL
Sbjct  384   CQGPNNTRFAASMNNVSFVFPTTLSVMQAYYQGVQGIFTADFPPVPPVRFDYTGNVNRAL  443

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             WQP  GTKVYK+K+GS+VQIVLQDT I +TEDHP+HLHGY F +VG GFGNFN   D   
Sbjct  444   WQPVNGTKVYKLKYGSTVQIVLQDTSIVTTEDHPMHLHGYQFSVVGMGFGNFNAARDTPK  503

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL+DPP+RNTI  P GGW AIRFVADNPGVWLMHCHID+HL WGLAM FLVENG    +
Sbjct  504   FNLVDPPVRNTIGTPPGGWVAIRFVADNPGVWLMHCHIDAHLVWGLAMCFLVENGQGAQQ  563

Query  320   TVppppPDLPRC  285
             TV PPP DLP+C
Sbjct  564   TVIPPPQDLPQC  575



>ref|XP_010423473.1| PREDICTED: laccase-12 [Camelina sativa]
Length=565

 Score =   371 bits (953),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 197/314 (63%), Positives = 242/314 (77%), Gaps = 12/314 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+TA+Q+P RYY+AA AY +AQ APFDNTT TA+L+Y  TT+S+     
Sbjct  260   LMLGPGQTTDVLLTADQQPKRYYIAARAYQSAQNAPFDNTTTTAILQYKNTTTSSP----  315

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
              +LP LPA NDT TVT+F+ + +SL   ++       I+  LFFTVGLG  NC    P  
Sbjct  316   PILPVLPAFNDTNTVTSFSRKFKSLRNVVVPKT----IDDDLFFTVGLGLDNCPKNFPKS  371

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN-VPR  687
             RCQG NGTRF ASMNNVSFVLP   S+L A+ N IPG++TTDFP+ PPV+F+YTGN + R
Sbjct  372   RCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPAKPPVKFDYTGNNISR  431

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             AL+QP   TK+Y +K+GS VQ+VLQDT I ++E+HPIHLHGY FYIVG+GFGNFNP  D 
Sbjct  432   ALFQPVKSTKLYNLKYGSRVQVVLQDTNIVTSENHPIHLHGYDFYIVGEGFGNFNPKKDT  491

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+ WGLAM+FLV+NG+ E
Sbjct  492   SKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLAMAFLVDNGVGE  551

Query  326   WETVppppPDLPRC  285
              ET+  PP DLP C
Sbjct  552   LETLEAPPHDLPVC  565



>ref|XP_002315130.1| hypothetical protein POPTR_0010s19080g [Populus trichocarpa]
 gb|EEF01301.1| hypothetical protein POPTR_0010s19080g [Populus trichocarpa]
Length=582

 Score =   372 bits (954),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 195/316 (62%), Positives = 239/316 (76%), Gaps = 10/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt--tssasyS  1041
             +MLGPGQTT+VLI+ +Q P RYYMAA AY +AQ APFDNTT TA+LEY ++   +    S
Sbjct  271   LMLGPGQTTDVLISGDQNPSRYYMAARAYQSAQNAPFDNTTTTAILEYKSSPCAAKNCSS  330

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP---  870
                ++P LP  NDTATVTAFTS  +S     + T     I+ SLFFTVGLG   C P   
Sbjct  331   NKPIMPPLPTFNDTATVTAFTSSFKSTDKTFVPTD----IDESLFFTVGLGLNPCPPNFN  386

Query  869   -GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
                +CQGPNGTRF ASMNNVSFVLP   S+L A++  I G++TTDFP+ PP +F+YTGNV
Sbjct  387   KSSQCQGPNGTRFTASMNNVSFVLPSNFSLLQAHHQRIQGVFTTDFPANPPRKFDYTGNV  446

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R+L+ P  GTK+Y++K+GS VQIVLQDT I ++E+HPIHLHGY FYI+ QGFGN+NP T
Sbjct  447   SRSLFTPVPGTKLYRLKYGSRVQIVLQDTSIVTSENHPIHLHGYDFYIIAQGFGNYNPRT  506

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             DP+ FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLA +FLVENG+
Sbjct  507   DPSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLATAFLVENGV  566

Query  332   TEWETVppppPDLPRC  285
              E +++  PP DLP C
Sbjct  567   GELQSIESPPEDLPLC  582



>ref|XP_006596443.1| PREDICTED: laccase-3-like [Glycine max]
Length=575

 Score =   371 bits (953),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 201/314 (64%), Positives = 244/314 (78%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssas--yS  1041
             +M+GPGQT NVL+TA+Q PGRYYMAA AY TA  A FDNTT TA+LEY + + S      
Sbjct  266   LMIGPGQTINVLVTADQTPGRYYMAARAYQTAMNAAFDNTTTTAILEYKSASCSKKNGQL  325

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--G  867
             P  +LP LPA NDTAT TA+T+ +R L    + T     ++ +L+F VGLG +NC     
Sbjct  326   PRPILPVLPAFNDTATATAYTTGIRGLSKINVFTK----VDVNLYFIVGLGLINCTNPNS  381

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
             PRCQGPNGTRFAAS+NN SFVLP   S++ AYYN IPG++TTDFP VPP+QFNYTGNVPR
Sbjct  382   PRCQGPNGTRFAASINNHSFVLPTTTSLMQAYYNGIPGVFTTDFPPVPPLQFNYTGNVPR  441

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              LW P  GTK++K+K+GS+VQIVLQDT I +TEDHP+H+HG+HF++VG GFGNFNP TDP
Sbjct  442   GLWTPARGTKLFKLKYGSNVQIVLQDTSIVTTEDHPMHIHGFHFFVVGSGFGNFNPATDP  501

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPP+RNTI  P GGW AIRFVADNPG+W +HCHIDSHL WGLA + LVENG+  
Sbjct  502   ARFNLVDPPVRNTIGTPPGGWVAIRFVADNPGIWFLHCHIDSHLNWGLATALLVENGVGP  561

Query  326   WETVppppPDLPRC  285
              ++V PPPPDLP+C
Sbjct  562   SQSVIPPPPDLPQC  575



>ref|XP_010452444.1| PREDICTED: laccase-12-like [Camelina sativa]
Length=565

 Score =   370 bits (951),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 197/314 (63%), Positives = 242/314 (77%), Gaps = 12/314 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+TA+Q+P RYY+AA AY +AQ APFDNTT TA+L+Y  TT+S+     
Sbjct  260   LMLGPGQTTDVLLTADQQPKRYYIAARAYQSAQNAPFDNTTTTAILQYKKTTTSSP----  315

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
              +LP LPA NDT TVT+F+ + +SL   ++       I+  LFFTVGLG  NC    P  
Sbjct  316   PILPVLPAFNDTNTVTSFSRKFKSLRNVVVPKT----IDDDLFFTVGLGLDNCPKNFPKS  371

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN-VPR  687
             RCQG NGTRF ASMNNVSFVLP   S+L A+ N IPG++TTDFP+ PPV+F+YTGN + R
Sbjct  372   RCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPAKPPVKFDYTGNNISR  431

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             AL+QP  GTK+Y +K+GS VQ+VLQDT I ++E+HPIHLHGY FYIVG+GFGNFNP  D 
Sbjct  432   ALFQPVKGTKLYNLKYGSRVQVVLQDTNIVTSENHPIHLHGYDFYIVGEGFGNFNPKKDT  491

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPPLRNT+ V V GWA IRFVADNPGVWLMHCH+D H+ WGLAM+FLV+NG+ E
Sbjct  492   SKFNLVDPPLRNTVAVLVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLAMAFLVDNGVGE  551

Query  326   WETVppppPDLPRC  285
              ET+  PP DLP C
Sbjct  552   LETLEAPPHDLPVC  565



>ref|XP_004239959.1| PREDICTED: laccase-12 [Solanum lycopersicum]
Length=574

 Score =   370 bits (950),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 200/314 (64%), Positives = 242/314 (77%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavle-yttttssasySP  1038
             +MLGPGQTT+VLI A+Q P RYYMAA AYA+AQGAPFDNTT TA+LE  T++ SS     
Sbjct  265   LMLGPGQTTDVLIKADQPPSRYYMAARAYASAQGAPFDNTTTTAILEYKTSSCSSNCVKT  324

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR-  861
               + P LPA NDTAT TAFT++ RS     +       I+ +LFFTVGLG  NC  G R 
Sbjct  325   NPVFPSLPAYNDTATATAFTTKFRSPRRVEVPKE----IDENLFFTVGLGLNNCPRGARS  380

Query  860   --CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRF ASMNNVSFVLP   S+L A++N IPG+++TDFP+VPPV+F+YTGNV R
Sbjct  381   RNCQGPNGTRFTASMNNVSFVLPSNFSLLQAHHNGIPGVFSTDFPAVPPVKFDYTGNVSR  440

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQ   GTK+YK+K+G+ VQ+VLQ T I + E+HPIHLHGY FYI+ +GFGNFNP  D 
Sbjct  441   SLWQLIRGTKLYKLKYGARVQVVLQGTNISTAENHPIHLHGYDFYIIAEGFGNFNPKRDT  500

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPPLRNT  VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVENG+++
Sbjct  501   SKFNLVDPPLRNTASVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGVSQ  560

Query  326   WETVppppPDLPRC  285
              E++  PP DLP C
Sbjct  561   LESLEAPPVDLPVC  574



>gb|EPS73068.1| hypothetical protein M569_01687, partial [Genlisea aurea]
Length=561

 Score =   370 bits (949),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 192/313 (61%), Positives = 238/313 (76%), Gaps = 11/313 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VLIT +Q+P RYY+AA AYA+A+GAPFDNTT TA+L+Y + + ++     
Sbjct  257   IMLGPGQTTDVLITGDQQPNRYYIAARAYASARGAPFDNTTTTAILQYASGSKNSK----  312

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPG---P  864
              ++P++PA NDTATVTAF++ LRS     +       ++H+LFF VGLG  NC PG    
Sbjct  313   PIMPQMPAFNDTATVTAFSASLRSPRQVPVPGN----VDHNLFFAVGLGVTNCPPGASNS  368

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRA  684
              CQGPNG R AASMNNVSFVLP   S+L AY   IPG++T DFP  PPV+F+YTGNV  +
Sbjct  369   SCQGPNGKRLAASMNNVSFVLPSSVSLLQAYKLGIPGVFTRDFPETPPVRFDYTGNVSTS  428

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             LW    GTKVY +K+G +VQ+V+Q T I   E+HPIHLHGY+FYI+ +GFGNF+P TD A
Sbjct  429   LWNTVKGTKVYPLKYGETVQLVIQGTSIVGAENHPIHLHGYNFYILAEGFGNFDPNTDTA  488

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FNLIDPP RNT  +PVGGW+ IRFVADNPGVWLMHCH+D H+TWGLAM+FLVE+G+ E 
Sbjct  489   KFNLIDPPQRNTASLPVGGWSVIRFVADNPGVWLMHCHLDIHITWGLAMAFLVEDGVGEL  548

Query  323   ETVppppPDLPRC  285
             E+V PPP DLP C
Sbjct  549   ESVEPPPLDLPFC  561



>ref|XP_002871156.1| hypothetical protein ARALYDRAFT_487334 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47415.1| hypothetical protein ARALYDRAFT_487334 [Arabidopsis lyrata subsp. 
lyrata]
Length=565

 Score =   370 bits (949),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 194/314 (62%), Positives = 243/314 (77%), Gaps = 12/314 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+TA+Q P RYY+AA AY +AQ APFDNTT TA+L+Y  T +++     
Sbjct  260   LMLGPGQTTDVLLTADQPPKRYYIAARAYQSAQNAPFDNTTTTAILQYKKTRATSK----  315

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
              ++P LPA NDT TVT+F+ + +SL   ++       I+ +LFFT+GLG  NC    P  
Sbjct  316   PIVPVLPAFNDTNTVTSFSRKFKSLRNVVVPKT----IDDNLFFTIGLGLDNCPKNFPKN  371

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN-VPR  687
             RCQG NGTRF ASMNNVSFVLP   S+L A+ N IPG++TTDFPS PPV+F+YTGN + R
Sbjct  372   RCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPSKPPVKFDYTGNNISR  431

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             AL+QP  GTK+YK+K+GS VQ+VLQDT I ++E+HPIHLHG+ FYIVG+GFGNFNP  D 
Sbjct  432   ALFQPVKGTKLYKLKYGSRVQVVLQDTNIVTSENHPIHLHGHDFYIVGEGFGNFNPKKDT  491

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL++PPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+ WGLAM+FLV+NG+ E
Sbjct  492   SKFNLVNPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLAMAFLVDNGVGE  551

Query  326   WETVppppPDLPRC  285
              ET+  PP DLP C
Sbjct  552   LETLEAPPHDLPIC  565



>ref|XP_010067566.1| PREDICTED: laccase-5 [Eucalyptus grandis]
 gb|KCW65725.1| hypothetical protein EUGRSUZ_G03098 [Eucalyptus grandis]
Length=571

 Score =   370 bits (949),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 231/314 (74%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VLI+ +Q P RYYMAA  Y +AQGAPFDNTT TA+LEY +    A     
Sbjct  262   IMLGPGQTTDVLISGDQPPARYYMAAEPYQSAQGAPFDNTTTTAILEYKSAPCPAKGISS  321

Query  1034  A-LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPG  867
               ++P LPA NDTATVTAF    RS     + T     I+ +LF TVGLG  NC      
Sbjct  322   KPVMPTLPAFNDTATVTAFIQSFRSPNKVDVPTD----IDENLFITVGLGLFNCPKNFGS  377

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
              RCQGPNGTRF ASMNNVSFVLP   SIL AY   +PG++TTDFP+ PPVQF+YTGNV R
Sbjct  378   SRCQGPNGTRFTASMNNVSFVLPSNVSILQAYKQGVPGVFTTDFPANPPVQFDYTGNVSR  437

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTKVYK+K+GS VQIVLQ T I + E+HPIH+HGY FYI+  GFGNFNP  D 
Sbjct  438   SLWQPVPGTKVYKLKYGSRVQIVLQGTNIQTAENHPIHIHGYDFYILATGFGNFNPQKDT  497

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPP+RNT+ V V GWA IRFVADNPG WLMHCH+D H+TWGLA+ FLVENG+ E
Sbjct  498   AKFNLVDPPMRNTVGVSVNGWAVIRFVADNPGAWLMHCHLDVHITWGLAVVFLVENGVGE  557

Query  326   WETVppppPDLPRC  285
              +++ PPP DLP C
Sbjct  558   LQSLQPPPADLPPC  571



>emb|CDY04949.1| BnaAnng01310D [Brassica napus]
Length=565

 Score =   370 bits (949),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 238/314 (76%), Gaps = 12/314 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+TANQ P RYY+AA AY +AQ APFDNTT TA+L+Y  TT ++     
Sbjct  260   LMLGPGQTTDVLLTANQPPKRYYIAARAYQSAQNAPFDNTTTTAILQYKKTTKTSP----  315

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
              ++P LPA N T TVT+F+ + +SL   ++       I+ +LFFT+GLG   C    P  
Sbjct  316   PIMPPLPAFNHTKTVTSFSRKFKSLRNVVVPKT----IDENLFFTIGLGLDKCPKNFPKS  371

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN-VPR  687
             RCQG NGTRF ASMNNVSFVLP   S+L A+ N IPG++TTDFP+ PPV+F+YTGN + R
Sbjct  372   RCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPAKPPVKFDYTGNNISR  431

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              L+QP  GTK+YK+K+G+ VQIVLQDT I ++E+HPIHLHGY FYIVG+GFGNFNP  D 
Sbjct  432   GLFQPVKGTKLYKLKYGTRVQIVLQDTNIVTSENHPIHLHGYDFYIVGEGFGNFNPKKDT  491

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+ WGL M+FLVENG+ E
Sbjct  492   SKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLGMAFLVENGVGE  551

Query  326   WETVppppPDLPRC  285
              ET+   P DLP C
Sbjct  552   LETLEAAPHDLPAC  565



>ref|XP_009594351.1| PREDICTED: laccase-12-like [Nicotiana tomentosiformis]
Length=574

 Score =   370 bits (949),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 199/314 (63%), Positives = 243/314 (77%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             +MLGPGQTT+VLI A+Q+P +YYMAA AYA+AQGAPFDNTT TA+LEY T++ S +    
Sbjct  265   LMLGPGQTTDVLIKADQQPAKYYMAARAYASAQGAPFDNTTTTAILEYKTSSCSLNCVKT  324

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR-  861
               + P LPA NDTAT TAFT++ RS     + T     I+ +LFFTVGLG  NC  G R 
Sbjct  325   NPVSPSLPAYNDTATATAFTTKFRSPRKVEVPTD----IDENLFFTVGLGLNNCPRGARS  380

Query  860   --CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRF ASMNNVSFVLP   S+L A++  IPG+++TDFP+ PPV+F+YTGNV R
Sbjct  381   RNCQGPNGTRFTASMNNVSFVLPSNFSLLQAHHQGIPGVFSTDFPAKPPVKFDYTGNVSR  440

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTK+YK+K+G+ VQ+VLQ T IF+ E+HPIHLHGY FYI+ +GFGNFNP  D 
Sbjct  441   SLWQPIRGTKLYKLKYGARVQVVLQGTSIFTAENHPIHLHGYDFYIIAEGFGNFNPKRDA  500

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPPLRNT  VPV GWA IRFVADNPGVWLMHCH+D H+ WGL M+F+VENG++E
Sbjct  501   AKFNLVDPPLRNTASVPVKGWAVIRFVADNPGVWLMHCHLDVHIGWGLGMAFIVENGVSE  560

Query  326   WETVppppPDLPRC  285
              E++  PP DLP C
Sbjct  561   LESLEAPPVDLPVC  574



>ref|XP_010922645.1| PREDICTED: laccase-3-like [Elaeis guineensis]
Length=573

 Score =   370 bits (949),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 197/315 (63%), Positives = 241/315 (77%), Gaps = 12/315 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+T +Q P RYYMAA AYA+AQG PFDNTT TA+L+Y    S+    PG
Sbjct  266   IMLGPGQTTDVLVTMDQPPSRYYMAARAYASAQGVPFDNTTTTAILDYDCGCSTK---PG  322

Query  1034  ALL----PRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPG  867
               +    P LPA NDT+T TAF++ LRSL    + +P    ++  LFFTVGLG  NC PG
Sbjct  323   LAIQPAFPALPAYNDTSTATAFSTGLRSLDKVRIPSP----VDEDLFFTVGLGLFNCPPG  378

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVP  690
               C GPNGTRF AS+NNVSFVLP   SIL A+++ +PG++TTDFP+ PPVQF+YT  NV 
Sbjct  379   KTCGGPNGTRFGASVNNVSFVLPTSFSILQAHHHGVPGVFTTDFPANPPVQFDYTAANVS  438

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             RALWQP   TKVYK+K+GS VQ+VLQ T IF+ E+HPIH+HGY FYI+ +GFGNF+   D
Sbjct  439   RALWQPVPATKVYKLKYGSVVQLVLQGTSIFAAENHPIHIHGYDFYILAEGFGNFDAAKD  498

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
              A FNL+DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVE+G+ 
Sbjct  499   TAKFNLVDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGVG  558

Query  329   EWETVppppPDLPRC  285
             E +++ PPP DLP C
Sbjct  559   ELQSLEPPPADLPLC  573



>ref|XP_004294763.1| PREDICTED: laccase-3-like [Fragaria vesca subsp. vesca]
Length=578

 Score =   370 bits (949),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 207/315 (66%), Positives = 242/315 (77%), Gaps = 9/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleytttt---ssasy  1044
             IMLGPGQTT+VL+TA+Q P  YY AA AY TAQ A FDNTT TA+LEY +     S  + 
Sbjct  268   IMLGPGQTTDVLLTADQPPAHYYAAARAYQTAQNAAFDNTTTTAILEYKSAAACDSKKAK  327

Query  1043  SPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC-IP-  870
                 +LP LPA NDTAT TAF+ Q++S     + T     I+ +L+F VGLG +NC +P 
Sbjct  328   FSAPVLPSLPAYNDTATATAFSVQIKSPSQVQIPTQ----IDENLYFIVGLGLINCTVPN  383

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
              PRCQGPN TRFAASMNNVSFV P+  S++ AYYN IPG++TTDFP VPPVQF+YTGNV 
Sbjct  384   SPRCQGPNNTRFAASMNNVSFVFPKTTSLMQAYYNGIPGVFTTDFPPVPPVQFDYTGNVS  443

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R LW P  GTK+YK+K+GSSVQIVLQDT I +TEDHP+HLHGYHFY+VG GFGNFNP TD
Sbjct  444   RGLWTPSRGTKLYKLKYGSSVQIVLQDTSIVTTEDHPMHLHGYHFYVVGSGFGNFNPRTD  503

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
             PA FNLIDPPLRNTI    GGW AIRFVADNPGVWLMHCH+D+HL  GLAM+F+VENG  
Sbjct  504   PAKFNLIDPPLRNTIGTNPGGWVAIRFVADNPGVWLMHCHLDAHLVLGLAMAFVVENGNG  563

Query  329   EWETVppppPDLPRC  285
               ++V PPP DLP+C
Sbjct  564   PLQSVIPPPADLPQC  578



>ref|XP_006355742.1| PREDICTED: laccase-12-like [Solanum tuberosum]
Length=574

 Score =   369 bits (948),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 196/314 (62%), Positives = 241/314 (77%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLI A+Q+P RYYMAA AYA+AQGAPFD+TT TA+LEY T + S++    
Sbjct  265   LMLGPGQTTDVLIKADQQPARYYMAARAYASAQGAPFDDTTTTAILEYNTASCSSNCIKT  324

Query  1034  A-LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPG  867
               + P LP  NDTAT TAFT++ RS     +       I+ +LFFTVGLG  NC    P 
Sbjct  325   KPVFPSLPEYNDTATATAFTTKFRSPRKVEVPKE----IDENLFFTVGLGLENCPRGAPS  380

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGP+GTR  ASMNNVSFVLP   S+L A+Y  IPG+++TDFP++PPV+F+YTGNV +
Sbjct  381   SYCQGPSGTRLTASMNNVSFVLPSNNSLLQAHYQGIPGVFSTDFPAMPPVKFDYTGNVSQ  440

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTK+YK+K+G+ VQ+VLQ T IFS E+HPIHLHGY FYI+ +GFGNFNP TD 
Sbjct  441   SLWQPIRGTKLYKLKYGARVQVVLQGTSIFSAENHPIHLHGYDFYIIAEGFGNFNPKTDT  500

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPPLRNT  VPV GW  IRFVA+NPGVWLMHCH+D H+TWGLAM+FLVENG+ E
Sbjct  501   SKFNLVDPPLRNTASVPVNGWTVIRFVANNPGVWLMHCHLDVHITWGLAMAFLVENGVCE  560

Query  326   WETVppppPDLPRC  285
              E++  PP DLP C
Sbjct  561   LESLEAPPVDLPVC  574



>emb|CDX70152.1| BnaA10g25010D [Brassica napus]
Length=565

 Score =   369 bits (947),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 237/314 (75%), Gaps = 12/314 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+TA+Q P RYYMAA AY +AQ APFDNTT TA+L Y  TT ++     
Sbjct  260   LMLGPGQTTDVLLTADQPPKRYYMAARAYQSAQNAPFDNTTTTAILHYRNTTKTSL----  315

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
              + P LPA NDT TVT+F+ + +SL   ++       I+ +LFFT+GLG  NC    P  
Sbjct  316   PITPSLPAFNDTNTVTSFSRKFKSLRNVVVPKT----IDENLFFTIGLGLDNCPKNFPKN  371

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN-VPR  687
             RCQG NGTRF ASMNNVSFVLP   S+L A+ N IPG++TTDFP+ PPV+F+YTGN + R
Sbjct  372   RCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPAKPPVKFDYTGNNISR  431

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              L+QP  GTK+YK+K+G+ VQIVLQDT I ++E+HPIHLHGY FYIV +GFGNFNP  D 
Sbjct  432   GLFQPVKGTKLYKLKYGTRVQIVLQDTNIVTSENHPIHLHGYDFYIVAEGFGNFNPKKDN  491

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+ WGL M+FLVENG+ +
Sbjct  492   SKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLGMAFLVENGVGD  551

Query  326   WETVppppPDLPRC  285
              ET+   P DLP C
Sbjct  552   LETLEAAPHDLPVC  565



>ref|XP_010692917.1| PREDICTED: laccase-12 [Beta vulgaris subsp. vulgaris]
Length=575

 Score =   369 bits (947),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 191/315 (61%), Positives = 236/315 (75%), Gaps = 9/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleytttts--sasyS  1041
             +MLGPGQTT+VLI+ +Q  GRYY+AA  Y +AQG  FDNTT TA+LEY +       +  
Sbjct  265   LMLGPGQTTDVLISGDQAAGRYYIAAKPYQSAQGVAFDNTTTTAILEYKSVACLPKGAAK  324

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP---  870
             P  + P LPA NDTATVTAFT++LRS     +       I+ +LFFTVGLG   C P   
Sbjct  325   PTPVFPSLPAFNDTATVTAFTNKLRSPRRVSVPLE----IDENLFFTVGLGLNQCPPNFN  380

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
               +CQGPNGTRF ASMNNVSFVLP   S+L A+   +PG++TTDFP+ PPV F+YTGNV 
Sbjct  381   SNQCQGPNGTRFTASMNNVSFVLPSNWSLLQAHKFGVPGVFTTDFPAQPPVTFDYTGNVS  440

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R+LWQP+ GTK+YK+K+GS VQIV+Q T I + E+HP+H+HGY FYI+ QGFGNFNP TD
Sbjct  441   RSLWQPQTGTKLYKMKYGSRVQIVIQGTSIVTAENHPMHIHGYDFYILAQGFGNFNPRTD  500

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
                FNLIDPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H++WGLAM+F+VE+G+ 
Sbjct  501   TKKFNLIDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHISWGLAMAFVVEDGVG  560

Query  329   EWETVppppPDLPRC  285
             E E++  PP DLP C
Sbjct  561   ELESLEAPPHDLPIC  575



>ref|XP_002520796.1| laccase, putative [Ricinus communis]
 gb|EEF41505.1| laccase, putative [Ricinus communis]
Length=577

 Score =   369 bits (947),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 194/314 (62%), Positives = 235/314 (75%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VLI+ +Q P RYY+AA AY +AQ APFDNTT TA+LEY +    A     
Sbjct  268   IMLGPGQTTDVLISGDQPPARYYIAARAYQSAQNAPFDNTTTTAILEYKSAPCPAKCLTS  327

Query  1034  A-LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPG  867
               ++P LPA NDT TVTAF+  LRS     + T     I+ +LFFT+GLG   C      
Sbjct  328   KPIMPPLPAFNDTPTVTAFSKSLRSPRKVDVPTE----IDENLFFTIGLGLNKCPKNFRA  383

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
              RCQGPNGTRF +SMNNVSFVLP   S+L A   NIPG++TTDFP+ PPV+F+YTGNV +
Sbjct  384   RRCQGPNGTRFTSSMNNVSFVLPSNFSLLQAARQNIPGVFTTDFPAKPPVKFDYTGNVSQ  443

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTK+YK+K+GS VQIVLQDT I + E+HPIHLHGY FY++ +GFGNFNP  D 
Sbjct  444   SLWQPVPGTKLYKLKYGSRVQIVLQDTSIVTPENHPIHLHGYDFYVIAEGFGNFNPKKDT  503

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPP+RNT+ VP  GWA IRFVADNPGVW+MHCH+D H+TWGLAM+FLVE+GI E
Sbjct  504   AKFNLVDPPMRNTVAVPSNGWAVIRFVADNPGVWIMHCHLDVHITWGLAMAFLVEDGIGE  563

Query  326   WETVppppPDLPRC  285
              + + PPP DLP C
Sbjct  564   LQKLEPPPNDLPLC  577



>ref|XP_004307187.1| PREDICTED: laccase-12-like [Fragaria vesca subsp. vesca]
Length=574

 Score =   369 bits (946),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 189/316 (60%), Positives = 232/316 (73%), Gaps = 10/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleytttt---ssasy  1044
             +MLGPGQTT+VLI+ +Q+P  YYMAA AY +AQ APFDNTT TA+LEY +     +++  
Sbjct  263   LMLGPGQTTDVLISGDQQPSLYYMAAHAYFSAQNAPFDNTTTTAILEYKSVRCNNTTSCK  322

Query  1043  SPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---I  873
                 ++P+LPA NDT T   FT   RS     + T     I+ +LFFT+GLG   C    
Sbjct  323   KSKPIMPQLPAFNDTNTADVFTRSFRSPRKVEVPTE----IDENLFFTIGLGLNKCPKHF  378

Query  872   PGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
                RCQGPNGTRF+ASMNNVSFVLP   SIL AY  NIPG+YT+DFP+ PP +F+YTGN+
Sbjct  379   RSRRCQGPNGTRFSASMNNVSFVLPNNMSILQAYQQNIPGVYTSDFPANPPKKFDYTGNI  438

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R+LWQP FGTK YK+++GS VQ+VLQDT I + E+HP+HLHGY FYI+ QGFGNFN  T
Sbjct  439   SRSLWQPSFGTKGYKLRYGSKVQVVLQDTSIVTPENHPVHLHGYDFYILAQGFGNFNAKT  498

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D   FNL+DPPLRNT+ VP  GWA IRFVADNPG WLMHCH+D H+ WGL M FLV+NG+
Sbjct  499   DTKKFNLVDPPLRNTVSVPANGWAVIRFVADNPGAWLMHCHLDVHINWGLGMVFLVDNGV  558

Query  332   TEWETVppppPDLPRC  285
              + +T+ PPP DLPRC
Sbjct  559   GQLQTIEPPPADLPRC  574



>ref|XP_006487674.1| PREDICTED: laccase-3-like [Citrus sinensis]
Length=579

 Score =   367 bits (943),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 196/316 (62%), Positives = 234/316 (74%), Gaps = 11/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasy---  1044
             IM+ PGQTTNVL+TA+Q P RYYMAA AY +A GA FDNTT TA+L Y +   +A     
Sbjct  269   IMIAPGQTTNVLLTADQPPARYYMAARAYNSANGA-FDNTTTTAILAYKSAPCNAKKWGS  327

Query  1043  -SPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP-  870
              S   + P LP  NDTAT TA+ +Q+R+L    + T    + +  LFFTVGLG +NC   
Sbjct  328   NSSAPVFPTLPGFNDTATATAYIAQIRNLQEVKVPT----VNDEDLFFTVGLGLINCSNP  383

Query  869   -GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
               PRCQGPNGTRFAAS+NNVSF  P   S++ AY+ + PG++TTDFP VPP++F+YTGNV
Sbjct  384   NSPRCQGPNGTRFAASINNVSFEFPTGNSLMQAYFQDQPGVFTTDFPPVPPIKFDYTGNV  443

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R LWQP  GTK+YK+KFGSSVQ+V QDT I + EDHP+HLHG+ FY+VG GFGNFNP T
Sbjct  444   SRGLWQPLKGTKLYKLKFGSSVQLVWQDTSIVTVEDHPMHLHGHEFYVVGSGFGNFNPST  503

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D A FNLIDPP RNTI  P GGW AIRFVA+NPG+W MHCH+DSHLTWGLAM+FLVENG 
Sbjct  504   DTAKFNLIDPPRRNTIGTPPGGWVAIRFVANNPGIWFMHCHLDSHLTWGLAMAFLVENGD  563

Query  332   TEWETVppppPDLPRC  285
              E + V  PP DLP C
Sbjct  564   EELQAVQSPPLDLPPC  579



>ref|XP_010045386.1| PREDICTED: laccase-3-like [Eucalyptus grandis]
 gb|KCW87557.1| hypothetical protein EUGRSUZ_B04003 [Eucalyptus grandis]
Length=575

 Score =   367 bits (942),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 207/314 (66%), Positives = 240/314 (76%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTTNVLITANQ PGRYY+AA AY TAQ A FDNTT TA+L+Y +T+ S      
Sbjct  266   IMIGPGQTTNVLITANQAPGRYYVAARAYDTAQNAAFDNTTTTAILQYISTSGSGGQGQS  325

Query  1034  A--LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--G  867
             +  +LP LPA NDT T TAFT+ LRS     + T     I+ +L FTVGLG +NC     
Sbjct  326   SRPILPILPAYNDTTTATAFTASLRSPGKINVPTQ----IDENLLFTVGLGLLNCSNPNS  381

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
             PRCQGPNGTRFAAS+NN+SFV P   S++ AYY  +PG++TTDFP VPP+ FNYTGNV R
Sbjct  382   PRCQGPNGTRFAASVNNISFVFPTTNSLMQAYYQGVPGVFTTDFPPVPPIPFNYTGNVSR  441

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              LWQP   TK+YK+K+GS VQ+V QDT I +TEDHP+HLHGY F +VG GFGNF+P  DP
Sbjct  442   GLWQPVKATKLYKLKYGSRVQLVFQDTSIVTTEDHPMHLHGYSFAVVGTGFGNFDPINDP  501

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
               FNLIDPPLRNTI    GGWAAIRFVADNPGVWLMHCH+DSHL  GLAMSFLVENG+ E
Sbjct  502   PKFNLIDPPLRNTIGSTPGGWAAIRFVADNPGVWLMHCHLDSHLVIGLAMSFLVENGVGE  561

Query  326   WETVppppPDLPRC  285
              ++V PPPPDLPRC
Sbjct  562   LQSVIPPPPDLPRC  575



>ref|XP_009788692.1| PREDICTED: laccase-12-like [Nicotiana sylvestris]
Length=574

 Score =   367 bits (941),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 197/314 (63%), Positives = 241/314 (77%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             +MLGPGQTT+VLI A+Q P +YYMAA AYA+AQGAPFDNTT TA+LEY   + S++ +  
Sbjct  265   LMLGPGQTTDVLIIADQPPAKYYMAARAYASAQGAPFDNTTTTAILEYKAASCSSNCAKT  324

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR-  861
               + P LPA NDTAT TAFT++ RS     + T     I+ +LFFTVGLG  NC  G R 
Sbjct  325   NPVSPSLPAYNDTATATAFTTKFRSPRKVEVPTE----IDENLFFTVGLGLNNCPRGARS  380

Query  860   --CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRF ASMNNVSFVLP   S+L A++  IPG+++TDFP+ PPV+F+YTGNV R
Sbjct  381   RNCQGPNGTRFTASMNNVSFVLPSNYSLLQAHHQGIPGVFSTDFPAKPPVKFDYTGNVSR  440

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTK+YK+K+G+ VQ+VLQ T IF+ E+HPIHLHGY FYI+ +GFGNFNP  D 
Sbjct  441   SLWQPIRGTKLYKLKYGARVQVVLQGTSIFTAENHPIHLHGYDFYIIAEGFGNFNPKRDT  500

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPPLRNT  VPV GW  IRFVADNPGVWLMHCH+D H+ WGL M+F+VENG++E
Sbjct  501   AKFNLVDPPLRNTASVPVKGWTVIRFVADNPGVWLMHCHLDVHIGWGLGMAFIVENGVSE  560

Query  326   WETVppppPDLPRC  285
              E++  PP DLP C
Sbjct  561   LESLEAPPVDLPVC  574



>ref|XP_009628839.1| PREDICTED: laccase-12-like isoform X2 [Nicotiana tomentosiformis]
Length=574

 Score =   367 bits (941),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 201/314 (64%), Positives = 242/314 (77%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             +MLGPGQTT+VLIT +Q   +YYMAA AYA+AQGAPFDNTT TA+LEY T + S++    
Sbjct  265   LMLGPGQTTDVLITTDQPRAKYYMAARAYASAQGAPFDNTTTTAILEYKTASCSSNCVKT  324

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPG---  867
               + P LPA NDTAT TAFT++ RS     + T     I+ +LFFTVGLG  NC  G   
Sbjct  325   NPVFPSLPAYNDTATATAFTTKFRSPRKVEVPTE----IDENLFFTVGLGLNNCPRGASS  380

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRFAASMNNVSFVLP   S+L A++  IPG+++TDFP+ PPV+F+YTGNV R
Sbjct  381   SNCQGPNGTRFAASMNNVSFVLPSNFSLLQAHHQGIPGVFSTDFPANPPVKFDYTGNVSR  440

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTK+YK+K+G+ VQ+VLQ T IF+ E+HPIHLHGY FYI+ +GFGNFNP  D 
Sbjct  441   SLWQPVPGTKLYKLKYGARVQVVLQGTSIFTAENHPIHLHGYDFYIIAEGFGNFNPKRDT  500

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNLIDPPLRNT  VPV GWA IRFVADNPGVWLMHCH+D H+ WGLAM+FLVENG++E
Sbjct  501   AKFNLIDPPLRNTASVPVNGWAVIRFVADNPGVWLMHCHLDVHIGWGLAMAFLVENGVSE  560

Query  326   WETVppppPDLPRC  285
              E++  PP DLP C
Sbjct  561   LESLEAPPVDLPVC  574



>ref|XP_010543702.1| PREDICTED: laccase-12 [Tarenaya hassleriana]
Length=575

 Score =   367 bits (941),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 194/320 (61%), Positives = 242/320 (76%), Gaps = 14/320 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+TA+Q P RYYMAA AY +AQ APFDNTT TA+L+Y ++   ++ +  
Sbjct  260   IMLGPGQTTDVLLTADQPPNRYYMAARAYQSAQNAPFDNTTTTAILQYKSSPCCSNGTAK  319

Query  1034  A------LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC-  876
                    ++P LPA NDT +VT+F+ + RSL   ++       I+ SLFFT+GLG  NC 
Sbjct  320   GIKKTPPIMPFLPAFNDTNSVTSFSGKFRSLRDIVVPKE----IDESLFFTIGLGLDNCP  375

Query  875   --IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYT  702
                P  RCQGPNGTRF ASMNNVSFVLP   S+L A+   IPG++TTDFP+ PPV+F++T
Sbjct  376   KSFPKSRCQGPNGTRFTASMNNVSFVLPSNFSLLQAHSKGIPGVFTTDFPAKPPVRFDFT  435

Query  701   G-NVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNF  525
             G NV R+L+QP  GTK+YK+K+GS VQIVLQDT I + E+HPIHLHGY FYIV +GFGNF
Sbjct  436   GNNVSRSLFQPVRGTKLYKLKYGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAEGFGNF  495

Query  524   NPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLV  345
             +P  D + FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H++WGLAM+FLV
Sbjct  496   DPKKDTSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHISWGLAMAFLV  555

Query  344   ENGITEWETVppppPDLPRC  285
             +NG  E +T+  PP DLP C
Sbjct  556   DNGSGELQTLEAPPEDLPVC  575



>gb|KGN65840.1| hypothetical protein Csa_1G533470 [Cucumis sativus]
Length=531

 Score =   365 bits (937),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 198/302 (66%), Positives = 228/302 (75%), Gaps = 8/302 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTT+VL+TANQ P  YYMAA+AY TAQ APFDNTT TA+L+Y       +  P 
Sbjct  226   IMVGPGQTTDVLVTANQPPAYYYMAATAYNTAQNAPFDNTTTTAILQYNNLPPQQNPQP-  284

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--GPR  861
              +L +LP  NDT T T FT QLRS     +       I+ +LFFTVGLG  NC     PR
Sbjct  285   -ILAQLPNFNDTPTATRFTDQLRSPNRVSVPLH----IDENLFFTVGLGLNNCTNPNSPR  339

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPNGTRF AS+NNVSFV P+  SI+ AYY  +PG++T DFP  PP+QF+YTGNV R L
Sbjct  340   CQGPNGTRFTASINNVSFVFPKSNSIMQAYYQGVPGVFTADFPPFPPLQFDYTGNVSRGL  399

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             WQPR GTK YK+K+GSSVQIVLQDT I + E+HP+HLHGYHFY+VG GFGNFNP TDPA 
Sbjct  400   WQPRRGTKAYKLKYGSSVQIVLQDTSIVTPENHPMHLHGYHFYVVGSGFGNFNPRTDPAR  459

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNLIDPP+RNTI  P GGW AIRF+ADNPG WLMHCHIDSHL WGLAM FLVENG  E +
Sbjct  460   FNLIDPPVRNTIGTPTGGWVAIRFIADNPGAWLMHCHIDSHLAWGLAMVFLVENGEGEMQ  519

Query  320   TV  315
             +V
Sbjct  520   SV  521



>ref|XP_011004433.1| PREDICTED: laccase-12-like [Populus euphratica]
Length=582

 Score =   367 bits (941),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 192/316 (61%), Positives = 240/316 (76%), Gaps = 10/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLI+ +Q P RYYMAA AY +AQ APFDNTT TA+LEY +++ +A     
Sbjct  271   LMLGPGQTTDVLISGDQTPSRYYMAARAYQSAQNAPFDNTTTTAILEYKSSSCAAKNCSA  330

Query  1034  A--LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC----I  873
                ++P LPA NDTATVT FT+  +S   N++ T     I+ SLFFT+GLG   C     
Sbjct  331   NKPIMPPLPAYNDTATVTNFTTSFKSADKNLVPTD----IDESLFFTIGLGLNPCPSNFN  386

Query  872   PGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
                +CQGPNGTRF ASMNNVSFVLP   S+L A++  I G++TTDFP+ PP +F+YTGNV
Sbjct  387   KSSQCQGPNGTRFTASMNNVSFVLPSNFSLLQAHHQRIQGVFTTDFPANPPRKFDYTGNV  446

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R+L+QP  GT++Y +K+GS VQ+VLQDT I + E+HPIHLHGY FYI+ QGFGN+NP T
Sbjct  447   SRSLFQPVAGTRLYNLKYGSRVQLVLQDTSIVTPENHPIHLHGYDFYIIAQGFGNYNPRT  506

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             DP+ FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLA +FLVENG+
Sbjct  507   DPSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLATAFLVENGV  566

Query  332   TEWETVppppPDLPRC  285
              E +++  PP DLP C
Sbjct  567   GELQSIESPPEDLPLC  582



>ref|XP_009125599.1| PREDICTED: laccase-12 [Brassica rapa]
Length=565

 Score =   366 bits (940),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 190/314 (61%), Positives = 237/314 (75%), Gaps = 12/314 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+TANQ P RYY+AA AY +AQ APFDNTT TA+L+Y+  T+++     
Sbjct  260   LMLGPGQTTDVLLTANQPPKRYYIAARAYQSAQNAPFDNTTTTAILQYSKKTTTSK----  315

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
              ++P LPA N T TVT+F+ + +SL   ++       I+ +LFFT+GLG   C    P  
Sbjct  316   PIMPPLPAFNHTKTVTSFSRKFKSLRNVVVPKT----IDENLFFTIGLGLDKCPKNFPKS  371

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN-VPR  687
             RCQG NGTRF ASMNNVSFVLP   S+L A+ N IP ++TTDFP+ PPV+F+YTGN + R
Sbjct  372   RCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPNVFTTDFPAKPPVKFDYTGNNISR  431

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              L+QP  GTK+YK+K+G+ VQIVLQDT I ++E+HPIHLHGY FYIV +GFGNFNP  D 
Sbjct  432   GLFQPVKGTKLYKLKYGTRVQIVLQDTNIVTSENHPIHLHGYDFYIVAEGFGNFNPKKDT  491

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+ WGL M+FLVENG+ E
Sbjct  492   SKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLGMAFLVENGVGE  551

Query  326   WETVppppPDLPRC  285
              ET+   P DLP C
Sbjct  552   LETLEAAPHDLPVC  565



>ref|XP_008457330.1| PREDICTED: laccase-3 [Cucumis melo]
Length=574

 Score =   366 bits (940),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 198/302 (66%), Positives = 228/302 (75%), Gaps = 8/302 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTT+VL+TANQ P  YYMAA+AY TAQ APFDNTT TA+L+Y       +  P 
Sbjct  269   IMIGPGQTTDVLVTANQPPAYYYMAATAYNTAQNAPFDNTTTTAILQYNNLPPQQNPRP-  327

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--GPR  861
              +L +LP  NDT T T FT QLRS     +       I+ +LFFTVGLG  NC     PR
Sbjct  328   -ILAQLPNFNDTPTATRFTDQLRSPHRVSVPLH----IDENLFFTVGLGLNNCTNPNSPR  382

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPNGTRF AS+NNVSFV P+  SI+ AYY  +PG++T DFP  PP+QF+YTGNV R L
Sbjct  383   CQGPNGTRFTASINNVSFVFPKSNSIMQAYYQGVPGVFTADFPPFPPLQFDYTGNVSRGL  442

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             WQPR GTK YK+K+GSSVQIVLQDT I + E+HP+HLHGYHFY+VG GFGNFNP TDPA 
Sbjct  443   WQPRRGTKAYKLKYGSSVQIVLQDTSIVTPENHPMHLHGYHFYVVGSGFGNFNPRTDPAR  502

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNLIDPP+RNTI  P GGW AIRF+ADNPG WLMHCHIDSHL WGLAM FLVENG  E +
Sbjct  503   FNLIDPPVRNTIGTPTGGWVAIRFIADNPGAWLMHCHIDSHLAWGLAMVFLVENGEGEMQ  562

Query  320   TV  315
             +V
Sbjct  563   SV  564



>ref|XP_006399003.1| hypothetical protein EUTSA_v10015589mg [Eutrema salsugineum]
 gb|ESQ40456.1| hypothetical protein EUTSA_v10015589mg [Eutrema salsugineum]
Length=565

 Score =   365 bits (938),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 241/314 (77%), Gaps = 12/314 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+TA+Q P RYY+AA AY +AQ APFDNTT TA+L+Y  TT+++     
Sbjct  260   LMLGPGQTTDVLLTADQPPKRYYIAARAYQSAQNAPFDNTTTTAILQYNKTTTTSP----  315

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
              ++P LPA NDT TVT+F+ + +SL   ++       I+ +L FT+GLG  NC    P  
Sbjct  316   PIVPFLPAFNDTNTVTSFSRKFKSLRNVVVPKT----IDDNLVFTIGLGLDNCPKNFPKN  371

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN-VPR  687
             RCQG NGTRF ASMNNVSFVLP   S+L A+ N IPG++TTDFP+ PPV+F+YTGN + R
Sbjct  372   RCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPAKPPVKFDYTGNNISR  431

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             AL+QP  GTK+YK+K+GS VQ+VLQDT I ++E+HPIHLHGY FYIV +GFGNFNP  D 
Sbjct  432   ALFQPVKGTKLYKLKYGSRVQVVLQDTSIVTSENHPIHLHGYDFYIVAEGFGNFNPKKDT  491

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+ WGLAM+FLV+NG+  
Sbjct  492   SKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLAMAFLVDNGVGT  551

Query  326   WETVppppPDLPRC  285
              ET+  PP DLP C
Sbjct  552   LETLEAPPLDLPVC  565



>ref|XP_010931307.1| PREDICTED: laccase-3-like [Elaeis guineensis]
Length=574

 Score =   365 bits (938),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 192/314 (61%), Positives = 236/314 (75%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+T +Q   RYYMAA AYA+AQG PFDNTT TA+L+Y    S+     G
Sbjct  265   LMLGPGQTTDVLVTMDQPVSRYYMAARAYASAQGVPFDNTTTTAILDYDCGFSAGKSGQG  324

Query  1034  AL---LPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGP  864
              +    P+LPA NDTAT TAF++ LRS     +  P    ++ +LFFTVGLG   C  G 
Sbjct  325   IVQPKFPKLPAYNDTATATAFSTGLRSPRKVDIPGP----VDENLFFTVGLGLFKCPRGK  380

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPR  687
             RC GPNGTRF ASMNN+SFVLP   SIL A++  +PG++TTDFP+ PPVQF+YT  NV R
Sbjct  381   RCGGPNGTRFGASMNNISFVLPANFSILQAHHLGVPGVFTTDFPAQPPVQFDYTAANVSR  440

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP   TKVYK+K+GS VQ+VLQ T IF+ E+HPIH+HG+ FYI+ +GFGNFN   D 
Sbjct  441   SLWQPVAATKVYKLKYGSVVQLVLQGTNIFAAENHPIHIHGHDFYILAEGFGNFNAAKDA  500

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVENG+  
Sbjct  501   ARFNLVDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGVGM  560

Query  326   WETVppppPDLPRC  285
              +++ PPP DLP C
Sbjct  561   LQSLEPPPADLPIC  574



>ref|XP_007206448.1| hypothetical protein PRUPE_ppa003408mg [Prunus persica]
 gb|EMJ07647.1| hypothetical protein PRUPE_ppa003408mg [Prunus persica]
Length=577

 Score =   365 bits (938),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 200/314 (64%), Positives = 238/314 (76%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +M+GPGQTT+VL+TA+Q P  YY+AA  Y TAQ APFDNTT TA+LEY +   S+     
Sbjct  268   LMMGPGQTTDVLLTADQPPAHYYVAARVYQTAQNAPFDNTTTTAILEYKSAACSSKKGQS  327

Query  1034  ALLPRLPAN--NDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC-IP-G  867
                        NDTAT TA+T+Q++S     + T     I+ +LFF VGLG  NC +P  
Sbjct  328   PPPALPLLPFFNDTATATAYTAQIKSPSQVKVPTQ----IDENLFFIVGLGLNNCTVPNS  383

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
             PRCQGPN TRF ASMNNVSFV P+  S++ AYYN +PG++TTDFP VP VQF+YTGNVPR
Sbjct  384   PRCQGPNNTRFTASMNNVSFVFPRTNSLMQAYYNGVPGVFTTDFPPVPLVQFDYTGNVPR  443

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              LW PR GTK+YK+K+GS+VQIVLQDT I +TEDHP+HLHGYHFY++G GFGNFNP TDP
Sbjct  444   GLWTPRRGTKLYKLKYGSNVQIVLQDTSIVTTEDHPMHLHGYHFYVIGSGFGNFNPRTDP  503

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPPLRNTI  P GGW AIRFVADNPGVWLMHCH+D+HL  GLAM+FLVENG   
Sbjct  504   AKFNLVDPPLRNTIGTPPGGWVAIRFVADNPGVWLMHCHLDAHLALGLAMAFLVENGKGP  563

Query  326   WETVppppPDLPRC  285
              ++V PPP DLPRC
Sbjct  564   LQSVIPPPADLPRC  577



>ref|XP_004145307.1| PREDICTED: laccase-3-like [Cucumis sativus]
 ref|XP_004153690.1| PREDICTED: laccase-3-like [Cucumis sativus]
 ref|XP_004168716.1| PREDICTED: laccase-3-like [Cucumis sativus]
Length=574

 Score =   365 bits (938),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 198/302 (66%), Positives = 228/302 (75%), Gaps = 8/302 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTT+VL+TANQ P  YYMAA+AY TAQ APFDNTT TA+L+Y       +  P 
Sbjct  269   IMVGPGQTTDVLVTANQPPAYYYMAATAYNTAQNAPFDNTTTTAILQYNNLPPQQNPQP-  327

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--GPR  861
              +L +LP  NDT T T FT QLRS     +       I+ +LFFTVGLG  NC     PR
Sbjct  328   -ILAQLPNFNDTPTATRFTDQLRSPNRVSVPLH----IDENLFFTVGLGLNNCTNPNSPR  382

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPNGTRF AS+NNVSFV P+  SI+ AYY  +PG++T DFP  PP+QF+YTGNV R L
Sbjct  383   CQGPNGTRFTASINNVSFVFPKSNSIMQAYYQGVPGVFTADFPPFPPLQFDYTGNVSRGL  442

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             WQPR GTK YK+K+GSSVQIVLQDT I + E+HP+HLHGYHFY+VG GFGNFNP TDPA 
Sbjct  443   WQPRRGTKAYKLKYGSSVQIVLQDTSIVTPENHPMHLHGYHFYVVGSGFGNFNPRTDPAR  502

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNLIDPP+RNTI  P GGW AIRF+ADNPG WLMHCHIDSHL WGLAM FLVENG  E +
Sbjct  503   FNLIDPPVRNTIGTPTGGWVAIRFIADNPGAWLMHCHIDSHLAWGLAMVFLVENGEGEMQ  562

Query  320   TV  315
             +V
Sbjct  563   SV  564



>emb|CDY14115.1| BnaC02g02320D [Brassica napus]
Length=564

 Score =   365 bits (937),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 192/314 (61%), Positives = 239/314 (76%), Gaps = 12/314 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+TANQ P RYY+A+ AY +AQ APFDNTT TA+L+YT TT+++     
Sbjct  259   LMLGPGQTTDVLLTANQPPKRYYIASRAYQSAQNAPFDNTTTTAILQYTKTTTTSP----  314

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
              ++P LPA N T TVT+F+ + +SL   ++       I+ +LFFT+GLG   C    P  
Sbjct  315   PIMPPLPAFNHTKTVTSFSRKFKSLRNVVVPKT----IDENLFFTIGLGLDKCPKHFPKN  370

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPR  687
             RCQG NGTRF ASMNNVSFVLP   S+L A+ N IP ++TTDFP+ PPV+F+YTG N+ R
Sbjct  371   RCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPNVFTTDFPAKPPVKFDYTGKNISR  430

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              L+QP  GTK+YK+K+GS VQIVLQDT I ++E+HPIHLHGY FYIV +GFGNFNP  D 
Sbjct  431   GLFQPVKGTKLYKLKYGSRVQIVLQDTNIVTSENHPIHLHGYDFYIVAEGFGNFNPKKDN  490

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+ WGL+M+FLVENG+ E
Sbjct  491   SKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLSMAFLVENGVGE  550

Query  326   WETVppppPDLPRC  285
              ET+   P DLP C
Sbjct  551   LETLEAAPHDLPVC  564



>emb|CDX98841.1| BnaC09g49940D [Brassica napus]
Length=565

 Score =   365 bits (937),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 191/314 (61%), Positives = 236/314 (75%), Gaps = 12/314 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+TA+Q P RYY+AA AY +AQ APFDNTT TA+L Y  T+ ++     
Sbjct  260   LMLGPGQTTDVLLTADQPPKRYYIAARAYQSAQNAPFDNTTTTAILHYRNTSKTSPPIAA  319

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
             +L    PA NDT TVT+F+ + +SL   ++       I+ +LFFT+GLG  NC    P  
Sbjct  320   SL----PAFNDTNTVTSFSRKFKSLRNVVVPKT----IDENLFFTIGLGLDNCPKNFPKN  371

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN-VPR  687
             RCQG NGTRF ASMNNVSFVLP   S+L A+ N IPG++TTDFP+ PPV+F+YTGN + R
Sbjct  372   RCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPAKPPVKFDYTGNNISR  431

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              L+QP  GTK+YK+K+G+ VQIVLQDT I ++E+HPIHLHGY FYIV +GFGNFNP  D 
Sbjct  432   GLFQPVKGTKLYKLKYGTRVQIVLQDTNIVTSENHPIHLHGYDFYIVAEGFGNFNPKKDN  491

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+ WGL M+FLVENG+ E
Sbjct  492   SKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLGMAFLVENGVGE  551

Query  326   WETVppppPDLPRC  285
              ET+   P DLP C
Sbjct  552   LETLEAAPHDLPVC  565



>ref|XP_008232145.1| PREDICTED: laccase-13 [Prunus mume]
Length=577

 Score =   365 bits (937),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 201/314 (64%), Positives = 238/314 (76%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +M+GPGQTT+VL+TA+Q P  YY+AA  Y TAQ APFDNTT TA+LEY +   S+     
Sbjct  268   LMMGPGQTTDVLLTADQPPAHYYVAARVYETAQNAPFDNTTTTAILEYKSAACSSKKGQS  327

Query  1034  ALLPRLPAN--NDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC-IP-G  867
                        NDTAT TAFT+Q++S     + T     I+ +LFF VGLG  NC +P  
Sbjct  328   PPPALPLLPAFNDTATATAFTAQIKSPSQVKVPTQ----IDENLFFIVGLGLNNCTVPNS  383

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
             PRCQGPN TRFAASMNNVSFV P+  S++ AYYN +PG++TTDFP VP VQF+YTGNVPR
Sbjct  384   PRCQGPNNTRFAASMNNVSFVFPRTNSLMQAYYNGVPGVFTTDFPPVPLVQFDYTGNVPR  443

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              LW PR GTK+YK+K+GS+VQIVLQDT I +TEDHP+HLHGYHFY++G GFGNFNP TDP
Sbjct  444   GLWTPRRGTKLYKLKYGSNVQIVLQDTSIVTTEDHPMHLHGYHFYVIGSGFGNFNPRTDP  503

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPP RNTI  P GGW AIRFVADNPGVWLMHCH+DSHL  GL+M+FLVENG   
Sbjct  504   AKFNLVDPPQRNTIGTPPGGWVAIRFVADNPGVWLMHCHLDSHLALGLSMAFLVENGKGP  563

Query  326   WETVppppPDLPRC  285
              ++V PPP DLPRC
Sbjct  564   SQSVIPPPADLPRC  577



>ref|XP_009407324.1| PREDICTED: laccase-3-like [Musa acuminata subsp. malaccensis]
Length=562

 Score =   365 bits (936),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 189/311 (61%), Positives = 232/311 (75%), Gaps = 5/311 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+T +Q   RYY+AA AYA+AQG PFDNTT TA+LEY    S       
Sbjct  256   LMLGPGQTTDVLVTMDQPVSRYYIAARAYASAQGVPFDNTTTTAILEYDCGCSEPVRVVQ  315

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
                P LPA NDT   +AF++ ++SL    +  P    ++ +LFFTVGLG   C  G  C 
Sbjct  316   PAFPALPAYNDTRAASAFSAGIKSLSRVRVPGP----VDENLFFTVGLGLFGCPAGKTCG  371

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPRALW  678
             GPN TRF ASMNNVSFVLP   SIL A+Y  +PG++TTDFP+VPPVQF+YT  N+ R+LW
Sbjct  372   GPNNTRFGASMNNVSFVLPDSYSILQAHYQGVPGVFTTDFPAVPPVQFDYTSQNISRSLW  431

Query  677   QPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASF  498
             QP  GTKVYK+K+GS VQ+VLQ T IF+ E+HPIH+HGY FYI+ +GFGNFNP  D A F
Sbjct  432   QPIAGTKVYKLKYGSVVQLVLQGTNIFAAENHPIHIHGYDFYILAEGFGNFNPAKDNAKF  491

Query  497   NLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWET  318
             NL+DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVE+G+ E ++
Sbjct  492   NLVDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGVGELQS  551

Query  317   VppppPDLPRC  285
             +  PP DLP C
Sbjct  552   LEAPPVDLPPC  562



>ref|XP_004307691.1| PREDICTED: laccase-5-like [Fragaria vesca subsp. vesca]
Length=574

 Score =   365 bits (936),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 191/316 (60%), Positives = 233/316 (74%), Gaps = 10/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasy---  1044
             +MLGPGQTT+VLIT +Q P RYYMAA AY +AQ A FDNTT TA+LEY +   S      
Sbjct  263   LMLGPGQTTDVLITGDQPPSRYYMAARAYFSAQNAQFDNTTTTAILEYESAPCSNCKNGP  322

Query  1043  SPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---I  873
             S   ++P+LPA NDT T +AFT+  RS     + T     I+ +LFFT+GLG  NC    
Sbjct  323   STKPVMPQLPAYNDTNTASAFTTSFRSPRKVEVPTD----IDENLFFTIGLGLNNCPKNF  378

Query  872   PGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
             P  RCQGPNGTRF ASMNNVSFVLP   SIL A+  NIPG+ T+DFP+ PP QF+YTGNV
Sbjct  379   PSSRCQGPNGTRFTASMNNVSFVLPNNISILQAFQQNIPGVVTSDFPANPPQQFDYTGNV  438

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R+LWQP+ GTK Y++ +GS VQ+VLQDT I + E+HPIHLHGY FY++ +GFGNFN  T
Sbjct  439   SRSLWQPKSGTKGYRLNYGSRVQVVLQDTSIVTPENHPIHLHGYDFYVLAEGFGNFNAKT  498

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D   FNL+DPP+RNT+ VPV GWA IRFVADNPG W+MHCH+D H+ WGLAM FLV+NG+
Sbjct  499   DTQKFNLVDPPMRNTVAVPVNGWAVIRFVADNPGAWIMHCHLDVHINWGLAMVFLVDNGV  558

Query  332   TEWETVppppPDLPRC  285
              + ++V PPP DLP C
Sbjct  559   GKLQSVEPPPADLPLC  574



>ref|XP_006488594.1| PREDICTED: laccase-3-like [Citrus sinensis]
Length=578

 Score =   365 bits (936),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 203/316 (64%), Positives = 240/316 (76%), Gaps = 11/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt----tssas  1047
             IM+ PGQTTNVL+TA+Q P RYYMAA AY TA  A FDNTT TA+LEY +         S
Sbjct  268   IMIAPGQTTNVLLTADQPPARYYMAAHAYNTANAA-FDNTTTTAILEYKSAPFNGKKGKS  326

Query  1046  ySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP-  870
              S   + P LP  NDTAT TAFT++++SL    + T    +I+ +LFFTVGLG +NC   
Sbjct  327   RSSAPIFPILPGFNDTATATAFTARIKSLHQVQVPT----VIDENLFFTVGLGLINCSNP  382

Query  869   -GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
               PRCQGPNGTRFAAS+NN+SFV P+R S++ AY    PGI+TTDFP VPP+ F+YTGNV
Sbjct  383   NSPRCQGPNGTRFAASINNISFVFPRRNSLMQAYIQGQPGIFTTDFPPVPPIIFDYTGNV  442

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R LWQPR  TK+YK+KFGS VQ+V QDT I S EDHP+HLHG+ FY+VG GFGNFNP T
Sbjct  443   SRGLWQPRKRTKLYKLKFGSRVQVVFQDTSIVSVEDHPMHLHGHEFYVVGSGFGNFNPST  502

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D A FNLIDPP RNTI  P GGW A+RFVA+NPG+WL+HCHIDSHLTWGLAM+FLVENG+
Sbjct  503   DTAKFNLIDPPRRNTIGTPPGGWVAVRFVAENPGIWLLHCHIDSHLTWGLAMAFLVENGV  562

Query  332   TEWETVppppPDLPRC  285
              + +TV PPP DLPRC
Sbjct  563   GKLQTVQPPPLDLPRC  578



>ref|XP_008799813.1| PREDICTED: laccase-3 [Phoenix dactylifera]
Length=573

 Score =   365 bits (936),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 192/315 (61%), Positives = 240/315 (76%), Gaps = 12/315 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL++ +Q P RYYMAA AYA+AQG PFDNTT TA+L+Y    S+    PG
Sbjct  266   VMLGPGQTTDVLVSMDQPPSRYYMAARAYASAQGVPFDNTTTTAILDYDCGCSAK---PG  322

Query  1034  A----LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPG  867
                    P LPA NDTAT TAF++ LRSL    + +P    ++ +LFFTVGLG  NC PG
Sbjct  323   QGIQPAFPNLPAYNDTATATAFSTGLRSLNKVSIPSP----VDENLFFTVGLGLFNCPPG  378

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVP  690
               C GPNGTRF AS+NN+SFVLP   SIL A+++ + G++TTDFP+ PPVQF+YT  NV 
Sbjct  379   KTCGGPNGTRFGASVNNISFVLPASFSILQAHHHGVAGVFTTDFPANPPVQFHYTATNVT  438

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             RALWQP   TKVYK+++GS VQ+VLQ T IF+ E+HPIH+HGY FYI+ +GFGNF+   D
Sbjct  439   RALWQPVAATKVYKLRYGSVVQLVLQGTSIFAAENHPIHIHGYDFYILAEGFGNFDAAKD  498

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
              A FNL+DPP++NT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVE+G+ 
Sbjct  499   TAKFNLVDPPMKNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGVG  558

Query  329   EWETVppppPDLPRC  285
             E +++ PPP DLP C
Sbjct  559   ELQSLEPPPADLPVC  573



>ref|XP_009122149.1| PREDICTED: laccase-12 [Brassica rapa]
Length=565

 Score =   364 bits (934),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 237/314 (75%), Gaps = 12/314 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+TA+Q P RYY+AA AY +AQ APFDNTT TA+L Y  TT ++   P 
Sbjct  260   LMLGPGQTTDVLLTADQPPKRYYIAARAYQSAQNAPFDNTTTTAILHYRNTTKTS---PP  316

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
               L  LPA NDT TVT+F+ + +SL   ++       I+ +LFFT+GLG  NC    P  
Sbjct  317   VTL-SLPAFNDTNTVTSFSRKFKSLRNVVVPKT----IDENLFFTIGLGLDNCPKNFPKN  371

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN-VPR  687
             RCQG NGTRF ASMNNVSFVLP   S+L A+ N IPG++TTDFP+ PPV+F+YTGN + R
Sbjct  372   RCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPAKPPVKFDYTGNNISR  431

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              L+QP  GTK+YK+K+G+ VQIVLQDT I ++E+HPIHLHGY FYIV +GFGNFNP  D 
Sbjct  432   GLFQPVKGTKLYKLKYGTRVQIVLQDTNIVTSENHPIHLHGYDFYIVAEGFGNFNPKKDN  491

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+ WGL M+FLVENG+ +
Sbjct  492   SKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLGMAFLVENGVGD  551

Query  326   WETVppppPDLPRC  285
              ET+   P DLP C
Sbjct  552   LETLEAAPHDLPVC  565



>ref|XP_006425169.1| hypothetical protein CICLE_v10030322mg [Citrus clementina]
 gb|ESR38409.1| hypothetical protein CICLE_v10030322mg [Citrus clementina]
Length=578

 Score =   364 bits (934),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 203/316 (64%), Positives = 240/316 (76%), Gaps = 11/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt----tssas  1047
             IM+ PGQTTNVL+TA++ P RYYMAA AY TA  A FDNTT TA+LEY +         S
Sbjct  268   IMIAPGQTTNVLLTADRPPARYYMAAHAYNTANAA-FDNTTTTAILEYKSAPFNGKKGKS  326

Query  1046  ySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP-  870
              S   + P LP  NDTAT TAFT++++SL    + T    +I+ +LFFTVGLG +NC   
Sbjct  327   RSSAPIFPILPGFNDTATATAFTARIKSLHQVQVPT----VIDENLFFTVGLGLINCSNP  382

Query  869   -GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
               PRCQGPNGTRFAAS+NN+SFV P+R S++ AY    PGI+TTDFP VPP+ F+YTGNV
Sbjct  383   NSPRCQGPNGTRFAASINNISFVFPRRNSLMQAYIQGQPGIFTTDFPPVPPIIFDYTGNV  442

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R LWQPR  TK+YK+KFGS VQIV QDT I S EDHP+HLHG+ FY+VG GFGNFNP T
Sbjct  443   SRGLWQPRKRTKLYKLKFGSRVQIVFQDTSIVSVEDHPMHLHGHEFYVVGSGFGNFNPST  502

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D A FNLIDPP RNTI  P GGW A+RFVA+NPG+WL+HCHIDSHLTWGLAM+FLVENG+
Sbjct  503   DTAKFNLIDPPRRNTIGTPPGGWVAVRFVAENPGIWLLHCHIDSHLTWGLAMAFLVENGV  562

Query  332   TEWETVppppPDLPRC  285
              + +TV PPP DLPRC
Sbjct  563   GKLQTVQPPPLDLPRC  578



>ref|XP_011076646.1| PREDICTED: laccase-12 [Sesamum indicum]
Length=578

 Score =   363 bits (932),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 238/314 (76%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             +MLGPGQTT++LITA+Q P RYY+AA AYA+AQGAPFDNTT TA+LEY +    A  +  
Sbjct  269   LMLGPGQTTDILITADQPPARYYIAARAYASAQGAPFDNTTTTAILEYKSAPCPAKGATI  328

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPG---  867
               ++P +PA NDTAT T+FT+  RS     + T     I+H+LFFTVGLG  NC PG   
Sbjct  329   KPVMPTMPAFNDTATATSFTTSFRSPRQVPVPTN----IDHNLFFTVGLGLNNCPPGASR  384

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRF ASMNNVSFVLP   S+L A+   IPG++T DFP+ PPV+F+YTGNV R
Sbjct  385   SSCQGPNGTRFTASMNNVSFVLPSNFSLLQAHQQGIPGVFTRDFPANPPVKFDYTGNVSR  444

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              LWQP  GTK+Y +K+G +VQ+VLQ T IF+ E+HPIHLHGY FYI+ +GFGNFNP TD 
Sbjct  445   TLWQPVPGTKLYPLKYGETVQVVLQGTSIFTAENHPIHLHGYDFYIIAEGFGNFNPSTDT  504

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPPLRNT  VPVGGW  IRFVADNPGVWLMHCH+D H+ WGLA +FLVENG+ E
Sbjct  505   AKFNLVDPPLRNTASVPVGGWTVIRFVADNPGVWLMHCHLDVHIGWGLATAFLVENGVGE  564

Query  326   WETVppppPDLPRC  285
              +T+  PP DLP C
Sbjct  565   LQTLEAPPADLPLC  578



>ref|XP_007016999.1| Laccase 3 [Theobroma cacao]
 gb|EOY34618.1| Laccase 3 [Theobroma cacao]
Length=576

 Score =   362 bits (930),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 237/314 (75%), Gaps = 9/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             IM+ PGQTTNVL+TA+Q   RYYMAA AY TA  APFDNTT TA+LEY +   SA     
Sbjct  268   IMIAPGQTTNVLLTADQPSARYYMAAHAYNTAN-APFDNTTTTAILEYKSAPCSAKKGQP  326

Query  1037  -GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--G  867
                + P+LP  NDTAT TAFT+Q++S     +       I+ SLFFTVGLG +NC     
Sbjct  327   VKPIFPQLPGFNDTATATAFTAQIKSPSQVKVPIE----IDESLFFTVGLGLINCSNPNS  382

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
             PRCQGPNGTRFAAS+NNVSFVLP+R S++ AYY   PGI+T DFP VPP+ F+YTGNV R
Sbjct  383   PRCQGPNGTRFAASINNVSFVLPRRNSLMQAYYQGQPGIFTADFPPVPPIPFDYTGNVSR  442

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
              LWQP  GTK++K+KFGS+VQIV QDT I + EDHP+HLHGY FY+VG GFGNF+P  DP
Sbjct  443   GLWQPVKGTKLFKLKFGSTVQIVFQDTSIVTVEDHPMHLHGYQFYVVGSGFGNFDPRNDP  502

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNLIDPP RNTI  P GGW AIRFVADNPG+WL+HCHID+HL WGLA +FLVENG+ +
Sbjct  503   AKFNLIDPPQRNTIGTPPGGWVAIRFVADNPGIWLLHCHIDTHLPWGLATAFLVENGVGK  562

Query  326   WETVppppPDLPRC  285
              +TV PPP DLP C
Sbjct  563   LQTVQPPPLDLPPC  576



>ref|XP_007218932.1| hypothetical protein PRUPE_ppa003349mg [Prunus persica]
 gb|EMJ20131.1| hypothetical protein PRUPE_ppa003349mg [Prunus persica]
Length=583

 Score =   362 bits (930),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 190/318 (60%), Positives = 233/318 (73%), Gaps = 12/318 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLIT +Q P RYY+AA AY +AQ A FDNTT TA+LEY +   S + + G
Sbjct  270   LMLGPGQTTDVLITGDQPPARYYLAARAYFSAQNAAFDNTTTTAILEYKSAPCSPNCTNG  329

Query  1034  A----LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---  876
                  ++P LPA NDTAT +AFT+  RS     + T     I+ +LFFT+GLG  NC   
Sbjct  330   PAVKPIMPPLPAFNDTATASAFTTSFRSPRKVEVPTE----IDENLFFTIGLGLNNCPKH  385

Query  875   -IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG  699
               P  RCQGPNGTRF ASMNNVSFVLP   SIL AY  NIPG++T DFP+ PP++F+YTG
Sbjct  386   FNPTRRCQGPNGTRFTASMNNVSFVLPNNISILQAYQQNIPGVFTADFPANPPLKFDYTG  445

Query  698   NVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNP  519
             NV R+LWQP  GT+ YK+K+GS VQ+VLQDT I + E+HPIHLHGY FYI+ +GFGNFN 
Sbjct  446   NVSRSLWQPLSGTRGYKLKYGSRVQVVLQDTSIVTPENHPIHLHGYDFYILAEGFGNFNA  505

Query  518   GTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVEN  339
              TD   FNL+DPP+RNT+ VP  GWA IRFVADNPG W+MHCH+D H+ WGLAM FLV+N
Sbjct  506   QTDTKKFNLVDPPMRNTVAVPANGWAVIRFVADNPGAWIMHCHLDVHINWGLAMVFLVDN  565

Query  338   GITEWETVppppPDLPRC  285
             G+   +++  PP DLP C
Sbjct  566   GVGTLQSIEAPPADLPLC  583



>ref|XP_009804480.1| PREDICTED: laccase-12-like isoform X1 [Nicotiana sylvestris]
Length=587

 Score =   362 bits (930),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 236/314 (75%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             +MLGPGQTT+VLIT NQ P RYYMAA AYA+AQGAPFDNTT TA+LEY  T  +      
Sbjct  278   LMLGPGQTTDVLITGNQPPARYYMAAQAYASAQGAPFDNTTTTAILEYKNTPCAVQGIKI  337

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPG---  867
               + P LP  NDTAT TAFT+  RS     L T     I+ +LF TVGLG  NC  G   
Sbjct  338   NPIFPSLPPFNDTATATAFTTSFRSPSKVELPTE----IDENLFITVGLGLKNCPKGASS  393

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRFAASMNNVSFVLP   SIL A+   IPGI++TDFP+VP V+F+YTGNV +
Sbjct  394   SSCQGPNGTRFAASMNNVSFVLPPNFSILQAHQQGIPGIFSTDFPAVPLVKFDYTGNVSQ  453

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTKVYK+K+G+ VQ+VLQ T I + E+HPIHLHGY FYI+ +GFGNFNP TD 
Sbjct  454   SLWQPVPGTKVYKLKYGAKVQVVLQGTSIVTGENHPIHLHGYDFYIIAEGFGNFNPQTDT  513

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPP RNT  +PV GW+ IRFVADNPGVWLMHCH+D H+TWGLAMSFLVENG++E
Sbjct  514   AKFNLVDPPRRNTASLPVNGWSVIRFVADNPGVWLMHCHLDVHITWGLAMSFLVENGVSE  573

Query  326   WETVppppPDLPRC  285
              E++  PP DLP C
Sbjct  574   LESLEDPPVDLPVC  587



>gb|EYU20068.1| hypothetical protein MIMGU_mgv1a020620mg [Erythranthe guttata]
Length=551

 Score =   361 bits (927),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 197/314 (63%), Positives = 238/314 (76%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             +MLGPGQTT+VLITA+Q P RYY+A  AYA+ QGAPFDNTT TA+LEY +    A  +  
Sbjct  242   LMLGPGQTTDVLITADQPPARYYIAGQAYASGQGAPFDNTTTTAILEYKSAPCPAKGATI  301

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR-  861
               ++P +PA NDTAT TAFT+  RS     L T     I+H+L FTVGLG +NC PG   
Sbjct  302   KPVMPAMPAFNDTATATAFTTSFRSPRQVPLPTE----IDHNLLFTVGLGLINCPPGASS  357

Query  860   --CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRFAASMNN SFVLP   S+L A+   IPG++TTDFP+ PP+ F+YTGNV R
Sbjct  358   STCQGPNGTRFAASMNNESFVLPSNFSLLQAHQQGIPGVFTTDFPANPPLTFDYTGNVSR  417

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTK+YK+K+G +VQ+VLQ T IF+ E+HPIHLHGY FYI+ +GFGNF+P  D 
Sbjct  418   SLWQPIKGTKLYKLKYGETVQLVLQGTSIFTAENHPIHLHGYDFYILAEGFGNFDPSRDT  477

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
               FNL+DPP RNT  VPVGGW  IRFVADNPGVWLMHCH+D+H+TWGLAM+FLVENG+ E
Sbjct  478   TKFNLVDPPQRNTASVPVGGWTVIRFVADNPGVWLMHCHLDAHITWGLAMAFLVENGLGE  537

Query  326   WETVppppPDLPRC  285
              + + PPP DLP C
Sbjct  538   LQKIEPPPADLPLC  551



>ref|XP_010534627.1| PREDICTED: laccase-5 [Tarenaya hassleriana]
Length=574

 Score =   362 bits (928),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 191/315 (61%), Positives = 232/315 (74%), Gaps = 9/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt--tssasyS  1041
             +MLGPGQTT+VL+T +Q P RYYMAA AY +AQ APFDNTT TA+L Y T         S
Sbjct  264   LMLGPGQTTDVLVTGDQPPNRYYMAARAYQSAQNAPFDNTTTTAILHYKTAPCCGKNGVS  323

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IP  870
                ++P LPA NDT TVT F+   RSL    + T     ++ +LFFT+GLG  NC     
Sbjct  324   LKPIMPLLPAYNDTNTVTQFSKSFRSLRRADVPTE----VDENLFFTIGLGLDNCPKNFR  379

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
               RCQGPNGTRF ASMNNVSFVLP+  S+L A+   IP ++TTDFP++PPV+F+YTGNV 
Sbjct  380   ARRCQGPNGTRFTASMNNVSFVLPRNYSLLQAHAQGIPRVFTTDFPAIPPVKFDYTGNVS  439

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R+L+QP  GTK+YK+KFGS VQIVLQDT I + E+HPIHLHGY FYI+ +GFGNFNP  D
Sbjct  440   RSLYQPVKGTKLYKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYILAEGFGNFNPKKD  499

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
                FNL+DPPLRNT  VPV GW  IRFVADNPGVW+MHCH+D H+ WGLAM+FLV+NG+ 
Sbjct  500   TKKFNLVDPPLRNTAAVPVNGWTVIRFVADNPGVWIMHCHLDVHINWGLAMAFLVDNGVG  559

Query  329   EWETVppppPDLPRC  285
               +++ PPP DLP C
Sbjct  560   ALQSLEPPPADLPVC  574



>ref|XP_007163585.1| hypothetical protein PHAVU_001G246700g [Phaseolus vulgaris]
 gb|ESW35579.1| hypothetical protein PHAVU_001G246700g [Phaseolus vulgaris]
Length=580

 Score =   362 bits (928),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 193/323 (60%), Positives = 228/323 (71%), Gaps = 17/323 (5%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt---------  1062
             +MLGPGQTT+VLIT +Q P RYYMAA AY +AQ A FDNTT TA+LEY +          
Sbjct  262   LMLGPGQTTDVLITGDQPPSRYYMAARAYQSAQNAAFDNTTTTAILEYKSLHHGNHSKHH  321

Query  1061  -tssasySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGF  885
              +         ++P LPA NDT TVTAF+   RS     +       I+ SLFFTVGLG 
Sbjct  322   HSKGVKNKTKPIMPPLPAYNDTNTVTAFSKSFRSPRKVEVPAE----IDQSLFFTVGLGL  377

Query  884   VNC---IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQ  714
               C       RCQGPNGTRF ASMNNVSFVLP   SIL A+Y+  PG++TTDFP  PPV+
Sbjct  378   NKCPKNFKANRCQGPNGTRFTASMNNVSFVLPNNVSILQAHYHRTPGVFTTDFPGKPPVK  437

Query  713   FNYTGNVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGF  534
             F+YTGNV R+LWQP  GTK +K+KFGS V+IVLQDT I + E+HPIHLHGY FYIV +GF
Sbjct  438   FDYTGNVSRSLWQPIPGTKAHKLKFGSRVEIVLQDTSIVTPENHPIHLHGYDFYIVAEGF  497

Query  533   GNFNPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMS  354
             GNF+P  D A FNL+DPPLRNT+ VPV GWA IRFVADNPG WLMHCH+D H+ WGLA  
Sbjct  498   GNFDPKKDRAKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGAWLMHCHLDVHIGWGLATV  557

Query  353   FLVENGITEWETVppppPDLPRC  285
              LVENG+ + +++ PPP DLP C
Sbjct  558   LLVENGVGKLQSIEPPPLDLPLC  580



>ref|XP_009386858.1| PREDICTED: laccase-3-like [Musa acuminata subsp. malaccensis]
Length=572

 Score =   361 bits (927),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 189/311 (61%), Positives = 232/311 (75%), Gaps = 5/311 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+T +Q   RYY+AA AYA+AQG  FDNTT TA+LEY    S       
Sbjct  266   LMLGPGQTTDVLVTMDQPASRYYIAARAYASAQGVAFDNTTTTAILEYDCGCSEPGQGVP  325

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
              + P LPA NDT   +AF++ LRSL T  +  P    ++ +LFFTVGLG   C PG  C 
Sbjct  326   PVFPALPAYNDTGAASAFSAGLRSLSTVDIPGP----VDENLFFTVGLGLFGCPPGKTCG  381

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPRALW  678
             GPN TR AAS+NNVSFVLP   SIL A+Y  +PG++TTDFP+VPPVQF+YT  NV R+LW
Sbjct  382   GPNNTRMAASINNVSFVLPDSYSILQAHYQRVPGVFTTDFPAVPPVQFDYTAQNVSRSLW  441

Query  677   QPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASF  498
             QP   TKVYK+K+GS VQ+VLQ T IF+ E+HPIH+HGY FYI+ +GFGNFN   D A F
Sbjct  442   QPVAATKVYKLKYGSVVQLVLQGTNIFAAENHPIHIHGYDFYILAEGFGNFNAAKDNAKF  501

Query  497   NLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWET  318
             NL+DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLV++G+ E ++
Sbjct  502   NLVDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVDDGVGELQS  561

Query  317   VppppPDLPRC  285
             +  PP DLP C
Sbjct  562   LEAPPVDLPAC  572



>ref|XP_008233819.1| PREDICTED: laccase-12-like [Prunus mume]
Length=583

 Score =   361 bits (927),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 189/318 (59%), Positives = 233/318 (73%), Gaps = 12/318 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLIT +Q P RYY+AA AY +AQ A FDNTT TA+LEY +   S + + G
Sbjct  270   LMLGPGQTTDVLITGDQPPARYYLAARAYFSAQNAAFDNTTTTAILEYKSAPCSPNCTNG  329

Query  1034  A----LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP-  870
                  ++P+LPA NDTAT +AFT+  RS     + T     I+ +LFFT+GLG  NC   
Sbjct  330   PAVKPIMPQLPAFNDTATASAFTTSFRSPRKVEVPTE----IDENLFFTIGLGLNNCPKH  385

Query  869   ---GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG  699
                  RCQGPNGTRF ASMNNVSFVLP   SIL AY  NIPG++T DFP+ PP++F+YTG
Sbjct  386   FNQTRRCQGPNGTRFTASMNNVSFVLPNNISILQAYQQNIPGVFTADFPANPPLKFDYTG  445

Query  698   NVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNP  519
             NV R+LWQP  GT+ YK+K+GS VQ+VLQDT I + E+HPIHLHGY FYI+ +GFGNFN 
Sbjct  446   NVSRSLWQPLSGTRGYKLKYGSRVQVVLQDTSIVTPENHPIHLHGYDFYILAEGFGNFNA  505

Query  518   GTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVEN  339
              TD   FNL+DPP+RNT+ VP  GWA IRFVADNPG W+MHCH+D H+ WGLAM FLV+N
Sbjct  506   QTDTKKFNLVDPPMRNTVAVPANGWAVIRFVADNPGAWIMHCHLDVHINWGLAMVFLVDN  565

Query  338   GITEWETVppppPDLPRC  285
             G+   +++  PP DLP C
Sbjct  566   GVGTLQSIEAPPADLPLC  583



>ref|XP_008363776.1| PREDICTED: laccase-12-like [Malus domestica]
Length=582

 Score =   361 bits (927),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 195/317 (62%), Positives = 233/317 (74%), Gaps = 12/317 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLIT +Q P RYY+AASAY +AQ A FDNTT TA+LEY +   S +   G
Sbjct  271   LMLGPGQTTDVLITGDQPPARYYLAASAYFSAQNAAFDNTTTTAILEYRSAPCSPNCKNG  330

Query  1034  A----LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---  876
                  ++P+LPA NDT T +AFT   RS     + T     I+ +LFFTVGLG  NC   
Sbjct  331   PTVKPIMPQLPAFNDTNTASAFTRSFRSPRKVEVPTE----IDENLFFTVGLGLNNCPNN  386

Query  875   IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN  696
                 RCQGPNGTRF ASMNNVSFV P   SIL AY  NIPG++T DFP+ PP+ F+YTGN
Sbjct  387   FRARRCQGPNGTRFTASMNNVSFVFPT-ISILQAYQQNIPGVFTADFPANPPLTFDYTGN  445

Query  695   VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPG  516
             V R+LWQP  GT+ YK+K+GS VQIVLQDT I + E+HPIHLHGY FYI+ +GFGNFN  
Sbjct  446   VSRSLWQPTPGTRGYKLKYGSRVQIVLQDTSIVTPENHPIHLHGYDFYILAEGFGNFNAQ  505

Query  515   TDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENG  336
              DP  FNL+DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM FLV+NG
Sbjct  506   NDPKKFNLVDPPMRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMVFLVDNG  565

Query  335   ITEWETVppppPDLPRC  285
             +   +++ PPP DLP C
Sbjct  566   VGALQSIEPPPADLPLC  582



>ref|XP_010685886.1| PREDICTED: laccase-3-like [Beta vulgaris subsp. vulgaris]
Length=573

 Score =   361 bits (926),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 193/316 (61%), Positives = 236/316 (75%), Gaps = 12/316 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTT+VL+TANQ PG YYMAA+AY++  G  FDNTT TA+++Y T    ++   G
Sbjct  264   IMIGPGQTTDVLVTANQPPGHYYMAATAYSSGPGIAFDNTTTTAIIQYKTAPCKSNK--G  321

Query  1034  ALLP----RLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCI-P  870
             +LL     +LPA NDT T  AFT+Q +S+    +       I+  LFFTVGLG +NC  P
Sbjct  322   SLLQPIFTQLPAWNDTNTANAFTAQFKSMYEGKVPLE----IDEKLFFTVGLGLINCSNP  377

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDA-YYNNIPGIYTTDFPSVPPVQFNYTGNV  693
               RCQ PN +RFAAS+NN+SFVLP++ SIL + YY N  G++TTDFP VPPVQF+YTGNV
Sbjct  378   SYRCQAPNNSRFAASINNISFVLPRKNSILQSLYYQNNAGVFTTDFPPVPPVQFDYTGNV  437

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R LW P  GTKVYK+KFG++VQIVLQDT I + EDHP+HLHGY F++VG G GNF+P  
Sbjct  438   SRGLWTPVSGTKVYKLKFGTTVQIVLQDTNISTIEDHPMHLHGYQFFVVGSGKGNFDPNR  497

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             DPA FNL+DP +RNTI    GGW AIRF+ADNPGVW MHCHID HLTWGLAM FLVENG 
Sbjct  498   DPARFNLVDPTIRNTIGTSPGGWVAIRFIADNPGVWFMHCHIDLHLTWGLAMVFLVENGD  557

Query  332   TEWETVppppPDLPRC  285
              E +++ PPP DLP+C
Sbjct  558   GELQSIEPPPLDLPQC  573



>ref|XP_009343324.1| PREDICTED: laccase-3-like [Pyrus x bretschneideri]
Length=567

 Score =   360 bits (924),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 238/312 (76%), Gaps = 7/312 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+TA+Q P RYYMAA AY T     FDNTT TA+LEY    SS      
Sbjct  261   IMLGPGQTTDVLLTADQGPARYYMAAGAYQTGLNVAFDNTTTTAILEYKNAASSNQGL-A  319

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC-IP-GPR  861
              + P LPA NDTAT TA+T+Q++SL    + T     I+ +LFFTVGLG  NC +P  PR
Sbjct  320   PVFPTLPAYNDTATATAYTAQIKSLSQVKVPTQ----IDENLFFTVGLGLYNCTVPNSPR  375

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPN TRFAASMNNVSFVLP+  S++ A Y  +PG++TTDFP VP VQFNYTGNVPR L
Sbjct  376   CQGPNNTRFAASMNNVSFVLPRTNSLMQAAYYGVPGVFTTDFPPVPLVQFNYTGNVPRGL  435

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             W PR GTK+YK+K+G++VQIV QDT I +T+DHP+HLHGY FY++G GFGN+NP TDPA 
Sbjct  436   WSPRRGTKLYKLKYGANVQIVFQDTSIVTTDDHPMHLHGYQFYVIGSGFGNYNPSTDPAR  495

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNLIDPP RNTI    GGW AIRF ADNPGVWLMHCH+DSHL+ GLAM+F VENG    +
Sbjct  496   FNLIDPPQRNTIGTGPGGWVAIRFKADNPGVWLMHCHLDSHLSLGLAMAFQVENGNGPLQ  555

Query  320   TVppppPDLPRC  285
             +V PPPPDLPRC
Sbjct  556   SVIPPPPDLPRC  567



>ref|XP_004500522.1| PREDICTED: laccase-12-like [Cicer arietinum]
Length=569

 Score =   360 bits (924),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 229/313 (73%), Gaps = 12/313 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLITANQ   RYY+AASAY +AQ A FDNTT TA+L+Y  +T +      
Sbjct  266   LMLGPGQTTDVLITANQPISRYYIAASAYQSAQNAAFDNTTTTAILQYYNSTKTK-----  320

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
              ++P LP+ NDT TVT F+ + +SL    ++     +I+ +L FT+GLG   C       
Sbjct  321   PIMPSLPSFNDTNTVTKFSKRFKSLKKVEVSN----VIDENLLFTIGLGLQGCPKNFRER  376

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRA  684
             RCQGPNG+R  ASMNNVSF LP   SIL A+Y  IPG++TTDFP+ PPV FNYTGNV R 
Sbjct  377   RCQGPNGSRLTASMNNVSFTLPNNLSILQAHYFGIPGVFTTDFPAKPPVNFNYTGNVSRP  436

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             LWQP  GTKVYK+KFGS VQIVLQDT I + E+HP HLHGY FYIV QGFGNF+P  D A
Sbjct  437   LWQPVPGTKVYKLKFGSRVQIVLQDTSIVTGENHPTHLHGYDFYIVAQGFGNFDPKKDSA  496

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FNL+DPP RNT+ VPV GW+ IRFVADNPG W+MHCH+D H+ WGLA   LVENG+ + 
Sbjct  497   KFNLVDPPKRNTVAVPVNGWSVIRFVADNPGAWIMHCHLDVHINWGLATVLLVENGVGKL  556

Query  323   ETVppppPDLPRC  285
             +++ PPP DLPRC
Sbjct  557   QSIEPPPADLPRC  569



>ref|XP_008374344.1| PREDICTED: laccase-12-like [Malus domestica]
Length=583

 Score =   360 bits (925),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 188/317 (59%), Positives = 226/317 (71%), Gaps = 11/317 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt----tssas  1047
             +M GPGQTT+VLIT +Q P RYY+AASAY +AQ A FDNTT TA+LEY +         S
Sbjct  271   LMJGPGQTTDVLITGDQSPARYYLAASAYFSAQNAAFDNTTTTAILEYKSAPCSPNCKNS  330

Query  1046  ySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---  876
              +   ++ +LPA NDT T +AFT   RS     + T     I+ +LFFT+GLG  NC   
Sbjct  331   SAAKPIMAQLPAFNDTNTASAFTKSFRSPRKVEVPTE----IDENLFFTIGLGLNNCPKN  386

Query  875   IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN  696
                 RCQGPNGTRF ASMNNVSFVLP   SIL AY  NIPG++T DFP+ PP +F+YTGN
Sbjct  387   FGSQRCQGPNGTRFTASMNNVSFVLPNNISILQAYLQNIPGVFTADFPANPPTKFDYTGN  446

Query  695   VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPG  516
             V R+LWQP  GT+ YK+K+GS VQ+VLQDT I + E+HPIHLHGY FYI+ +GFGNFN  
Sbjct  447   VSRSLWQPMSGTRGYKLKYGSRVQVVLQDTSIVTPENHPIHLHGYDFYILAEGFGNFNAQ  506

Query  515   TDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENG  336
             TD   FNL DPPLRNT+ VP  GWA IRFVADNPG W+MHCH+D H+ WGLAM FLV+NG
Sbjct  507   TDTKKFNLXDPPLRNTVAVPANGWAVIRFVADNPGAWIMHCHLDVHINWGLAMVFLVDNG  566

Query  335   ITEWETVppppPDLPRC  285
             +   ++V  PP DLP C
Sbjct  567   VGALQSVEQPPVDLPLC  583



>ref|XP_008369303.1| PREDICTED: laccase-12-like [Malus domestica]
Length=583

 Score =   360 bits (925),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 190/317 (60%), Positives = 229/317 (72%), Gaps = 11/317 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLIT +Q P RYY+AA AY +A  A FDNTT TA+LEY +   S +   G
Sbjct  271   LMLGPGQTTDVLITGDQPPARYYLAARAYFSAHNAAFDNTTTTAILEYKSAPCSPNCKKG  330

Query  1034  A----LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---  876
                  ++P+LPA NDT T +AFT   RS     + T     I+ +LFFT+GLG  NC   
Sbjct  331   PTAKPIMPQLPAFNDTNTASAFTKSFRSPRKVEVPTE----IDENLFFTIGLGLNNCPKN  386

Query  875   IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN  696
                 RCQGPNGTRF ASMNNVSFVLP   SIL AY  NIPG++TTDFP+ PP +F+YTGN
Sbjct  387   FGSQRCQGPNGTRFTASMNNVSFVLPNNISILQAYQQNIPGVFTTDFPANPPRKFDYTGN  446

Query  695   VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPG  516
             V R+LWQP  GT+ YK+K+GS VQ+VLQDT I + E+HPIHLHGY FYI+ +GFGNFN  
Sbjct  447   VSRSLWQPMPGTRGYKLKYGSRVQVVLQDTSIVTPENHPIHLHGYDFYILAEGFGNFNAQ  506

Query  515   TDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENG  336
             TD   FNL+DPPLRNT+ VP  GWA IRFVADNPG W+MHCH+D H+ WGLAM FLV+NG
Sbjct  507   TDTKKFNLVDPPLRNTVAVPANGWAVIRFVADNPGAWIMHCHLDVHINWGLAMVFLVDNG  566

Query  335   ITEWETVppppPDLPRC  285
             +   ++V  PP DLP C
Sbjct  567   VGALQSVEQPPVDLPLC  583



>ref|XP_010087027.1| hypothetical protein L484_012271 [Morus notabilis]
 gb|EXB25845.1| hypothetical protein L484_012271 [Morus notabilis]
Length=571

 Score =   360 bits (923),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 234/315 (74%), Gaps = 10/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLIT +Q P R+Y+AA AY +A  A FDNTT TA+L+Y +   S++    
Sbjct  262   LMLGPGQTTDVLITGDQPPARFYIAARAYQSA-SASFDNTTTTAILQYKSAPCSSTNCAA  320

Query  1034  A--LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IP  870
                ++P+LPA NDTATVTAF+   RS     + T     I+ +LFFT+GLG   C     
Sbjct  321   TKPVMPQLPAFNDTATVTAFSRSFRSPRPVEVPTD----IDENLFFTIGLGLNRCPTKFN  376

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
               RCQGPNGTRFA+SMNNVSFVLP   SIL A+   IPG++T DFP+ PPV+F+YTGNV 
Sbjct  377   SRRCQGPNGTRFASSMNNVSFVLPSTISILQAFQQRIPGVFTADFPANPPVKFDYTGNVS  436

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R+LWQP  GTK Y++K+GS VQIVLQDT I + E+HPIHLHGY FYIV +GFGNFNP TD
Sbjct  437   RSLWQPVPGTKGYRLKYGSRVQIVLQDTNIVTPENHPIHLHGYDFYIVAEGFGNFNPKTD  496

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
                FNL+DPPLRNT+ VP  GWA IRFVADNPG WLMHCH+D H+TWGLAM FLV+NG+ 
Sbjct  497   TKKFNLVDPPLRNTVAVPANGWAVIRFVADNPGAWLMHCHLDVHITWGLAMVFLVDNGVG  556

Query  329   EWETVppppPDLPRC  285
             E +T+ PPP DLP C
Sbjct  557   ELQTMQPPPEDLPLC  571



>ref|XP_006411293.1| hypothetical protein EUTSA_v10016439mg [Eutrema salsugineum]
 gb|ESQ52746.1| hypothetical protein EUTSA_v10016439mg [Eutrema salsugineum]
Length=573

 Score =   359 bits (921),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 191/316 (60%), Positives = 235/316 (74%), Gaps = 10/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             ++LGPGQTT+VLIT +Q P RYYMAA AY +AQ APF NTT TA+L+Y +     +    
Sbjct  262   VVLGPGQTTDVLITGDQPPNRYYMAARAYQSAQNAPFGNTTTTAILQYKSAPCCTNKGIS  321

Query  1034  A--LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IP  870
                ++P LPA NDT TVT F+   RSL    + T     I+ +LF TVGLG  NC     
Sbjct  322   VKPIMPLLPAYNDTNTVTRFSQSFRSLKRAEVPTE----IDENLFVTVGLGLNNCPKNFR  377

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN-V  693
               RCQGPNGTRF ASMNNVSF LP   S+L A+++NIPG++TTDFP+ PPV+F+YTG+ +
Sbjct  378   SRRCQGPNGTRFTASMNNVSFALPSNYSLLQAHHHNIPGVFTTDFPAKPPVKFDYTGSKI  437

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R+L+QP  GTK+YK+K+GS VQIVLQDTGI + E+HPIHLHGY FYI+ +GFGNFNP  
Sbjct  438   SRSLYQPVRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDFYILAEGFGNFNPKK  497

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D A FNL DPPLRNT+ VPV GWA IRFVADNPGVW+MHCH+D+H++WGLAM+FLVE+G 
Sbjct  498   DTAKFNLEDPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDAHISWGLAMAFLVEDGK  557

Query  332   TEWETVppppPDLPRC  285
                ET+  PP DLP C
Sbjct  558   GLLETMEEPPADLPVC  573



>ref|XP_008363777.1| PREDICTED: laccase-12-like [Malus domestica]
Length=583

 Score =   359 bits (921),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 189/317 (60%), Positives = 230/317 (73%), Gaps = 11/317 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLIT +Q P RYY+AA AY +A  A FDNTT TA+LEY +   S +   G
Sbjct  271   LMLGPGQTTDVLITGDQPPARYYLAARAYFSAHNAAFDNTTTTAILEYKSAPCSPNCKKG  330

Query  1034  A----LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---  876
                  ++P+LPA NDT T +AFT   RS     + T     I+ +LFFT+GLG  NC   
Sbjct  331   PTAKPIMPQLPAFNDTNTASAFTKSFRSPRKVEVPTE----IDENLFFTIGLGLNNCPKN  386

Query  875   IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN  696
                 RCQGPNGTRF ASMNNVSFVLP   SIL AY  NIPG++TTDFP+ PP +F+YTGN
Sbjct  387   FGSQRCQGPNGTRFTASMNNVSFVLPNNISILQAYQQNIPGVFTTDFPANPPRKFDYTGN  446

Query  695   VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPG  516
             V R+LWQP  GT+ YK+K+GS VQ+VLQDT I + E+HPIHLHGY FYI+ +GFGNFN  
Sbjct  447   VSRSLWQPMPGTRGYKLKYGSRVQVVLQDTSIVTPENHPIHLHGYDFYILAEGFGNFNAK  506

Query  515   TDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENG  336
             TD   FNL+DPP+RNT+ VP  GWA IRFVADNPG W+MHCH+D H+ WGLAM FLV+NG
Sbjct  507   TDTKKFNLVDPPMRNTVAVPANGWAVIRFVADNPGAWIMHCHLDVHINWGLAMVFLVDNG  566

Query  335   ITEWETVppppPDLPRC  285
             +   +++ PPP DLP C
Sbjct  567   VGALQSIKPPPADLPLC  583



>emb|CDX93188.1| BnaC04g47080D [Brassica napus]
Length=569

 Score =   358 bits (920),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 190/314 (61%), Positives = 232/314 (74%), Gaps = 10/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             I+LGPGQTT+VLIT +Q P  YYMAA AY +AQ APF NTT TA+L+Y +        P 
Sbjct  262   IVLGPGQTTDVLITGDQPPNHYYMAARAYQSAQNAPFGNTTTTAILQYKSAPCCGGAKP-  320

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
              ++P LPA NDT T T F+   RSL    +       ++ +LF T+GLG  NC       
Sbjct  321   -IMPLLPAYNDTNTATRFSQSFRSLKRAEVPPE----LDENLFITIGLGLNNCPKNFRSR  375

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPR  687
             RCQGPNGTRF ASMNNVSF LP   S+L A++++IPG++TTDFP+ PPV+F+YTG N+ R
Sbjct  376   RCQGPNGTRFTASMNNVSFALPSNYSLLQAHHHSIPGVFTTDFPARPPVKFDYTGSNISR  435

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +L+QP  GTK+YK+K+GS VQIVLQDTGI + E+HPIHLHGY FYIV +GFGNFNP  D 
Sbjct  436   SLYQPVRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDFYIVAEGFGNFNPKKDT  495

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL DPPLRNT+ VPV GWA IRFVADNPGVW+MHCH+D+H++WGLAM+FLVENG   
Sbjct  496   AKFNLEDPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDAHISWGLAMAFLVENGSGL  555

Query  326   WETVppppPDLPRC  285
              ET+  PP DLP C
Sbjct  556   LETMEEPPADLPVC  569



>ref|XP_006293898.1| hypothetical protein CARUB_v10022891mg [Capsella rubella]
 gb|EOA26796.1| hypothetical protein CARUB_v10022891mg [Capsella rubella]
Length=579

 Score =   358 bits (920),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 194/320 (61%), Positives = 238/320 (74%), Gaps = 14/320 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt------tss  1053
             I+LGPGQTT+VLIT +Q P RYYMAA AY +AQ APF NTT TA+L+Y +       ++ 
Sbjct  264   IVLGPGQTTDVLITGDQPPNRYYMAARAYQSAQNAPFGNTTTTAILQYKSAPCCGGGSAK  323

Query  1052  asySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC-  876
                S   ++P LPA NDT TVT F+   RSL    + T     I+ +LF T+GLG  NC 
Sbjct  324   KGISVKPIMPLLPAYNDTNTVTRFSQSFRSLRRAEVPTE----IDENLFITIGLGLNNCP  379

Query  875   --IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYT  702
                   RCQGPNGTRF ASMNNVSF LP   S+L A+++ IPG++TTDFP+ PPV+F+YT
Sbjct  380   KNFRSRRCQGPNGTRFTASMNNVSFALPSNYSLLQAHHHGIPGVFTTDFPAKPPVKFDYT  439

Query  701   G-NVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNF  525
             G N+ R+L+QP  GTK+YK+K+GS+VQIVLQDTGI + E+HPIHLHGY FYIV +GFGNF
Sbjct  440   GNNISRSLYQPDRGTKLYKLKYGSTVQIVLQDTGIVTPENHPIHLHGYDFYIVAEGFGNF  499

Query  524   NPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLV  345
             NP  D A FNL DPPLRNT+ VPV GWA IRFVADNPGVW+MHCH+D+H++WGLAM+FLV
Sbjct  500   NPKKDTAKFNLEDPPLRNTVSVPVNGWAVIRFVADNPGVWIMHCHLDAHISWGLAMAFLV  559

Query  344   ENGITEWETVppppPDLPRC  285
             ENG    +T+  PPPDLP C
Sbjct  560   ENGNGVLQTMEQPPPDLPVC  579



>gb|KHN48594.1| Laccase-5 [Glycine soja]
Length=481

 Score =   355 bits (911),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 190/314 (61%), Positives = 229/314 (73%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             IMLGPGQTT+VLI  +Q P RYYMAA AY +AQ APFDNTT TA+LEY +    A  S  
Sbjct  172   IMLGPGQTTDVLIQGDQPPTRYYMAARAYQSAQNAPFDNTTTTAILEYKSAPCPAKGSSI  231

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPG  867
               ++P LPA NDT TVTAF+   RS     +       I+ +LFFT+GLG  NC      
Sbjct  232   KPVMPSLPAYNDTNTVTAFSKSFRSPRKVEVPAE----IDDNLFFTIGLGLNNCPKNFNA  287

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
              +CQGPNGTRF ASMNNVSFVLP   SIL A++  + G++TTDFP+ PPV+F+YTGNV R
Sbjct  288   NQCQGPNGTRFTASMNNVSFVLPNNVSILQAHHLGVQGVFTTDFPTQPPVKFDYTGNVSR  347

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTKV K+KFGS VQIVLQDT I + E+HPIHLHGY FYIV +GFGNF+P  D 
Sbjct  348   SLWQPVQGTKVTKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAEGFGNFDPNKDT  407

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPP+RNT+ VPV GWA IRFVADNPG W+MHCH+D H+ WGLA   LV+NG+  
Sbjct  408   SKFNLVDPPMRNTVAVPVNGWAVIRFVADNPGAWIMHCHLDVHIGWGLATVLLVDNGVGL  467

Query  326   WETVppppPDLPRC  285
              +++ PPP DLP C
Sbjct  468   LQSIEPPPEDLPLC  481



>ref|XP_009369225.1| PREDICTED: laccase-5-like [Pyrus x bretschneideri]
 ref|XP_009350695.1| PREDICTED: laccase-5-like [Pyrus x bretschneideri]
Length=554

 Score =   357 bits (917),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 189/317 (60%), Positives = 228/317 (72%), Gaps = 11/317 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLI  +Q P RYY+AA AY +AQ A FDNTT TA+LEY +   S +   G
Sbjct  242   LMLGPGQTTDVLINGDQPPARYYLAARAYFSAQNAAFDNTTTTAILEYKSAPCSPNCKKG  301

Query  1034  A----LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---  876
                  ++P+LPA NDT T +AFT   RS     + T     I+ +LFFT+GLG   C   
Sbjct  302   PTTKPIMPQLPAFNDTNTASAFTKSFRSPRKVEVPTE----IDENLFFTIGLGLNKCPKN  357

Query  875   IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN  696
                 RCQGPNGTRF ASMNNVSFVLP   SIL AY  NIPG++TTDFP+ PP +F YTGN
Sbjct  358   FGSQRCQGPNGTRFTASMNNVSFVLPNNNSILQAYQQNIPGVFTTDFPANPPQKFGYTGN  417

Query  695   VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPG  516
             V R+LWQP  GT+ YK+K+GS VQ+VLQDT I + E+HPIHLHGY FYI+ +GFGNFN  
Sbjct  418   VSRSLWQPMSGTRGYKLKYGSRVQVVLQDTSIVTPENHPIHLHGYDFYILAEGFGNFNAK  477

Query  515   TDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENG  336
             TD   FNL+DPPLRNT+ VP  GWA IRFVADNPG W+MHCH+D H+ WGLAM FLV+NG
Sbjct  478   TDTKKFNLVDPPLRNTVAVPANGWAVIRFVADNPGAWMMHCHLDVHIHWGLAMVFLVDNG  537

Query  335   ITEWETVppppPDLPRC  285
             +   +++ PPP DLP C
Sbjct  538   VGALQSINPPPADLPLC  554



>gb|KHN38548.1| Laccase-5 [Glycine soja]
Length=481

 Score =   355 bits (910),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 190/314 (61%), Positives = 229/314 (73%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             IMLGPGQTT+VLI  +Q P RYYMAA AY +AQ APFDNTT TA+LEY +    A  S  
Sbjct  172   IMLGPGQTTDVLIQGDQPPTRYYMAARAYQSAQNAPFDNTTTTAILEYKSAPCPAKGSSI  231

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPG  867
               ++P LPA NDT TVTAF+   RS     +       I+ +LFFT+GLG  NC      
Sbjct  232   KPVMPSLPAYNDTNTVTAFSKSFRSPRKVEVPAE----IDENLFFTIGLGLNNCPKNFNA  287

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
              +CQGPNGTRF ASMNNVSFVLP   SIL A++  + G++TTDFP+ PPV+F+YTGNV R
Sbjct  288   NQCQGPNGTRFTASMNNVSFVLPNNVSILQAHHLGVQGVFTTDFPTQPPVKFDYTGNVSR  347

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTKV K+KFGS VQIVLQDT I + E+HPIHLHGY FYIV +GFGNF+P  D 
Sbjct  348   SLWQPVPGTKVTKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAEGFGNFDPNKDT  407

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPP+RNT+ VPV GWA IRFVADNPG W+MHCH+D H+ WGLA   LV+NG+  
Sbjct  408   SKFNLVDPPMRNTVAVPVNGWAVIRFVADNPGAWIMHCHLDVHIGWGLATVLLVDNGVGL  467

Query  326   WETVppppPDLPRC  285
              +++ PPP DLP C
Sbjct  468   LQSIEPPPEDLPLC  481



>ref|XP_004500523.1| PREDICTED: laccase-12-like [Cicer arietinum]
Length=572

 Score =   358 bits (918),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 186/313 (59%), Positives = 229/313 (73%), Gaps = 12/313 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLITANQ   RYY+AASAY +AQ A FDNTT TA+L+Y  +  +      
Sbjct  269   LMLGPGQTTDVLITANQPISRYYIAASAYQSAQNAAFDNTTTTAILQYHNSIKTK-----  323

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
              ++P LP+ NDT TVT F+   +SL    +       I+ +LFFT+GLG   C       
Sbjct  324   PIMPSLPSFNDTNTVTKFSKSFKSLKKVEVPNE----IDENLFFTIGLGLNKCPKNFRKR  379

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRA  684
             RCQG NG+RF ASMNNVSF LP   SIL A+Y  IPG++TTDFP+ PPV+F+YTGNV R+
Sbjct  380   RCQGLNGSRFTASMNNVSFTLPNNLSILQAHYFGIPGVFTTDFPAKPPVKFDYTGNVSRS  439

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             LWQP  GTK YK+KFGS VQIVLQDT I + E+HPIHLHGY FYIV QGFGNF+   D A
Sbjct  440   LWQPVPGTKAYKLKFGSRVQIVLQDTSIVTAENHPIHLHGYDFYIVAQGFGNFDSKKDTA  499

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FNL+DPP+RNT+ VPV GW+ IRFVADNPG W+MHCH+D H+ WGLA   LVE+G+ ++
Sbjct  500   KFNLVDPPMRNTVAVPVNGWSVIRFVADNPGAWIMHCHLDVHINWGLATVLLVEDGVGKY  559

Query  323   ETVppppPDLPRC  285
             +++ PPP DLPRC
Sbjct  560   QSIEPPPLDLPRC  572



>ref|XP_008385007.1| PREDICTED: laccase-3-like [Malus domestica]
Length=368

 Score =   351 bits (900),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 200/312 (64%), Positives = 232/312 (74%), Gaps = 7/312 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTT+VL+TA+QRP RYYMAA AY TAQ  PFDNTT TA+LEY    SS      
Sbjct  62    IMIGPGQTTDVLLTADQRPARYYMAARAYQTAQNVPFDNTTTTAILEYKNAASSNQGL-A  120

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC-IP-GPR  861
              + P LPA NDTAT TA+T+Q++S     + T     I+ +LFFTVGLG  NC +P  P 
Sbjct  121   PVFPTLPAYNDTATATAYTAQIKSPSQVKVPTQ----IDENLFFTVGLGPYNCTVPNSPW  176

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPN TRFAASMNNVSF LP   S + A Y  + G++TTDFP VP VQFNYTGNVPR L
Sbjct  177   CQGPNNTRFAASMNNVSFALPSTNSSMQAAYYGVLGVFTTDFPPVPLVQFNYTGNVPRGL  236

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             W P  GTK+YK+K+G++VQIV QDT   + +DHP+H HG H Y++G GFGN+NP TDPA 
Sbjct  237   WSPCRGTKLYKLKYGANVQIVFQDTSTVTIDDHPMHFHGCHSYVIGSGFGNYNPSTDPAR  296

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNLIDPP RNTI  P GGW AIRF ADNPGVWLMHCH+DSHL  GLAM+ LVENGI   +
Sbjct  297   FNLIDPPQRNTIGTPPGGWVAIRFKADNPGVWLMHCHLDSHLFLGLAMACLVENGIGPLQ  356

Query  320   TVppppPDLPRC  285
             TV PPPPDLPRC
Sbjct  357   TVIPPPPDLPRC  368



>ref|XP_003519418.1| PREDICTED: laccase-5-like [Glycine max]
Length=569

 Score =   357 bits (916),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 191/314 (61%), Positives = 229/314 (73%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             IMLGPGQTT+VLI  +Q P RYYMAA AY +AQ APFDNTT TA+LEY +    A  S  
Sbjct  260   IMLGPGQTTDVLIQGDQPPTRYYMAARAYQSAQNAPFDNTTTTAILEYKSAPCPAKGSSI  319

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPG  867
               ++P LPA NDT TVTAF+   RS     +       I+ +LFFT+GLG  NC      
Sbjct  320   KPVMPSLPAYNDTNTVTAFSKSFRSPRKVEVPAE----IDENLFFTIGLGLNNCPKNFNA  375

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
              +CQGPNGTRF ASMNNVSFVLP   SIL A++  + G++TTDFP+ PPV+F+YTGNV R
Sbjct  376   NQCQGPNGTRFTASMNNVSFVLPNNVSILQAHHLGVQGVFTTDFPTQPPVKFDYTGNVSR  435

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTKV K+KFGS VQIVLQDT I + E+HPIHLHGY FYIV +GFGNF+P  D 
Sbjct  436   SLWQPVPGTKVTKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAEGFGNFDPNKDT  495

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNLIDPP+RNT+ VPV GWA IRFVADNPG W+MHCH+D H+ WGLA   LV+NG+  
Sbjct  496   SKFNLIDPPMRNTVAVPVNGWAVIRFVADNPGAWIMHCHLDVHIGWGLATVLLVDNGVGL  555

Query  326   WETVppppPDLPRC  285
              +++ PPP DLP C
Sbjct  556   LQSIEPPPEDLPLC  569



>ref|XP_009417976.1| PREDICTED: laccase-3-like [Musa acuminata subsp. malaccensis]
Length=578

 Score =   357 bits (917),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 225/302 (75%), Gaps = 7/302 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+V +T NQ PGRYYMAA AYA+A+G  FDNTT TAVLEY  +       PG
Sbjct  270   LMLGPGQTTDVFVTTNQPPGRYYMAAHAYASARGVAFDNTTTTAVLEYKNSGCPTKNGPG  329

Query  1034  AL--LPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR  861
                  P LP  NDT T TAF + +RS     +  P    ++H LFFTVGLG  NC PG R
Sbjct  330   LPPPFPVLPDFNDTPTATAFAAGIRSPYPVQIPGP----VDHHLFFTVGLGLFNCPPGRR  385

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPRA  684
             C GPNGTRF ASMNNVSF LP   S+L A++  +PG++TTDFP+VPPV F+YT  NV R 
Sbjct  386   CGGPNGTRFGASMNNVSFQLPTGLSLLQAHHLGVPGVFTTDFPAVPPVPFDYTAANVSRG  445

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             LWQP  GTK+Y +K+GS VQ+VLQ T IF+ E+HP+H+HGYHFY++  GFGNF+P  D A
Sbjct  446   LWQPVLGTKLYPLKYGSVVQLVLQGTNIFAGEEHPMHIHGYHFYVLATGFGNFDPARDSA  505

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FNL+DPPLRNT+ VPV GWA IRFVADNPGVWL+HCH+D H+TWGLAM+FLVENG+ E 
Sbjct  506   RFNLVDPPLRNTVGVPVNGWAVIRFVADNPGVWLVHCHLDVHITWGLAMAFLVENGVGEL  565

Query  323   ET  318
             ++
Sbjct  566   QS  567



>ref|XP_003544045.1| PREDICTED: laccase-5-like [Glycine max]
Length=569

 Score =   357 bits (915),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 189/314 (60%), Positives = 228/314 (73%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             IMLGPGQTT+VLI  +Q P RYYMAA AY +AQ APFDNTT TA+LEY +       S  
Sbjct  260   IMLGPGQTTDVLIQGDQPPTRYYMAARAYQSAQNAPFDNTTTTAILEYKSAPCPTKGSSI  319

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPG  867
               ++P LPA NDT TVTAF+   RS     +       I+ +LFFT+GLG  NC      
Sbjct  320   KPVMPSLPAYNDTNTVTAFSKSFRSPRKVEVPAE----IDDNLFFTIGLGLNNCPKNFNA  375

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
              +CQGPNGTRF ASMNNVSFVLP   SIL A++  + G++TTDFP+ PPV+F+YTGNV R
Sbjct  376   NQCQGPNGTRFTASMNNVSFVLPNNVSILQAHHLGVQGVFTTDFPTQPPVKFDYTGNVSR  435

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTKV K+KFGS VQIVLQDT I + E+HPIHLHGY FYIV +GFGNF+P  D 
Sbjct  436   SLWQPVQGTKVTKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAEGFGNFDPNKDT  495

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPP+RNT+ VPV GWA IRFVADNPG W+MHCH+D H+ WGLA   LV+NG+  
Sbjct  496   SKFNLVDPPMRNTVAVPVNGWAVIRFVADNPGAWIMHCHLDVHIGWGLATVLLVDNGVGL  555

Query  326   WETVppppPDLPRC  285
              +++ PPP DLP C
Sbjct  556   LQSIEPPPEDLPLC  569



>gb|KGN45808.1| hypothetical protein Csa_6G012820 [Cucumis sativus]
Length=530

 Score =   355 bits (910),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 188/316 (59%), Positives = 234/316 (74%), Gaps = 10/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt---tssasy  1044
             +MLGPGQTT+VLI+ NQ P RYY+AA AY +AQ APF NTT TA+L Y +        S 
Sbjct  219   LMLGPGQTTDVLISGNQVPARYYIAARAYQSAQNAPFGNTTTTAILNYKSAPCPAKKGSP  278

Query  1043  SPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---I  873
             +   ++P LPA NDTATVTAF+ + RS     + T     I+ +LFFTVGLG  NC    
Sbjct  279   TIKPIMPFLPAFNDTATVTAFSRKFRSPRPVPVPTK----IDENLFFTVGLGLNNCPRNF  334

Query  872   PGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
                +CQGPNGTRF ASMNNVSFVLP   SIL A+   IPG+ T+DFP+ PPV+F+YTGNV
Sbjct  335   KPSQCQGPNGTRFTASMNNVSFVLPSNISILQAFQQGIPGVLTSDFPANPPVKFDYTGNV  394

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              ++L+QP  GTK Y++K+GS+VQ+VLQDT I + E+HPIHLHGY FYI+ +GFGNF+P  
Sbjct  395   SQSLFQPVPGTKGYRLKYGSTVQVVLQDTSIVTPENHPIHLHGYDFYIIAEGFGNFDPKK  454

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D   FNL+DPPLRNT+ VPV GWA IRFVADNPG W+MHCH+D H+TWGLAM FLV+NG+
Sbjct  455   DTKKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGAWIMHCHLDVHITWGLAMVFLVDNGV  514

Query  332   TEWETVppppPDLPRC  285
              + +++  PPPDLP C
Sbjct  515   GQLQSIEAPPPDLPLC  530



>ref|XP_003579045.1| PREDICTED: laccase-23-like [Brachypodium distachyon]
Length=569

 Score =   356 bits (913),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 238/313 (76%), Gaps = 11/313 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             ++LGPGQTT+VL+T +Q PGRYY+AA AYA+AQG PFDNTT TA+ +Y     + S +  
Sbjct  265   LVLGPGQTTDVLVTFDQPPGRYYLAARAYASAQGVPFDNTTTTAIFDYGAGDGTTSPA--  322

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
               +P LPA NDTATVTAFT+ LR+L +  L +    +++  LFFTVG+G  NC  G  C 
Sbjct  323   --MPTLPAYNDTATVTAFTTSLRNLHSIGLPS----VVDEDLFFTVGVGLFNCSKGQSCG  376

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNN--IPGIYTTDFPSVPPVQFNYTG-NVPRA  684
             GPN TRFAAS+NNVSFVLP   SIL A+Y+     G++TTDFP+ PPVQF+YT  NV R 
Sbjct  377   GPNNTRFAASINNVSFVLPSTVSILQAHYDGGANAGVFTTDFPANPPVQFDYTAQNVSRG  436

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             LWQP  GTK+Y +K+G+ VQ+VLQ T IF+ E+HPIH+HGY FYI+ +GFGNF+  TD A
Sbjct  437   LWQPVPGTKLYNLKYGAVVQVVLQGTNIFAGENHPIHIHGYDFYILAEGFGNFDAATDTA  496

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FNL DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLV++G+ E 
Sbjct  497   KFNLDDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVKDGVGEL  556

Query  323   ETVppppPDLPRC  285
             +++  PPPDLP C
Sbjct  557   QSLGAPPPDLPIC  569



>ref|XP_006367545.1| PREDICTED: laccase-5-like [Solanum tuberosum]
Length=574

 Score =   356 bits (913),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 197/314 (63%), Positives = 237/314 (75%), Gaps = 9/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             +MLGPGQTT+VLI  NQ PGRYY+A  AYA+AQG PFDNTT+TA+LEY  T  S      
Sbjct  266   LMLGPGQTTDVLIDGNQPPGRYYIAVRAYASAQG-PFDNTTSTAILEYKDTPCSVQGIKI  324

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR-  861
               + P LPA NDTAT T F++  RS     + T     I+ +LFFTVGLG  NC  G   
Sbjct  325   NPIFPSLPAFNDTATATTFSTSFRSPRQVEVPTE----IDENLFFTVGLGLNNCPRGSSS  380

Query  860   --CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRF ASMNN+SFVLP   SIL A++  IPG+++TDFP+VPP++F+YTGNV R
Sbjct  381   RSCQGPNGTRFTASMNNMSFVLPPNFSILQAHHQGIPGVFSTDFPAVPPLKFDYTGNVSR  440

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTKVYK+K+G+ VQ+VLQ T I + E+HPIHLHGY FYI+ +GFGNFNP TD 
Sbjct  441   SLWQPIRGTKVYKLKYGARVQVVLQGTSIVTGENHPIHLHGYDFYIIAEGFGNFNPQTDT  500

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPP RNT  VPV GW+ IRFVA+NPGVWLMHCH+D H+TWGLAMSFLVENG++E
Sbjct  501   AKFNLVDPPTRNTASVPVNGWSVIRFVANNPGVWLMHCHLDVHITWGLAMSFLVENGVSE  560

Query  326   WETVppppPDLPRC  285
              E++  PP DLP C
Sbjct  561   LESLEEPPVDLPVC  574



>ref|XP_009141888.1| PREDICTED: laccase-5-like [Brassica rapa]
Length=569

 Score =   356 bits (913),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 190/314 (61%), Positives = 231/314 (74%), Gaps = 10/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             I+LGPGQTT+VLIT +Q P  YYMAA AY +AQ APF NTT TA+L+Y +        P 
Sbjct  262   IVLGPGQTTDVLITGDQPPNHYYMAARAYQSAQNAPFGNTTTTAILQYKSAPCCGGAKP-  320

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
              ++P LPA NDT T T F+   RSL      T     ++ +LF T+GLG  NC       
Sbjct  321   -IMPLLPAYNDTNTATRFSQSFRSLKRAEFPTE----LDENLFITIGLGLNNCPKNFRSR  375

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPR  687
             RCQGPNGTRF ASMNNVSF LP   S+L A+++ IPG++TTDFP+ PPV+F+YTG N+ R
Sbjct  376   RCQGPNGTRFTASMNNVSFALPSNYSLLQAHHHAIPGVFTTDFPARPPVKFDYTGSNISR  435

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +L+QP  GTK+YK+K+GS VQIVLQDTGI + E+HPIHLHGY FYIV +GFGNFNP  D 
Sbjct  436   SLYQPVRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDFYIVAEGFGNFNPKKDT  495

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL +PPLRNT+ VPV GWA IRFVADNPGVW+MHCH+D+H++WGLAM+FLVENG   
Sbjct  496   AKFNLENPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDAHISWGLAMAFLVENGNGL  555

Query  326   WETVppppPDLPRC  285
              ET+  PP DLP C
Sbjct  556   LETMEEPPADLPVC  569



>ref|XP_002881718.1| hypothetical protein ARALYDRAFT_903327 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57977.1| hypothetical protein ARALYDRAFT_903327 [Arabidopsis lyrata subsp. 
lyrata]
Length=581

 Score =   356 bits (914),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 192/323 (59%), Positives = 236/323 (73%), Gaps = 17/323 (5%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleytt---------t  1062
             I+LGPGQTT+VLIT +Q P RYYMAA AY +AQ APF NTT TA+L+Y +         +
Sbjct  262   IVLGPGQTTDVLITGDQPPNRYYMAARAYQSAQNAPFGNTTTTAILQYKSAPCCGVGGGS  321

Query  1061  tssasySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFV  882
              +    S   ++P LPA NDT TVT F+   RSL    + T     I+ +LF TVGLG  
Sbjct  322   GTKKGISVKLIMPILPAYNDTNTVTRFSQSFRSLRRAEVPTE----IDENLFVTVGLGLN  377

Query  881   NC---IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQF  711
             NC       RCQGPNGTRF ASMNN+SF LP   S+L A+++ IPG++TTDFP+ PPV+F
Sbjct  378   NCPKNFRSRRCQGPNGTRFTASMNNISFALPSNYSLLQAHHHGIPGVFTTDFPAKPPVKF  437

Query  710   NYTGN-VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGF  534
             +YTGN + R+L+QP  GTK+YK+K+GS VQIVLQDTGI + E+HPIHLHGY FYI+ +GF
Sbjct  438   DYTGNNISRSLYQPDRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDFYIIAEGF  497

Query  533   GNFNPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMS  354
             GNFNP  D A FNL DPPLRNT+ VPV GWA IRFVADNPGVW+MHCH+D+H++WGLAM+
Sbjct  498   GNFNPKKDTAKFNLEDPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDAHISWGLAMA  557

Query  353   FLVENGITEWETVppppPDLPRC  285
             FLVENG    +T+  PP DLP C
Sbjct  558   FLVENGNGVLQTMEQPPADLPVC  580



>emb|CAN75316.1| hypothetical protein VITISV_024159 [Vitis vinifera]
Length=566

 Score =   355 bits (912),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 191/315 (61%), Positives = 226/315 (72%), Gaps = 20/315 (6%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleytttt--ssasyS  1041
             IMLGPGQTT+VLIT +Q P RYYMAA AY +AQGAPFDNTT TA+LEY +    +    S
Sbjct  267   IMLGPGQTTDVLITGDQPPARYYMAARAYQSAQGAPFDNTTTTAILEYKSAPCPAKKGVS  326

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP---  870
                + P LPA NDTATVTAF+   RS     + T     I+ SLFFTVGLG   C P   
Sbjct  327   TTPVFPSLPAFNDTATVTAFSKSFRSPAKVEVPTD----IDESLFFTVGLGLNRCPPKFK  382

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
               +CQGPNGTRF ASMNNVSFVLP   S+L A+   IPG++TTD+P+ PPV+F+YTGNV 
Sbjct  383   SSQCQGPNGTRFTASMNNVSFVLPSNFSLLQAHQQGIPGVFTTDYPAAPPVKFDYTGNVS  442

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R+LWQP               Q+VLQ T IF+ E+HPIHLHGY FYI+ +GFGNFNP TD
Sbjct  443   RSLWQPV-----------PEFQVVLQGTSIFTAENHPIHLHGYDFYIIAEGFGNFNPSTD  491

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
              + FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVENG+ 
Sbjct  492   TSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGVG  551

Query  329   EWETVppppPDLPRC  285
               +++  PP DLP C
Sbjct  552   ALQSIEXPPADLPLC  566



>ref|XP_006644937.1| PREDICTED: laccase-3-like [Oryza brachyantha]
Length=566

 Score =   355 bits (912),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 228/313 (73%), Gaps = 8/313 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssas--yS  1041
             +M+ PGQTT+VL+T +Q P RYY+AA AY T Q A FDNTT TAV+EY    ++      
Sbjct  259   LMIAPGQTTDVLVTMDQAPTRYYIAARAYDTVQNAAFDNTTTTAVIEYDCGCATDFGPSI  318

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR  861
             P A  P LPA NDT T TAF + ++S     +  P    ++ +LFFTVGLG  NC PG +
Sbjct  319   PPAF-PALPAFNDTKTATAFAAGIKSPHEVKVPGP----VDENLFFTVGLGLFNCEPGQQ  373

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPRA  684
             C GPN TRF ASMNN+SFV PQ  S+L A+Y  IPG++TTDFP+ PPVQF+YT  NVPRA
Sbjct  374   CGGPNNTRFTASMNNISFVFPQTTSLLHAHYYGIPGVFTTDFPAYPPVQFDYTAQNVPRA  433

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             LWQP   TK+YK+KFGS VQIVLQDT I S E+HPIH+HGY FYI+ +GFGNF+   D  
Sbjct  434   LWQPVPATKLYKLKFGSVVQIVLQDTSIVSPENHPIHIHGYDFYILAEGFGNFDAKKDAE  493

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FN +DPP RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVE+G  + 
Sbjct  494   KFNYVDPPQRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGYGKL  553

Query  323   ETVppppPDLPRC  285
             ET+  PP DLP C
Sbjct  554   ETLEAPPVDLPMC  566



>ref|XP_006431538.1| hypothetical protein CICLE_v10003240mg [Citrus clementina]
 gb|ESR44778.1| hypothetical protein CICLE_v10003240mg [Citrus clementina]
Length=579

 Score =   355 bits (912),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 198/316 (63%), Positives = 235/316 (74%), Gaps = 11/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasy---  1044
             IM+ PGQTTNVL+TA+Q P RYYMAA AY +A  A FDNTT TA+L Y +   +A     
Sbjct  269   IMIAPGQTTNVLLTADQPPARYYMAARAYNSANVA-FDNTTTTAILAYKSAPCNAKNGGS  327

Query  1043  -SPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP-  870
              S   + P LP  NDTAT TA+T+Q+RSL    + T     I+  LFFTVGLG +NC   
Sbjct  328   NSSAPVFPTLPGFNDTATATAYTAQIRSLHEVKVPTA----IDEDLFFTVGLGLINCSNP  383

Query  869   -GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
               PRCQGPNGTRFAAS+NNVSF  P   S++ AY+ + PG++TTDFP VPP++F+YTGNV
Sbjct  384   NSPRCQGPNGTRFAASINNVSFEFPTGNSLMQAYFQDQPGVFTTDFPPVPPIKFDYTGNV  443

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R LWQP  GTK+YK+KFGSSVQ+V QDT I + EDHP+HLHG+ FY+VG GFGNFNP T
Sbjct  444   SRVLWQPLKGTKLYKLKFGSSVQLVWQDTSIVTVEDHPMHLHGHEFYVVGSGFGNFNPST  503

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D   FNLIDPP RNTI +P GGW AIRFVA+NPG+W MHCH+DSHLTWGLAM+FLVENG 
Sbjct  504   DTPKFNLIDPPRRNTIGMPPGGWVAIRFVANNPGIWFMHCHLDSHLTWGLAMAFLVENGD  563

Query  332   TEWETVppppPDLPRC  285
              E +TV  PP DLP C
Sbjct  564   KELQTVQSPPLDLPPC  579



>ref|XP_007141728.1| hypothetical protein PHAVU_008G220300g [Phaseolus vulgaris]
 gb|ESW13722.1| hypothetical protein PHAVU_008G220300g [Phaseolus vulgaris]
Length=610

 Score =   357 bits (915),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 187/314 (60%), Positives = 226/314 (72%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             IMLGPGQTT+VLI  +Q P RYYMAA AY +AQ APFDNTT TA+L Y +    A     
Sbjct  301   IMLGPGQTTDVLIQGDQPPSRYYMAARAYQSAQNAPFDNTTTTAILNYKSAPCPAKGVSI  360

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPG---  867
               L+P LPA NDT TVT F++  RS     +       I+  LFFT+GLG  NC P    
Sbjct  361   KPLMPSLPAYNDTNTVTTFSNSFRSPRKVEVPAE----IDDDLFFTIGLGLNNCPPNFSP  416

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
              +CQGPNGTRF ASMNNVSFVLP   SIL A++  + G++TTDFP+ PP++F+YTGNV R
Sbjct  417   NQCQGPNGTRFTASMNNVSFVLPNNVSILQAHHLGVQGVFTTDFPTQPPLKFDYTGNVSR  476

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTKV K+KFGS VQIVLQDT I + E+HPIHLHGY FYIV +GFGNF+P  D 
Sbjct  477   SLWQPVPGTKVTKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAEGFGNFDPKKDT  536

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             + FNL+DPP+RNT+ VPV GWA IRFVADNPG W+MHCH+D H+ WGLA   LV+NG+  
Sbjct  537   SKFNLVDPPMRNTVAVPVNGWAVIRFVADNPGAWIMHCHLDVHIGWGLATVLLVDNGVGL  596

Query  326   WETVppppPDLPRC  285
              +++  PP DLP C
Sbjct  597   LQSIEAPPEDLPLC  610



>emb|CDY52925.1| BnaA04g29320D [Brassica napus]
Length=573

 Score =   355 bits (912),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 190/314 (61%), Positives = 231/314 (74%), Gaps = 10/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             I+LGPGQTT+VLIT +Q P  YYMAA AY +AQ APF NTT TA+L+Y +        P 
Sbjct  266   IVLGPGQTTDVLITGDQPPNHYYMAARAYQSAQNAPFGNTTTTAILQYKSAPCCGGAKP-  324

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
              ++P LPA NDT T T F+   RSL    + T     ++ +LF T+GLG  NC       
Sbjct  325   -IMPLLPAYNDTNTATRFSQSFRSLKRAEVPTE----LDENLFITIGLGLNNCPKNFRSR  379

Query  863   RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPR  687
             RCQGPNGTRF ASMNNVSF LP   S+L A+++ IPG++TTDFP+ PPV+F+YTG N+ R
Sbjct  380   RCQGPNGTRFTASMNNVSFALPSNYSLLQAHHHAIPGVFTTDFPARPPVKFDYTGSNISR  439

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +L+Q   GTK+YK+K+GS VQIVLQDTGI + E+HPIHLHGY FYIV +GFGNFNP  D 
Sbjct  440   SLYQSVRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDFYIVAEGFGNFNPKKDT  499

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL DPPLRNT+ VPV GWA IRFVADNPGVW+MHCH+D+H++WGLAM+FLVENG   
Sbjct  500   AKFNLEDPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDAHISWGLAMAFLVENGNGL  559

Query  326   WETVppppPDLPRC  285
              ET+  PP DLP C
Sbjct  560   LETMEEPPADLPVC  573



>ref|XP_004241090.2| PREDICTED: laccase-12-like isoform X1 [Solanum lycopersicum]
Length=583

 Score =   355 bits (912),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 197/314 (63%), Positives = 236/314 (75%), Gaps = 9/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             +MLGPGQTT+VLI  NQ PGRYY+A  AYA+AQG PFDNTT+TA+LEY  T  S      
Sbjct  275   LMLGPGQTTDVLIDGNQPPGRYYIAVRAYASAQG-PFDNTTSTAILEYKNTPCSVQGIKI  333

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR-  861
               + P LPA NDTAT T F++  RS     + T     I+ +L FTVGLG  NC  G   
Sbjct  334   NPIFPSLPAFNDTATATTFSTSFRSPRQVDVPTE----IDENLLFTVGLGLNNCPRGSSS  389

Query  860   --CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRF ASMNN+SFVLP   SIL A+Y  I G+++TDFP+VPPV+F+YTGNV R
Sbjct  390   RSCQGPNGTRFTASMNNMSFVLPPNFSILQAHYQGIAGVFSTDFPAVPPVKFDYTGNVSR  449

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTKVYK+K+G+ VQ+VLQ T I + E+HPIHLHGY FYI+ +GFGNFNP TD 
Sbjct  450   SLWQPVRGTKVYKLKYGARVQVVLQGTSIVTGENHPIHLHGYDFYIIAEGFGNFNPQTDT  509

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPP+RNT  VPV GW+ IRFVA+NPGVWLMHCH+D H+TWGLAMSFLVENG++E
Sbjct  510   AKFNLVDPPIRNTASVPVNGWSVIRFVANNPGVWLMHCHLDVHITWGLAMSFLVENGVSE  569

Query  326   WETVppppPDLPRC  285
              E++  PP DLP C
Sbjct  570   LESLVEPPLDLPVC  583



>ref|XP_010322117.1| PREDICTED: laccase-12-like isoform X2 [Solanum lycopersicum]
Length=574

 Score =   355 bits (911),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 197/314 (63%), Positives = 236/314 (75%), Gaps = 9/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             +MLGPGQTT+VLI  NQ PGRYY+A  AYA+AQG PFDNTT+TA+LEY  T  S      
Sbjct  266   LMLGPGQTTDVLIDGNQPPGRYYIAVRAYASAQG-PFDNTTSTAILEYKNTPCSVQGIKI  324

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR-  861
               + P LPA NDTAT T F++  RS     + T     I+ +L FTVGLG  NC  G   
Sbjct  325   NPIFPSLPAFNDTATATTFSTSFRSPRQVDVPTE----IDENLLFTVGLGLNNCPRGSSS  380

Query  860   --CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
               CQGPNGTRF ASMNN+SFVLP   SIL A+Y  I G+++TDFP+VPPV+F+YTGNV R
Sbjct  381   RSCQGPNGTRFTASMNNMSFVLPPNFSILQAHYQGIAGVFSTDFPAVPPVKFDYTGNVSR  440

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTKVYK+K+G+ VQ+VLQ T I + E+HPIHLHGY FYI+ +GFGNFNP TD 
Sbjct  441   SLWQPVRGTKVYKLKYGARVQVVLQGTSIVTGENHPIHLHGYDFYIIAEGFGNFNPQTDT  500

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL+DPP+RNT  VPV GW+ IRFVA+NPGVWLMHCH+D H+TWGLAMSFLVENG++E
Sbjct  501   AKFNLVDPPIRNTASVPVNGWSVIRFVANNPGVWLMHCHLDVHITWGLAMSFLVENGVSE  560

Query  326   WETVppppPDLPRC  285
              E++  PP DLP C
Sbjct  561   LESLVEPPLDLPVC  574



>ref|XP_002468016.1| hypothetical protein SORBIDRAFT_01g038130 [Sorghum bicolor]
 gb|EER95014.1| hypothetical protein SORBIDRAFT_01g038130 [Sorghum bicolor]
Length=600

 Score =   356 bits (913),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 189/335 (56%), Positives = 235/335 (70%), Gaps = 29/335 (9%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             ++LGPGQTT+VL+TA+  PGRYY+AA AYA+AQG PFDNTTATA+ +Y       + S G
Sbjct  268   VLLGPGQTTDVLVTAHAAPGRYYLAARAYASAQGVPFDNTTATAIFQYKNAPGCPTASAG  327

Query  1034  A------------------------LLPRLPANNDTATVTAFTSQLRSlptnmlttplpL  927
             A                        +LP LPA NDT T TAF++ LRS     +  P   
Sbjct  328   AGAFSGPVGRSTRSSGHLGRAGPQPMLPFLPAFNDTNTATAFSNSLRSPAPVKVPGP---  384

Query  926   IIEHSLFFTVGLGFVNCIPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIY  747
              +   +F TVG G  NC PGP CQGPN TRF ASMNNVSF LP   S+L A+Y++IPG++
Sbjct  385   -VTQEVFTTVGFGLFNCRPGPFCQGPNNTRFGASMNNVSFQLPNTVSLLQAHYHHIPGVF  443

Query  746   TTDFPSVPPVQFNYTG-NVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHL  570
             T DFP+ PPV F++T  NVPRALWQP  GTK+Y+V++G+ VQ+V QDTGIF+ E+HP+H+
Sbjct  444   TEDFPAFPPVFFDFTSQNVPRALWQPVKGTKLYRVEYGAVVQMVFQDTGIFAAEEHPMHI  503

Query  569   HGYHFYIVGQGFGNFNPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCH  390
             HGYHF+++  GFGN++P  D A FNL+DPP RNTI VPVGGWA +RFVADNPGVWL+HCH
Sbjct  504   HGYHFFVLATGFGNYDPRRDEAKFNLVDPPSRNTIGVPVGGWAVVRFVADNPGVWLVHCH  563

Query  389   IDSHLTWGLAMSFLVENGITEWETVppppPDLPRC  285
             ID+HLT GLAM+ LVE+G  E E    PP DLP C
Sbjct  564   IDAHLTGGLAMALLVEDGEAELEATIAPPLDLPIC  598



>ref|XP_004138412.1| PREDICTED: laccase-12-like [Cucumis sativus]
 ref|XP_004172777.1| PREDICTED: laccase-12-like [Cucumis sativus]
Length=574

 Score =   355 bits (911),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 188/316 (59%), Positives = 234/316 (74%), Gaps = 10/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt---tssasy  1044
             +MLGPGQTT+VLI+ NQ P RYY+AA AY +AQ APF NTT TA+L Y +        S 
Sbjct  263   LMLGPGQTTDVLISGNQVPARYYIAARAYQSAQNAPFGNTTTTAILNYKSAPCPAKKGSP  322

Query  1043  SPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---I  873
             +   ++P LPA NDTATVTAF+ + RS     + T     I+ +LFFTVGLG  NC    
Sbjct  323   TIKPIMPFLPAFNDTATVTAFSRKFRSPRPVPVPTK----IDENLFFTVGLGLNNCPRNF  378

Query  872   PGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
                +CQGPNGTRF ASMNNVSFVLP   SIL A+   IPG+ T+DFP+ PPV+F+YTGNV
Sbjct  379   KPSQCQGPNGTRFTASMNNVSFVLPSNISILQAFQQGIPGVLTSDFPANPPVKFDYTGNV  438

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              ++L+QP  GTK Y++K+GS+VQ+VLQDT I + E+HPIHLHGY FYI+ +GFGNF+P  
Sbjct  439   SQSLFQPVPGTKGYRLKYGSTVQVVLQDTSIVTPENHPIHLHGYDFYIIAEGFGNFDPKK  498

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D   FNL+DPPLRNT+ VPV GWA IRFVADNPG W+MHCH+D H+TWGLAM FLV+NG+
Sbjct  499   DTKKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGAWIMHCHLDVHITWGLAMVFLVDNGV  558

Query  332   TEWETVppppPDLPRC  285
              + +++  PPPDLP C
Sbjct  559   GQLQSIEAPPPDLPLC  574



>ref|NP_001044679.1| Os01g0827300 [Oryza sativa Japonica Group]
 sp|Q941X2.1|LAC3_ORYSJ RecName: Full=Laccase-3; AltName: Full=Benzenediol:oxygen oxidoreductase 
3; AltName: Full=Diphenol oxidase 3; AltName: Full=Urishiol 
oxidase 3; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB68098.1| putative laccase [Oryza sativa Japonica Group]
 dbj|BAF06593.1| Os01g0827300 [Oryza sativa Japonica Group]
 dbj|BAG92758.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55611.1| hypothetical protein OsJ_03932 [Oryza sativa Japonica Group]
Length=567

 Score =   355 bits (910),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 188/313 (60%), Positives = 228/313 (73%), Gaps = 8/313 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssas--yS  1041
             +M+ PGQTT+VL+T +Q P RYY+AA AY +AQG  FDNTT TAV+EY    ++      
Sbjct  260   LMIAPGQTTDVLVTMDQAPTRYYLAARAYDSAQGVAFDNTTTTAVIEYDCGCATDFGPSI  319

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR  861
             P A  P LPA NDT T TAF + +RS     +  P    ++ +LFFTVG+G  NC PG +
Sbjct  320   PPAF-PVLPAFNDTNTATAFAAGIRSPHEVKIPGP----VDENLFFTVGVGLFNCEPGQQ  374

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPRA  684
             C GPN TRF ASMNN+SFV PQ  S+L A+Y  IPG++TTDFP+ PPVQF+YT  NVPR 
Sbjct  375   CGGPNNTRFTASMNNISFVFPQTTSLLHAHYYGIPGVFTTDFPAYPPVQFDYTAQNVPRY  434

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             LWQP   TK+YK+KFGS VQIVLQDT I S E+HPIH+HGY FYI+ +GFGNF+P  D  
Sbjct  435   LWQPVPATKLYKLKFGSVVQIVLQDTSIVSPENHPIHIHGYDFYILAEGFGNFDPKKDAK  494

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FN +DPP RNT+ VP  GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVE+G  + 
Sbjct  495   KFNYVDPPQRNTVAVPTNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGYGKL  554

Query  323   ETVppppPDLPRC  285
             ET+  PP DLP C
Sbjct  555   ETLEAPPVDLPMC  567



>ref|XP_008441484.1| PREDICTED: laccase-12 [Cucumis melo]
Length=574

 Score =   355 bits (911),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 189/316 (60%), Positives = 233/316 (74%), Gaps = 10/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt---tssasy  1044
             +MLGPGQTT+VLI+ NQ P RYY+AA AY +AQ APF NTT TA+L Y +        S 
Sbjct  263   LMLGPGQTTDVLISGNQVPARYYIAARAYQSAQNAPFGNTTTTAILNYKSAPCPAKKGSP  322

Query  1043  SPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---I  873
             +   ++P LPA NDTATVTAF+ + RS     + T     I+ +LFFTVGLG  NC    
Sbjct  323   TIKPIMPFLPAFNDTATVTAFSRKFRSPRPVPVPTK----IDENLFFTVGLGLNNCPRNF  378

Query  872   PGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
                +CQGPNGTRF ASMNNVSFVLP   SIL A+   IPG+ T+DFP+ PPV+F+YTGNV
Sbjct  379   KPSQCQGPNGTRFTASMNNVSFVLPSNISILQAFQQGIPGVVTSDFPANPPVKFDYTGNV  438

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R+L+QP  GTK Y++K+GS+VQ+VLQDT I + E+HPIHLHGY FYI+ +GFGNF+P  
Sbjct  439   SRSLFQPVPGTKGYRLKYGSTVQVVLQDTSIVTPENHPIHLHGYDFYIIAEGFGNFDPKK  498

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D   FNL+DPPLRNT+ VPV GWA IRFVADNPG W+MHCH+D H+TWGLAM FLV+NG+
Sbjct  499   DTKKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGAWIMHCHLDVHITWGLAMVFLVDNGV  558

Query  332   TEWETVppppPDLPRC  285
                +++  PPPDLP C
Sbjct  559   GHLQSIEAPPPDLPIC  574



>gb|KDO50911.1| hypothetical protein CISIN_1g039963mg [Citrus sinensis]
Length=578

 Score =   355 bits (911),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 197/316 (62%), Positives = 235/316 (74%), Gaps = 11/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasy---  1044
             IM+ PGQTTNVL+TA+Q P RYYMAA AY +A  A FDNTT TA+L Y +   +A     
Sbjct  268   IMIAPGQTTNVLLTADQPPARYYMAARAYNSANVA-FDNTTTTAILAYKSAPCNAKNGGS  326

Query  1043  -SPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP-  870
              S   + P LP  NDTAT TA+T+Q+RSL    + T    +I+  LFFTVGLG +NC   
Sbjct  327   NSSAPVFPTLPGFNDTATATAYTAQIRSLHEVKVPT----VIDEDLFFTVGLGLINCSNP  382

Query  869   -GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
               PRCQGPNGTRFAAS+NNVSF  P   S++ AY+ + PG++TTDFP VPP++F+YTGNV
Sbjct  383   NSPRCQGPNGTRFAASINNVSFEFPTGNSLMQAYFQDQPGVFTTDFPPVPPIKFDYTGNV  442

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R LWQP  GTK+YK+KFGSSVQ+V QDT I + EDHP+HLHG+ FY+VG GFGNFNP T
Sbjct  443   SRVLWQPLKGTKLYKLKFGSSVQLVWQDTSIVTVEDHPMHLHGHEFYVVGSGFGNFNPST  502

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D   FNLIDPP RNTI +P GGW AIRFVA+NPG+W MHCH+DSHLTWGLAM+FLVENG 
Sbjct  503   DTPKFNLIDPPRRNTIGMPPGGWVAIRFVANNPGIWFMHCHLDSHLTWGLAMAFLVENGD  562

Query  332   TEWETVppppPDLPRC  285
              E + V  PP DLP C
Sbjct  563   EELQAVQSPPLDLPPC  578



>gb|KHN31314.1| Laccase-5 [Glycine soja]
Length=492

 Score =   352 bits (903),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 195/324 (60%), Positives = 228/324 (70%), Gaps = 18/324 (6%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleytt----------  1065
             IMLGPGQTT+VLI  +Q P RYYMAA AY +AQ A FDNTT TA+LEY +          
Sbjct  173   IMLGPGQTTDVLIQGDQPPTRYYMAARAYQSAQNAAFDNTTTTAILEYKSPNHHNKHSHH  232

Query  1064  ttssasySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGF  885
                        ++P LPA NDT  VTAF+   RS     + T     I+ SLFFTVGLG 
Sbjct  233   HAKGVKNKTKPIMPPLPAYNDTNAVTAFSKSFRSPRKVEVPTE----IDQSLFFTVGLGI  288

Query  884   VNCIP--GP-RCQGP-NGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPV  717
               C    GP RCQGP NGTRF ASMNNVSFVLP   SIL A++  IPG++TTDFP  PPV
Sbjct  289   KKCPKNFGPKRCQGPINGTRFTASMNNVSFVLPNNVSILQAHHLGIPGVFTTDFPGKPPV  348

Query  716   QFNYTGNVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQG  537
             +F+YTGNV R+LWQP  GTK +K+KFGS VQIVLQDT I + E+HPIHLHGY FYIV +G
Sbjct  349   KFDYTGNVSRSLWQPVPGTKAHKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAEG  408

Query  536   FGNFNPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAM  357
             FGNF+P  D A FNL+DPPLRNT+ VPV GWA IRFVADNPG WL+HCH+D H+ WGLA 
Sbjct  409   FGNFDPKKDTAKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGAWLLHCHLDVHIGWGLAT  468

Query  356   SFLVENGITEWETVppppPDLPRC  285
               LVENG+ + +++ PPP DLP C
Sbjct  469   VLLVENGVGKLQSIEPPPVDLPLC  492



>ref|XP_010517456.1| PREDICTED: laccase-5-like [Camelina sativa]
Length=577

 Score =   355 bits (910),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 234/318 (74%), Gaps = 12/318 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt----tssas  1047
             I+LGPGQTT+VLI  +Q P RYYMAA AY +AQ APF NTT TA+L+Y T       SA 
Sbjct  264   IVLGPGQTTDVLIKGDQPPNRYYMAARAYQSAQNAPFGNTTTTAILQYKTAPCCGGGSAK  323

Query  1046  ySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---  876
                  ++P LPA NDT TVT F+   RSL    + T     I+ +LF T+GLG  NC   
Sbjct  324   NGIKPIMPLLPAYNDTNTVTRFSQSFRSLRRAEVPTE----IDENLFVTIGLGLDNCPKN  379

Query  875   IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN  696
                 RCQGPNGTRF ASMNNVSF LP   S+L A+++ IPG++TTDFP+ PPV+F+YTGN
Sbjct  380   FRSRRCQGPNGTRFTASMNNVSFTLPSNYSLLQAHHHGIPGVFTTDFPAKPPVKFDYTGN  439

Query  695   -VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNP  519
              + R+L+QP  GTK+YK+K+GS VQIVLQDTGI + E+HPIHLHGY FYIV +GFGNFNP
Sbjct  440   NISRSLYQPDRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDFYIVAEGFGNFNP  499

Query  518   GTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVEN  339
               D A FNL DPPLRNT+ VPV GWA IRFVADNPGVW+MHCH+D H++WGLAM+FLVEN
Sbjct  500   KKDTAKFNLEDPPLRNTVGVPVKGWAVIRFVADNPGVWIMHCHLDVHISWGLAMAFLVEN  559

Query  338   GITEWETVppppPDLPRC  285
             G    +T+  PPPDLP C
Sbjct  560   GKGVLQTMEQPPPDLPVC  577



>gb|KHN04792.1| Laccase-5 [Glycine soja]
Length=587

 Score =   355 bits (910),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 199/324 (61%), Positives = 233/324 (72%), Gaps = 18/324 (6%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyt---tttssasy  1044
             +MLGPGQTT+VLIT +Q P RYYMAA AY +AQ A FDNTT TA+LEY     +  S  +
Sbjct  268   LMLGPGQTTDVLITGDQPPSRYYMAARAYQSAQNAAFDNTTTTAILEYKSPHHSNHSHHH  327

Query  1043  SPGAL-------LPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGF  885
             S GAL       +P LPA NDT TVTAF+   RS     +       I+ SLFFTVGLG 
Sbjct  328   SKGALKKKTKPIMPSLPAYNDTNTVTAFSKSFRSPRKVEVPDE----IDQSLFFTVGLGI  383

Query  884   VNCIP--GP-RCQGP-NGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPV  717
               C    GP RCQGP NGTRF ASMNNVSFVLP   SIL A++  IPG++TTDFP  PPV
Sbjct  384   NKCPKNFGPKRCQGPINGTRFTASMNNVSFVLPNNVSILQAHHLGIPGVFTTDFPGKPPV  443

Query  716   QFNYTGNVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQG  537
             +F+YTGNV R+LWQP  GTK +K+KFGS VQIVLQDT I + E+HPIHLHGY FYIV +G
Sbjct  444   KFDYTGNVSRSLWQPVPGTKAHKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAEG  503

Query  536   FGNFNPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAM  357
             FGNF+   D A FNL+DPPLRNT+ VPV GWA IRFVADNPG WL+HCH+D H+ WGLA 
Sbjct  504   FGNFDAKKDTAKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGAWLLHCHLDVHIGWGLAT  563

Query  356   SFLVENGITEWETVppppPDLPRC  285
               LVENG+ + +++ PPP DLP C
Sbjct  564   VLLVENGVGKLQSIEPPPLDLPLC  587



>emb|CDX74795.1| BnaA05g05410D [Brassica napus]
Length=574

 Score =   354 bits (908),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 189/319 (59%), Positives = 232/319 (73%), Gaps = 13/319 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             I+LGPGQTT+VLIT +Q P RYYMAA AY +AQ  PF NTT TA+L+Y +       +  
Sbjct  260   IVLGPGQTTDVLITGDQPPNRYYMAARAYQSAQNVPFGNTTTTAILQYKSAPCCIGGAKK  319

Query  1034  A-----LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC--  876
                   ++P LPA NDT TVT F+   +SL    + T     ++ +LF T+GLG  NC  
Sbjct  320   GTSIKPIMPLLPAYNDTNTVTRFSQSFKSLRKAEVPTE----LDENLFITIGLGLNNCPK  375

Query  875   -IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG  699
                  RCQG NGTRF ASMNNVSF LP   S+L A+++NIPG++TTDFP+ PPV+F+YTG
Sbjct  376   NFRSRRCQGLNGTRFTASMNNVSFALPSNYSLLQAHHHNIPGVFTTDFPAKPPVKFDYTG  435

Query  698   -NVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFN  522
              N+ R+L+QP  GTK+YK+K+GS VQIVLQDTGI + E+HPIHLHGY FYIV +GFGNFN
Sbjct  436   SNISRSLYQPDRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDFYIVAEGFGNFN  495

Query  521   PGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVE  342
             P  D   FNL DPPLRNT+ VPV GWA IRFVADNPGVW+MHCH+D+H++WGLAM+FLVE
Sbjct  496   PKKDIGKFNLEDPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDAHISWGLAMAFLVE  555

Query  341   NGITEWETVppppPDLPRC  285
             NG    ET+  PP DLP C
Sbjct  556   NGKGLLETIEEPPADLPVC  574



>ref|NP_181568.1| laccase 5 [Arabidopsis thaliana]
 sp|Q9SIY8.1|LAC5_ARATH RecName: Full=Laccase-5; AltName: Full=Benzenediol:oxygen oxidoreductase 
5; AltName: Full=Diphenol oxidase 5; AltName: Full=Urishiol 
oxidase 5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM77221.1|AF506030_1 laccase [Arabidopsis thaliana]
 gb|AAD25671.1| putative laccase (diphenol oxidase) [Arabidopsis thaliana]
 gb|AEC09819.1| laccase 5 [Arabidopsis thaliana]
Length=580

 Score =   354 bits (909),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 191/323 (59%), Positives = 236/323 (73%), Gaps = 17/323 (5%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleytt---------t  1062
             I+LGPGQTT+VLIT +Q P RYYMAA AY +AQ APF NTT TA+L+Y +         +
Sbjct  262   IVLGPGQTTDVLITGDQPPNRYYMAARAYQSAQNAPFGNTTTTAILQYKSAPCCGVGGGS  321

Query  1061  tssasySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFV  882
              +    S   ++P LPA NDT TVT F+   RSL    + T     I+ +LF T+GLG  
Sbjct  322   GTKKGNSFKPIMPILPAYNDTNTVTRFSQSFRSLRRAEVPTE----IDENLFVTIGLGLN  377

Query  881   NC---IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQF  711
             NC       RCQGPNGTRF ASMNNVSF LP   S+L A+++ IPG++TTDFP+ PPV+F
Sbjct  378   NCPKNFRSRRCQGPNGTRFTASMNNVSFALPSNYSLLQAHHHGIPGVFTTDFPAKPPVKF  437

Query  710   NYTGN-VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGF  534
             +YTGN + R+L+QP  GTK+YK+K+GS VQIVLQDTGI + E+HPIHLHGY FYI+ +GF
Sbjct  438   DYTGNNISRSLYQPDRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDFYIIAEGF  497

Query  533   GNFNPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMS  354
             GNFNP  D A FNL DPPLRNT+ VPV GWA IRF+ADNPGVW+MHCH+D+H++WGLAM+
Sbjct  498   GNFNPKKDTAKFNLEDPPLRNTVGVPVNGWAVIRFIADNPGVWIMHCHLDAHISWGLAMA  557

Query  353   FLVENGITEWETVppppPDLPRC  285
             FLVENG    +T+  PP DLP C
Sbjct  558   FLVENGNGVLQTIEQPPHDLPVC  580



>gb|EEC71732.1| hypothetical protein OsI_04280 [Oryza sativa Indica Group]
Length=599

 Score =   355 bits (910),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 188/313 (60%), Positives = 228/313 (73%), Gaps = 8/313 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssas--yS  1041
             +M+ PGQTT+VL+T +Q P RYY+AA AY +AQG  FDNTT TAV+EY    ++      
Sbjct  292   LMIAPGQTTDVLVTMDQAPTRYYLAARAYDSAQGVAFDNTTTTAVIEYDCGCATDFGPSI  351

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR  861
             P A  P LPA NDT T TAF + +RS     +  P    ++ +LFFTVG+G  NC PG +
Sbjct  352   PPAF-PVLPAFNDTNTATAFAAGIRSPHEVKIPGP----VDENLFFTVGVGLFNCEPGQQ  406

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPRA  684
             C GPN TRF ASMNN+SFV PQ  S+L A+Y  IPG++TTDFP+ PPVQF+YT  NVPR 
Sbjct  407   CGGPNNTRFTASMNNISFVFPQTTSLLHAHYYGIPGVFTTDFPAYPPVQFDYTAQNVPRY  466

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             LWQP   TK+YK+KFGS VQIVLQDT I S E+HPIH+HGY FYI+ +GFGNF+P  D  
Sbjct  467   LWQPVPATKLYKLKFGSVVQIVLQDTSIVSPENHPIHIHGYDFYILAEGFGNFDPKKDAK  526

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FN +DPP RNT+ VP  GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVE+G  + 
Sbjct  527   KFNYVDPPQRNTVAVPTNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGYGKL  586

Query  323   ETVppppPDLPRC  285
             ET+  PP DLP C
Sbjct  587   ETLEAPPVDLPMC  599



>ref|XP_009143220.1| PREDICTED: laccase-5 [Brassica rapa]
Length=574

 Score =   353 bits (907),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 189/319 (59%), Positives = 232/319 (73%), Gaps = 13/319 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             I+LGPGQTT+VLIT +Q P RYYMAA AY +AQ  PF NTT TA+L+Y +       +  
Sbjct  260   IVLGPGQTTDVLITGDQPPNRYYMAARAYQSAQNVPFGNTTTTAILQYKSAPCCIGGAKK  319

Query  1034  A-----LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC--  876
                   ++P LPA NDT TVT F+   +SL    + T     ++ +LF T+GLG  NC  
Sbjct  320   GTSIKPIMPLLPAYNDTNTVTRFSQSFKSLRKAEVPTE----LDENLFITIGLGLNNCPK  375

Query  875   -IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG  699
                  RCQG NGTRF ASMNNVSF LP   S+L A+++NIPG++TTDFP+ PPV+F+YTG
Sbjct  376   NFRSRRCQGLNGTRFTASMNNVSFALPSNYSLLQAHHHNIPGVFTTDFPAKPPVKFDYTG  435

Query  698   -NVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFN  522
              N+ R+L+QP  GTK+YK+K+GS VQIVLQDTGI + E+HPIHLHGY FYIV +GFGNFN
Sbjct  436   SNISRSLYQPDRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDFYIVAEGFGNFN  495

Query  521   PGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVE  342
             P  D   FNL DPPLRNT+ VPV GWA IRFVADNPGVW+MHCH+D+H++WGLAM+FLVE
Sbjct  496   PKKDIRKFNLEDPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDAHISWGLAMAFLVE  555

Query  341   NGITEWETVppppPDLPRC  285
             NG    ET+  PP DLP C
Sbjct  556   NGKGLLETIEEPPADLPVC  574



>ref|XP_010508873.1| PREDICTED: laccase-5-like [Camelina sativa]
Length=578

 Score =   353 bits (907),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 194/318 (61%), Positives = 235/318 (74%), Gaps = 12/318 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt----tssas  1047
             I+LGPGQTT+VLI  +Q P RYYMAA AY +AQ APF NTT TAVL+Y T       SA 
Sbjct  265   IVLGPGQTTDVLIKGDQPPNRYYMAARAYQSAQNAPFGNTTTTAVLQYKTAPCCGGGSAK  324

Query  1046  ySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---  876
                  ++P LP+ NDT TVT F+   RSL    + T    +I+ +LF T+GLG  NC   
Sbjct  325   NGIKPVMPLLPSYNDTNTVTRFSQSFRSLRRAEVPT----VIDENLFVTIGLGLDNCPKN  380

Query  875   IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN  696
                 RCQGPNGTRF ASMNNVSF LP   S+L A+++ IPG++TTDFP+ PPV+F+YTGN
Sbjct  381   FRSRRCQGPNGTRFTASMNNVSFALPSNYSLLQAHHHGIPGVFTTDFPAKPPVKFDYTGN  440

Query  695   -VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNP  519
              + R+L+QP  GTK+YK+K+GS VQIVLQDTGI + E+HPIHLHGY FYIV +GFGNFNP
Sbjct  441   NISRSLYQPDRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDFYIVAEGFGNFNP  500

Query  518   GTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVEN  339
               D A FNL DPPLRNT+ VPV GWA IRFVADNPGVW+MHCH+D H++WGLAM+F+VEN
Sbjct  501   KKDTAKFNLEDPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDVHISWGLAMAFVVEN  560

Query  338   GITEWETVppppPDLPRC  285
             G    +T+  PPPDLP C
Sbjct  561   GKGVLQTMEQPPPDLPVC  578



>gb|AET79245.1| multicopper oxidase [Glycine max]
Length=502

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 193/324 (60%), Positives = 229/324 (71%), Gaps = 18/324 (6%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleytt----------  1065
             ++LGPGQTT+VLIT +Q P RYYMAA AY +AQ A FDNTT TA+LEY +          
Sbjct  183   LILGPGQTTDVLITGDQPPSRYYMAARAYQSAQNAAFDNTTTTAILEYKSPNHHNKHSHH  242

Query  1064  ttssasySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGF  885
                        ++P LPA NDT  VT+F+   RS     + T     I+ SLFFTVGLG 
Sbjct  243   RAKGVKNKTKPIMPPLPAYNDTNAVTSFSKSFRSPRKVEVPTE----IDQSLFFTVGLGI  298

Query  884   VNCIP--GP-RCQGP-NGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPV  717
               C    GP RCQGP NGTRF ASMNNVSFVLP   SIL A++  IPG++TTDFP  PPV
Sbjct  299   KKCPKNFGPKRCQGPINGTRFTASMNNVSFVLPNNVSILQAHHLGIPGVFTTDFPGKPPV  358

Query  716   QFNYTGNVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQG  537
             +F+YTGNV R+LWQP  GTK +K+KFGS VQIVLQDT I + E+HPIHLHGY FYIV +G
Sbjct  359   KFDYTGNVSRSLWQPVPGTKAHKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAEG  418

Query  536   FGNFNPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAM  357
             FGNF+P  D A FNL+DPPLRNT+ VPV GWA IRFVADNPG WL+HCH+D H+ WGLA 
Sbjct  419   FGNFDPKKDTAKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGAWLLHCHLDVHIGWGLAT  478

Query  356   SFLVENGITEWETVppppPDLPRC  285
               LVENG+ + +++ PPP DLP C
Sbjct  479   VLLVENGVGKLQSIEPPPVDLPLC  502



>ref|NP_001145891.1| putative laccase family protein precursor [Zea mays]
 gb|ACL52797.1| unknown [Zea mays]
 tpg|DAA44912.1| TPA: putative laccase family protein [Zea mays]
Length=607

 Score =   354 bits (908),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 187/342 (55%), Positives = 235/342 (69%), Gaps = 36/342 (11%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatav---------------  1080
             ++LGPGQTT+VL+TA+  PGRYY+AA AYA+AQG PFDNTTATA+               
Sbjct  268   VLLGPGQTTDVLVTAHAAPGRYYLAARAYASAQGVPFDNTTATAIFQYKNAPGCPTTSGA  327

Query  1079  ----------------leyttttssasySPGALLPRLPANNDTATVTAFTSQLRSlptnm  948
                                 ++       P  +LP LPA NDT T TAF+++LRS     
Sbjct  328   GAGAGAGAGTFSGPVGRSSRSSGYLGRAGPQPMLPFLPAFNDTNTATAFSNRLRSPVPVK  387

Query  947   lttplpLIIEHSLFFTVGLGFVNCIPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYY  768
             +  P+       +F TVG G  NC PGP CQGPN TRF ASMNNVSF LP   S+L A+Y
Sbjct  388   VPGPVT----QEVFTTVGFGLFNCRPGPFCQGPNNTRFGASMNNVSFQLPDTVSLLQAHY  443

Query  767   NNIPGIYTTDFPSVPPVQFNYTG-NVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFST  591
             ++IPG++T DFP++PPV F++T  NVPRALWQP  GT++Y+V++G+ VQIV QDTGIF+ 
Sbjct  444   HHIPGVFTDDFPALPPVFFDFTSQNVPRALWQPVKGTRLYRVRYGAVVQIVFQDTGIFAA  503

Query  590   EDHPIHLHGYHFYIVGQGFGNFNPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPG  411
             E+HP+H+HGYHFY++  GFGN++P  D A FNL+DPP RNTI VPVGGWA +RFVADNPG
Sbjct  504   EEHPMHIHGYHFYVLATGFGNYDPRRDAARFNLVDPPSRNTIGVPVGGWAVVRFVADNPG  563

Query  410   VWLMHCHIDSHLTWGLAMSFLVENGITEWETVppppPDLPRC  285
             VWL+HCHID+HLT GLAM+ LVE+G +E E    PP DLP C
Sbjct  564   VWLVHCHIDAHLTGGLAMALLVEDGESELEATVAPPLDLPIC  605



>emb|CBW38080.1| laccase-like multicopper oxidase [Hordeum vulgare subsp. vulgare]
Length=592

 Score =   353 bits (906),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 185/337 (55%), Positives = 231/337 (69%), Gaps = 31/337 (9%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttss------  1053
             ++LGPGQTT+VL+TA+  PGRYY+ A  YA+AQG PFDNTTATA+ +Y            
Sbjct  258   VLLGPGQTTDVLVTAHAAPGRYYLGARVYASAQGVPFDNTTATAIFQYKDAAGCPPTGAV  317

Query  1052  --------------------asySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttpl  933
                                     P  + P LPANNDT T T F++ +RS     +  P 
Sbjct  318   AVAGAGAKTGLGHRRPSGNPGRAGPAPMFPMLPANNDTNTATGFSNLIRSPRPVKVPGP-  376

Query  932   pLIIEHSLFFTVGLGFVNCIPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPG  753
                +   +F T+G G  NC PGP CQGPN TRF ASMNNVSF LP   S+L A+Y+ IPG
Sbjct  377   ---VTQEVFTTIGFGLFNCRPGPFCQGPNNTRFGASMNNVSFQLPNTVSLLQAHYHRIPG  433

Query  752   IYTTDFPSVPPVQFNYTG-NVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPI  576
             ++T DFP+ PPV F+YT  NVPRALWQP  GT++Y+VK+G+ VQIV QDTGIF+ E+HP+
Sbjct  434   VFTEDFPARPPVVFDYTSQNVPRALWQPVKGTRLYRVKYGAVVQIVFQDTGIFAAEEHPM  493

Query  575   HLHGYHFYIVGQGFGNFNPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMH  396
             H+HGYHFY++  GFGN+NP  D A FN++DPP RNTI VPVGGWA +RF+ADNPGVWL+H
Sbjct  494   HIHGYHFYVLATGFGNYNPRRDEAKFNMVDPPSRNTIGVPVGGWAVVRFLADNPGVWLVH  553

Query  395   CHIDSHLTWGLAMSFLVENGITEWETVppppPDLPRC  285
             CHID+HLT GLAM+ +VE+G TE +T  PPP DLP C
Sbjct  554   CHIDAHLTGGLAMALVVEDGKTELQTTMPPPVDLPIC  590



>ref|XP_009343323.1| PREDICTED: laccase-3-like [Pyrus x bretschneideri]
Length=563

 Score =   352 bits (904),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 194/310 (63%), Positives = 231/310 (75%), Gaps = 7/310 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+TA+Q P RYYMAA AY T     FDNTT TA+LEY    SS      
Sbjct  261   IMLGPGQTTDVLLTADQGPARYYMAARAYQTDLNVAFDNTTTTAILEYKNAASSNQGL-A  319

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
              + P LPA+NDTA  TA+T+Q++S     + T     I+ +LFFTVGLG    +   R  
Sbjct  320   PVFPTLPASNDTAPATAYTAQIKSPSQVKVPTR----IDENLFFTVGLGLY--LLHIRNS  373

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRALWQ  675
               N TRFAASMNNVSFVLP+  S++ A Y  +PG++TTDFP VP VQFNYTGNVPR LW 
Sbjct  374   ITNNTRFAASMNNVSFVLPRTNSLMQAAYYGVPGVFTTDFPPVPLVQFNYTGNVPRGLWS  433

Query  674   PRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASFN  495
             PR GTK+YK+K+G++VQIV QDT I +T+DHP+HLHGY FY++G GFGN+NP TDPA FN
Sbjct  434   PRRGTKLYKLKYGANVQIVFQDTSIVTTDDHPMHLHGYQFYVIGSGFGNYNPSTDPARFN  493

Query  494   LIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWETV  315
             LIDPPLRNTI    GGW AIRF ADNPGVWLMHCH++SHL+ GLAM+FLVENG    ++V
Sbjct  494   LIDPPLRNTIGTGPGGWVAIRFKADNPGVWLMHCHLESHLSLGLAMAFLVENGNGPLQSV  553

Query  314   ppppPDLPRC  285
              PPPPDLPRC
Sbjct  554   IPPPPDLPRC  563



>ref|XP_002312187.2| hypothetical protein POPTR_0008s07380g [Populus trichocarpa]
 gb|EEE89554.2| hypothetical protein POPTR_0008s07380g [Populus trichocarpa]
Length=520

 Score =   350 bits (899),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 191/316 (60%), Positives = 237/316 (75%), Gaps = 10/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLI+ +Q P RYYMAA AY +AQ APFDNTT TA+LEY ++  +A     
Sbjct  209   LMLGPGQTTDVLISGDQTPSRYYMAARAYQSAQNAPFDNTTTTAILEYKSSACAAKNCSS  268

Query  1034  --ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC----I  873
                ++P LPA NDTATVT FT+  +S    ++ T     I+ SLFFT+GLG   C     
Sbjct  269   NKPIMPPLPAYNDTATVTTFTTSFKSADKTLVPTD----IDESLFFTIGLGLNPCPSNFN  324

Query  872   PGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNV  693
                +CQGPNGTRF ASMNNVSFVLP   S+L A++  I G++TTDFP+ PP +F+YTGNV
Sbjct  325   KSSQCQGPNGTRFTASMNNVSFVLPSNFSLLQAHHQRIQGVFTTDFPANPPRKFDYTGNV  384

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R+L+QP  GTK+Y +K+GS VQIVLQDT I + E+HPIHLHGY FYI+ QGFGN+NP  
Sbjct  385   SRSLFQPVAGTKLYNLKYGSRVQIVLQDTSIVTPENHPIHLHGYDFYIIAQGFGNYNPRA  444

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             DP+ FNL+DPPLRNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLA +FLVENG+
Sbjct  445   DPSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLATAFLVENGV  504

Query  332   TEWETVppppPDLPRC  285
              + +++  PP DLP C
Sbjct  505   GQLQSIESPPEDLPLC  520



>ref|XP_004984887.1| PREDICTED: laccase-3-like [Setaria italica]
Length=608

 Score =   353 bits (906),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 190/347 (55%), Positives = 232/347 (67%), Gaps = 41/347 (12%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatav---------------  1080
             I+LGPGQTT+VL+TA+  PGRYY+AA AYA+AQG PFDNTTATA+               
Sbjct  264   ILLGPGQTTDVLVTAHAAPGRYYLAARAYASAQGVPFDNTTATAIFQYKNAPGCPTTTAS  323

Query  1079  ---------------------leyttttssasySPGALLPRLPANNDTATVTAFTSQLRS  963
                                      ++       P  +LP LPA NDT T TAF++ LRS
Sbjct  324   AGAGAGAGAGMGGNTFNGPVGRSSRSSGHPGRTGPQPMLPFLPAFNDTNTATAFSNSLRS  383

Query  962   lptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQGPNGTRFAASMNNVSFVLPQRASI  783
                  +  P    +   LF TVG G  NC PGP CQGPN TRF ASMNNVSF LP   S+
Sbjct  384   PHPVKVPGP----VTQELFTTVGFGLFNCHPGPFCQGPNNTRFGASMNNVSFQLPNTVSL  439

Query  782   LDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPRALWQPRFGTKVYKVKFGSSVQIVLQDT  606
             L A+Y++IPG++T DFPS PPV F++T  N+PR LWQP  GTK+Y+V++G+ VQIV QDT
Sbjct  440   LQAHYHHIPGVFTDDFPSFPPVFFDFTSQNIPRPLWQPVKGTKLYRVRYGAVVQIVFQDT  499

Query  605   GIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFV  426
             GIF+ E+HP+H+HGYHFY++  GFGN++P  D A FNL+DPP RNTI VPVGGWA +RFV
Sbjct  500   GIFAAEEHPMHIHGYHFYVLATGFGNYDPRRDAAKFNLVDPPSRNTIGVPVGGWAVVRFV  559

Query  425   ADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWETVppppPDLPRC  285
             ADNPGVWL+HCHID+HLT GLAM+ LVENG +E E    PP DLP C
Sbjct  560   ADNPGVWLVHCHIDAHLTGGLAMALLVENGGSELEATMAPPLDLPIC  606



>ref|XP_010505765.1| PREDICTED: laccase-5 [Camelina sativa]
Length=575

 Score =   352 bits (903),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 193/318 (61%), Positives = 234/318 (74%), Gaps = 12/318 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt----tssas  1047
             I+LGPGQTT+VL+  +Q P RYYMAA AY +AQ APF NTT TA+L+Y T       SA 
Sbjct  262   IVLGPGQTTDVLVKGDQPPNRYYMAARAYQSAQNAPFGNTTTTAILQYKTAPCCGGGSAK  321

Query  1046  ySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---  876
                  ++P LPA NDT TVT F+   RSL    + T     I+ +LF T+GLG  NC   
Sbjct  322   NGIKPIMPLLPAYNDTNTVTRFSQSFRSLRRAEVPTE----IDENLFVTIGLGLDNCPKN  377

Query  875   IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN  696
                 RCQGPNGTRF ASMNNVSF LP   S+L A+++ IPG++TTDFP+ PPV+F+YTGN
Sbjct  378   FRSRRCQGPNGTRFTASMNNVSFALPSNYSLLQAHHHGIPGVFTTDFPAKPPVKFDYTGN  437

Query  695   -VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNP  519
              + R+L+QP  GTK+YK+K+GS VQIVLQDTGI + E+HPIHLHGY FYIV +GFG+FNP
Sbjct  438   NISRSLYQPDRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDFYIVAEGFGSFNP  497

Query  518   GTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVEN  339
               D A FNL DPPLRNT+ VPV GWA IRFVADNPGVW+MHCH+D H++WGLAM+FLVEN
Sbjct  498   KKDTAKFNLEDPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDVHISWGLAMAFLVEN  557

Query  338   GITEWETVppppPDLPRC  285
             G    +T+  PPPDLP C
Sbjct  558   GKGVLQTMEQPPPDLPVC  575



>gb|AFV52384.1| laccase [Picea abies]
Length=573

 Score =   352 bits (903),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 194/312 (62%), Positives = 227/312 (73%), Gaps = 3/312 (1%)
 Frame = -2

Query  1214  IMLGPGQTTNVLIT-ANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP  1038
             +MLGPGQTT+VL+  A  R GRYYMAA AY +AQG PFDNTT TA+LEY T     S S 
Sbjct  263   VMLGPGQTTDVLLRGARHRVGRYYMAARAYDSAQGVPFDNTTTTAILEYRTRRPPPSSSF  322

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRC  858
               ++P LPA NDT T T F   LRSL T      +P  ++ SLF+T+GLG  NC P   C
Sbjct  323   RPVMPILPAYNDTRTATNFARGLRSLGTREHPVYVPQTVDESLFYTIGLGLFNC-PNRSC  381

Query  857   QGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPRAL  681
              GPNGTRF ASMNN+SFVLP   S+L A+Y    G++TT FP  PPVQFNYT  NV R+L
Sbjct  382   GGPNGTRFTASMNNISFVLPSTYSVLQAHYFGKKGVFTTGFPDNPPVQFNYTAQNVSRSL  441

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             W P  GTKV  +K+ + VQ++LQDT I + E+HPIHLHGY FYIVG+GFGN+NP TDP  
Sbjct  442   WSPVRGTKVKVLKYNAKVQVILQDTNIVNAENHPIHLHGYDFYIVGEGFGNYNPRTDPQK  501

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL+DPPLRNT+ VPV GWAAIRFVADNPG WLMHCH+D H+TWGLAM FLVENG +   
Sbjct  502   FNLVDPPLRNTVAVPVNGWAAIRFVADNPGAWLMHCHLDVHITWGLAMVFLVENGPSYMT  561

Query  320   TVppppPDLPRC  285
             T+  PPPDLP C
Sbjct  562   TIESPPPDLPVC  573



>gb|AFV52383.1| laccase [Picea abies]
Length=573

 Score =   352 bits (902),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 194/312 (62%), Positives = 227/312 (73%), Gaps = 3/312 (1%)
 Frame = -2

Query  1214  IMLGPGQTTNVLIT-ANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP  1038
             +MLGPGQTT+VL+  A  R GRYYMAA AY +AQG PFDNTT TA+LEY T     S S 
Sbjct  263   VMLGPGQTTDVLLRGARHRVGRYYMAARAYDSAQGVPFDNTTTTAILEYRTRRPPPSSSF  322

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRC  858
               ++P LPA NDT T T F   LRSL T      +P  ++ SLF+T+GLG  NC P   C
Sbjct  323   RPVMPILPAYNDTRTATNFARGLRSLGTREHPVYVPQTVDESLFYTIGLGLFNC-PNRSC  381

Query  857   QGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPRAL  681
              GPNGTRF ASMNN+SFVLP   S+L A+Y    G++TT FP  PPVQFNYT  NV R+L
Sbjct  382   GGPNGTRFTASMNNISFVLPSTYSVLQAHYFGKKGVFTTGFPDNPPVQFNYTAQNVSRSL  441

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             W P  GTKV  +K+ + VQ++LQDT I + E+HPIHLHGY FYIVG+GFGN+NP TDP  
Sbjct  442   WSPVRGTKVKVLKYNAKVQVILQDTNIVNAENHPIHLHGYDFYIVGEGFGNYNPRTDPQK  501

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL+DPPLRNT+ VPV GWAAIRFVADNPG WLMHCH+D H+TWGLAM FLVENG +   
Sbjct  502   FNLVDPPLRNTVAVPVNGWAAIRFVADNPGAWLMHCHLDVHITWGLAMVFLVENGPSYMT  561

Query  320   TVppppPDLPRC  285
             T+  PPPDLP C
Sbjct  562   TIESPPPDLPVC  573



>gb|KFK36912.1| hypothetical protein AALP_AA4G189000 [Arabis alpina]
Length=578

 Score =   352 bits (902),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 189/321 (59%), Positives = 234/321 (73%), Gaps = 15/321 (5%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt-------ts  1056
             ++LGPGQTT+VLIT +Q P RYYMAA AY +AQ APF NTT TA+L+Y +         +
Sbjct  262   VVLGPGQTTDVLITGDQPPNRYYMAARAYQSAQNAPFGNTTTTAILQYKSAPCCGVGGGN  321

Query  1055  sasySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC  876
             +   S   ++P LPA NDT TVT F+   RSL    + T     I+ +LF TVGLG  NC
Sbjct  322   NKGLSVKPIMPLLPAYNDTNTVTRFSQSFRSLKRAEVPTE----IDENLFVTVGLGLNNC  377

Query  875   ---IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNY  705
                    RCQGPNGTRF ASMNNVSF LP   S+L A+++NIPG++TTDFP+ PPV+F+Y
Sbjct  378   PKNFRSRRCQGPNGTRFTASMNNVSFALPSNYSLLQAHHHNIPGVFTTDFPAKPPVKFDY  437

Query  704   T-GNVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGN  528
             T  N+ R+L+QP  GTK+YK+K+GS VQ+VLQDTGI + E+HPIHLHGY FYI+ +GFGN
Sbjct  438   TSSNISRSLYQPVRGTKLYKIKYGSRVQVVLQDTGIVTPENHPIHLHGYDFYIIAEGFGN  497

Query  527   FNPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFL  348
             FNP  D A FNL DPPLRNT+ V V GWA IRFVADNPGVW+MHCH+D+H++WGLAM+FL
Sbjct  498   FNPKKDIAKFNLEDPPLRNTVGVNVNGWAVIRFVADNPGVWIMHCHLDAHISWGLAMAFL  557

Query  347   VENGITEWETVppppPDLPRC  285
             VE+G    E +  PP DLP C
Sbjct  558   VEDGKGLLERIEEPPADLPVC  578



>ref|XP_003538485.1| PREDICTED: laccase-5-like [Glycine max]
Length=587

 Score =   352 bits (902),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 198/324 (61%), Positives = 232/324 (72%), Gaps = 18/324 (6%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyt---tttssasy  1044
             +MLGPGQTT+VLIT +Q P  YYMAA AY +AQ A FDNTT TA+LEY     +  S  +
Sbjct  268   LMLGPGQTTDVLITGDQPPSPYYMAARAYQSAQNAAFDNTTTTAILEYKSPHHSNHSHHH  327

Query  1043  SPGAL-------LPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGF  885
             S GAL       +P LPA NDT TVTAF+   RS     +       I+ SLFFTVGLG 
Sbjct  328   SKGALKKKTKPIMPSLPAYNDTNTVTAFSKSFRSPRKVEVPAE----IDQSLFFTVGLGI  383

Query  884   VNCIP--GP-RCQGP-NGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPV  717
               C    GP RCQGP NGTRF ASMNNVSFVLP   SIL A++  IPG++TTDFP  PPV
Sbjct  384   NKCPKNFGPKRCQGPINGTRFTASMNNVSFVLPNNVSILQAHHLGIPGVFTTDFPGKPPV  443

Query  716   QFNYTGNVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQG  537
             +F+YTGNV R+LWQP  GTK +K+KFGS VQIVLQDT I + E+HPIHLHGY FYIV +G
Sbjct  444   KFDYTGNVSRSLWQPVPGTKAHKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAEG  503

Query  536   FGNFNPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAM  357
             FGNF+   D A FNL+DPPLRNT+ VPV GWA IRFVADNPG WL+HCH+D H+ WGLA 
Sbjct  504   FGNFDAKKDTAKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGAWLLHCHLDVHIGWGLAT  563

Query  356   SFLVENGITEWETVppppPDLPRC  285
               LVENG+ + +++ PPP DLP C
Sbjct  564   VLLVENGVGKLQSIEPPPLDLPLC  587



>gb|EMS46935.1| Laccase-3 [Triticum urartu]
Length=600

 Score =   351 bits (901),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 185/335 (55%), Positives = 231/335 (69%), Gaps = 29/335 (9%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             ++LGPGQTT+VL+TA+  PGRYY+ A  YA+AQ  PFDNTTATAV +Y           G
Sbjct  268   VLLGPGQTTDVLVTAHAAPGRYYLGARVYASAQNVPFDNTTATAVFQYKNAAGCPPTGAG  327

Query  1034  A------------------------LLPRLPANNDTATVTAFTSQLRSlptnmlttplpL  927
             A                        + P LPANNDT T T F++ +RS     +  P   
Sbjct  328   AGLGDHTGLGRPRSSGNPGRAGPAPMFPMLPANNDTNTATGFSNLIRSPRPVKVPGP---  384

Query  926   IIEHSLFFTVGLGFVNCIPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIY  747
              +   +F T+G G  NC PGP CQGPN TRF ASMNNVSF LP   S+L A+Y+ IPG++
Sbjct  385   -VTQEVFTTIGFGLFNCQPGPFCQGPNNTRFGASMNNVSFQLPNTVSLLQAHYHRIPGVF  443

Query  746   TTDFPSVPPVQFNYTG-NVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHL  570
             T DFP+ PPV F+YT  NVPRALWQP  GT++Y+VK+G+ VQ+V QDTGIF+ E+HP+H+
Sbjct  444   TEDFPARPPVVFDYTSQNVPRALWQPVKGTRLYRVKYGAVVQMVFQDTGIFAAEEHPMHI  503

Query  569   HGYHFYIVGQGFGNFNPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCH  390
             HGYHFY++  GFGN+NP  D A FN++DPP RNTI VPVGGWA +RF+ADNPGVWL+HCH
Sbjct  504   HGYHFYVLATGFGNYNPRRDEAKFNMVDPPSRNTIGVPVGGWAVVRFLADNPGVWLVHCH  563

Query  389   IDSHLTWGLAMSFLVENGITEWETVppppPDLPRC  285
             ID+HLT GLAM+ +VE+G TE +T  PPP DLP C
Sbjct  564   IDAHLTGGLAMALVVEDGKTELQTTMPPPLDLPVC  598



>ref|NP_001236616.1| diphenol oxidase laccase precursor [Glycine max]
 gb|AAM54731.1| diphenol oxidase laccase [Glycine max]
 gb|AAM89257.1| diphenol oxidase laccase [Glycine max]
Length=589

 Score =   351 bits (900),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 192/324 (59%), Positives = 229/324 (71%), Gaps = 18/324 (6%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleytt----------  1065
             ++LGPGQTT+VLIT +Q P RYYMAA AY +AQ A FDNTT TA+LEY +          
Sbjct  270   LILGPGQTTDVLITGDQPPSRYYMAARAYQSAQNAAFDNTTTTAILEYKSPNHHNKHSHH  329

Query  1064  ttssasySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGF  885
                        ++P LPA NDT  VT+F+   RS     + T     I+ SLFFTVGLG 
Sbjct  330   RAKGVKNKTKPIMPPLPAYNDTNAVTSFSKSFRSPRKVEVPTE----IDQSLFFTVGLGI  385

Query  884   VNCIP--GP-RCQGP-NGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPV  717
               C    GP RCQGP NGTRF ASMNNVSFVLP   SIL A++  IPG++TTDFP  PPV
Sbjct  386   KKCPKNFGPKRCQGPINGTRFTASMNNVSFVLPNNVSILQAHHLGIPGVFTTDFPGKPPV  445

Query  716   QFNYTGNVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQG  537
             +F+YTGNV R+LWQP  GTK +K++FGS VQIVLQDT I + E+HPIHLHGY FYIV +G
Sbjct  446   KFDYTGNVSRSLWQPVPGTKAHKLEFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAEG  505

Query  536   FGNFNPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAM  357
             FGNF+P  D A FNL+DPPLRNT+ VPV GWA IRFVADNPG WL+HCH+D H+ WGLA 
Sbjct  506   FGNFDPKKDTAKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGAWLLHCHLDVHIGWGLAT  565

Query  356   SFLVENGITEWETVppppPDLPRC  285
               LVENG+ + +++ PPP DLP C
Sbjct  566   VLLVENGVGKLQSIEPPPVDLPLC  589



>gb|ABR17539.1| unknown [Picea sitchensis]
Length=573

 Score =   350 bits (899),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 194/312 (62%), Positives = 226/312 (72%), Gaps = 3/312 (1%)
 Frame = -2

Query  1214  IMLGPGQTTNVLIT-ANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP  1038
             + LGPGQTT+VL+  A  R GRYYMAA AY +AQG PFDNTT TA+LEY T     S S 
Sbjct  263   VKLGPGQTTDVLLRGARHRVGRYYMAARAYDSAQGVPFDNTTTTAILEYRTRRPPPSSSF  322

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRC  858
               ++P LPA NDT T T F   LRSL T      +P  ++ SLF+T+GLG  NC P   C
Sbjct  323   RPVMPILPAYNDTRTATNFARGLRSLGTREHPVYVPQTVDESLFYTIGLGLFNC-PNQSC  381

Query  857   QGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPRAL  681
              GPNGTRF ASMNN+SFVLP   SIL A+Y    G++TT FP  PPVQFNYT  NV R+L
Sbjct  382   GGPNGTRFTASMNNISFVLPSTYSILQAHYFGKKGVFTTGFPDNPPVQFNYTAQNVSRSL  441

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             W P  GTKV  +K+ + VQ++LQDT I + E+HPIHLHGY FYIVG+GFGN+NP TDP  
Sbjct  442   WSPVRGTKVKVLKYNAKVQVILQDTNIVNAENHPIHLHGYDFYIVGEGFGNYNPRTDPQK  501

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL+DPPLRNT+ VPV GWAAIRFVADNPG WLMHCH+D H+TWGLAM FLVENG +   
Sbjct  502   FNLVDPPLRNTVAVPVNGWAAIRFVADNPGAWLMHCHLDVHITWGLAMVFLVENGPSYMT  561

Query  320   TVppppPDLPRC  285
             T+  PPPDLP C
Sbjct  562   TIESPPPDLPVC  573



>ref|XP_008359050.1| PREDICTED: laccase-3-like [Malus domestica]
Length=567

 Score =   350 bits (897),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 200/312 (64%), Positives = 232/312 (74%), Gaps = 7/312 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IM+GPGQTT+VL+TA+QRP RYYMAA AY TAQ  PFDNTT TA+LEY    SS      
Sbjct  261   IMIGPGQTTDVLLTADQRPARYYMAARAYQTAQNVPFDNTTTTAILEYKNAASSNQGL-A  319

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC-IP-GPR  861
              + P LPA NDTAT TA+T+Q++S     + T     I+ +LFFTVGLG  NC +P  P 
Sbjct  320   PVFPTLPAYNDTATATAYTAQIKSPSQVKVPTQ----IDENLFFTVGLGPYNCTVPNSPW  375

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             CQGPN TRFAASMNNVSF LP   S + A Y  + G++TTDFP VP VQFNYTGNVPR L
Sbjct  376   CQGPNNTRFAASMNNVSFALPSTNSSMQAAYYGVLGVFTTDFPPVPLVQFNYTGNVPRGL  435

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             W P  GTK+YK+K+G++VQIV QDT   + +DHP+H HG H Y++G GFGN+NP TDPA 
Sbjct  436   WSPCRGTKLYKLKYGANVQIVFQDTSTVTIDDHPMHFHGCHSYVIGSGFGNYNPSTDPAR  495

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNLIDPP RNTI  P GGW AIRF ADNPGVWLMHCH+DSHL  GLAM+ LVENGI   +
Sbjct  496   FNLIDPPQRNTIGTPPGGWVAIRFKADNPGVWLMHCHLDSHLFLGLAMACLVENGIGPLQ  555

Query  320   TVppppPDLPRC  285
             TV PPPPDLPRC
Sbjct  556   TVIPPPPDLPRC  567



>ref|XP_006664275.1| PREDICTED: putative laccase-17-like [Oryza brachyantha]
Length=445

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 190/312 (61%), Positives = 237/312 (76%), Gaps = 10/312 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             ++LGPGQTT+VL+T +Q PGRYY+AA AYA+AQG PFDNTT TA+ +Y     S+S +  
Sbjct  142   LLLGPGQTTDVLVTFDQPPGRYYLAARAYASAQGVPFDNTTTTAIFDYGAGNGSSSPA--  199

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
               +P LPA NDTAT TAFT+ LR L    L +     ++ SLFFTVG+G  NC  G +C 
Sbjct  200   --MPTLPAYNDTATATAFTTSLRGLRKAELPSR----VDESLFFTVGVGLFNCSKGQQCG  253

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPG-IYTTDFPSVPPVQFNYTG-NVPRAL  681
             GPNG RFAAS+NNVSFVLP  +SIL A+Y+     ++T DFP+ PPVQF+YT  NV RAL
Sbjct  254   GPNGMRFAASINNVSFVLPSSSSILQAHYHGAANCVFTADFPANPPVQFDYTAQNVSRAL  313

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             WQP  GTKVY++K+GS+VQ+VLQ T IF+ E+HPIHLHGY FYI+ +G GNF+ G D   
Sbjct  314   WQPVAGTKVYRLKYGSAVQVVLQGTNIFAGENHPIHLHGYDFYILAEGLGNFDAGRDTGK  373

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLV++G+ E +
Sbjct  374   FNLEDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVDDGVGELQ  433

Query  320   TVppppPDLPRC  285
             ++  PPPDLP C
Sbjct  434   SLEAPPPDLPLC  445



>emb|CDY18869.1| BnaC04g04810D [Brassica napus]
Length=574

 Score =   349 bits (895),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 187/319 (59%), Positives = 231/319 (72%), Gaps = 13/319 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             I+LGPGQTT+ LIT +Q P RYYMAA AY +AQ  PF NTT TA+L+Y +       +  
Sbjct  260   IVLGPGQTTDALITGDQPPNRYYMAARAYQSAQNVPFGNTTTTAILQYKSAPCCIGGAKK  319

Query  1034  AL-----LPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC--  876
              +     +P LPA NDT TVT F+   +SL    + T     ++ +LF T+GLG  NC  
Sbjct  320   GISIKPIMPLLPAYNDTNTVTRFSQSFKSLRKAEVPTE----LDENLFITIGLGLNNCPK  375

Query  875   -IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG  699
                  RCQG NGTRF ASMNNVSF LP   S+L A++++I G++TTDFP+ PPV+F+YTG
Sbjct  376   NFRSRRCQGLNGTRFTASMNNVSFALPSNYSLLQAHHHSIHGVFTTDFPAKPPVKFDYTG  435

Query  698   -NVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFN  522
              N+ R+L+QP  GTK+YK+K+GS VQIVLQDTGI + E+HPIHLHGY FYIV +GFGNFN
Sbjct  436   SNISRSLYQPDRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDFYIVAEGFGNFN  495

Query  521   PGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVE  342
             P  D A FNL DPPLRNT+ VPV GWA IRFVADNPGVW+MHCH+D+H++WGLAM+FLVE
Sbjct  496   PKKDTAKFNLEDPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDAHISWGLAMAFLVE  555

Query  341   NGITEWETVppppPDLPRC  285
             NG    ET+  PP DLP C
Sbjct  556   NGKGLLETIEEPPADLPVC  574



>ref|XP_003616702.1| Laccase [Medicago truncatula]
 gb|AES99660.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=567

 Score =   348 bits (894),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 185/315 (59%), Positives = 226/315 (72%), Gaps = 9/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLI  +Q P RYY+A  AY +AQ A FDNTT TA+LEY ++   A     
Sbjct  257   LMLGPGQTTDVLIQGDQPPSRYYIAGRAYQSAQNAAFDNTTTTAILEYKSSPCPAKGGAN  316

Query  1034  A--LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IP  870
                ++P LPA NDT TVT+F+   RSL    +       I+  LFFT+GLG  NC     
Sbjct  317   IRPIMPSLPAYNDTNTVTSFSKSFRSLRNVEVPNE----IDEDLFFTIGLGLNNCPSNFN  372

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVP  690
               +CQGPNGTRF +SMNNVSFVLP   SIL A+   + G++TTDFP+ PPVQF+YTGNV 
Sbjct  373   SNQCQGPNGTRFTSSMNNVSFVLPSNFSILQAHKLGVQGVFTTDFPTKPPVQFDYTGNVS  432

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R+LWQP  GTKV K++FGS VQ+VLQDT I + E+HPIHLHGY FYIV +GFGNF+P  D
Sbjct  433   RSLWQPIQGTKVTKLRFGSRVQVVLQDTSIVTPENHPIHLHGYDFYIVAEGFGNFDPKKD  492

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
              + FNL+DPP+RNT+ VPV GWA IRFVADNPGVW+MHCH+D H+ WGLA  FLVE+G  
Sbjct  493   ASKFNLVDPPMRNTVAVPVNGWAVIRFVADNPGVWIMHCHLDVHIGWGLATVFLVEDGEG  552

Query  329   EWETVppppPDLPRC  285
               E++  PP DLP C
Sbjct  553   LLESIEAPPEDLPLC  567



>ref|XP_010452666.1| PREDICTED: laccase-13-like isoform X2 [Camelina sativa]
Length=484

 Score =   345 bits (886),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 194/316 (61%), Positives = 226/316 (72%), Gaps = 11/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+TA+Q P  YYMAA AY +A  A FDNTT TA+L+Y   +        
Sbjct  174   IMLGPGQTTDVLLTADQPPAHYYMAAHAYNSANAA-FDNTTTTAILKYKDASCVTLLGKS  232

Query  1034  ---ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--  870
                A+L +LP  NDTAT  AFT+Q++S     +       I+ +LFFTVGLG  NC    
Sbjct  233   QARAILAQLPGFNDTATAAAFTAQMKSPSKVEVPLE----IDENLFFTVGLGLFNCTTPN  288

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIP-GIYTTDFPSVPPVQFNYTGNV  693
               RCQGPNGTRF AS+NNVSFV P+R SI+ AYY   P G++TTDFP  PPV F+YTGNV
Sbjct  289   TQRCQGPNGTRFTASINNVSFVFPKRNSIMQAYYQGTPAGVFTTDFPPTPPVTFDYTGNV  348

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R LWQP  GTK YK+KF S VQI+LQDT I +TE+HP+HLHGY FY+VG G GNFN  T
Sbjct  349   SRGLWQPTRGTKAYKLKFNSKVQIILQDTSIVTTENHPMHLHGYEFYVVGTGVGNFNANT  408

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D ASFNLIDPP RNTI  P GGW AIRFVA+NPG WLMHCHIDSH+ WGLAM FLVENG 
Sbjct  409   DTASFNLIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHIDSHIFWGLAMVFLVENGE  468

Query  332   TEWETVppppPDLPRC  285
                ++V  PP DLP+C
Sbjct  469   GHLQSVQSPPLDLPQC  484



>ref|XP_003558123.1| PREDICTED: laccase-3 [Brachypodium distachyon]
Length=599

 Score =   349 bits (895),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 182/334 (54%), Positives = 232/334 (69%), Gaps = 28/334 (8%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasyS--  1041
             ++LGPGQTT+VL+TA+  P RYY+AA  YA+AQG PFDNTTATA+ +Y       + +  
Sbjct  265   VLLGPGQTTDVLVTADAAPARYYLAARVYASAQGVPFDNTTATAIFQYKNAAGCPTTTNP  324

Query  1040  ---------------------PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLI  924
                                  P  L+P LPA NDT T TAF+  +RS     +  P    
Sbjct  325   ALNGPVGRPSQRSSAHPGRAGPAPLMPALPAFNDTNTATAFSKSIRSPRPVKVPGP----  380

Query  923   IEHSLFFTVGLGFVNCIPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYT  744
             +   +F TVG G  NC PGP CQGPN TRFAASMNNVSF LP   S+L A+Y+++PG++T
Sbjct  381   VTQEVFTTVGFGLFNCRPGPFCQGPNNTRFAASMNNVSFQLPNTVSLLQAHYHHVPGVFT  440

Query  743   TDFPSVPPVQFNYTG-NVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLH  567
              DFP+VPPV F++T  NVPR+LWQP  GT++Y+VK+G+ VQ+V QDTGIF+ E+HP+H+H
Sbjct  441   EDFPAVPPVIFDFTSQNVPRSLWQPVKGTRLYRVKYGAVVQMVFQDTGIFAAEEHPMHIH  500

Query  566   GYHFYIVGQGFGNFNPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHI  387
             GYHFY++  GFGN++   D A FN++DPP RNTI VPVGGWA +RFVADNPGVWL+HCHI
Sbjct  501   GYHFYVLATGFGNYDARRDAAKFNMVDPPSRNTIGVPVGGWAVVRFVADNPGVWLVHCHI  560

Query  386   DSHLTWGLAMSFLVENGITEWETVppppPDLPRC  285
             D+HLT GL M+ LVE+G  E +   PPP DLP C
Sbjct  561   DAHLTGGLGMALLVEDGKAELQATVPPPLDLPIC  594



>emb|CDX99004.1| BnaC09g48310D [Brassica napus]
Length=566

 Score =   348 bits (892),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 195/315 (62%), Positives = 228/315 (72%), Gaps = 11/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttt-tssasySP  1038
             IMLGPGQTT+VL+TA+Q P  YYMAA AY +A  APFDNTT TA+L+Y      ++    
Sbjct  258   IMLGPGQTTDVLLTADQPPAHYYMAAHAYNSAN-APFDNTTTTAILQYKDAPCVTSKSQA  316

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGP--  864
             GA+  +LP  NDTAT  AFT+Q++S     +       IE  LFFTVGLG  NC P P  
Sbjct  317   GAIPAQLPGFNDTATAAAFTAQMKSPSKVEVPLE----IEEDLFFTVGLGLFNC-PTPNT  371

Query  863   -RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIP-GIYTTDFPSVPPVQFNYTGNVP  690
              RCQGPNGTRF AS+NNVSFV P+R SI+ AYY   P G++TTDFP VPP  F+YTGNV 
Sbjct  372   QRCQGPNGTRFTASINNVSFVFPKRNSIMQAYYQGTPAGVFTTDFPPVPPTTFDYTGNVS  431

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R LWQP  GTK YK+K+ S VQ++LQDT I +TE+HP+HLHGY FY+VG G GNFN   D
Sbjct  432   RGLWQPTRGTKAYKLKYKSKVQVILQDTSIVTTENHPMHLHGYEFYVVGTGIGNFNANKD  491

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
               SFNLIDPP RNTI  P GGW AIRFVADNPGVWLMHCH+DSH+ WGLAM FLVENG  
Sbjct  492   TPSFNLIDPPRRNTIGTPPGGWIAIRFVADNPGVWLMHCHLDSHILWGLAMVFLVENGEG  551

Query  329   EWETVppppPDLPRC  285
               ++V  PP DLP+C
Sbjct  552   HLQSVQSPPLDLPQC  566



>ref|XP_006828131.1| hypothetical protein AMTR_s00023p00051360 [Amborella trichopoda]
 gb|ERM95547.1| hypothetical protein AMTR_s00023p00051360 [Amborella trichopoda]
Length=589

 Score =   348 bits (892),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 184/313 (59%), Positives = 231/313 (74%), Gaps = 3/313 (1%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssa--syS  1041
             +M+ PGQTT++L+TA+Q PGRYY+AA AYA+     FDNTT TA+L+Y      A  + +
Sbjct  277   LMIAPGQTTDLLVTADQAPGRYYIAARAYASNINVAFDNTTTTAILQYQGLPCPAPGTSA  336

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR  861
             P  ++P LP  NDT T T FT+ LRSL +      +P  ++ +LFFTVGLG  NC  G  
Sbjct  337   PQPIMPSLPFYNDTNTATRFTTSLRSLNSREFPARVPQSVDENLFFTVGLGLFNCRTGQM  396

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPRA  684
             C GPN TRFAAS+NN+SF LPQ  SIL A+   + G++T DFP VPPVQF+YT  NV RA
Sbjct  397   CGGPNNTRFAASVNNISFALPQSLSILQAHTYGVNGVFTRDFPRVPPVQFDYTAQNVSRA  456

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             LWQP  GT+V ++KFGS VQ+VLQ T I + E+HP+HLHG+ FY++ +GFGNFNP  D +
Sbjct  457   LWQPVRGTRVKQMKFGSVVQVVLQGTNIVNGENHPMHLHGHDFYVLAEGFGNFNPSRDTS  516

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
             +FNL+DPPLRNT+ VP+ GWA IRFVADNPGVWLMHCH D H+ WGLAM FLVENGI+E 
Sbjct  517   NFNLVDPPLRNTMGVPINGWAVIRFVADNPGVWLMHCHFDVHINWGLAMVFLVENGISEL  576

Query  323   ETVppppPDLPRC  285
             E++ PPP DLP C
Sbjct  577   ESLEPPPIDLPPC  589



>ref|XP_008343632.1| PREDICTED: laccase-12-like [Malus domestica]
Length=583

 Score =   347 bits (890),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 189/317 (60%), Positives = 228/317 (72%), Gaps = 11/317 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLIT +Q P RYY+AASAY +AQ A F NTT TA+LEY +   S S   G
Sbjct  271   LMLGPGQTTDVLITGDQPPARYYLAASAYFSAQNAAFXNTTTTAILEYKSAPCSPSCKNG  330

Query  1034  A----LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---  876
                  ++P+LPA NDT T +AFT   RS     + T     I+ +LFFT+GLG  NC   
Sbjct  331   PTAKPIMPQLPAFNDTNTASAFTKSFRSPRKVEVPTE----IDENLFFTIGLGLNNCPKH  386

Query  875   IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN  696
                 RCQGPNGTRF ASMNNVSFVLP   SIL AY  NIPG++T DFP+ PP +F+YTGN
Sbjct  387   FRARRCQGPNGTRFTASMNNVSFVLPNNMSILQAYQQNIPGVFTNDFPANPPKKFDYTGN  446

Query  695   VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPG  516
             V  +LWQP  GT+ Y +K+GS VQ+VLQDT I + E+HPIHLHGY FYI+ +GFGNFN  
Sbjct  447   VSSSLWQPLSGTRGYNLKYGSRVQVVLQDTSIVTPENHPIHLHGYDFYILAEGFGNFNAK  506

Query  515   TDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENG  336
             TD   FNL+DPP+RNT+ VP  GWA IRFVADNPG W+MHCH+D H+ WGLAM FLV+NG
Sbjct  507   TDTKKFNLVDPPMRNTVAVPANGWAVIRFVADNPGAWIMHCHLDVHINWGLAMVFLVDNG  566

Query  335   ITEWETVppppPDLPRC  285
             + E + + PPP DLP C
Sbjct  567   VGELQXIEPPPADLPVC  583



>ref|XP_006399193.1| hypothetical protein EUTSA_v10013732mg [Eutrema salsugineum]
 gb|ESQ40646.1| hypothetical protein EUTSA_v10013732mg [Eutrema salsugineum]
Length=399

 Score =   340 bits (873),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 191/317 (60%), Positives = 226/317 (71%), Gaps = 12/317 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyt----tttssas  1047
             IMLGPGQTT+VL+TA+Q P  YYMAA AY +A  APFDNTT TA+L+Y      T     
Sbjct  88    IMLGPGQTTDVLLTADQPPAHYYMAAHAYNSAN-APFDNTTTTAILQYKGAPCVTRQGNL  146

Query  1046  ySPGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP-  870
              +  A+  +LP  NDTAT  AFT+Q++S     +       I+  LFFTVGLG  NC   
Sbjct  147   QAQRAVPAQLPGFNDTATAAAFTAQMKSPSRVEVPLE----IDEDLFFTVGLGLFNCSTP  202

Query  869   -GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYN-NIPGIYTTDFPSVPPVQFNYTGN  696
                RCQGPN TRF AS+NNVSFV P+R SI+ AYY  N  G++TTDFP +PP+ F+YTGN
Sbjct  203   NTQRCQGPNRTRFTASINNVSFVFPRRNSIMQAYYQGNSAGVFTTDFPPIPPLAFDYTGN  262

Query  695   VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPG  516
             V R LWQP  GTK YK+K+ S VQ++LQDT I + E+HP+HLHGY FY+VG G GNFNP 
Sbjct  263   VSRGLWQPTRGTKAYKLKYKSKVQVILQDTSIVTIENHPMHLHGYEFYVVGTGIGNFNPS  322

Query  515   TDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENG  336
              D ASFNL+DPP RNTI  P GGW AIRFVADNPGVWLMHCHIDSH+ WGLAM FLVENG
Sbjct  323   KDTASFNLLDPPRRNTIGTPPGGWVAIRFVADNPGVWLMHCHIDSHIFWGLAMVFLVENG  382

Query  335   ITEWETVppppPDLPRC  285
                 ++V  PP DLP+C
Sbjct  383   EGHLQSVQSPPLDLPQC  399



>ref|XP_010452665.1| PREDICTED: laccase-13-like isoform X1 [Camelina sativa]
Length=569

 Score =   346 bits (888),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 194/316 (61%), Positives = 226/316 (72%), Gaps = 11/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+TA+Q P  YYMAA AY +A  A FDNTT TA+L+Y   +        
Sbjct  259   IMLGPGQTTDVLLTADQPPAHYYMAAHAYNSANAA-FDNTTTTAILKYKDASCVTLLGKS  317

Query  1034  ---ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--  870
                A+L +LP  NDTAT  AFT+Q++S     +       I+ +LFFTVGLG  NC    
Sbjct  318   QARAILAQLPGFNDTATAAAFTAQMKSPSKVEVPLE----IDENLFFTVGLGLFNCTTPN  373

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIP-GIYTTDFPSVPPVQFNYTGNV  693
               RCQGPNGTRF AS+NNVSFV P+R SI+ AYY   P G++TTDFP  PPV F+YTGNV
Sbjct  374   TQRCQGPNGTRFTASINNVSFVFPKRNSIMQAYYQGTPAGVFTTDFPPTPPVTFDYTGNV  433

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R LWQP  GTK YK+KF S VQI+LQDT I +TE+HP+HLHGY FY+VG G GNFN  T
Sbjct  434   SRGLWQPTRGTKAYKLKFNSKVQIILQDTSIVTTENHPMHLHGYEFYVVGTGVGNFNANT  493

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D ASFNLIDPP RNTI  P GGW AIRFVA+NPG WLMHCHIDSH+ WGLAM FLVENG 
Sbjct  494   DTASFNLIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHIDSHIFWGLAMVFLVENGE  553

Query  332   TEWETVppppPDLPRC  285
                ++V  PP DLP+C
Sbjct  554   GHLQSVQSPPLDLPQC  569



>ref|XP_004978572.1| PREDICTED: putative laccase-17-like [Setaria italica]
Length=586

 Score =   347 bits (889),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 193/312 (62%), Positives = 240/312 (77%), Gaps = 8/312 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +M+ PGQTT+VL+T +Q PGRYY+AA AYA+AQG PFDNTT TA+ +Y++++SS S SP 
Sbjct  281   LMIAPGQTTDVLVTFDQPPGRYYLAARAYASAQGVPFDNTTTTAIFDYSSSSSSGSSSPA  340

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
               +P LPA NDTAT T FT+ LR L    L +     ++ +LFFTVG+G  NC  G  C 
Sbjct  341   --MPTLPAYNDTATATTFTTNLRGLRKAELPSR----VDENLFFTVGVGLFNCSRGQTCG  394

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIP-GIYTTDFPSVPPVQFNYTG-NVPRAL  681
             GPN TRFAASMNNVSFVLP   SIL A+Y     G++T DFP+ PPVQF+YT  NV RAL
Sbjct  395   GPNNTRFAASMNNVSFVLPSTVSILQAHYGGAQQGVFTADFPANPPVQFDYTAQNVSRAL  454

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             WQP  GTKVY++K+G++VQ+VLQ T IF+ E+HPIH+HGY FYI+ +GFGNF+  TD A 
Sbjct  455   WQPAPGTKVYRLKYGAAVQLVLQGTNIFAGENHPIHIHGYDFYILAEGFGNFDAATDTAK  514

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FNL DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVE+G+ E +
Sbjct  515   FNLDDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGVGELQ  574

Query  320   TVppppPDLPRC  285
             ++  PPPDLP C
Sbjct  575   SLEAPPPDLPLC  586



>ref|XP_004491004.1| PREDICTED: laccase-5-like [Cicer arietinum]
Length=569

 Score =   346 bits (887),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 180/317 (57%), Positives = 224/317 (71%), Gaps = 11/317 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLI A+Q P RYY+AA AY +AQ APFDNTT T++LEY +          
Sbjct  257   LMLGPGQTTDVLIVADQPPSRYYIAARAYQSAQNAPFDNTTTTSILEYKSAPCPKKGGAS  316

Query  1034  A---LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC----  876
             +   ++P LP+ NDT TVT+F+   RSL    +       I+  LFFT+GLG  NC    
Sbjct  317   SNKPIMPSLPSYNDTNTVTSFSKSFRSLRKVEVPLE----IDEDLFFTIGLGLNNCPKNF  372

Query  875   IPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN  696
                 +CQGPNGTRF +SMNNVSFVLP   SIL A+   + G++T DFP+ PPV+F+YTGN
Sbjct  373   DAKKQCQGPNGTRFTSSMNNVSFVLPSNFSILQAHKLGVQGVFTDDFPAKPPVKFDYTGN  432

Query  695   VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPG  516
             V R+LWQP  GTKV K++FGS VQIVLQDT I + E+HPIHLHGY FYIV +GFGNF+  
Sbjct  433   VSRSLWQPIQGTKVTKLRFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAEGFGNFDSK  492

Query  515   TDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENG  336
              D + FNL+DPP+RNT+ VP  GWA IRFVADNPGVW++HCH+D H+ WGLA   LVE+G
Sbjct  493   KDASKFNLVDPPMRNTVAVPANGWAVIRFVADNPGVWILHCHLDVHIAWGLATVLLVEDG  552

Query  335   ITEWETVppppPDLPRC  285
                 E++  PP DLP C
Sbjct  553   EGLLESIEAPPEDLPLC  569



>ref|XP_004977611.1| PREDICTED: laccase-23-like [Setaria italica]
Length=595

 Score =   346 bits (887),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 241/314 (77%), Gaps = 9/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +M+ PGQTT+VL+T +Q PGRYY+AA AYA+AQG PFDNTT TA+ +Y++++ S+S S  
Sbjct  287   LMIAPGQTTDVLVTFDQPPGRYYLAARAYASAQGVPFDNTTTTAIFDYSSSSGSSSSSSP  346

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
             A+ P LPA NDTAT T FT+ LR L    L +     I+ +LFFTVG+G  NC  G +C 
Sbjct  347   AM-PTLPAYNDTATATTFTTSLRGLRKAELPSR----IDENLFFTVGVGLFNCSSGQKCG  401

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIP---GIYTTDFPSVPPVQFNYTG-NVPR  687
             GPN TRFAASMNNVSFVLP   SIL A+Y       G++T DFP+ PPVQF+YT  NV R
Sbjct  402   GPNNTRFAASMNNVSFVLPSTVSILQAHYGGAQVQQGVFTDDFPANPPVQFDYTAQNVSR  461

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             ALWQP  GTKVY++K+G++VQ+VLQ T IF+ E+HPIH+HGY FYI+ +GFGNF+  TD 
Sbjct  462   ALWQPAPGTKVYRLKYGAAVQLVLQGTNIFAGENHPIHIHGYDFYILAEGFGNFDAATDT  521

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVE+G+ E
Sbjct  522   AKFNLDDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGVGE  581

Query  326   WETVppppPDLPRC  285
              +++  PPPDLP C
Sbjct  582   LQSLEAPPPDLPLC  595



>ref|NP_196330.3| laccase 13 [Arabidopsis thaliana]
 sp|Q9LYQ2.1|LAC13_ARATH RecName: Full=Laccase-13; AltName: Full=Benzenediol:oxygen oxidoreductase 
13; AltName: Full=Diphenol oxidase 13; AltName: 
Full=Urishiol oxidase 13; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB87269.1| laccase-like protein [Arabidopsis thaliana]
 gb|AED91113.1| laccase 13 [Arabidopsis thaliana]
Length=569

 Score =   345 bits (885),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 194/317 (61%), Positives = 229/317 (72%), Gaps = 13/317 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+TA+Q P  YYMAA AY +A  A FDNTT TA+L+Y   +     +  
Sbjct  259   IMLGPGQTTDVLLTADQPPAHYYMAAHAYNSANAA-FDNTTTTAILKYKDASCVTLQAKS  317

Query  1034  ---ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGP  864
                A+  +LP  NDTAT  AFT+Q++S     +       I+ +LFFTVGLG  NC P P
Sbjct  318   QARAIPAQLPGFNDTATAAAFTAQMKSPSKVKVPLE----IDENLFFTVGLGLFNC-PTP  372

Query  863   ---RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIP-GIYTTDFPSVPPVQFNYTGN  696
                RCQGPNGTRF AS+NNVSFV P++ SI+ AYY   P G++TTDFP  PPV F+YTGN
Sbjct  373   NTQRCQGPNGTRFTASINNVSFVFPKQNSIMQAYYQGTPTGVFTTDFPPTPPVTFDYTGN  432

Query  695   VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPG  516
             V R LWQP  GTK YK+KF S VQI+LQDT I +TE+HP+HLHGY FY+VG G GNFNP 
Sbjct  433   VSRGLWQPTRGTKAYKLKFNSQVQIILQDTSIVTTENHPMHLHGYEFYVVGTGVGNFNPN  492

Query  515   TDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENG  336
             TD +SFNLIDPP RNTI  P GGW AIRFVA+NPG WLMHCHIDSH+ WGLAM FLVENG
Sbjct  493   TDTSSFNLIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHIDSHIFWGLAMVFLVENG  552

Query  335   ITEWETVppppPDLPRC  285
                 ++V  PP DLP+C
Sbjct  553   EGHLQSVQSPPLDLPQC  569



>ref|XP_002871251.1| laccase-13 precursor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47510.1| laccase-13 precursor [Arabidopsis lyrata subsp. lyrata]
Length=569

 Score =   345 bits (884),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 194/317 (61%), Positives = 228/317 (72%), Gaps = 13/317 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+TA+Q P  YYMAA AY +A  A FDNTT TA+L+Y   +        
Sbjct  259   IMLGPGQTTDVLLTADQPPAHYYMAAHAYNSANAA-FDNTTTTAILKYKDASCVTLQGKS  317

Query  1034  ---ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGP  864
                A+  +LP  NDTAT  AFT+Q++S     +       I+ +LFFTVGLG  NC P P
Sbjct  318   QAQAIPAQLPGFNDTATAAAFTAQMKSPSKVKVPLE----IDENLFFTVGLGLFNC-PTP  372

Query  863   ---RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIP-GIYTTDFPSVPPVQFNYTGN  696
                RCQGPNGTRF AS+NNVSFV P++ SI+ AYY   P G++TTDFP  PPV F+YTGN
Sbjct  373   NTQRCQGPNGTRFTASINNVSFVFPKQNSIMQAYYQGTPAGVFTTDFPPTPPVTFDYTGN  432

Query  695   VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPG  516
             V R LWQP  GTK YK+KF S VQI+LQDT I +TE+HP+HLHGY FY+VG G GNFNP 
Sbjct  433   VSRGLWQPTRGTKAYKLKFNSKVQIILQDTSIVTTENHPMHLHGYEFYVVGTGVGNFNPN  492

Query  515   TDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENG  336
             TD ASFNLIDPP RNTI  P GGW AIRFVA+NPG WLMHCH+DSH+ WGLAM FLVENG
Sbjct  493   TDTASFNLIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHLDSHIFWGLAMVFLVENG  552

Query  335   ITEWETVppppPDLPRC  285
                 ++V  PP DLP+C
Sbjct  553   EGHLQSVQSPPLDLPQC  569



>ref|XP_009122371.1| PREDICTED: laccase-13 isoform X2 [Brassica rapa]
 ref|XP_009122372.1| PREDICTED: laccase-13 isoform X2 [Brassica rapa]
 ref|XP_009122373.1| PREDICTED: laccase-13 isoform X2 [Brassica rapa]
Length=482

 Score =   342 bits (876),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 227/315 (72%), Gaps = 11/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+TA+Q P  YYMAA AY +A  APFDNTT T++LEY       S S  
Sbjct  174   IMLGPGQTTDVLLTADQPPAHYYMAAHAYNSAN-APFDNTTTTSILEYKDAPCVTSQSQA  232

Query  1034  ALLP-RLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGP--  864
               +P +LP  NDTAT  AFT+Q++S     +       ++  LFFTVGLG  NC P P  
Sbjct  233   RAIPAQLPGFNDTATAAAFTAQMKSPSKVEVPLE----VDEDLFFTVGLGLFNC-PTPNT  287

Query  863   -RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIP-GIYTTDFPSVPPVQFNYTGNVP  690
              RCQGPNGTRF AS+NNVSFV P++ SIL AYY   P G++TTDFP VPP  F+YTGNV 
Sbjct  288   QRCQGPNGTRFTASINNVSFVFPRQNSILQAYYQGTPAGVFTTDFPPVPPTTFDYTGNVS  347

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R LWQP  GTK YK+K+ S VQ++LQDT I + E+HP+HLHGY FY+VG G GNFN   D
Sbjct  348   RGLWQPTRGTKAYKLKYKSKVQVILQDTSIVTIENHPMHLHGYEFYVVGTGIGNFNANKD  407

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
              +SFNLIDPP RNTI  P GGW AIRFVADNPGVWLMHCHID+H+ WGLAM FLVENG  
Sbjct  408   TSSFNLIDPPRRNTIGTPPGGWIAIRFVADNPGVWLMHCHIDAHIFWGLAMVFLVENGEG  467

Query  329   EWETVppppPDLPRC  285
               ++V  PP DLP+C
Sbjct  468   HLQSVQSPPLDLPQC  482



>ref|XP_010491316.1| PREDICTED: laccase-13 isoform X1 [Camelina sativa]
Length=569

 Score =   344 bits (883),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 193/316 (61%), Positives = 226/316 (72%), Gaps = 11/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+TA+Q P  YYMAA AY +A  A FDNTT TA+L+Y   +        
Sbjct  259   IMLGPGQTTDVLLTADQPPAHYYMAAHAYNSANAA-FDNTTTTAILKYKDASCVTLQGKS  317

Query  1034  ---ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--  870
                A+  +LP  NDTAT  AFT+Q++S     +       I+ +LFFTVGLG  NC    
Sbjct  318   LARAIPAQLPGFNDTATAAAFTAQMKSPSKVQVPLE----IDENLFFTVGLGLFNCTTPN  373

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIP-GIYTTDFPSVPPVQFNYTGNV  693
               RCQGPNGTRF AS+NNVSFV P++ SI+ AYY   P G++TTDFP  PPV F+YTGNV
Sbjct  374   TQRCQGPNGTRFTASINNVSFVFPKQNSIMQAYYQGTPAGVFTTDFPPTPPVTFDYTGNV  433

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R LWQP  GTK YK+KF S VQI+LQDT I +TE+HP+HLHGY FY+VG G GNFNP T
Sbjct  434   SRGLWQPTRGTKAYKLKFNSKVQIILQDTSIVTTENHPMHLHGYEFYVVGTGVGNFNPNT  493

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D ASFNLIDPP RNTI  P GGW AIRFVA+NPG WLMHCHIDSH+ WGLAM FLVENG 
Sbjct  494   DTASFNLIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHIDSHIFWGLAMVFLVENGE  553

Query  332   TEWETVppppPDLPRC  285
                ++V  PP DLP+C
Sbjct  554   GHLQSVQSPPLDLPQC  569



>ref|XP_010491317.1| PREDICTED: laccase-13 isoform X2 [Camelina sativa]
Length=568

 Score =   344 bits (882),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 193/316 (61%), Positives = 226/316 (72%), Gaps = 11/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+TA+Q P  YYMAA AY +A  A FDNTT TA+L+Y   +        
Sbjct  258   IMLGPGQTTDVLLTADQPPAHYYMAAHAYNSANAA-FDNTTTTAILKYKDASCVTLQGKS  316

Query  1034  ---ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--  870
                A+  +LP  NDTAT  AFT+Q++S     +       I+ +LFFTVGLG  NC    
Sbjct  317   LARAIPAQLPGFNDTATAAAFTAQMKSPSKVQVPLE----IDENLFFTVGLGLFNCTTPN  372

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIP-GIYTTDFPSVPPVQFNYTGNV  693
               RCQGPNGTRF AS+NNVSFV P++ SI+ AYY   P G++TTDFP  PPV F+YTGNV
Sbjct  373   TQRCQGPNGTRFTASINNVSFVFPKQNSIMQAYYQGTPAGVFTTDFPPTPPVTFDYTGNV  432

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R LWQP  GTK YK+KF S VQI+LQDT I +TE+HP+HLHGY FY+VG G GNFNP T
Sbjct  433   SRGLWQPTRGTKAYKLKFNSKVQIILQDTSIVTTENHPMHLHGYEFYVVGTGVGNFNPNT  492

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D ASFNLIDPP RNTI  P GGW AIRFVA+NPG WLMHCHIDSH+ WGLAM FLVENG 
Sbjct  493   DTASFNLIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHIDSHIFWGLAMVFLVENGE  552

Query  332   TEWETVppppPDLPRC  285
                ++V  PP DLP+C
Sbjct  553   GHLQSVQSPPLDLPQC  568



>ref|XP_002448873.1| hypothetical protein SORBIDRAFT_05g000680 [Sorghum bicolor]
 gb|EES07861.1| hypothetical protein SORBIDRAFT_05g000680 [Sorghum bicolor]
Length=587

 Score =   344 bits (883),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 191/317 (60%), Positives = 237/317 (75%), Gaps = 14/317 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +M+ PGQTT+VL+T +Q PGRYY+AA AYA+AQG PFDNTT TA+ +Y T  +++S +  
Sbjct  278   LMIAPGQTTDVLVTFDQAPGRYYLAARAYASAQGVPFDNTTTTAIFDYGTGATTSSPA--  335

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
               +P LPA NDTAT T FT+ LR L    L T     ++ SLFFTVG+G  NC  G  C 
Sbjct  336   --MPTLPAYNDTATATTFTTSLRGLRKAELPTTR---VDESLFFTVGVGLFNCSSGQTCG  390

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYY-----NNIP-GIYTTDFPSVPPVQFNYTG-N  696
             GPN TRFAASMNNVSFVLP   SIL A+Y      + P G++T DFP+ PPV F+YT  N
Sbjct  391   GPNNTRFAASMNNVSFVLPSTTSILQAHYASGGATSAPAGVFTADFPANPPVTFDYTAQN  450

Query  695   VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPG  516
             V RALWQP  GTKVY++K+G++VQ+VLQ T +F+ E+HPIHLHGY FYI+ +GFGNF+  
Sbjct  451   VSRALWQPVPGTKVYRLKYGAAVQLVLQGTNVFAAENHPIHLHGYDFYILAEGFGNFDAA  510

Query  515   TDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENG  336
             TD A FN+ DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLVE+G
Sbjct  511   TDTAKFNMDDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEDG  570

Query  335   ITEWETVppppPDLPRC  285
             + E E++  PP DLP C
Sbjct  571   VGELESLEAPPADLPVC  587



>ref|XP_010423250.1| PREDICTED: laccase-13-like isoform X2 [Camelina sativa]
Length=484

 Score =   341 bits (875),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 192/316 (61%), Positives = 225/316 (71%), Gaps = 11/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+TA+Q P  YYMAA AY +A  A FDNTT TA+L+Y   +        
Sbjct  174   IMLGPGQTTDVLLTADQPPAHYYMAAHAYNSANAA-FDNTTTTAILKYKDASCVTLQGKS  232

Query  1034  ---ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--  870
                A+  +LP  NDTAT  AFT+Q++S     +       I+ +LFFTVGLG  NC    
Sbjct  233   LARAIPAQLPGFNDTATAAAFTAQMKSPSKVEVPLE----IDENLFFTVGLGLFNCTTPN  288

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIP-GIYTTDFPSVPPVQFNYTGNV  693
               RCQGPNGTRF AS+NNVSFV P++ SI+ AYY   P G++TTDFP  PPV F+YTGNV
Sbjct  289   TQRCQGPNGTRFTASINNVSFVFPKQNSIMQAYYQGTPAGVFTTDFPPTPPVTFDYTGNV  348

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R LWQP  GTK YK+KF S VQI+LQDT I +TE+HP+HLHGY FY+VG G GNFN  T
Sbjct  349   SRGLWQPTRGTKAYKLKFNSKVQIILQDTSIVTTENHPMHLHGYEFYVVGTGVGNFNANT  408

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D ASFNLIDPP RNTI  P GGW AIRFVA+NPG WLMHCHIDSH+ WGLAM FLVENG 
Sbjct  409   DTASFNLIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHIDSHIFWGLAMVFLVENGE  468

Query  332   TEWETVppppPDLPRC  285
                ++V  PP DLP+C
Sbjct  469   GHLQSVQSPPLDLPQC  484



>ref|XP_009122370.1| PREDICTED: laccase-13 isoform X1 [Brassica rapa]
Length=566

 Score =   342 bits (878),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 227/315 (72%), Gaps = 11/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+TA+Q P  YYMAA AY +A  APFDNTT T++LEY       S S  
Sbjct  258   IMLGPGQTTDVLLTADQPPAHYYMAAHAYNSA-NAPFDNTTTTSILEYKDAPCVTSQSQA  316

Query  1034  ALLP-RLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGP--  864
               +P +LP  NDTAT  AFT+Q++S     +       ++  LFFTVGLG  NC P P  
Sbjct  317   RAIPAQLPGFNDTATAAAFTAQMKSPSKVEVPLE----VDEDLFFTVGLGLFNC-PTPNT  371

Query  863   -RCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIP-GIYTTDFPSVPPVQFNYTGNVP  690
              RCQGPNGTRF AS+NNVSFV P++ SIL AYY   P G++TTDFP VPP  F+YTGNV 
Sbjct  372   QRCQGPNGTRFTASINNVSFVFPRQNSILQAYYQGTPAGVFTTDFPPVPPTTFDYTGNVS  431

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R LWQP  GTK YK+K+ S VQ++LQDT I + E+HP+HLHGY FY+VG G GNFN   D
Sbjct  432   RGLWQPTRGTKAYKLKYKSKVQVILQDTSIVTIENHPMHLHGYEFYVVGTGIGNFNANKD  491

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
              +SFNLIDPP RNTI  P GGW AIRFVADNPGVWLMHCHID+H+ WGLAM FLVENG  
Sbjct  492   TSSFNLIDPPRRNTIGTPPGGWIAIRFVADNPGVWLMHCHIDAHIFWGLAMVFLVENGEG  551

Query  329   EWETVppppPDLPRC  285
               ++V  PP DLP+C
Sbjct  552   HLQSVQSPPLDLPQC  566



>gb|AAK37826.1|AF132122_1 laccase [Pinus taeda]
Length=570

 Score =   342 bits (877),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 181/311 (58%), Positives = 231/311 (74%), Gaps = 5/311 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+TA+Q  GRYYMAA AY++ QG PFDNTT  A+LEY  ++SS S    
Sbjct  264   LMLGPGQTTDVLVTADQTTGRYYMAARAYSSGQGVPFDNTTTVAILEYKGSSSSTSV---  320

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
               +P LPA NDT T T F + LRSL ++     +P  ++ +LF+T+GLG +NC PG  C 
Sbjct  321   PTVPNLPAYNDTQTATRFANALRSLASHDHPVFVPQSVDQNLFYTIGLGLINC-PGQSCG  379

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPRALW  678
             GPNG+RFAASMNN SFVLP  +SIL+A +  + G+++ DFP  PPVQF+YT  NV R LW
Sbjct  380   GPNGSRFAASMNNASFVLPTTSSILEAQHFGMKGVFSGDFPDNPPVQFDYTAQNVSRGLW  439

Query  677   QPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASF  498
              P   T+V  + + ++VQ++LQ T IF+ E HPIHLHGY FYIVG GFGN+NP TDP  F
Sbjct  440   SPVKSTRVKILNYNTTVQVILQGTNIFAGESHPIHLHGYDFYIVGSGFGNYNPKTDPQKF  499

Query  497   NLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWET  318
             NL+DPP+RNT++VPV GWAAIRFVADNPG W+MHCH+D H+TWGLAM F+V NG +   +
Sbjct  500   NLVDPPMRNTVNVPVNGWAAIRFVADNPGAWVMHCHLDVHITWGLAMVFVVSNGPSSLLS  559

Query  317   VppppPDLPRC  285
             +  PP DLP+C
Sbjct  560   IESPPLDLPQC  570



>ref|XP_006289181.1| hypothetical protein CARUB_v10002622mg [Capsella rubella]
 gb|EOA22079.1| hypothetical protein CARUB_v10002622mg [Capsella rubella]
Length=568

 Score =   342 bits (877),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 193/316 (61%), Positives = 224/316 (71%), Gaps = 11/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL TA+Q P  YYMAA AY +A  A FDNTT TA+L+Y   +        
Sbjct  258   IMLGPGQTTDVLFTADQPPEHYYMAAHAYNSANAA-FDNTTTTAILKYKDASCVTLQGKS  316

Query  1034  ---ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--  870
                A+  +LP  NDTAT  AFT+Q++S     +       I+ +LFFTVGLG  NC    
Sbjct  317   LARAIPAQLPGFNDTATAAAFTAQMKSPSKVKVPLE----IDENLFFTVGLGLFNCTTPN  372

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIP-GIYTTDFPSVPPVQFNYTGNV  693
               RCQGPNGTRF ASMNNVSFV P+  SI+ AYY   P G++TTDFP  PPV F+YTGNV
Sbjct  373   TQRCQGPNGTRFTASMNNVSFVFPKGNSIMQAYYQGTPAGVFTTDFPPTPPVTFDYTGNV  432

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R LWQP  GTK YK+KF S VQI+LQDT I +TE+HP+HLHGY FY+VG G GNFNP T
Sbjct  433   SRGLWQPTRGTKAYKLKFKSKVQIILQDTSIVTTENHPMHLHGYEFYVVGTGVGNFNPNT  492

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D ASFNLIDPP RNTI  P GGW AIRFVA+NPG WLMHCHID+H+ WGLAM FLVENG 
Sbjct  493   DTASFNLIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHIDAHIFWGLAMVFLVENGE  552

Query  332   TEWETVppppPDLPRC  285
                ++V  PP DLP+C
Sbjct  553   GHLQSVQSPPLDLPQC  568



>ref|XP_010423249.1| PREDICTED: laccase-13-like isoform X1 [Camelina sativa]
Length=569

 Score =   342 bits (876),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 192/316 (61%), Positives = 225/316 (71%), Gaps = 11/316 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+TA+Q P  YYMAA AY +A  A FDNTT TA+L+Y   +        
Sbjct  259   IMLGPGQTTDVLLTADQPPAHYYMAAHAYNSANAA-FDNTTTTAILKYKDASCVTLQGKS  317

Query  1034  ---ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP--  870
                A+  +LP  NDTAT  AFT+Q++S     +       I+ +LFFTVGLG  NC    
Sbjct  318   LARAIPAQLPGFNDTATAAAFTAQMKSPSKVEVPLE----IDENLFFTVGLGLFNCTTPN  373

Query  869   GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIP-GIYTTDFPSVPPVQFNYTGNV  693
               RCQGPNGTRF AS+NNVSFV P++ SI+ AYY   P G++TTDFP  PPV F+YTGNV
Sbjct  374   TQRCQGPNGTRFTASINNVSFVFPKQNSIMQAYYQGTPAGVFTTDFPPTPPVTFDYTGNV  433

Query  692   PRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGT  513
              R LWQP  GTK YK+KF S VQI+LQDT I +TE+HP+HLHGY FY+VG G GNFN  T
Sbjct  434   SRGLWQPTRGTKAYKLKFNSKVQIILQDTSIVTTENHPMHLHGYEFYVVGTGVGNFNANT  493

Query  512   DPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGI  333
             D ASFNLIDPP RNTI  P GGW AIRFVA+NPG WLMHCHIDSH+ WGLAM FLVENG 
Sbjct  494   DTASFNLIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHIDSHIFWGLAMVFLVENGE  553

Query  332   TEWETVppppPDLPRC  285
                ++V  PP DLP+C
Sbjct  554   GHLQSVQSPPLDLPQC  569



>ref|XP_002456566.1| hypothetical protein SORBIDRAFT_03g038550 [Sorghum bicolor]
 gb|EES01686.1| hypothetical protein SORBIDRAFT_03g038550 [Sorghum bicolor]
Length=568

 Score =   341 bits (875),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 179/312 (57%), Positives = 225/312 (72%), Gaps = 6/312 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             +M+ PGQTT+VL+T +Q P RYY+AA AY + Q   FDNTT TAVLEY    +S      
Sbjct  261   LMIAPGQTTDVLVTMDQAPTRYYVAARAYVSGQNVAFDNTTTTAVLEYDCGCASDFGPKI  320

Query  1037  GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRC  858
                 P LPA NDT+  TAF + ++S     +       ++  LFFTVGLG  NC PG  C
Sbjct  321   QPAFPALPAFNDTSAATAFAAGIKSPNRVKIHEN----VDEYLFFTVGLGLFNCKPGQLC  376

Query  857   QGPNG-TRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPRAL  681
             +GPN  TRF ASMNNVSFV P+  S+L A+Y  +PG++TTDFP+ PPVQF+YTGNV +AL
Sbjct  377   KGPNNNTRFTASMNNVSFVFPKSDSLLHAHYYKVPGVFTTDFPAYPPVQFDYTGNVSQAL  436

Query  680   WQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPAS  501
             WQP  GTK+Y ++FGS VQ+VLQDT I + E+HPIH+HGY F+I+ +GFGNF+P  D   
Sbjct  437   WQPVPGTKLYPLRFGSVVQVVLQDTSIVTPENHPIHIHGYDFFILAEGFGNFDPKKDVEK  496

Query  500   FNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWE  321
             FN +DPP RNT+ VPV GWA I+FVADNPGVWLMHCH+D H+TWGLAM+FLVE+G  E +
Sbjct  497   FNYVDPPQRNTVAVPVNGWAVIQFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGYGELQ  556

Query  320   TVppppPDLPRC  285
             ++ PPP DLP C
Sbjct  557   SLEPPPVDLPMC  568



>ref|NP_001065948.1| Os12g0108000 [Oryza sativa Japonica Group]
 sp|Q2QYS3.1|LAC23_ORYSJ RecName: Full=Laccase-23; AltName: Full=Benzenediol:oxygen oxidoreductase 
23; AltName: Full=Diphenol oxidase 23; AltName: 
Full=Urishiol oxidase 23; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|ABA96185.1| Multicopper oxidase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28967.1| Os12g0108000 [Oryza sativa Japonica Group]
Length=567

 Score =   341 bits (874),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 188/314 (60%), Positives = 237/314 (75%), Gaps = 10/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             ++L PGQTT+VL+T +Q PGRYY+AA AYA+AQG PFDNTT TA+ +Y    +++S +  
Sbjct  260   LLLAPGQTTDVLVTFDQPPGRYYLAARAYASAQGVPFDNTTTTAIFDYGAANNASSAA--  317

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCI--PGPR  861
               +P LPA NDT   TAFT+ LR L    L +     ++ SLFFTVG+G  NC      +
Sbjct  318   IAMPTLPAYNDTTAATAFTTNLRGLRKAELPSR----VDESLFFTVGVGLFNCTNATAQQ  373

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPG-IYTTDFPSVPPVQFNYTG-NVPR  687
             C GPNGTRFAAS+NNVSFVLP   SIL A+++  PG ++T DFP+ PPVQF+YT  NV R
Sbjct  374   CGGPNGTRFAASINNVSFVLPSSTSILQAHHHGAPGGVFTADFPASPPVQFDYTAQNVSR  433

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             ALWQP  GTKVYK+K+GS+VQ+VLQ T IF+ E+HPIHLHGY FYI+ +G GNF+ G D 
Sbjct  434   ALWQPVPGTKVYKLKYGSAVQVVLQGTNIFAGENHPIHLHGYDFYILAEGLGNFDAGADT  493

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FN+ DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLV++G+ E
Sbjct  494   AKFNMEDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVDDGVGE  553

Query  326   WETVppppPDLPRC  285
              +++  PPPDLP C
Sbjct  554   LQSLEAPPPDLPLC  567



>ref|NP_001065548.2| Os11g0108700 [Oryza sativa Japonica Group]
 dbj|BAF27393.2| Os11g0108700 [Oryza sativa Japonica Group]
Length=522

 Score =   339 bits (869),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 187/314 (60%), Positives = 236/314 (75%), Gaps = 10/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             ++L PGQTT+VL+T +Q PGRYY+AA AYA+AQG PFDNTT TA+ +Y    +++S +  
Sbjct  215   LLLAPGQTTDVLVTFDQPPGRYYLAARAYASAQGVPFDNTTTTAIFDYGAANNASSAA--  272

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCI--PGPR  861
               +P LPA NDT   TAFT+ LR L    L +     ++ SLFFTVG+G  NC      +
Sbjct  273   IAMPTLPAYNDTTAATAFTTNLRGLRKAELPSR----VDESLFFTVGVGLFNCTNATAQQ  328

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPG-IYTTDFPSVPPVQFNYTG-NVPR  687
             C GPNGTRFAAS+NNVSFVLP   SIL A+++  PG ++T DFP+ PPVQF+YT  NV R
Sbjct  329   CGGPNGTRFAASINNVSFVLPSSTSILQAHHHGAPGGVFTADFPANPPVQFDYTAQNVSR  388

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             ALWQP  GTKVYK+K+GS+VQ+VLQ T IF+ E+HPIHLHGY FYI+ +G GNF+ G D 
Sbjct  389   ALWQPVAGTKVYKLKYGSAVQVVLQGTNIFAGENHPIHLHGYDFYILAEGLGNFDAGADT  448

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
               FN+ DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLV++G+ E
Sbjct  449   GKFNVEDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVDDGVGE  508

Query  326   WETVppppPDLPRC  285
              +++  PPPDLP C
Sbjct  509   LQSLEAPPPDLPLC  522



>gb|AFV52377.1| laccase [Picea abies]
Length=575

 Score =   340 bits (872),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 179/311 (58%), Positives = 229/311 (74%), Gaps = 5/311 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+TA+Q  GRYYMAA AY++ QG PFDNTT  A+LEY  ++S+ S    
Sbjct  269   LMLGPGQTTDVLVTADQSIGRYYMAARAYSSGQGVPFDNTTTVAILEYEGSSSTTSNPN-  327

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
               +P LP  NDT + T+F + LRSL +N     +P  ++ +L +T+GLG +NC PG  C 
Sbjct  328   --MPNLPFYNDTQSATSFANGLRSLASNDHPVFVPRSVDKNLLYTIGLGLINC-PGQSCG  384

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPRALW  678
             GPNG+RFAASMNN+SFVLP  +SIL A +  + G+++ DFP  PPVQF+YT  NV R LW
Sbjct  385   GPNGSRFAASMNNISFVLPTTSSILQAQHFGVKGVFSGDFPDNPPVQFDYTAQNVNRGLW  444

Query  677   QPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASF  498
                 GTKV  + + ++VQ++LQ T IF+ E HPIHLHGY FYIVG GFGN++P  DP  F
Sbjct  445   STVKGTKVKVLNYNTTVQVILQGTNIFAGESHPIHLHGYDFYIVGTGFGNYSPQNDPQKF  504

Query  497   NLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWET  318
             NL+DPP+RNT++VPV GWAAIRFVADNPG WLMHCH+D+H+TWGLAM FLV NG     +
Sbjct  505   NLVDPPMRNTVNVPVNGWAAIRFVADNPGAWLMHCHLDAHITWGLAMVFLVNNGPNSLLS  564

Query  317   VppppPDLPRC  285
             +  PP DLP+C
Sbjct  565   LESPPVDLPQC  575



>emb|CDX70010.1| BnaA10g23590D [Brassica napus]
Length=567

 Score =   339 bits (870),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 191/315 (61%), Positives = 225/315 (71%), Gaps = 10/315 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             IMLGPGQTT+VL+TA+Q P  YYMAA AY +A  APFDNTT TA+LEY       S S  
Sbjct  258   IMLGPGQTTDVLLTADQPPAHYYMAAHAYNSA-NAPFDNTTTTAILEYKYAPCVTSQSQA  316

Query  1034  ALLP-RLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPG  867
               +P +LP  NDTAT  AFT+Q++S     +       ++  LFFTVGLG  NC      
Sbjct  317   RAIPAQLPGFNDTATAAAFTAQMKSPSKVEVPLE----VDEDLFFTVGLGLFNCPTSTNT  372

Query  866   PRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIP-GIYTTDFPSVPPVQFNYTGNVP  690
              RCQGPNGTRF AS+NNVSFV P++ SI+ AYY   P G++TTDFP VPP  F+YTGNV 
Sbjct  373   QRCQGPNGTRFTASINNVSFVFPRQNSIMQAYYQGTPAGVFTTDFPPVPPTTFDYTGNVS  432

Query  689   RALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTD  510
             R LWQP  GTK YK+K+ S VQ++LQDT I + E+HP+HLHGY FY+VG G GNFN   D
Sbjct  433   RGLWQPTRGTKAYKLKYKSKVQVILQDTSIVTIENHPMHLHGYEFYVVGTGIGNFNANKD  492

Query  509   PASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGIT  330
              +SFNLIDPP RNTI  P GGW AIRFVADNPGVWLMHCHID+H+ WGLAM FLVENG  
Sbjct  493   TSSFNLIDPPRRNTIGTPPGGWIAIRFVADNPGVWLMHCHIDAHIFWGLAMVFLVENGEG  552

Query  329   EWETVppppPDLPRC  285
               ++V  PP DLP+C
Sbjct  553   HLQSVQSPPLDLPQC  567



>sp|Q2RBK2.1|LAC17_ORYSJ RecName: Full=Putative laccase-17; AltName: Full=Benzenediol:oxygen 
oxidoreductase 17; AltName: Full=Diphenol oxidase 17; 
AltName: Full=Urishiol oxidase 17; Flags: Precursor [Oryza 
sativa Japonica Group]
 gb|ABA91124.1| laccase, putative [Oryza sativa Japonica Group]
 gb|EAZ17158.1| hypothetical protein OsJ_32663 [Oryza sativa Japonica Group]
Length=567

 Score =   338 bits (868),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 187/314 (60%), Positives = 236/314 (75%), Gaps = 10/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             ++L PGQTT+VL+T +Q PGRYY+AA AYA+AQG PFDNTT TA+ +Y    +++S +  
Sbjct  260   LLLAPGQTTDVLVTFDQPPGRYYLAARAYASAQGVPFDNTTTTAIFDYGAANNASSAA--  317

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCI--PGPR  861
               +P LPA NDT   TAFT+ LR L    L +     ++ SLFFTVG+G  NC      +
Sbjct  318   IAMPTLPAYNDTTAATAFTTNLRGLRKAELPSR----VDESLFFTVGVGLFNCTNATAQQ  373

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPG-IYTTDFPSVPPVQFNYTG-NVPR  687
             C GPNGTRFAAS+NNVSFVLP   SIL A+++  PG ++T DFP+ PPVQF+YT  NV R
Sbjct  374   CGGPNGTRFAASINNVSFVLPSSTSILQAHHHGAPGGVFTADFPANPPVQFDYTAQNVSR  433

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             ALWQP  GTKVYK+K+GS+VQ+VLQ T IF+ E+HPIHLHGY FYI+ +G GNF+ G D 
Sbjct  434   ALWQPVAGTKVYKLKYGSAVQVVLQGTNIFAGENHPIHLHGYDFYILAEGLGNFDAGADT  493

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
               FN+ DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+D H+TWGLAM+FLV++G+ E
Sbjct  494   GKFNVEDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVDDGVGE  553

Query  326   WETVppppPDLPRC  285
              +++  PPPDLP C
Sbjct  554   LQSLEAPPPDLPLC  567



>gb|ABR17528.1| unknown [Picea sitchensis]
Length=570

 Score =   338 bits (866),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 188/311 (60%), Positives = 229/311 (74%), Gaps = 7/311 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VL+ AN+  G+YY+AA AYA+AQG PFDNTT TA+L+Y  ++SS+     
Sbjct  266   VMLGPGQTTDVLLIANKPVGKYYIAARAYASAQGIPFDNTTTTAILDYEGSSSSS-----  320

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
              + P LPA NDT T T FT+ LRSL +       P  I+ +LFFTVGLG ++C PG  C 
Sbjct  321   PVSPNLPAYNDTQTATQFTTGLRSLGSPDHPVNAPFNIDENLFFTVGLGLLDC-PGQPCG  379

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPRALW  678
             GPNG R  ASMNNVSFV P+  S+L A+Y  I G++T DFP  PP+QF+YT  NV  ALW
Sbjct  380   GPNGKRSTASMNNVSFVFPKTFSLLQAHYFGIQGVFTKDFPDNPPMQFDYTAQNVSTALW  439

Query  677   QPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASF  498
              P  GTKV  +K+ S+VQI+LQ T I S E+HPIHLHGY FYIVG+GFGNF+P  DP +F
Sbjct  440   SPVRGTKVKVLKYNSAVQIILQGTSIVSAENHPIHLHGYDFYIVGEGFGNFDPQRDPMTF  499

Query  497   NLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWET  318
             NLIDPP RNT+ VPV GW+AIRFVADNPG+WLMHCH+D H+TWGLAM+FLVENG      
Sbjct  500   NLIDPPQRNTVGVPVNGWSAIRFVADNPGIWLMHCHLDVHITWGLAMAFLVENGPHPLAR  559

Query  317   VppppPDLPRC  285
             +  PP DLP C
Sbjct  560   LEAPPLDLPVC  570



>ref|XP_010921047.1| PREDICTED: LOW QUALITY PROTEIN: laccase-3-like [Elaeis guineensis]
Length=572

 Score =   338 bits (866),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 188/313 (60%), Positives = 233/313 (74%), Gaps = 8/313 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             + +GPG+TT+VL+T +Q PGRYYMAA A+ATAQG PFDNTT TA+LEY +   +    P 
Sbjct  265   LKMGPGETTDVLVTTDQPPGRYYMAARAFATAQGVPFDNTTTTAILEYNSNCPTTEIQPK  324

Query  1034  A--LLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR  861
                  P LPA NDTAT  A+ + +RS     L  P    ++  LFFTVGLG  NC  G +
Sbjct  325   TPPKFPVLPAFNDTATAAAYDAGIRSPHPVNLPGP----VDEHLFFTVGLGLFNCPRGKQ  380

Query  860   CQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPRA  684
             C GPN TRF ASMNNVSF  P R SIL+AYY +  G++TTDFP+ PPVQF+YT  N+ RA
Sbjct  381   CGGPNNTRFGASMNNVSFTFP-RYSILEAYYQHKNGVFTTDFPAFPPVQFDYTAKNISRA  439

Query  683   LWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPA  504
             L QP  GTK+Y +K+GS VQ+V+Q T IF+ E+HP+H+HGY FYI+ QGFGNF+P TD A
Sbjct  440   LQQPARGTKLYPLKYGSVVQLVMQGTNIFAGEEHPMHIHGYQFYILAQGFGNFDPRTDTA  499

Query  503   SFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEW  324
              FNL+DPPL NT+ VPV GWA IRFVA+NPGVWL+HCH+D HLTWGLAM+FLVENG+ E 
Sbjct  500   KFNLVDPPLXNTVGVPVNGWAVIRFVANNPGVWLVHCHLDVHLTWGLAMAFLVENGVGEL  559

Query  323   ETVppppPDLPRC  285
             +++ PPP DLP+C
Sbjct  560   QSLEPPPADLPKC  572



>gb|ACN27868.1| unknown [Zea mays]
 tpg|DAA57027.1| TPA: putative laccase family protein [Zea mays]
Length=516

 Score =   336 bits (861),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 183/314 (58%), Positives = 224/314 (71%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssas--yS  1041
             +ML PGQTT+VL+T +Q P RYY+AA AY + Q   FDNTT TAVLEY    +S      
Sbjct  207   LMLAPGQTTDVLVTMDQPPTRYYVAARAYVSGQNVAFDNTTTTAVLEYDCGCASDFGPKI  266

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR  861
               A    LPA NDT+  TAF + +RS     +       ++  LFFTVGLG  NC PG  
Sbjct  267   QPAFPAALPAFNDTSAATAFAAGIRSPDRVKVHEN----VDEYLFFTVGLGLFNCKPGQL  322

Query  860   CQGPNG-TRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPR  687
             C GPN  TRFAASMNNVSFV PQ  S+L A+Y  IPG++TTDFP+ PPVQF+YTG NV +
Sbjct  323   CAGPNNNTRFAASMNNVSFVFPQTDSLLHAHYYKIPGVFTTDFPAYPPVQFDYTGQNVSQ  382

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             ALWQP   TK+Y ++FGS VQ+VLQDT I + E+HPIH+HGY F+I+ +GFGNF+P  D 
Sbjct  383   ALWQPVPATKLYPLRFGSVVQLVLQDTSIVTPENHPIHIHGYDFFILAEGFGNFDPKKDV  442

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
               FN +DPP RNT+ VPV GWA I+FVADNPGVWLMHCH+D H+TWGLAM+FLVE+G  E
Sbjct  443   EKFNYVDPPQRNTVAVPVNGWAVIQFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGYGE  502

Query  326   WETVppppPDLPRC  285
              +++ PPP DLP C
Sbjct  503   LQSLEPPPVDLPMC  516



>gb|EMS57222.1| Laccase-23 [Triticum urartu]
Length=567

 Score =   337 bits (864),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 190/314 (61%), Positives = 233/314 (74%), Gaps = 13/314 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             I+LGPGQTT+VL+T +Q PGRYY+AA AYA+AQG PFDN T TA+ +Y    +++     
Sbjct  263   IVLGPGQTTDVLVTFDQPPGRYYLAARAYASAQGVPFDNPTTTAIFDYGAGGTASPA---  319

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
               +P LPA NDTATVT FT+ LR+L +  L +     ++  LFFTVG+G  NC  G  C 
Sbjct  320   --MPPLPAYNDTATVTTFTTSLRNLHSVGLPSA----VDEDLFFTVGVGLFNCSSGQNCG  373

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNN---IPGIYTTDFPSVPPVQFNYTG-NVPR  687
             GPN TRFAAS+NN SFVLP   SIL A+Y       G++TTDFP+ PPVQF+YT  NV R
Sbjct  374   GPNNTRFAASINNASFVLPSTVSILQAHYQGDAAATGVFTTDFPANPPVQFDYTAQNVSR  433

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             ALWQP  GTKVYK+K+GS VQIVLQ T IF+ E+HPIH HGY F+I+ +GFGNF+  TD 
Sbjct  434   ALWQPVPGTKVYKLKYGSVVQIVLQGTNIFAGENHPIHTHGYDFFILAEGFGNFDAATDT  493

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
             A FNL DPP+RNT+ VPV GWA IRFVADNPGVWLMHCH+  H+TWGLAM+FLVE+G+ E
Sbjct  494   AKFNLDDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLGVHITWGLAMAFLVEDGVGE  553

Query  326   WETVppppPDLPRC  285
              +++  PPPDLP C
Sbjct  554   LQSLGAPPPDLPIC  567



>ref|XP_003600994.1| Laccase [Medicago truncatula]
Length=575

 Score =   337 bits (863),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 181/319 (57%), Positives = 227/319 (71%), Gaps = 18/319 (6%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLI ANQ P +YY+AA AY +AQ APFDNTT TA+L+Y  +  +      
Sbjct  266   LMLGPGQTTDVLIHANQPPSKYYIAARAYQSAQNAPFDNTTTTAILQYHNSIKTK-----  320

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNC---IPGP  864
              ++P LP+ N+T  VT F+    SL    + T     I+ +LFFT+GLG  NC       
Sbjct  321   PIMPPLPSYNNTNIVTKFSRSFFSLRKAEVPTE----IDENLFFTIGLGLNNCPKNFRKR  376

Query  863   RCQGP-NGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGNVPR  687
             RCQGP NGTRF ASMNNVSF LP   SIL A+Y+ IPG++TTDFP+ PPV+F+YTGNV R
Sbjct  377   RCQGPINGTRFTASMNNVSFTLPNNISILQAHYHGIPGVFTTDFPAKPPVKFDYTGNVSR  436

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             +LWQP  GTK YK+KFGS VQIVLQDT I + E+HPIHLHGY FYIV +GFGNF+   D 
Sbjct  437   SLWQPVPGTKAYKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAEGFGNFDAKKDT  496

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGV-----WLMHCHIDSHLTWGLAMSFLVE  342
             + FNL+DPP+RNT+ VPV GWA IRFVADN  +     W++HCH+D H+ WGLA   LVE
Sbjct  497   SKFNLVDPPMRNTVAVPVNGWAVIRFVADNTRIKKVSAWILHCHLDVHIGWGLATILLVE  556

Query  341   NGITEWETVppppPDLPRC  285
             +G+ + +++  PP DLP C
Sbjct  557   DGVGKLQSIQSPPQDLPIC  575



>ref|NP_001148479.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG31666.1| L-ascorbate oxidase precursor [Zea mays]
Length=572

 Score =   336 bits (862),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 183/314 (58%), Positives = 224/314 (71%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssas--yS  1041
             +ML PGQTT+VL+T +Q P RYY+AA AY + Q   FDNTT TAVLEY    +S      
Sbjct  263   LMLAPGQTTDVLVTMDQPPTRYYVAARAYVSGQNVAFDNTTTTAVLEYDCGCASDFGPKI  322

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR  861
               A    LPA NDT+  TAF + +RS     +       ++  LFFTVGLG  NC PG  
Sbjct  323   QPAFPAALPAFNDTSAATAFAAGIRSPDRVKVHEN----VDEYLFFTVGLGLFNCKPGQL  378

Query  860   CQGPNG-TRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPR  687
             C GPN  TRFAASMNNVSFV PQ  S+L A+Y  IPG++TTDFP+ PPVQF+YTG NV +
Sbjct  379   CAGPNNNTRFAASMNNVSFVFPQTDSLLHAHYYKIPGVFTTDFPAYPPVQFDYTGQNVSQ  438

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             ALWQP   TK+Y ++FGS VQ+VLQDT I + E+HPIH+HGY F+I+ +GFGNF+P  D 
Sbjct  439   ALWQPVPATKLYPLRFGSVVQLVLQDTSIVTPENHPIHIHGYDFFILAEGFGNFDPKKDV  498

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
               FN +DPP RNT+ VPV GWA I+FVADNPGVWLMHCH+D H+TWGLAM+FLVE+G  E
Sbjct  499   EKFNYVDPPQRNTVAVPVNGWAVIQFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGYGE  558

Query  326   WETVppppPDLPRC  285
              +++ PPP DLP C
Sbjct  559   LQSLEPPPVDLPMC  572



>tpg|DAA57028.1| TPA: putative laccase family protein [Zea mays]
Length=572

 Score =   336 bits (862),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 183/314 (58%), Positives = 224/314 (71%), Gaps = 8/314 (3%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssas--yS  1041
             +ML PGQTT+VL+T +Q P RYY+AA AY + Q   FDNTT TAVLEY    +S      
Sbjct  263   LMLAPGQTTDVLVTMDQPPTRYYVAARAYVSGQNVAFDNTTTTAVLEYDCGCASDFGPKI  322

Query  1040  PGALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPR  861
               A    LPA NDT+  TAF + +RS     +       ++  LFFTVGLG  NC PG  
Sbjct  323   QPAFPAALPAFNDTSAATAFAAGIRSPDRVKVHEN----VDEYLFFTVGLGLFNCKPGQL  378

Query  860   CQGPNG-TRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPR  687
             C GPN  TRFAASMNNVSFV PQ  S+L A+Y  IPG++TTDFP+ PPVQF+YTG NV +
Sbjct  379   CAGPNNNTRFAASMNNVSFVFPQTDSLLHAHYYKIPGVFTTDFPAYPPVQFDYTGQNVSQ  438

Query  686   ALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDP  507
             ALWQP   TK+Y ++FGS VQ+VLQDT I + E+HPIH+HGY F+I+ +GFGNF+P  D 
Sbjct  439   ALWQPVPATKLYPLRFGSVVQLVLQDTSIVTPENHPIHIHGYDFFILAEGFGNFDPKKDV  498

Query  506   ASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITE  327
               FN +DPP RNT+ VPV GWA I+FVADNPGVWLMHCH+D H+TWGLAM+FLVE+G  E
Sbjct  499   EKFNYVDPPQRNTVAVPVNGWAVIQFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGYGE  558

Query  326   WETVppppPDLPRC  285
              +++ PPP DLP C
Sbjct  559   LQSLEPPPVDLPMC  572



>gb|EMT30315.1| Laccase-3 [Aegilops tauschii]
Length=566

 Score =   335 bits (859),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 223/311 (72%), Gaps = 5/311 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             ++LGPGQTT+VL+TA+  PGRYY+ A  YA+A+G P DNTTATA+ +Y    + A     
Sbjct  258   VLLGPGQTTDVLVTAHAAPGRYYLGARVYASARGVPVDNTTATAIFQYKNAAAGAGAGAP  317

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
                  LPANNDTAT TAF++ +RS     +  P    +   +F TVG G  +C PGP CQ
Sbjct  318   MFPAMLPANNDTATATAFSNSIRSPRPVKVPGP----VTQEVFTTVGFGQFSCRPGPFCQ  373

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPRALW  678
             GPN TR  ASMNNVSF LP   S+L A+Y  IPG++T DFP+ PPV F+YT  +VPRALW
Sbjct  374   GPNSTRLGASMNNVSFQLPSTVSLLQAHYGRIPGVFTDDFPARPPVAFDYTSQSVPRALW  433

Query  677   QPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASF  498
             QP  GT++Y+V++G+  Q+  QDTGIF+ E+ P+H+HGYHFY++  GFGN++P  D   F
Sbjct  434   QPVKGTRLYRVRYGAVGQMGFQDTGIFAAEEPPMHIHGYHFYVLAAGFGNYDPRRDAGRF  493

Query  497   NLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWET  318
             N++DPP RNTI VPVGGWA +RF ADNPGVWL+HCHID+HL+ GLAM+ LVE+G TE + 
Sbjct  494   NMVDPPSRNTIGVPVGGWAGVRFRADNPGVWLVHCHIDAHLSGGLAMALLVEDGKTELQA  553

Query  317   VppppPDLPRC  285
               PPP DLP C
Sbjct  554   TVPPPLDLPIC  564



>ref|XP_010424027.1| PREDICTED: laccase-3-like [Camelina sativa]
Length=557

 Score =   335 bits (858),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 180/279 (65%), Positives = 207/279 (74%), Gaps = 12/279 (4%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySP-  1038
             IMLGPGQTTNVLITANQRPGRYYMAA AY +A  APFDNTT TA+L+Y    +       
Sbjct  261   IMLGPGQTTNVLITANQRPGRYYMAARAYNSA-NAPFDNTTTTAILQYVNAPTRRGRGRG  319

Query  1037  ----GALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIP  870
                   + P LP  NDTAT TAFT++LR      +       I+ +LFFTVGLG +NC  
Sbjct  320   RGQMAPVFPVLPGFNDTATATAFTNRLRYWKRAPVPQQ----IDENLFFTVGLGLINCAN  375

Query  869   --GPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTGN  696
                PRCQGPNGTRFAAS+NN+SFVLP+R S++ AYY  +PGI+TTDFP VPPVQF+YTGN
Sbjct  376   PNSPRCQGPNGTRFAASINNMSFVLPRRNSVMQAYYQGMPGIFTTDFPPVPPVQFDYTGN  435

Query  695   VPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPG  516
             V RALWQP  GTK YK+K+ ++VQIVLQDT I + E+HP+HLHGY FY+VG GFGNFNP 
Sbjct  436   VSRALWQPIKGTKAYKLKYRANVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFGNFNPR  495

Query  515   TDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLM  399
             TDPA FNL DPP RNTI  P GGW AIRFVADNPG W M
Sbjct  496   TDPARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFM  534



>gb|EMT01053.1| Laccase-3 [Aegilops tauschii]
Length=591

 Score =   336 bits (861),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 180/336 (54%), Positives = 227/336 (68%), Gaps = 30/336 (9%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQR-PGRYYMAASAYATAQGAPFDNttatavleyttttssasySP  1038
             ++LGPGQTT+VL+TA+   PGRYY+ A  YA+AQ  PFDNTTATA+ +Y           
Sbjct  258   VLLGPGQTTDVLVTAHAAAPGRYYLGARVYASAQNVPFDNTTATAIFQYKNAAGCPPTGA  317

Query  1037  GA------------------------LLPRLPANNDTATVTAFTSQLRSlptnmlttplp  930
             GA                        + P LPANNDT T T F++ +RS     +  P  
Sbjct  318   GAGVGGHTGLGRPRSSGNPGRAGPAPMFPMLPANNDTNTATGFSNLIRSPGPVKVPGP--  375

Query  929   LIIEHSLFFTVGLGFVNCIPGPRCQGPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGI  750
               +   +F T+G G  NC PGP CQGPN TRF ASMNNVSF LP   S+L A+Y+ IPG+
Sbjct  376   --VTQEVFTTIGFGLFNCQPGPFCQGPNNTRFGASMNNVSFQLPNTVSLLQAHYHRIPGV  433

Query  749   YTTDFPSVPPVQFNYTG-NVPRALWQPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIH  573
             +T DFP+ PPV F+YT  NVPRALWQP  GT++Y+VK+G+ VQ+V QDTGIF+ E+HP+H
Sbjct  434   FTEDFPARPPVVFDYTSQNVPRALWQPVKGTRLYRVKYGAVVQMVFQDTGIFAAEEHPMH  493

Query  572   LHGYHFYIVGQGFGNFNPGTDPASFNLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHC  393
             +HGYHFY++  GFGN+NP  D A  N++ P  RNTI VPVGGWA +RF+ADNPG WL+HC
Sbjct  494   IHGYHFYVLATGFGNYNPRRDEAKVNMVGPASRNTIGVPVGGWAVVRFLADNPGGWLVHC  553

Query  392   HIDSHLTWGLAMSFLVENGITEWETVppppPDLPRC  285
             HID+HLT GLAM+ +VE+G TE +T  PPP DLP C
Sbjct  554   HIDAHLTGGLAMALVVEDGKTELQTTMPPPLDLPLC  589



>gb|AFV52378.1| laccase [Picea abies]
Length=570

 Score =   333 bits (853),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 180/311 (58%), Positives = 223/311 (72%), Gaps = 5/311 (2%)
 Frame = -2

Query  1214  IMLGPGQTTNVLITANQRPGRYYMAASAYATAQGAPFDNttatavleyttttssasySPG  1035
             +MLGPGQTT+VLITA+Q  GRYYMAA AY++ QG PFDNTT  A+LEY  ++SS S    
Sbjct  264   LMLGPGQTTDVLITADQATGRYYMAARAYSSGQGVPFDNTTTVAILEYKGSSSSKST---  320

Query  1034  ALLPRLPANNDTATVTAFTSQLRSlptnmlttplpLIIEHSLFFTVGLGFVNCIPGPRCQ  855
               +P LP  NDT T T F + L+SL +N     +P  +  +LF+TVGLG + C PG  C 
Sbjct  321   PTMPSLPFYNDTKTATKFANGLKSLASNDHPVFVPQKVNENLFYTVGLGLIKC-PGQSCG  379

Query  854   GPNGTRFAASMNNVSFVLPQRASILDAYYNNIPGIYTTDFPSVPPVQFNYTG-NVPRALW  678
             GPNG+RFAASMNNVSFVLP  +SIL A +    G+++ DFP  P V F+YT  NV R +W
Sbjct  380   GPNGSRFAASMNNVSFVLPSTSSILQAQHFGTKGVFSRDFPDNPAVLFDYTAQNVSRGIW  439

Query  677   QPRFGTKVYKVKFGSSVQIVLQDTGIFSTEDHPIHLHGYHFYIVGQGFGNFNPGTDPASF  498
              P   TKV  + + ++VQI+LQ T IF+ E HPIHLHGY FYIVG GFGN+NP TD   F
Sbjct  440   SPVKDTKVKVLNYNTTVQIILQGTNIFAGESHPIHLHGYDFYIVGAGFGNYNPQTDSQKF  499

Query  497   NLIDPPLRNTIDVPVGGWAAIRFVADNPGVWLMHCHIDSHLTWGLAMSFLVENGITEWET  318
             NL+DPP+RNT++VPV GW+AIRFVADNPG WLMHCH+D H+TWGLAM F+V NG     +
Sbjct  500   NLVDPPMRNTVNVPVNGWSAIRFVADNPGAWLMHCHLDVHITWGLAMVFVVNNGPDSLLS  559

Query  317   VppppPDLPRC  285
             +  PP DLP+C
Sbjct  560   LESPPLDLPQC  570



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3049142729236