BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24985_g2_i3 len=1273 path=[2331:0-24 2356:25-186 2825:187-245
2883:246-334 204:335-356 469:357-357 2428:358-470 7917:471-471
7918:472-483 3116:484-484 3117:485-556 3188:557-573 2470:574-720
3350:721-1272]

Length=1273
                                                                      Score     E

emb|CDP13890.1|  unnamed protein product                                242   2e-74   
ref|XP_011084807.1|  PREDICTED: probable RNA-binding protein EIF1AD     224   1e-67   
ref|XP_009782131.1|  PREDICTED: probable RNA-binding protein EIF1AD     222   7e-67   
ref|XP_009611463.1|  PREDICTED: probable RNA-binding protein EIF1AD     219   2e-65   
ref|XP_006356481.1|  PREDICTED: probable RNA-binding protein EIF1...    218   2e-65   
ref|XP_007136410.1|  hypothetical protein PHAVU_009G042700g             218   2e-65   
ref|XP_007150848.1|  hypothetical protein PHAVU_005G185900g             215   3e-64   
ref|XP_006365334.1|  PREDICTED: probable RNA-binding protein EIF1...    215   4e-64   
ref|XP_006486144.1|  PREDICTED: probable RNA-binding protein EIF1...    213   2e-63   
ref|XP_004239975.1|  PREDICTED: probable RNA-binding protein EIF1AD     213   3e-63   
ref|XP_004502815.1|  PREDICTED: probable RNA-binding protein EIF1...    212   6e-63   
ref|XP_010525424.1|  PREDICTED: probable RNA-binding protein EIF1AD     212   7e-63   
ref|XP_009757975.1|  PREDICTED: LOW QUALITY PROTEIN: probable RNA...    211   8e-63   
ref|XP_008234164.1|  PREDICTED: probable RNA-binding protein EIF1AD     211   1e-62   
ref|XP_004158969.1|  PREDICTED: probable RNA-binding protein EIF1...    211   2e-62   
ref|XP_007011379.1|  OB-fold nucleic acid binding domain-containi...    211   2e-62   
ref|XP_004146450.1|  PREDICTED: probable RNA-binding protein EIF1...    210   2e-62   
ref|XP_010678866.1|  PREDICTED: probable RNA-binding protein EIF1AD     209   6e-62   
ref|XP_006435950.1|  hypothetical protein CICLE_v10032334mg             212   1e-61   
gb|KDO67560.1|  hypothetical protein CISIN_1g030718mg                   208   2e-61   
ref|XP_010554727.1|  PREDICTED: probable RNA-binding protein EIF1AD     208   3e-61   
ref|XP_010253036.1|  PREDICTED: probable RNA-binding protein EIF1AD     207   3e-61   
ref|XP_007218511.1|  hypothetical protein PRUPE_ppa012453mg             207   4e-61   
ref|XP_010086856.1|  putative RNA-binding protein EIF1AD                206   1e-60   
ref|NP_001237534.1|  uncharacterized protein LOC100306612               205   3e-60   
ref|XP_008456911.1|  PREDICTED: probable RNA-binding protein EIF1AD     204   6e-60   
gb|KHN25797.1|  Putative RNA-binding protein EIF1AD                     203   2e-59   
ref|XP_010100677.1|  Protein UXT-like protein                           206   1e-58   
ref|XP_006371308.1|  hypothetical protein POPTR_0019s08940g             200   2e-58   
ref|XP_008359826.1|  PREDICTED: probable RNA-binding protein EIF1AD     199   6e-58   
ref|XP_010931384.1|  PREDICTED: probable RNA-binding protein EIF1AD     198   2e-57   
ref|XP_010999652.1|  PREDICTED: probable RNA-binding protein EIF1AD     197   2e-57   
ref|XP_008788115.1|  PREDICTED: probable RNA-binding protein EIF1...    197   3e-57   
ref|XP_002276446.2|  PREDICTED: probable RNA-binding protein EIF1AD     196   9e-57   Vitis vinifera
gb|KDP21631.1|  hypothetical protein JCGZ_03302                         193   1e-55   
ref|XP_004512897.1|  PREDICTED: probable RNA-binding protein EIF1...    192   2e-55   
gb|KEH35526.1|  nucleic acid-binding, OB-fold-like protein              199   7e-55   
ref|XP_009362776.1|  PREDICTED: probable RNA-binding protein EIF1AD     189   2e-54   
ref|XP_008366807.1|  PREDICTED: probable RNA-binding protein EIF1AD     187   1e-53   
gb|EYU35193.1|  hypothetical protein MIMGU_mgv1a015058mg                187   3e-53   
ref|XP_006856122.1|  hypothetical protein AMTR_s00059p00149620          184   4e-52   
ref|XP_006842528.1|  hypothetical protein AMTR_s00077p00119490          179   2e-50   
ref|XP_009384761.1|  PREDICTED: probable RNA-binding protein EIF1AD     179   2e-50   
ref|XP_003558986.1|  PREDICTED: probable RNA-binding protein EIF1AD     178   4e-50   
ref|XP_004297940.1|  PREDICTED: probable RNA-binding protein EIF1...    179   4e-50   
ref|XP_002879891.1|  RNA binding protein                                178   5e-50   
ref|XP_010508809.1|  PREDICTED: probable RNA-binding protein EIF1AD     178   8e-50   
emb|CBI23031.3|  unnamed protein product                                176   2e-49   
emb|CDY14742.1|  BnaC04g47390D                                          176   3e-49   
ref|XP_004307742.1|  PREDICTED: probable RNA-binding protein EIF1...    176   4e-49   
ref|XP_009141937.1|  PREDICTED: probable RNA-binding protein EIF1AD     175   7e-49   
ref|NP_181610.1|  Nucleic acid-binding, OB-fold-like protein            175   8e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004986009.1|  PREDICTED: probable RNA-binding protein EIF1...    171   3e-47   
gb|EYU30448.1|  hypothetical protein MIMGU_mgv1a021159mg                169   5e-47   
ref|NP_001048742.1|  Os03g0114200                                       168   2e-46   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK04858.1|  predicted protein                                      167   6e-46   
ref|XP_010532381.1|  PREDICTED: probable RNA-binding protein EIF1AD     165   1e-45   
ref|XP_002879695.1|  predicted protein                                  166   2e-45   
ref|XP_004951619.1|  PREDICTED: probable RNA-binding protein EIF1...    166   2e-45   
gb|EMT10805.1|  Putative RNA-binding protein EIF1AD                     165   5e-45   
ref|XP_006411345.1|  hypothetical protein EUTSA_v10017311mg             165   7e-45   
ref|XP_006649259.1|  PREDICTED: probable RNA-binding protein EIF1...    164   1e-44   
gb|KFK36949.1|  hypothetical protein AALP_AA4G193000                    163   2e-44   
ref|XP_006295098.1|  hypothetical protein CARUB_v10024173mg             162   6e-44   
ref|XP_010067623.1|  PREDICTED: probable RNA-binding protein EIF1AD     161   2e-43   
ref|XP_002465992.1|  hypothetical protein SORBIDRAFT_01g049700          159   8e-43   Sorghum bicolor [broomcorn]
ref|XP_010505829.1|  PREDICTED: probable RNA-binding protein EIF1AD     159   1e-42   
ref|XP_010517517.1|  PREDICTED: probable RNA-binding protein EIF1AD     159   1e-42   
ref|XP_008788116.1|  PREDICTED: probable RNA-binding protein EIF1...    155   7e-42   
ref|NP_001149105.1|  RNA binding protein                                156   9e-42   Zea mays [maize]
ref|XP_008238340.1|  PREDICTED: probable RNA-binding protein EIF1AD     154   3e-41   
gb|ABK21882.1|  unknown                                                 153   2e-40   Picea sitchensis
ref|NP_001118488.1|  Nucleic acid-binding, OB-fold-like protein         142   8e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010318364.1|  PREDICTED: uncharacterized protein LOC101254068    140   2e-36   
ref|XP_001775606.1|  predicted protein                                  128   2e-31   
gb|ACG45606.1|  RNA binding protein                                     118   2e-28   Zea mays [maize]
gb|KDO67561.1|  hypothetical protein CISIN_1g030718mg                   117   6e-28   
gb|ABE65899.1|  hypothetical protein At2g40780                          113   8e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28532.1|  unknown                                                 113   8e-27   Arabidopsis thaliana [mouse-ear cress]
gb|KCW65795.1|  hypothetical protein EUGRSUZ_G031471                  95.5    4e-20   
ref|XP_003294850.1|  hypothetical protein DICPUDRAFT_159921           89.7    2e-17   
gb|EPS62852.1|  hypothetical protein M569_11936                       82.8    4e-16   
ref|XP_001965340.1|  GF24643                                          84.7    7e-16   Drosophila ananassae
gb|EMS61943.1|  hypothetical protein TRIUR3_07127                     81.6    2e-15   
emb|CDY09266.1|  BnaC03g62960D                                        82.4    3e-15   
emb|CDY40524.1|  BnaC01g19880D                                        81.6    3e-15   
ref|XP_009515592.1|  hypothetical protein PHYSODRAFT_474031           81.6    1e-14   
ref|XP_002115905.1|  hypothetical protein TRIADDRAFT_59800            80.9    2e-14   Trichoplax adhaerens
gb|ETO69353.1|  hypothetical protein F444_14060                       81.3    3e-14   
gb|ETI40666.1|  hypothetical protein F443_14028                       80.9    3e-14   
ref|XP_004627267.1|  PREDICTED: probable RNA-binding protein EIF1AD   79.7    4e-14   
ref|XP_002906548.1|  conserved hypothetical protein                   80.5    5e-14   
ref|XP_004901767.1|  PREDICTED: probable RNA-binding protein EIF1...  79.7    5e-14   
ref|XP_002001752.1|  GI15299                                          79.7    5e-14   Drosophila mojavensis
ref|XP_005384493.1|  PREDICTED: probable RNA-binding protein EIF1AD   79.7    6e-14   
ref|XP_629853.1|  hypothetical protein DDB_G0292138                   79.7    6e-14   Dictyostelium discoideum AX4
ref|XP_008588467.1|  PREDICTED: probable RNA-binding protein EIF1AD   78.6    1e-13   
gb|ETP38599.1|  hypothetical protein, variant                         82.0    2e-13   
ref|XP_008909485.1|  hypothetical protein, variant                    82.0    2e-13   
ref|XP_006002516.1|  PREDICTED: probable RNA-binding protein EIF1AD   78.6    2e-13   
ref|NP_722949.1|  CG31957, isoform A                                  78.2    2e-13   Drosophila melanogaster
ref|XP_004019735.1|  PREDICTED: probable RNA-binding protein EIF1AD   78.2    2e-13   
ref|XP_005333462.1|  PREDICTED: probable RNA-binding protein EIF1AD   77.8    2e-13   
gb|ETP38598.1|  hypothetical protein F442_13870                       82.0    3e-13   
ref|XP_008909484.1|  hypothetical protein PPTG_23530                  82.0    3e-13   
ref|XP_004682664.1|  PREDICTED: probable RNA-binding protein EIF1AD   77.8    3e-13   
ref|XP_003970161.1|  PREDICTED: probable RNA-binding protein EIF1...  77.4    3e-13   
ref|XP_002078090.1|  GD22725                                          77.0    4e-13   Drosophila simulans
ref|XP_004073614.1|  PREDICTED: probable RNA-binding protein EIF1...  77.4    4e-13   
ref|XP_010731168.1|  PREDICTED: probable RNA-binding protein EIF1AD   77.8    4e-13   
ref|XP_002037774.1|  GM18117                                          77.0    4e-13   Drosophila sechellia
ref|XP_005699967.1|  PREDICTED: probable RNA-binding protein EIF1AD   77.0    5e-13   
ref|NP_001069861.1|  probable RNA-binding protein EIF1AD              77.0    5e-13   Bos taurus [bovine]
ref|XP_007518823.1|  PREDICTED: probable RNA-binding protein EIF1AD   76.6    6e-13   
ref|XP_005894089.1|  PREDICTED: probable RNA-binding protein EIF1AD   76.6    6e-13   
ref|XP_006056493.1|  PREDICTED: probable RNA-binding protein EIF1AD   76.6    6e-13   
ref|XP_002064533.1|  GK23772                                          75.9    9e-13   Drosophila willistoni
ref|XP_002087885.1|  GE14789                                          75.9    1e-12   Drosophila yakuba
ref|XP_002051920.1|  GJ17268                                          75.9    1e-12   Drosophila virilis
ref|XP_004393967.1|  PREDICTED: probable RNA-binding protein EIF1AD   75.5    2e-12   
ref|XP_006179578.1|  PREDICTED: probable RNA-binding protein EIF1AD   75.5    2e-12   
ref|XP_006740233.1|  PREDICTED: probable RNA-binding protein EIF1AD   75.1    2e-12   
ref|XP_003468301.1|  PREDICTED: probable RNA-binding protein EIF1AD   75.1    2e-12   
gb|KFM27151.1|  putative RNA-binding protein EIF1AD                   74.3    2e-12   
ref|XP_533226.1|  PREDICTED: probable RNA-binding protein EIF1AD ...  75.1    2e-12   Canis lupus familiaris [dogs]
ref|XP_004437693.1|  PREDICTED: probable RNA-binding protein EIF1...  75.1    2e-12   
ref|XP_001968629.1|  GG24398                                          75.1    2e-12   Drosophila erecta
ref|XP_004051608.1|  PREDICTED: probable RNA-binding protein EIF1...  75.1    2e-12   
ref|NP_001088978.1|  probable RNA-binding protein EIF1AD              75.1    2e-12   Xenopus laevis [clawed frog]
ref|XP_508567.2|  PREDICTED: probable RNA-binding protein EIF1AD      75.1    2e-12   Pan troglodytes
ref|NP_001127270.1|  probable RNA-binding protein EIF1AD              74.7    3e-12   Pongo abelii [orang utan]
sp|Q58CY2.1|EIF1A_BOVIN  RecName: Full=Probable RNA-binding prote...  74.7    3e-12   Bos taurus [bovine]
ref|XP_010634230.1|  PREDICTED: probable RNA-binding protein EIF1AD   74.7    3e-12   
ref|XP_009006746.1|  PREDICTED: probable RNA-binding protein EIF1...  75.1    3e-12   
ref|XP_008820461.1|  PREDICTED: probable RNA-binding protein EIF1AD   74.3    3e-12   
ref|XP_008271697.1|  PREDICTED: probable RNA-binding protein EIF1AD   74.3    3e-12   
ref|XP_004901769.1|  PREDICTED: probable RNA-binding protein EIF1...  73.9    5e-12   
ref|NP_001016696.1|  probable RNA-binding protein EIF1AD              74.3    5e-12   Xenopus tropicalis [western clawed frog]
ref|XP_008707249.1|  PREDICTED: probable RNA-binding protein EIF1AD   73.9    5e-12   
ref|XP_007438971.1|  PREDICTED: probable RNA-binding protein EIF1...  73.9    5e-12   
gb|KFM80501.1|  putative RNA-binding protein EIF1AD                   73.6    6e-12   
ref|XP_005092024.1|  PREDICTED: probable RNA-binding protein EIF1...  74.3    6e-12   
ref|XP_007438970.1|  PREDICTED: probable RNA-binding protein EIF1...  73.6    7e-12   
emb|CDQ79129.1|  unnamed protein product                              73.9    8e-12   
ref|XP_001989084.1|  GH10238                                          73.2    9e-12   Drosophila grimshawi
ref|XP_006036924.1|  PREDICTED: probable RNA-binding protein EIF1AD   73.2    1e-11   
ref|XP_007091923.1|  PREDICTED: probable RNA-binding protein EIF1AD   73.2    1e-11   
ref|XP_002755658.1|  PREDICTED: probable RNA-binding protein EIF1...  73.2    1e-11   Callithrix jacchus [common marmoset]
ref|XP_003993702.1|  PREDICTED: probable RNA-binding protein EIF1AD   73.2    1e-11   
ref|XP_006210711.1|  PREDICTED: probable RNA-binding protein EIF1AD   73.2    1e-11   
ref|XP_001697455.1|  eukaryotic initiation factor                     73.6    1e-11   Chlamydomonas reinhardtii
ref|XP_006771634.1|  PREDICTED: probable RNA-binding protein EIF1AD   72.8    1e-11   
dbj|GAM27717.1|  hypothetical protein SAMD00019534_108930             72.8    1e-11   
ref|XP_005811172.1|  PREDICTED: probable RNA-binding protein EIF1...  73.2    1e-11   
ref|XP_006149985.1|  PREDICTED: probable RNA-binding protein EIF1...  72.8    1e-11   
ref|XP_006893481.1|  PREDICTED: probable RNA-binding protein EIF1AD   72.4    1e-11   
ref|XP_008613654.1|  hypothetical protein SDRG_09494                  73.2    1e-11   
ref|XP_008280428.1|  PREDICTED: probable RNA-binding protein EIF1AD   73.2    1e-11   
ref|XP_010765813.1|  PREDICTED: probable RNA-binding protein EIF1AD   72.8    1e-11   
ref|XP_007568418.1|  PREDICTED: probable RNA-binding protein EIF1AD   72.8    2e-11   
ref|XP_007648227.1|  PREDICTED: probable RNA-binding protein EIF1...  72.0    2e-11   
ref|XP_005064072.1|  PREDICTED: probable RNA-binding protein EIF1AD   72.4    2e-11   
ref|XP_004264439.1|  PREDICTED: probable RNA-binding protein EIF1AD   72.4    2e-11   
emb|CBK22524.2|  unnamed protein product                              72.8    2e-11   
ref|XP_007462030.1|  PREDICTED: probable RNA-binding protein EIF1AD   72.4    2e-11   
ref|XP_004563246.1|  PREDICTED: probable RNA-binding protein EIF1...  72.4    2e-11   
ref|XP_004656526.1|  PREDICTED: probable RNA-binding protein EIF1AD   72.0    2e-11   
ref|XP_005719522.1|  PREDICTED: probable RNA-binding protein EIF1...  72.4    2e-11   
ref|XP_003419627.1|  PREDICTED: probable RNA-binding protein EIF1AD   72.0    2e-11   
ref|XP_006980664.1|  PREDICTED: probable RNA-binding protein EIF1AD   72.4    2e-11   
ref|XP_005190715.1|  PREDICTED: probable RNA-binding protein EIF1...  72.0    2e-11   
ref|XP_006781910.1|  PREDICTED: probable RNA-binding protein EIF1...  72.0    3e-11   
ref|XP_004311800.1|  PREDICTED: probable RNA-binding protein EIF1AD   72.0    3e-11   
ref|XP_003509487.1|  PREDICTED: probable RNA-binding protein EIF1...  72.0    3e-11   
ref|XP_006860966.1|  PREDICTED: probable RNA-binding protein EIF1AD   72.0    3e-11   
ref|XP_001844517.1|  obelix                                           71.6    3e-11   Culex quinquefasciatus
gb|EFB26195.1|  hypothetical protein PANDA_004772                     70.9    3e-11   Ailuropoda melanoleuca
ref|XP_003798735.1|  PREDICTED: probable RNA-binding protein EIF1AD   71.6    3e-11   
ref|XP_003702317.1|  PREDICTED: probable RNA-binding protein EIF1...  71.6    3e-11   
ref|NP_081512.1|  probable RNA-binding protein EIF1AD                 71.6    3e-11   Mus musculus [mouse]
ref|XP_007171039.1|  PREDICTED: probable RNA-binding protein EIF1...  71.6    3e-11   
pdb|2DGY|A  Chain A, Solution Structure Of The Eukaryotic Initiat...  70.5    3e-11   
ref|XP_010346650.1|  PREDICTED: probable RNA-binding protein EIF1AD   71.6    3e-11   
ref|XP_007128281.1|  PREDICTED: probable RNA-binding protein EIF1AD   71.6    3e-11   
ref|XP_006911142.1|  PREDICTED: probable RNA-binding protein EIF1AD   71.6    3e-11   
gb|EFA83297.1|  hypothetical protein PPL_04087                        71.6    3e-11   Heterostelium album PN500
ref|XP_005351780.1|  PREDICTED: probable RNA-binding protein EIF1AD   71.6    4e-11   
ref|XP_004770037.1|  PREDICTED: probable RNA-binding protein EIF1...  71.6    4e-11   
gb|ABD57202.1|  hypothetical protein MGC11102                         70.9    4e-11   Bos taurus [bovine]
ref|XP_004383964.1|  PREDICTED: probable RNA-binding protein EIF1AD   71.2    4e-11   
ref|NP_001008306.1|  probable RNA-binding protein EIF1AD              71.2    4e-11   Rattus norvegicus [brown rat]
ref|XP_005864329.1|  PREDICTED: probable RNA-binding protein EIF1AD   71.2    4e-11   
ref|XP_002916670.1|  PREDICTED: probable RNA-binding protein EIF1...  71.2    4e-11   
ref|NP_001181454.1|  probable RNA-binding protein EIF1AD              71.2    4e-11   
ref|XP_006129731.1|  PREDICTED: probable RNA-binding protein EIF1...  71.2    4e-11   
emb|CCI47563.1|  unnamed protein product                              71.2    4e-11   
ref|XP_003122556.1|  PREDICTED: probable RNA-binding protein EIF1...  71.2    4e-11   
gb|EHH56067.1|  Eukaryotic translation initiation factor 1A domai...  71.2    4e-11   
ref|NP_115701.2|  probable RNA-binding protein EIF1AD                 71.2    5e-11   Homo sapiens [man]
gb|AAH05131.1|  EIF1AD protein                                        71.2    5e-11   Homo sapiens [man]
ref|XP_001689185.1|  AGAP010181-PA                                    70.5    5e-11   Anopheles gambiae str. PEST
ref|XP_008559878.1|  PREDICTED: probable RNA-binding protein EIF1AD   70.9    5e-11   
ref|XP_006129729.1|  PREDICTED: probable RNA-binding protein EIF1...  71.2    5e-11   
dbj|BAB25440.1|  unnamed protein product                              71.2    5e-11   Mus musculus [mouse]
ref|XP_007943150.1|  PREDICTED: probable RNA-binding protein EIF1AD   70.9    5e-11   
ref|XP_001379488.1|  PREDICTED: probable RNA-binding protein EIF1...  70.9    5e-11   Monodelphis domestica
emb|CCI47564.1|  unnamed protein product                              71.2    5e-11   
tpg|DAA42900.1|  TPA: hypothetical protein ZEAMMB73_687067            71.6    5e-11   
ref|XP_001491132.1|  PREDICTED: probable RNA-binding protein EIF1AD   70.9    6e-11   Equus caballus [domestic horse]
ref|XP_008059207.1|  PREDICTED: probable RNA-binding protein EIF1AD   70.9    6e-11   
ref|XP_008145152.1|  PREDICTED: probable RNA-binding protein EIF1AD   70.9    7e-11   
ref|XP_005305562.1|  PREDICTED: probable RNA-binding protein EIF1...  70.9    7e-11   
ref|XP_003451850.1|  PREDICTED: probable RNA-binding protein EIF1...  70.9    7e-11   
ref|XP_005305561.1|  PREDICTED: probable RNA-binding protein EIF1...  70.9    8e-11   
ref|XP_005844079.1|  hypothetical protein CHLNCDRAFT_27264            68.9    9e-11   
ref|XP_004618596.1|  PREDICTED: probable RNA-binding protein EIF1AD   70.1    1e-10   
emb|CEF62493.1|  Probable RNA-binding protein EIF1AD                  70.1    1e-10   
ref|XP_006268167.1|  PREDICTED: probable RNA-binding protein EIF1AD   69.3    1e-10   
emb|CDJ95875.1|  S1 domain containing protein                         70.1    2e-10   
ref|XP_003429077.1|  PREDICTED: LOW QUALITY PROTEIN: probable RNA...  69.7    2e-10   
gb|EYC02527.1|  hypothetical protein Y032_0099g3166                   69.7    2e-10   
ref|XP_005113461.1|  PREDICTED: probable RNA-binding protein EIF1...  68.6    2e-10   
gb|KIH50265.1|  putative translation initiation factor eIF-1A         68.9    2e-10   
ref|XP_008325733.1|  PREDICTED: probable RNA-binding protein EIF1AD   68.9    2e-10   
gb|EHJ64807.1|  translation initiation factor 1a                      68.9    2e-10   
gb|ACQ58150.1|  Probable RNA-binding protein EIF1AD                   68.9    3e-10   Anoplopoma fimbria
ref|XP_011068773.1|  PREDICTED: probable RNA-binding protein EIF1AD   68.6    3e-10   
ref|NP_956762.1|  probable RNA-binding protein EIF1AD                 68.9    3e-10   Danio rerio [leopard danio]
ref|XP_008116415.1|  PREDICTED: interferon-inducible double-stran...  72.0    3e-10   
ref|XP_004521699.1|  PREDICTED: probable RNA-binding protein EIF1...  68.9    3e-10   
ref|XP_004596714.1|  PREDICTED: probable RNA-binding protein EIF1AD   68.6    3e-10   
ref|XP_008864748.1|  hypothetical protein H310_02855                  68.9    4e-10   
ref|XP_009838388.1|  hypothetical protein H257_12776                  68.6    4e-10   
ref|XP_002950217.1|  hypothetical protein VOLCADRAFT_104609           71.6    4e-10   
ref|XP_004367104.1|  hypothetical protein DFA_07241                   68.2    5e-10   
gb|EKC24483.1|  Putative RNA-binding protein EIF1AD                   68.2    5e-10   
emb|CEI86597.1|  hypothetical protein RMCBS344292_01032               67.8    6e-10   
gb|KCW65794.1|  hypothetical protein EUGRSUZ_G031472                  67.8    7e-10   
dbj|BAE40073.1|  unnamed protein product                              67.8    7e-10   Mus musculus [mouse]
gb|AAY66860.1|  unknown                                               67.4    9e-10   Ixodes scapularis [blacklegged tick]
gb|KHN80746.1|  putative RNA-binding protein EIF1AD                   67.8    9e-10   
gb|EFX69139.1|  hypothetical protein DAPPUDRAFT_329420                67.4    1e-09   
ref|XP_003774157.1|  PREDICTED: probable RNA-binding protein EIF1AD   67.4    1e-09   
ref|XP_004364155.1|  eukaryotic translation initiation factor 1A      67.4    1e-09   
ref|XP_007056214.1|  PREDICTED: probable RNA-binding protein EIF1AD   67.0    1e-09   
ref|NP_505624.1|  Protein ZK856.11                                    67.0    1e-09   Caenorhabditis elegans [roundworm]
ref|XP_001749622.1|  hypothetical protein                             66.6    1e-09   Monosiga brevicollis MX1
ref|XP_007246458.1|  PREDICTED: LOW QUALITY PROTEIN: probable RNA...  66.6    2e-09   
emb|CCA24116.1|  conserved hypothetical protein                       67.0    2e-09   
ref|XP_001656497.1|  translation initiation factor 1A, putative       66.2    2e-09   Aedes aegypti
ref|XP_001356489.1|  GA16587                                          66.2    2e-09   Drosophila pseudoobscura pseudoobscura
ref|XP_002014666.1|  GL19303                                          66.2    2e-09   Drosophila persimilis
emb|CBJ25456.1|  conserved unknown protein                            67.4    2e-09   
ref|XP_003747851.1|  PREDICTED: probable RNA-binding protein EIF1...  66.2    2e-09   
gb|EFN71061.1|  Probable RNA-binding protein EIF1AD                   65.9    3e-09   
ref|XP_003062117.1|  predicted protein                                66.2    3e-09   
ref|XP_008646675.1|  PREDICTED: uncharacterized protein LOC103628205  68.6    4e-09   
ref|NP_001001612.1|  probable RNA-binding protein EIF1AD              65.9    4e-09   Gallus gallus [bantam]
ref|XP_002403797.1|  conserved hypothetical protein                   65.1    4e-09   Ixodes scapularis [blacklegged tick]
ref|XP_784016.1|  PREDICTED: probable RNA-binding protein EIF1AD-...  65.5    6e-09   Strongylocentrotus purpuratus [purple urchin]
ref|XP_003745259.1|  PREDICTED: probable RNA-binding protein EIF1...  65.1    6e-09   
ref|XP_002735202.1|  PREDICTED: probable RNA-binding protein EIF1...  65.5    6e-09   Saccoglossus kowalevskii
ref|XP_007502737.1|  PREDICTED: probable RNA-binding protein EIF1...  65.1    6e-09   
gb|KDR10712.1|  putative RNA-binding protein EIF1AD                   64.7    7e-09   
ref|XP_002637050.1|  Hypothetical protein CBG09545                    64.7    9e-09   Caenorhabditis briggsae
gb|KFB40059.1|  AGAP010181-PA-like protein                            64.7    1e-08   
ref|XP_002610553.1|  hypothetical protein BRAFLDRAFT_202521           63.2    1e-08   Branchiostoma floridae
emb|CEG65914.1|  hypothetical protein RMATCC62417_02596               63.9    1e-08   
ref|XP_001120246.1|  PREDICTED: probable RNA-binding protein EIF1...  63.9    1e-08   Apis mellifera [bee]
gb|EJW80326.1|  translation initiation factor 1a                      64.7    1e-08   
ref|XP_002880562.1|  hypothetical protein ARALYDRAFT_900931           62.0    1e-08   
ref|XP_005080603.1|  PREDICTED: probable RNA-binding protein EIF1...  63.9    1e-08   
ref|XP_004452557.1|  PREDICTED: LOW QUALITY PROTEIN: probable RNA...  63.9    2e-08   
ref|XP_006642882.1|  PREDICTED: LOW QUALITY PROTEIN: probable RNA...  63.9    2e-08   
ref|XP_001895985.1|  obelix                                           63.9    2e-08   Brugia malayi [agent of lymphatic filariasis]
ref|XP_006569035.1|  PREDICTED: probable RNA-binding protein EIF1...  63.5    2e-08   
gb|EPB83366.1|  hypothetical protein HMPREF1544_09899                 63.2    2e-08   
ref|XP_003385062.1|  PREDICTED: probable RNA-binding protein EIF1...  63.5    2e-08   
ref|XP_002130036.1|  PREDICTED: probable RNA-binding protein EIF1AD   63.5    2e-08   Ciona intestinalis [sea vase]
ref|NP_001040352.1|  translation initiation factor 1a                 63.2    2e-08   
gb|ERG83705.1|  putative rna-binding protein eif1ad                   63.5    2e-08   
ref|XP_006622322.1|  PREDICTED: probable RNA-binding protein EIF1...  62.8    3e-08   
ref|XP_003112378.1|  hypothetical protein CRE_30701                   63.2    3e-08   
gb|EXX50770.1|  hypothetical protein RirG_267680                      62.8    3e-08   
gb|KFH65776.1|  hypothetical protein MVEG_07879                       62.8    3e-08   
gb|ACO12516.1|  Probable RNA-binding protein EIF1AD                   62.8    4e-08   
gb|ADD38048.1|  Probable RNA-binding protein EIF1AD                   62.4    5e-08   
emb|CEG84087.1|  hypothetical protein RMATCC62417_17936               62.0    5e-08   
ref|XP_968962.1|  PREDICTED: probable RNA-binding protein EIF1AD      61.6    6e-08   
gb|EPY49433.1|  translation initiation factor eIF1A-like protein      61.2    6e-08   
gb|EGE05619.1|  hypothetical protein TEQG_04628                       61.6    6e-08   
ref|XP_002499794.1|  predicted protein                                62.0    7e-08   
ref|XP_005838271.1|  hypothetical protein GUITHDRAFT_85170            61.6    8e-08   
gb|ETN78966.1|  putative translation initiation factor eIF-1A         63.9    8e-08   
ref|XP_009066310.1|  hypothetical protein LOTGIDRAFT_134275           60.5    8e-08   
ref|XP_002845288.1|  conserved hypothetical protein                   61.2    8e-08   
ref|XP_003233346.1|  hypothetical protein TERG_06339                  61.2    8e-08   
gb|EGD96394.1|  hypothetical protein TESG_03842                       61.2    8e-08   
ref|XP_005305563.1|  PREDICTED: probable RNA-binding protein EIF1...  60.5    2e-07   
gb|ELU17921.1|  hypothetical protein CAPTEDRAFT_172896                60.5    2e-07   
ref|XP_003171652.1|  hypothetical protein MGYG_06197                  60.1    2e-07   
gb|ETN65556.1|  hypothetical protein AND_002674                       62.4    2e-07   
gb|EYE94046.1|  putative eukaryotic initiation factor 1A              60.1    2e-07   
gb|EWM22121.1|  putative rna-binding protein eif1ad                   61.2    2e-07   
gb|KDD75238.1|  hypothetical protein H632_c791p1                      59.7    3e-07   
ref|XP_005793947.1|  hypothetical protein EMIHUDRAFT_193847           59.7    4e-07   
ref|XP_005785721.1|  hypothetical protein EMIHUDRAFT_122911           59.3    4e-07   
ref|XP_003849514.1|  hypothetical protein MYCGRDRAFT_101301           58.5    6e-07   
gb|ACO11432.1|  Probable RNA-binding protein EIF1AD                   58.9    6e-07   
ref|XP_002175117.1|  translation initiation factor eIF1A-like pro...  58.5    6e-07   
ref|XP_009006751.1|  PREDICTED: probable RNA-binding protein EIF1...  58.5    7e-07   
gb|EZA49915.1|  putative RNA-binding protein EIF1AD                   58.5    7e-07   
gb|ETE57784.1|  putative RNA-binding protein EIF1AD                   58.5    8e-07   
ref|XP_001259498.1|  eukaryotic initiation factor 1A, putative        58.2    8e-07   
gb|EFN85051.1|  Probable RNA-binding protein EIF1AD                   58.2    9e-07   
gb|EGT55428.1|  hypothetical protein CAEBREN_22449                    58.5    9e-07   
ref|XP_009363894.1|  PREDICTED: uncharacterized protein LOC103953819  57.0    9e-07   
ref|XP_003146548.1|  obelix                                           58.5    1e-06   
ref|XP_001481511.1|  eukaryotic translation initation factor eIF1...  57.8    1e-06   
gb|EJU06255.1|  hypothetical protein DACRYDRAFT_12978                 57.4    1e-06   
gb|KDN48145.1|  hypothetical protein RSAG8_03161                      57.8    1e-06   
ref|XP_003017496.1|  hypothetical protein ARB_04377                   56.2    3e-06   
gb|EPX74309.1|  translation initiation factor eIF1A-like protein      56.6    3e-06   
gb|ACJ53922.1|  eukaryotic translation initiation factor 1A domain    55.8    3e-06   
gb|KGO77669.1|  Translation initiation factor 1A (eIF-1A)             56.2    4e-06   
gb|KGO35855.1|  Translation initiation factor 1A (eIF-1A)             56.2    4e-06   
ref|XP_001632316.1|  predicted protein                                55.8    5e-06   
gb|ERL96260.1|  hypothetical protein D910_01671                       56.2    5e-06   
ref|XP_657709.1|  hypothetical protein AN0105.2                       55.8    6e-06   
gb|EDM12476.1|  similar to 2010003J03Rik protein, isoform CRA_b       55.1    6e-06   
ref|XP_008559876.1|  PREDICTED: probable RNA-binding protein EIF1AD   55.5    7e-06   
ref|XP_010761063.1|  hypothetical protein PADG_05591                  55.5    7e-06   
ref|XP_005062702.1|  PREDICTED: probable RNA-binding protein EIF1...  54.7    7e-06   
dbj|GAA83265.1|  eukaryotic initiation factor 1A                      55.1    9e-06   
ref|XP_006842527.1|  hypothetical protein AMTR_s00077p00119170        53.9    1e-05   
ref|NP_595397.1|  translation initiation factor eIF1A-like (predi...  54.7    1e-05   
gb|EKV10589.1|  Eukaryotic initiation factor 1A, putative             55.1    1e-05   
dbj|GAD98962.1|  eukaryotic initiation factor 1A                      54.7    1e-05   
ref|XP_002425718.1|  eukaryotic translation initiation factor 1A,...  54.7    1e-05   
ref|XP_002381121.1|  eukaryotic translation initation factor eIF1...  54.3    2e-05   
ref|XP_002795736.1|  conserved hypothetical protein                   54.3    2e-05   
ref|XP_001824043.1|  eukaryotic initiation factor 1A                  54.3    2e-05   
ref|XP_001211254.1|  conserved hypothetical protein                   54.3    2e-05   
gb|EEH22724.1|  hypothetical protein PABG_04935                       54.3    2e-05   
ref|XP_506091.1|  YALI0F31339p                                        53.9    2e-05   
gb|KDQ20723.1|  hypothetical protein BOTBODRAFT_26739                 53.9    2e-05   
ref|XP_002567752.1|  Pc21g07110                                       53.9    2e-05   
ref|XP_001398697.1|  eukaryotic initiation factor 1A                  53.5    3e-05   
gb|EAS28312.2|  hypothetical protein CIMG_09209                       53.9    3e-05   
ref|XP_007776260.1|  hypothetical protein W97_00153                   53.5    3e-05   
gb|KFK42325.1|  hypothetical protein AALP_AA2G241500                  56.2    3e-05   
ref|XP_001239588.1|  hypothetical protein CIMG_09209                  53.1    4e-05   
ref|XP_006677334.1|  hypothetical protein BATDEDRAFT_23639            53.9    4e-05   
gb|ELQ33516.1|  hypothetical protein OOU_Y34scaffold00927g5           53.1    4e-05   
ref|XP_005431451.1|  PREDICTED: probable RNA-binding protein EIF1...  54.3    4e-05   
dbj|GAM34353.1|  eukaryotic translation initation factor              53.1    4e-05   
gb|EPQ63771.1|  hypothetical protein BGT96224_1466                    52.4    7e-05   
emb|CDW60022.1|  eIF-1a domain containing protein                     53.1    7e-05   
gb|EIE89514.1|  hypothetical protein RO3G_14225                       55.5    8e-05   
ref|XP_002181463.1|  predicted protein                                53.1    8e-05   
gb|KFZ14372.1|  hypothetical protein V502_06114                       52.0    9e-05   
gb|KIH50525.1|  eukaryotic initiation factor 1A                       52.0    9e-05   
emb|CBY41113.1|  unnamed protein product                              52.4    1e-04   
ref|XP_007930630.1|  hypothetical protein MYCFIDRAFT_64332            52.0    1e-04   
ref|XP_005854611.1|  rna binding protein                              52.8    1e-04   
gb|ELU45935.1|  eIF-1a domain-containing protein                      52.4    1e-04   
emb|CBY23805.1|  unnamed protein product                              52.0    1e-04   
gb|KFD57722.1|  hypothetical protein M513_01392                       52.4    1e-04   
gb|KFD72192.1|  hypothetical protein M514_01392                       52.0    1e-04   
ref|XP_005715572.1|  unnamed protein product                          51.6    2e-04   
gb|EMF09174.1|  nucleic acid-binding protein                          51.2    2e-04   
gb|EPS32536.1|  hypothetical protein PDE_07496                        51.2    2e-04   
gb|EME41057.1|  hypothetical protein DOTSEDRAFT_136348                50.8    2e-04   
gb|KFY83721.1|  hypothetical protein V500_09989                       50.8    2e-04   
ref|XP_003067168.1|  hypothetical protein CPC735_016240               50.8    2e-04   
gb|KHJ49410.1|  eukaryotic initiation factor 1A                       52.8    3e-04   
gb|EMT60508.1|  hypothetical protein FOC4_g10011780                   50.4    3e-04   
gb|EXK31990.1|  hypothetical protein FOMG_12352                       50.4    3e-04   
gb|KFY63568.1|  hypothetical protein V496_03876                       50.1    4e-04   
emb|CCU75942.1|  putative S1-like domain-containing protein           50.1    4e-04   
emb|CDH57806.1|  hypothetical protein RO3G_14225                      49.7    5e-04   
ref|XP_002144819.1|  eukaryotic translation initation factor eIF1...  49.7    5e-04   
emb|CDS05489.1|  hypothetical protein LRAMOSA08017                    49.7    5e-04   
gb|EKG13023.1|  Translation initiation factor 1A (eIF-1A)             49.7    6e-04   
emb|CCT63974.1|  related to eukaryotic translation initation fact...  49.3    7e-04   
gb|KFY23542.1|  hypothetical protein V493_05794                       49.3    7e-04   
gb|EQL03701.1|  Nucleic acid-binding, OB-fold-like protein            49.3    8e-04   
gb|EXL77093.1|  hypothetical protein FOPG_08370                       48.9    9e-04   



>emb|CDP13890.1| unnamed protein product [Coffea canephora]
Length=170

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E+T  LQQGQSIMQVVDLRGSN+IEV+DA GE+SLAIFPAKFQKSMWIKRGNF
Sbjct  7    NLKRAVEEETLTLQQGQSIMQVVDLRGSNLIEVMDAKGERSLAIFPAKFQKSMWIKRGNF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDE+GREEA E GRKVGC+V QVLFY++VR  QKSPEWPE+FK+A +  SK++L+ HT
Sbjct  67   VVVDETGREEAAEFGRKVGCVVVQVLFYERVRVLQKSPEWPEVFKAATLGNSKQDLQSHT  126

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
            S  ++ ++SSDDDGLPPLEANTNRL+PFQ
Sbjct  127  SNMEENDNSSDDDGLPPLEANTNRLRPFQ  155



>ref|XP_011084807.1| PREDICTED: probable RNA-binding protein EIF1AD [Sesamum indicum]
 ref|XP_011084808.1| PREDICTED: probable RNA-binding protein EIF1AD [Sesamum indicum]
Length=171

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E+   LQQGQSIMQVVDLRGSN+IEV+D  G+K LAIFPAKFQKSMWIKRGNF
Sbjct  7    NLKRAIEEEMVTLQQGQSIMQVVDLRGSNLIEVMDTKGQKLLAIFPAKFQKSMWIKRGNF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            +VVDESGREEA+ESGRKVG IVTQVL++DQVR  QKSPEWPEIFKS   ETSK++L   T
Sbjct  67   IVVDESGREEAVESGRKVGGIVTQVLYHDQVRLLQKSPEWPEIFKSLPQETSKQDLNSCT  126

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKPF  214
            SQ QD E  +DD+GLPPLEANTNR  P 
Sbjct  127  SQ-QDDESCTDDEGLPPLEANTNRQNPL  153



>ref|XP_009782131.1| PREDICTED: probable RNA-binding protein EIF1AD [Nicotiana sylvestris]
Length=168

 Score =   222 bits (566),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E+   LQQGQSIMQVVDLRGSN+I+V+DA GE S+AIFPAKFQKSMWIKRGNF
Sbjct  7    NLKRAVEEEFFTLQQGQSIMQVVDLRGSNLIKVMDAKGETSIAIFPAKFQKSMWIKRGNF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDE GREEA+ESGRKVGC+VTQVL+Y+QVR  QKSPEWPE+FKS  VE+SK++ +   
Sbjct  67   VVVDERGREEAVESGRKVGCVVTQVLYYEQVRVLQKSPEWPEVFKSTAVESSKQHTQSDN  126

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
            +Q  + EDSSDDDGLPPLEANTNRL PFQ
Sbjct  127  TQMDENEDSSDDDGLPPLEANTNRLNPFQ  155



>ref|XP_009611463.1| PREDICTED: probable RNA-binding protein EIF1AD [Nicotiana tomentosiformis]
Length=169

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 131/150 (87%), Gaps = 1/150 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E+   LQQGQSIMQVVDLRGSN+I+V+DA GE S+AIFPAKFQKSMWIKRGNF
Sbjct  7    NLKRAVEEEFFTLQQGQSIMQVVDLRGSNLIQVMDAKGETSIAIFPAKFQKSMWIKRGNF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLER-H  301
            VVVDE GREEA+ESGRKVGC+VTQVL+Y+QVR  QKSPEWPE+FKS  VE+SK++ +  +
Sbjct  67   VVVDERGREEAVESGRKVGCVVTQVLYYEQVRVLQKSPEWPEVFKSTTVESSKQDTQSDN  126

Query  300  TSQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
             +Q  + EDSSDDDGLPPLEANTNRL PFQ
Sbjct  127  NTQMDENEDSSDDDGLPPLEANTNRLNPFQ  156



>ref|XP_006356481.1| PREDICTED: probable RNA-binding protein EIF1AD-like isoform X1 
[Solanum tuberosum]
Length=169

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 128/150 (85%), Gaps = 1/150 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E+   LQ+GQSIMQV+DLRGSNII+V DA GE SLAIFPAKFQKSMWIK GNF
Sbjct  7    NLKRAVEEEFFTLQKGQSIMQVLDLRGSNIIQVRDAKGETSLAIFPAKFQKSMWIKTGNF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKE-NLERH  301
            VVVD+SGREEA ESGRKVGC+VTQVL+YDQVR  QKSPEWPEIFKS  V +SK+ N + H
Sbjct  67   VVVDDSGREEATESGRKVGCVVTQVLYYDQVRVLQKSPEWPEIFKSTAVGSSKQDNTQSH  126

Query  300  TSQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
             SQ  + EDSSDDDGLPPLEANTNRL PFQ
Sbjct  127  NSQMDENEDSSDDDGLPPLEANTNRLNPFQ  156



>ref|XP_007136410.1| hypothetical protein PHAVU_009G042700g [Phaseolus vulgaris]
 gb|ESW08404.1| hypothetical protein PHAVU_009G042700g [Phaseolus vulgaris]
Length=168

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +EK   LQ+GQ+IM+VV LRGSNIIEV+DA G KSLA+FPAKFQKS+WIKRG+F
Sbjct  7    NLKRATEEKHVTLQEGQNIMKVVSLRGSNIIEVMDACGNKSLALFPAKFQKSVWIKRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDE+G+E+A+ESG KV C+V+QVLFY+QVRE QK+PEWP+ FK+A+V+ SKE     +
Sbjct  67   VVVDETGKEKALESGSKVACLVSQVLFYEQVRELQKTPEWPQSFKTAMVDESKET--SAS  124

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
             Q  ++EDS DDDGLPPLEANTNRL+PF+
Sbjct  125  KQENELEDSDDDDGLPPLEANTNRLRPFE  153



>ref|XP_007150848.1| hypothetical protein PHAVU_005G185900g [Phaseolus vulgaris]
 gb|ESW22842.1| hypothetical protein PHAVU_005G185900g [Phaseolus vulgaris]
Length=168

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 127/149 (85%), Gaps = 2/149 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +EK   LQ+GQ+IM+VV LRGSNIIEV+DA G KSLA+FPAKFQKS+WIKRG+F
Sbjct  7    NLKRATEEKHVTLQEGQNIMKVVSLRGSNIIEVMDACGNKSLALFPAKFQKSVWIKRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDE+G+ +A+ESG KV C+V+QVLFY+QVRE QK+PEWP+ FK+A+V+ SKE     +
Sbjct  67   VVVDETGKVKALESGSKVACLVSQVLFYEQVRELQKTPEWPQSFKTAMVDESKET--SAS  124

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
             Q  ++EDS DDDGLPPLEANTNRL+PF+
Sbjct  125  KQENELEDSDDDDGLPPLEANTNRLRPFE  153



>ref|XP_006365334.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Solanum 
tuberosum]
Length=164

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 130/149 (87%), Gaps = 3/149 (2%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E    L+QGQSIMQVVDLRGSN+I+V+DA GE SLAIFPAKFQKSMWIKRGNF
Sbjct  8    NLKRAIEEDNFTLEQGQSIMQVVDLRGSNLIQVMDAKGENSLAIFPAKFQKSMWIKRGNF  67

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDESGREEAIESGRKVGC+VT+VL+++QVR  QKS EWPEIFKS  VE+SK++L    
Sbjct  68   VVVDESGREEAIESGRKVGCVVTKVLYFEQVRVLQKSAEWPEIFKSIAVESSKQDL---V  124

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
            SQ ++ EDSSDDDGLPPLEANTNR+ PFQ
Sbjct  125  SQIKEDEDSSDDDGLPPLEANTNRVNPFQ  153



>ref|XP_006486144.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Citrus sinensis]
Length=172

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 122/151 (81%), Gaps = 2/151 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E++  LQ GQSIMQVV LRGSN+IEVLDA GEKSLA+FPAKFQKSMWIKRG+F
Sbjct  7    NLKRAAEEQSLTLQDGQSIMQVVSLRGSNLIEVLDAKGEKSLALFPAKFQKSMWIKRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDESG+E+AI+ G KV CIVT+VLFY+QVR  QKS EWPEIFKS   + +  +LER  
Sbjct  67   VVVDESGKEKAIKDGSKVACIVTKVLFYEQVRALQKSTEWPEIFKSTNSDDANGSLERQA  126

Query  297  --SQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
               +  D  +S DDDGLPPLEANTNR+KP +
Sbjct  127  CNHEENDQSESDDDDGLPPLEANTNRMKPME  157



>ref|XP_004239975.1| PREDICTED: probable RNA-binding protein EIF1AD [Solanum lycopersicum]
Length=174

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 130/149 (87%), Gaps = 3/149 (2%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E    L+QGQSIMQVVDLRGSN+I+V+DA GE SLAIFPAKFQKSMWIKRGNF
Sbjct  8    NLKRAIEEDNFTLEQGQSIMQVVDLRGSNLIQVMDAKGENSLAIFPAKFQKSMWIKRGNF  67

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDESGREEA+ESGRKVGC+VT+VL+++QVR  QKS EWPEIFKS  VE+SK+++    
Sbjct  68   VVVDESGREEAVESGRKVGCVVTKVLYFEQVRVLQKSAEWPEIFKSIAVESSKQDI---V  124

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
            SQ ++ EDSSDDDGLPPLEANTNR+ PFQ
Sbjct  125  SQIEEDEDSSDDDGLPPLEANTNRVNPFQ  153



>ref|XP_004502815.1| PREDICTED: probable RNA-binding protein EIF1AD-like isoform X1 
[Cicer arietinum]
 ref|XP_004502816.1| PREDICTED: probable RNA-binding protein EIF1AD-like isoform X2 
[Cicer arietinum]
 ref|XP_004502817.1| PREDICTED: probable RNA-binding protein EIF1AD-like isoform X3 
[Cicer arietinum]
Length=175

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 122/149 (82%), Gaps = 7/149 (5%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +EK   LQ GQSIMQVV LRGSN+IEV+DA GEKSLA+FPAKFQKSMWIKRG+F
Sbjct  7    NLKRASEEKHVTLQDGQSIMQVVSLRGSNLIEVMDARGEKSLALFPAKFQKSMWIKRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDESG+ EA+ESG KV C+V +VLFY+QVR  QKS EWPEIFK  +        ER T
Sbjct  67   VVVDESGKIEALESGSKVACLVCKVLFYEQVRALQKSTEWPEIFKDDLN-------ERTT  119

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
            +Q ++ +D+SDDDGLPPLEANTNR++PF+
Sbjct  120  AQQENEDDTSDDDGLPPLEANTNRMRPFE  148



>ref|XP_010525424.1| PREDICTED: probable RNA-binding protein EIF1AD [Tarenaya hassleriana]
Length=172

 Score =   212 bits (539),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 126/150 (84%), Gaps = 2/150 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLK+A +E++  L++ QSI+QVV LRGSN+IEV+DA GEKSLA+FPAKFQKSMWIKRG+F
Sbjct  7    NLKKATEERSLTLEECQSIVQVVSLRGSNLIEVMDAKGEKSLALFPAKFQKSMWIKRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVD +G+E+A+ESG KV CIV QVLFY+QVR  QK+P+WPEIF+ A  + + E  +RHT
Sbjct  67   VVVDHTGKEKALESGSKVACIVCQVLFYEQVRALQKTPDWPEIFRDAKSKEADECSQRHT  126

Query  297  SQTQ--DIEDSSDDDGLPPLEANTNRLKPF  214
            ++ +  D  DSS+DDGLPPLEANTNR+KPF
Sbjct  127  TEQEENDETDSSEDDGLPPLEANTNRMKPF  156



>ref|XP_009757975.1| PREDICTED: LOW QUALITY PROTEIN: probable RNA-binding protein 
EIF1AD [Nicotiana sylvestris]
Length=167

 Score =   211 bits (538),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA  E+   LQQGQ+IMQVVDLRGSN+I+V+DA GE S+AIFPAKFQKSMWIKRGNF
Sbjct  7    NLKRA-VEEFFTLQQGQNIMQVVDLRGSNLIQVMDAKGETSIAIFPAKFQKSMWIKRGNF  65

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDE G EEA+ESGRKVGC+VTQVL+Y+QVR  QKSP WPEIFKS  VE+SK++ +   
Sbjct  66   VVVDERGXEEAVESGRKVGCVVTQVLYYEQVRVLQKSPVWPEIFKSTAVESSKQDTQSDN  125

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
            +Q  + EDSSDDDGLPPLEANTNRL PFQ
Sbjct  126  TQIDENEDSSDDDGLPPLEANTNRLNPFQ  154



>ref|XP_008234164.1| PREDICTED: probable RNA-binding protein EIF1AD [Prunus mume]
Length=171

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E +  L+ G SIMQV+ LRGSN+IE++D  GEKSLA+FPAKFQKSMWIKRG+F
Sbjct  7    NLKRAVEEDSLTLKDGHSIMQVLSLRGSNLIEIMDGQGEKSLALFPAKFQKSMWIKRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVD SG+E+ +ESG KVGCIV+QVLFY+QVR  +KSPEWPEIFKS V +    +L+  T
Sbjct  67   VVVDASGKEKVLESGSKVGCIVSQVLFYEQVRVLKKSPEWPEIFKSTVSDGCHASLQGDT  126

Query  297  SQTQDIE-DSSDDDGLPPLEANTNRLKP  217
            SQ ++ E DSSDDDGLPPLEANTNR+KP
Sbjct  127  SQQEENELDSSDDDGLPPLEANTNRMKP  154



>ref|XP_004158969.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Cucumis 
sativus]
Length=169

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 123/149 (83%), Gaps = 1/149 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NL+RA +   A L+ G SIMQVV +RGSN+IEV+DA GEKSLA+FPAKFQKSMWIKRG+F
Sbjct  7    NLQRASEHHIASLEDGHSIMQVVSIRGSNLIEVMDAQGEKSLALFPAKFQKSMWIKRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDESG++ A+ESG KV CIV++VL+++Q+RE QKSPEWPEIFK+A+V    ENL+   
Sbjct  67   VVVDESGKKNALESGSKVACIVSRVLYFEQIRELQKSPEWPEIFKNAIVGDRSENLQAQN  126

Query  297  SQ-TQDIEDSSDDDGLPPLEANTNRLKPF  214
            +Q  +D  +SSDDDGLPPLEANTNR KP 
Sbjct  127  NQPVEDEVNSSDDDGLPPLEANTNRAKPL  155



>ref|XP_007011379.1| OB-fold nucleic acid binding domain-containing protein [Theobroma 
cacao]
 gb|EOY20189.1| OB-fold nucleic acid binding domain-containing protein [Theobroma 
cacao]
Length=179

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 129/160 (81%), Gaps = 12/160 (8%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA K++   LQ GQSIMQV+ LRGSN+IEV+DA G KSLA+FPAKFQKS+WIKRG+F
Sbjct  7    NLKRAAKDQNLSLQHGQSIMQVLSLRGSNLIEVVDARGGKSLALFPAKFQKSLWIKRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN-----  313
            VVVDESG+E+A+ESG KV CIV+QVLFY+Q+R  QKSPEWPE FKS+ ++   EN     
Sbjct  67   VVVDESGKEKALESGSKVACIVSQVLFYEQLRALQKSPEWPENFKSSNLDDLVENDGGAT  126

Query  312  ---LERHTSQTQDIED---SSDDDGLPPLEANTNRLKPFQ  211
               L+RH SQ Q++ED   SSDDDGLPPLEAN NR+KPF+
Sbjct  127  SECLQRHPSQ-QEVEDELESSDDDGLPPLEANLNRIKPFE  165



>ref|XP_004146450.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Cucumis 
sativus]
 gb|KGN50715.1| hypothetical protein Csa_5G218810 [Cucumis sativus]
Length=169

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 123/149 (83%), Gaps = 1/149 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NL+RA +   A L+ G SIMQVV +RGSN+IEV+DA GEKSLA+FPAKFQKSMWIKRG+F
Sbjct  7    NLQRASEHHIASLEDGHSIMQVVSIRGSNLIEVMDAQGEKSLALFPAKFQKSMWIKRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDESG++ A+ESG KV CIV++VL+++Q+RE QKSPEWPEIFK+A+V    ENL+   
Sbjct  67   VVVDESGKKNALESGSKVACIVSRVLYFEQIRELQKSPEWPEIFKNAIVGDRNENLQAQN  126

Query  297  SQT-QDIEDSSDDDGLPPLEANTNRLKPF  214
            +Q  +D  +SSDDDGLPPLEANTNR KP 
Sbjct  127  NQPGEDEVNSSDDDGLPPLEANTNRAKPL  155



>ref|XP_010678866.1| PREDICTED: probable RNA-binding protein EIF1AD [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010678867.1| PREDICTED: probable RNA-binding protein EIF1AD [Beta vulgaris 
subsp. vulgaris]
Length=175

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 124/151 (82%), Gaps = 3/151 (2%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E T  LQQGQSIMQVV LRGSN+IE++DA G+KSLA+FPAKFQKSMWIKRG+F
Sbjct  7    NLKRAVEEDTLTLQQGQSIMQVVSLRGSNLIEIVDAEGKKSLALFPAKFQKSMWIKRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVD S RE+A+ESG KV CIV+QVLF+D+VR  QKSPEWPE FKS +++TS +N     
Sbjct  67   VVVDGSNREDALESGSKVACIVSQVLFHDKVRRLQKSPEWPEAFKSQIIDTSSKNTPGPA  126

Query  297  SQTQDIE--DSSDDDGLPPLEANTNRLKPFQ  211
            S+  D+E  D+SDDDGLPPLE N NR +P++
Sbjct  127  SEG-DVEETDTSDDDGLPPLETNMNRWRPYE  156



>ref|XP_006435950.1| hypothetical protein CICLE_v10032334mg [Citrus clementina]
 gb|ESR49190.1| hypothetical protein CICLE_v10032334mg [Citrus clementina]
Length=282

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 122/151 (81%), Gaps = 2/151 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E++  LQ GQSIMQVV LRGSN+IEVLDA GEKSLA+FPAKFQKSMWIKRG+F
Sbjct  117  NLKRAAEEQSLTLQDGQSIMQVVSLRGSNLIEVLDAKGEKSLALFPAKFQKSMWIKRGSF  176

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDESG+E+AI+ G KV CIVT+VLFY+QVR  QKS EWPEIFKS   + +  +LER  
Sbjct  177  VVVDESGKEKAIKDGSKVACIVTKVLFYEQVRALQKSTEWPEIFKSTNSDDANGSLERQA  236

Query  297  SQTQ--DIEDSSDDDGLPPLEANTNRLKPFQ  211
               +  D  +S DDDGLPPLEANTNR+KP +
Sbjct  237  CNHEENDQSESDDDDGLPPLEANTNRMKPME  267



>gb|KDO67560.1| hypothetical protein CISIN_1g030718mg [Citrus sinensis]
Length=172

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 120/151 (79%), Gaps = 2/151 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E++  LQ GQSIMQVV LRGSN+IEVLDA  EKSLA+FPAKFQKSMWIKRG+F
Sbjct  7    NLKRAAEEQSLTLQDGQSIMQVVSLRGSNLIEVLDAKDEKSLALFPAKFQKSMWIKRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDESG+E+AI+ G KV CIVT+VLFY+QVR  QKS EWPEIFKS   + +  +LER  
Sbjct  67   VVVDESGKEKAIKDGSKVACIVTKVLFYEQVRALQKSTEWPEIFKSTNSDDANGSLERQA  126

Query  297  --SQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
               +  D  +S DDDGLPPLEAN NR+KP +
Sbjct  127  CNHEENDQSESDDDDGLPPLEANINRMKPME  157



>ref|XP_010554727.1| PREDICTED: probable RNA-binding protein EIF1AD [Tarenaya hassleriana]
Length=177

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 124/151 (82%), Gaps = 3/151 (2%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLK+A +E+T  L++G SI QVV LRGSN+IEV+D  GEKSLA+FPAKFQKSMWIKRG+F
Sbjct  11   NLKKATQEQTLTLEEGHSIAQVVSLRGSNLIEVMDVKGEKSLALFPAKFQKSMWIKRGSF  70

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVD++G+E+A+ESG KV CIV +VLFY+QVR  +KSPEWPEIF+    + + EN +R T
Sbjct  71   VVVDQTGKEKALESGSKVACIVCRVLFYEQVRALRKSPEWPEIFRETKSKEADENSQRQT  130

Query  297  SQTQ---DIEDSSDDDGLPPLEANTNRLKPF  214
            ++ +   +I+ S DDDGLPPLEANTNR+KPF
Sbjct  131  TEQEENGEIDTSDDDDGLPPLEANTNRMKPF  161



>ref|XP_010253036.1| PREDICTED: probable RNA-binding protein EIF1AD [Nelumbo nucifera]
 ref|XP_010253037.1| PREDICTED: probable RNA-binding protein EIF1AD [Nelumbo nucifera]
Length=166

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E+   LQ+GQSIM+VV LRGSN+IEV+DA GEKSLA+FPAKFQKSMWIK+G+F
Sbjct  6    NLKRAAREEVLTLQEGQSIMRVVSLRGSNVIEVMDAGGEKSLALFPAKFQKSMWIKQGSF  65

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDESGRE+A+ESG KV C+V+QVLFY+QVR  QKS  WPEIFK+   + S  +L+R  
Sbjct  66   VVVDESGREKALESGSKVACMVSQVLFYEQVRTLQKSTIWPEIFKTTNKDDSCSHLQRPA  125

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKP  217
            SQ ++  +SSDDDGLPPLEAN NR +P
Sbjct  126  SQPEEEWNSSDDDGLPPLEANLNRSRP  152



>ref|XP_007218511.1| hypothetical protein PRUPE_ppa012453mg [Prunus persica]
 gb|EMJ19710.1| hypothetical protein PRUPE_ppa012453mg [Prunus persica]
Length=169

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E++  L+ G SIMQV+ LRGSN+IE++D  GEKSLA+FPAKFQKSMWIKRG+F
Sbjct  7    NLKRAVEEESLTLKDGHSIMQVLSLRGSNLIEIMDGQGEKSLALFPAKFQKSMWIKRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVD SG+E+ +ESG KVGCIV+QVLFY+QVR  +KSPEWPEIFKS V +    +L+  T
Sbjct  67   VVVDASGKEKVLESGSKVGCIVSQVLFYEQVRVLKKSPEWPEIFKSTVSDGCNASLQGDT  126

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKP  217
            SQ ++ E SSDDDGLPPLEAN NR+KP
Sbjct  127  SQQEENE-SSDDDGLPPLEANMNRMKP  152



>ref|XP_010086856.1| putative RNA-binding protein EIF1AD [Morus notabilis]
 gb|EXB24280.1| putative RNA-binding protein EIF1AD [Morus notabilis]
Length=168

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 130/149 (87%), Gaps = 2/149 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E++  L++G +IMQV+ LRGSN+IEV+DA G+KSLA+FPAKFQKSMWIKRG+F
Sbjct  7    NLKRATEEESLTLEEGHNIMQVLSLRGSNLIEVMDAQGKKSLALFPAKFQKSMWIKRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVD+SG+E+AIESG KV CIV++VLFY+Q+R  QKSPEWPE+FKS V++ S  ++ER T
Sbjct  67   VVVDDSGKEKAIESGSKVTCIVSKVLFYEQLRALQKSPEWPEVFKSTVLDDSNGSMERET  126

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
            SQ +   +SSD+DGLPPLEANTNR++P++
Sbjct  127  SQQEG--ESSDNDGLPPLEANTNRIRPYE  153



>ref|NP_001237534.1| uncharacterized protein LOC100306612 [Glycine max]
 ref|XP_006580933.1| PREDICTED: uncharacterized protein LOC100306612 isoform X1 [Glycine 
max]
 ref|XP_006580934.1| PREDICTED: uncharacterized protein LOC100306612 isoform X2 [Glycine 
max]
 ref|XP_006580935.1| PREDICTED: uncharacterized protein LOC100306612 isoform X3 [Glycine 
max]
 gb|ACU14877.1| unknown [Glycine max]
Length=171

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 120/147 (82%), Gaps = 3/147 (2%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +EK   LQ GQ IMQVV LRG+NIIEV+DA+G K LA+FPAK QKSMWIKRG+F
Sbjct  9    NLKRATEEKHITLQDGQGIMQVVSLRGANIIEVMDASGNKLLALFPAKIQKSMWIKRGSF  68

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDESG+E+A+ESG KV C+V+QVLF  QVRE +KSPEWPE FKSA+V+ S   +E  T
Sbjct  69   VVVDESGKEKALESGSKVACLVSQVLFSKQVRELEKSPEWPESFKSAMVDDS---IESTT  125

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKP  217
            SQ +   + SDDDGLPPLEANTNR++P
Sbjct  126  SQQEHELEGSDDDGLPPLEANTNRIRP  152



>ref|XP_008456911.1| PREDICTED: probable RNA-binding protein EIF1AD [Cucumis melo]
 ref|XP_008456912.1| PREDICTED: probable RNA-binding protein EIF1AD [Cucumis melo]
Length=169

 Score =   204 bits (519),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 121/149 (81%), Gaps = 1/149 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NL+RA +   A L+ G SIM VV +RGSN+IEV+DA G KSLA+FPAKFQKSMWIKRG+F
Sbjct  7    NLQRASEHHIASLEDGHSIMLVVSIRGSNLIEVMDAQGGKSLALFPAKFQKSMWIKRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDESG++ A+ESG KV CIV++VL+++QVRE QKSP WPEIFK+A+V    ENL    
Sbjct  67   VVVDESGKKNALESGSKVACIVSRVLYFEQVRELQKSPGWPEIFKNAIVGDRNENLRAQN  126

Query  297  SQTQDIE-DSSDDDGLPPLEANTNRLKPF  214
            +Q+++ E +SSDDDGLPPLEANTNR KP 
Sbjct  127  NQSEEDEVNSSDDDGLPPLEANTNRAKPL  155



>gb|KHN25797.1| Putative RNA-binding protein EIF1AD [Glycine soja]
Length=171

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 119/147 (81%), Gaps = 3/147 (2%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +EK   LQ GQ IMQVV LRG+NIIEV+DA+G K LA+FPAK QKSMWIKRG+F
Sbjct  9    NLKRATEEKHITLQDGQGIMQVVSLRGANIIEVMDASGNKLLALFPAKIQKSMWIKRGSF  68

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDESG+E+A+ESG KV C+V+QVLF  QVRE +KSP WPE FKSA+V+ S   +E  T
Sbjct  69   VVVDESGKEKALESGSKVACLVSQVLFSKQVRELEKSPAWPESFKSAMVDDS---IESTT  125

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKP  217
            SQ +   + SDDDGLPPLEANTNR++P
Sbjct  126  SQQEHELEGSDDDGLPPLEANTNRIRP  152



>ref|XP_010100677.1| Protein UXT-like protein [Morus notabilis]
 gb|EXB83839.1| Protein UXT-like protein [Morus notabilis]
Length=339

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 131/149 (88%), Gaps = 2/149 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E++  L++G +IMQV+ LRGSN+IEV+DA G+KSLA+FPAKFQKSMWIKRG+F
Sbjct  178  NLKRATEEESLTLEEGYNIMQVLSLRGSNLIEVMDAQGKKSLALFPAKFQKSMWIKRGSF  237

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVD+SG+E+A+ESG KV CIV++VLFY+Q+R  QKSPEWPE+FKS V++ S  ++ER T
Sbjct  238  VVVDDSGKEKALESGSKVTCIVSKVLFYEQLRVLQKSPEWPEVFKSTVLDDSNGSMERET  297

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
            SQ +D  +SSD+DGLPPLEANTNR++P++
Sbjct  298  SQQED--ESSDNDGLPPLEANTNRIRPYE  324



>ref|XP_006371308.1| hypothetical protein POPTR_0019s08940g [Populus trichocarpa]
 gb|ERP49105.1| hypothetical protein POPTR_0019s08940g [Populus trichocarpa]
Length=174

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = -2

Query  657  NLKRAG--KEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRG  484
            N+KRA   +E    L+ GQSIMQVV LRGSN+IEV+DA G KSLA+FPAKFQKSMWIKRG
Sbjct  7    NMKRAAVAEEHNLSLEGGQSIMQVVSLRGSNLIEVMDARGGKSLALFPAKFQKSMWIKRG  66

Query  483  NFVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLER  304
            +FVVVDESG+E+A+ESG KV CIV+QVLFY+ VR  Q+SPEWPEIFKS  ++ S  +L  
Sbjct  67   SFVVVDESGKEKALESGSKVACIVSQVLFYEHVRVLQRSPEWPEIFKSTALDDSSGSLNI  126

Query  303  HTSQTQDIE-DSSDDDGLPPLEANTNRLKP  217
               Q ++ E +SSDDDGLPPLEAN NR+KP
Sbjct  127  TNGQLEENELESSDDDGLPPLEANMNRIKP  156



>ref|XP_008359826.1| PREDICTED: probable RNA-binding protein EIF1AD [Malus domestica]
Length=169

 Score =   199 bits (506),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 121/149 (81%), Gaps = 2/149 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA ++++  L+ G S+MQV+ LRGSN+IEV+DA GEKSLA+FPAKF KSMWIKR ++
Sbjct  7    NLKRAVEQQSFTLEDGHSVMQVLSLRGSNLIEVMDAKGEKSLALFPAKFSKSMWIKRRSY  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVD SG+E+ +ESG KV CIV+QVLFY+QVR  +KSP+WPE+FKS V +    +L+  T
Sbjct  67   VVVDASGKEKVLESGSKVACIVSQVLFYEQVRVLKKSPDWPELFKSEVSDGCDGSLQGDT  126

Query  297  SQTQDIE--DSSDDDGLPPLEANTNRLKP  217
            SQ +D E  DSSDDDGLPPLEANTNR KP
Sbjct  127  SQKEDNELNDSSDDDGLPPLEANTNRNKP  155



>ref|XP_010931384.1| PREDICTED: probable RNA-binding protein EIF1AD [Elaeis guineensis]
Length=174

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NL+RA +E+   LQ+GQSIMQVV LRGSN+IEV+DA G K LA+FPAKFQ+S WIK+GNF
Sbjct  11   NLRRATEEEGLSLQEGQSIMQVVSLRGSNVIEVMDAKGVKYLALFPAKFQRSFWIKKGNF  70

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDESGRE+A+ESG K+ C+V++VLF+DQVR+ +KSPEWP IF++ V + SK  ++R T
Sbjct  71   VVVDESGREKALESGSKIVCMVSRVLFHDQVRKLEKSPEWPAIFRTIVADDSKSLVQRPT  130

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
            S  ++  +S D+DGLPPLEAN NR +P +
Sbjct  131  SGGEEGSNSDDEDGLPPLEANLNRNRPVE  159



>ref|XP_010999652.1| PREDICTED: probable RNA-binding protein EIF1AD [Populus euphratica]
Length=174

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 119/150 (79%), Gaps = 3/150 (2%)
 Frame = -2

Query  657  NLKRAG--KEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRG  484
            N+KRA   +E    L+ GQSIMQVV LRGSN+IEV+DA G KSLA+FPAKFQKSMWIK+G
Sbjct  7    NMKRAAVAEEHNLSLEDGQSIMQVVSLRGSNLIEVMDARGGKSLALFPAKFQKSMWIKKG  66

Query  483  NFVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLER  304
            +FVVVDESG+E+A+ESG KV CIV+QVLFY+ VR  Q+SPEWPEIFKS   + S  +L  
Sbjct  67   SFVVVDESGKEKALESGSKVACIVSQVLFYEHVRVLQRSPEWPEIFKSTAPDDSSGSLNI  126

Query  303  HTSQTQDIE-DSSDDDGLPPLEANTNRLKP  217
               Q ++ E +SSDDDGLPPLEAN NR+KP
Sbjct  127  TNGQLEENELESSDDDGLPPLEANMNRIKP  156



>ref|XP_008788115.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X1 [Phoenix 
dactylifera]
Length=174

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NL+RA +E+   LQ+GQSIMQVV LRGSN+IEV+DA   KSLA+FPAKFQ+S WIK+GNF
Sbjct  11   NLRRASQEEGLSLQEGQSIMQVVSLRGSNVIEVMDAKAVKSLALFPAKFQRSFWIKKGNF  70

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDESGRE+A+ESG K+ C+V++VLF+DQVR+ +KSPEWP IF++ +V+ SK +++R T
Sbjct  71   VVVDESGREKALESGSKIVCMVSRVLFHDQVRKLEKSPEWPAIFRTTMVDDSKSHVQRPT  130

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
            S  ++  +S  DD LPPLEAN NR +P +
Sbjct  131  SGGEEGSNSDVDDSLPPLEANLNRNRPVE  159



>ref|XP_002276446.2| PREDICTED: probable RNA-binding protein EIF1AD [Vitis vinifera]
 ref|XP_010662881.1| PREDICTED: probable RNA-binding protein EIF1AD [Vitis vinifera]
 ref|XP_010662882.1| PREDICTED: probable RNA-binding protein EIF1AD [Vitis vinifera]
 ref|XP_010662883.1| PREDICTED: probable RNA-binding protein EIF1AD [Vitis vinifera]
 ref|XP_010662884.1| PREDICTED: probable RNA-binding protein EIF1AD [Vitis vinifera]
 ref|XP_010662885.1| PREDICTED: probable RNA-binding protein EIF1AD [Vitis vinifera]
 ref|XP_010662886.1| PREDICTED: probable RNA-binding protein EIF1AD [Vitis vinifera]
 ref|XP_010662887.1| PREDICTED: probable RNA-binding protein EIF1AD [Vitis vinifera]
 ref|XP_010662888.1| PREDICTED: probable RNA-binding protein EIF1AD [Vitis vinifera]
 ref|XP_010662889.1| PREDICTED: probable RNA-binding protein EIF1AD [Vitis vinifera]
 ref|XP_010662890.1| PREDICTED: probable RNA-binding protein EIF1AD [Vitis vinifera]
 ref|XP_010662891.1| PREDICTED: probable RNA-binding protein EIF1AD [Vitis vinifera]
 ref|XP_010662892.1| PREDICTED: probable RNA-binding protein EIF1AD [Vitis vinifera]
 ref|XP_010662893.1| PREDICTED: probable RNA-binding protein EIF1AD [Vitis vinifera]
 ref|XP_010662894.1| PREDICTED: probable RNA-binding protein EIF1AD [Vitis vinifera]
Length=192

 Score =   196 bits (499),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 124/173 (72%), Gaps = 24/173 (14%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E+T  LQ+GQSIMQVV LRG+N+IEV+DA GE SLA+FPAKFQKSMWIK+G+F
Sbjct  7    NLKRAAEEQTLTLQEGQSIMQVVSLRGTNLIEVMDARGENSLALFPAKFQKSMWIKKGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSK-ENLERH  301
            VVVDESGRE+A+ESG KV CIV+QVLFY+QVR  QKS EWPEIFKS ++  S   +L  +
Sbjct  67   VVVDESGREKAMESGSKVACIVSQVLFYEQVRVLQKSIEWPEIFKSTLLHDSNGTSLHSN  126

Query  300  TSQTQDIEDSSDDD-----------------------GLPPLEANTNRLKPFQ  211
            TSQ ++ + ++  D                       GLPPLEAN NR++P +
Sbjct  127  TSQQEEFKSTARHDSNGNLHCSTSQQEEDESSSSDDDGLPPLEANMNRIRPLE  179



>gb|KDP21631.1| hypothetical protein JCGZ_03302 [Jatropha curcas]
Length=171

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E    L+ G+SI QVV LRGSN+IEV+DA GEKSLA+FPAKFQKSMWIKRG+F
Sbjct  7    NLKRAAEEHNLTLEDGKSIAQVVSLRGSNVIEVMDARGEKSLALFPAKFQKSMWIKRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDESG+++A+ESG KV CIV+QVLFY+QVR  +KS EWPEIFKS   + S  +L + T
Sbjct  67   VVVDESGKQKALESGSKVACIVSQVLFYEQVRALRKSLEWPEIFKSTTSDDSNGSLHKST  126

Query  297  S-QTQDIEDSSDDDGLPPLEANTNRLKP  217
            S Q  D  DSSDDDGLPPLEAN NR+KP
Sbjct  127  SQQEDDEFDSSDDDGLPPLEANMNRIKP  154



>ref|XP_004512897.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Cicer arietinum]
Length=180

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 124/151 (82%), Gaps = 3/151 (2%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +EK   LQ GQSIMQVV LRGSN+IEV+DA+GEKSLA+FPAKFQKSMWIK+G+F
Sbjct  7    NLKRATEEKHVTLQDGQSIMQVVSLRGSNLIEVMDAHGEKSLALFPAKFQKSMWIKQGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVE--TSKENLER  304
            +VVDESG+++A+ESG KV C+V+QVLFY+QVR  QKSPEWPEIFK  + E  TS++  E 
Sbjct  67   IVVDESGKKKALESGSKVACLVSQVLFYEQVRALQKSPEWPEIFKHDLNERITSQQENEI  126

Query  303  HTSQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
              S   + ++  DDDGLPPLEANTNR++P +
Sbjct  127  VASDDDE-DEDDDDDGLPPLEANTNRIRPVE  156



>gb|KEH35526.1| nucleic acid-binding, OB-fold-like protein [Medicago truncatula]
Length=426

 Score =   199 bits (505),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 124/186 (67%), Gaps = 37/186 (20%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +EK   LQ GQ IM+VV LRGSN+IE++DA G+KSLAIFPAKFQKSMWIKRGNF
Sbjct  216  NLKRATEEKHVTLQHGQCIMRVVSLRGSNLIEIMDARGDKSLAIFPAKFQKSMWIKRGNF  275

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKS--AVVETSKENLE-  307
            VVVDESG++EA+ESG KVGCIV QVL Y+QVR  QKSPEWPEIFK    V+ T ++  E 
Sbjct  276  VVVDESGKKEALESGSKVGCIVVQVLVYEQVRALQKSPEWPEIFKQDLKVIATEQQETET  335

Query  306  ---------------------------RHTS-------QTQDIEDSSDDDGLPPLEANTN  229
                                       +H S       Q  + + S DDDGLPPLEANTN
Sbjct  336  DIRDDDELPAMEDNTNKIQPFEPPEIFKHDSNERATVQQENETDTSDDDDGLPPLEANTN  395

Query  228  RLKPFQ  211
            R++PF+
Sbjct  396  RIQPFE  401



>ref|XP_009362776.1| PREDICTED: probable RNA-binding protein EIF1AD [Pyrus x bretschneideri]
Length=169

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 122/149 (82%), Gaps = 2/149 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA ++++  L+ G S+MQV+ LRGSN+IEV+DA GEKSLA+FPAKF KSMWIKRG++
Sbjct  7    NLKRAVEQQSFTLEDGHSVMQVLSLRGSNLIEVMDAKGEKSLALFPAKFSKSMWIKRGSY  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVD SG+E+ +ESG KV CIV+QVLFY+QVR  +KSP+WPE+FKS V +    NL+  T
Sbjct  67   VVVDASGKEKVLESGSKVACIVSQVLFYEQVRVLKKSPDWPELFKSEVSDGCDGNLQGDT  126

Query  297  SQTQDIE--DSSDDDGLPPLEANTNRLKP  217
            SQ +D E  DSSDDDGLPPLEANTNR KP
Sbjct  127  SQKEDNELDDSSDDDGLPPLEANTNRNKP  155



>ref|XP_008366807.1| PREDICTED: probable RNA-binding protein EIF1AD [Malus domestica]
Length=169

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 122/149 (82%), Gaps = 2/149 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA ++++  L+ G S+MQV+ LRGSN+IEV+DA GEKSLA+FPAKF KSMWIKRG++
Sbjct  7    NLKRAVEQQSFTLEDGHSVMQVLSLRGSNLIEVMDAKGEKSLALFPAKFSKSMWIKRGSY  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVD SG+E+ +ESG KV CIV+QVLFY+QVR  +KSP+WPE+FKS V +    +L+  T
Sbjct  67   VVVDASGKEKVLESGSKVACIVSQVLFYEQVRVLKKSPDWPELFKSEVSDGCDGSLQGDT  126

Query  297  SQTQDIE--DSSDDDGLPPLEANTNRLKP  217
            SQ +D E  DSSDDDGLPPLEANTNR KP
Sbjct  127  SQKEDNELDDSSDDDGLPPLEANTNRNKP  155



>gb|EYU35193.1| hypothetical protein MIMGU_mgv1a015058mg [Erythranthe guttata]
Length=169

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 121/149 (81%), Gaps = 1/149 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA + + A LQQGQSIMQVV+LRGSN IEV+D+ G+K +A+FPAKF KSMWIK+GNF
Sbjct  7    NLKRAVESEMATLQQGQSIMQVVELRGSNHIEVMDSKGDKFIALFPAKFHKSMWIKKGNF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDESGREEA ESGRKV   V QVL+++Q+R  QKS EWPEIFKS   E  KE LE  T
Sbjct  67   VVVDESGREEAEESGRKVAGFVRQVLYHEQIRLLQKSLEWPEIFKSISQENPKEALECCT  126

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
            SQ +D EDSSDDDGLPPLEANTNR+ P +
Sbjct  127  SQ-KDDEDSSDDDGLPPLEANTNRVNPLK  154



>ref|XP_006856122.1| hypothetical protein AMTR_s00059p00149620 [Amborella trichopoda]
 gb|ERN17589.1| hypothetical protein AMTR_s00059p00149620 [Amborella trichopoda]
Length=165

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 111/146 (76%), Gaps = 2/146 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA  EK   LQ GQ IMQVV LRGSN+IEV+D +G KSL IFPAKFQKS+WIKRGNF
Sbjct  7    NLKRAAIEKHVSLQDGQRIMQVVSLRGSNLIEVMDDSGRKSLGIFPAKFQKSIWIKRGNF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVD SG E+A+ESG K+ C+++QVLF++QVR  QKSP+WPEIF++     +K+     T
Sbjct  67   VVVDGSGSEKALESGNKITCMISQVLFHEQVRTLQKSPDWPEIFRTTASVEAKDT--ETT  124

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLK  220
            ++  +    S DDGLPPLEAN NR++
Sbjct  125  NEQMEEAHCSSDDGLPPLEANLNRVR  150



>ref|XP_006842528.1| hypothetical protein AMTR_s00077p00119490 [Amborella trichopoda]
 gb|ERN04203.1| hypothetical protein AMTR_s00077p00119490 [Amborella trichopoda]
Length=164

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 113/147 (77%), Gaps = 2/147 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA  E+   LQ G  IMQVV LRGSN+IEV+D +G KSLAIFPAKFQKS+WIKRGNF
Sbjct  7    NLKRAVMEEHVSLQDGLRIMQVVSLRGSNLIEVMDDSGSKSLAIFPAKFQKSIWIKRGNF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVV+ SG E+A+ESG K+ C+++QVLF++QVR  QKS +WPEIF++     +K+  E+  
Sbjct  67   VVVEGSGSEKALESGNKITCMISQVLFHEQVRTLQKSSDWPEIFRTTASVEAKDT-EKTN  125

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKP  217
             Q ++   SS DDGLPPLEAN NR++P
Sbjct  126  EQVEETHCSS-DDGLPPLEANLNRVRP  151



>ref|XP_009384761.1| PREDICTED: probable RNA-binding protein EIF1AD [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384762.1| PREDICTED: probable RNA-binding protein EIF1AD [Musa acuminata 
subsp. malaccensis]
Length=166

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 114/149 (77%), Gaps = 3/149 (2%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            N++RA KE    L++GQ IM+VV LRGSN+IEV+DA G KSLA+FPAKFQKS WIK G+F
Sbjct  8    NIRRASKEDGISLREGQGIMKVVSLRGSNVIEVMDAKGVKSLALFPAKFQKSFWIKTGSF  67

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVDESGRE+A+ESG K+ C+V+QVLF+DQVR  +KS +WP IF++A   T  ++ +   
Sbjct  68   VVVDESGREKALESGSKIACMVSQVLFHDQVRALEKSLDWPAIFRTA---TPDDSHQESK  124

Query  297  SQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
            SQ ++   S  +DGLPP+EAN NR +P +
Sbjct  125  SQCKEETGSDSEDGLPPIEANLNRNRPIE  153



>ref|XP_003558986.1| PREDICTED: probable RNA-binding protein EIF1AD [Brachypodium 
distachyon]
Length=164

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 113/151 (75%), Gaps = 6/151 (4%)
 Frame = -2

Query  657  NLKRAGKEKTAI-LQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGN  481
            NL+RA +E  A+ L  G+SIMQVV LRGSN+IEVLD+ G KSLA+FPAKFQKS WIK GN
Sbjct  7    NLRRACQEGAAVTLADGESIMQVVTLRGSNLIEVLDSKGVKSLALFPAKFQKSFWIKNGN  66

Query  480  FVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERH  301
            FVVVD SGR+EA+ESG K+ C+V++VLF+DQVR  +KS EWP IFKS    TS       
Sbjct  67   FVVVDASGRDEALESGSKIACVVSRVLFHDQVRALEKSGEWPAIFKS----TSNAWATGT  122

Query  300  TSQT-QDIEDSSDDDGLPPLEANTNRLKPFQ  211
            TS+  +++    DDD LPPLEANTNR +P +
Sbjct  123  TSKVEEELNSEEDDDDLPPLEANTNRNRPVE  153



>ref|XP_004297940.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Fragaria 
vesca subsp. vesca]
Length=177

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 118/152 (78%), Gaps = 5/152 (3%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E++  L  G SIMQV+ LRGSN+IEV+DA GEK LA+FPAKF KSMWIK+G F
Sbjct  7    NLKRAVEEQSLTLSDGHSIMQVLSLRGSNLIEVMDAKGEKYLALFPAKFSKSMWIKQGFF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVD S +++ IESG KV CIV+QVLF++QVR  +KSPEWPEIFKS V E    +L+ HT
Sbjct  67   VVVDASEKDKVIESGGKVACIVSQVLFFEQVRALRKSPEWPEIFKSTVSEEPCGSLKGHT  126

Query  297  SQTQD-----IEDSSDDDGLPPLEANTNRLKP  217
            S+ +       +DSSDDDGLPPLEAN NR++P
Sbjct  127  SKQEGNANDNEDDSSDDDGLPPLEANMNRMRP  158



>ref|XP_002879891.1| RNA binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56150.1| RNA binding protein [Arabidopsis lyrata subsp. lyrata]
Length=171

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 113/150 (75%), Gaps = 3/150 (2%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLK+A  E+   L++ QSI QVV LRGSN IE++DA GE SLA+FPAKF++SMWI+RG+F
Sbjct  7    NLKQAASEQDFTLEECQSIAQVVSLRGSNQIEIMDAKGENSLALFPAKFRESMWIRRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSA--VVETSKENLER  304
            VV+D +G+E+A ESG KV  IV +VLF++QVR  QKSPEWPEIFK    +       +E+
Sbjct  67   VVIDHTGKEKAQESGSKVTSIVCKVLFFEQVRLLQKSPEWPEIFKDTKPIPADKSSPIEQ  126

Query  303  HTSQTQDIEDSSDDDGLPPLEANTNRLKPF  214
            H    + I+ S DDDG+PPLEANTNRL+PF
Sbjct  127  HEDDGE-IDSSDDDDGMPPLEANTNRLRPF  155



>ref|XP_010508809.1| PREDICTED: probable RNA-binding protein EIF1AD [Camelina sativa]
Length=173

 Score =   178 bits (451),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 113/151 (75%), Gaps = 3/151 (2%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLK+A  E+   L++ QSI QVV LRGSN IE++DA GE SLA+FPAKF++SMWI+RG+F
Sbjct  7    NLKQAASEQDFTLEECQSIAQVVSLRGSNQIEIMDAKGENSLALFPAKFRESMWIRRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VV+D +G+E+A ESG KV  IV +VLF++QVR  QKSPEWPEIFK      + E+     
Sbjct  67   VVIDHTGKEKAQESGSKVTSIVCKVLFFEQVRLLQKSPEWPEIFKDTKPIPADESSHIPI  126

Query  297  SQTQD---IEDSSDDDGLPPLEANTNRLKPF  214
             Q +D   ++ S DDDG+PPLEANTNRL+PF
Sbjct  127  PQQEDDGEVDSSDDDDGMPPLEANTNRLRPF  157



>emb|CBI23031.3| unnamed protein product [Vitis vinifera]
Length=144

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E+T  LQ+GQSIMQVV LRG+N+IEV+DA GE SLA+FPAKFQKSMWIK+G+F
Sbjct  7    NLKRAAEEQTLTLQEGQSIMQVVSLRGTNLIEVMDARGENSLALFPAKFQKSMWIKKGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETS  322
            VVVDESGRE+A+ESG KV CIV+QVLFY+QVR  QKS EWPEIFKS ++  S
Sbjct  67   VVVDESGREKAMESGSKVACIVSQVLFYEQVRVLQKSIEWPEIFKSTLLHDS  118



>emb|CDY14742.1| BnaC04g47390D [Brassica napus]
 emb|CDY06963.1| BnaA04g23520D [Brassica napus]
Length=171

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 114/149 (77%), Gaps = 1/149 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLK+A  E+   L++ QSI QVV LRGSN IE++DA GE SLA+FPAKF++SMWI+RG+F
Sbjct  7    NLKQAASEQDFTLEECQSIAQVVSLRGSNQIEIMDAKGENSLALFPAKFRESMWIRRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VV+D +G+E+A ESG KV  IV +VLF++Q+R  QKSPEWPEIF+ A    + E+ +   
Sbjct  67   VVIDHTGKEKAQESGSKVTSIVCKVLFFEQIRLLQKSPEWPEIFRDAKPVPADESSQIPI  126

Query  297  SQTQDIEDSSD-DDGLPPLEANTNRLKPF  214
             Q  DI+ S + DDG+PPLEANTNRL+PF
Sbjct  127  PQDDDIDLSDESDDGMPPLEANTNRLRPF  155



>ref|XP_004307742.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Fragaria 
vesca subsp. vesca]
Length=177

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 118/152 (78%), Gaps = 5/152 (3%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLKRA +E++  L  G SIMQVV LRGSN+IEV+DA GEK LA+FPAKF KSMWIK+G+F
Sbjct  7    NLKRAVEEQSLTLSDGHSIMQVVSLRGSNLIEVMDAKGEKYLALFPAKFSKSMWIKQGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVD S +++ IESG KV CIV+QVLF++QVR  +KSPEWPEIFKS V E    +L+  T
Sbjct  67   VVVDASEKDKVIESGGKVACIVSQVLFFEQVRALRKSPEWPEIFKSTVSEEPCGSLKGPT  126

Query  297  SQTQD-----IEDSSDDDGLPPLEANTNRLKP  217
            ++ +       +DSSDDDGLPPLEAN NR++P
Sbjct  127  TKQEGNENDNEDDSSDDDGLPPLEANMNRMRP  158



>ref|XP_009141937.1| PREDICTED: probable RNA-binding protein EIF1AD [Brassica rapa]
Length=171

 Score =   175 bits (444),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 114/149 (77%), Gaps = 1/149 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLK+A  E+   L++ QSI QVV LRGSN IE++DA GE SLA+FPAKF++SMWI+RG+F
Sbjct  7    NLKQAASEQDFTLEECQSIAQVVSLRGSNQIEIMDAKGENSLALFPAKFRESMWIRRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VV+D +G+E+A ESG KV  IV +VLF++Q+R  QKSPEWPEI++ A    + E+ +   
Sbjct  67   VVIDHTGKEKAQESGSKVTSIVCKVLFFEQIRLLQKSPEWPEIYRDAKPVPADESSQIPI  126

Query  297  SQTQDIEDSSD-DDGLPPLEANTNRLKPF  214
             Q  DI+ S + DDG+PPLEANTNRL+PF
Sbjct  127  PQDDDIDLSDESDDGMPPLEANTNRLRPF  155



>ref|NP_181610.1| Nucleic acid-binding, OB-fold-like protein [Arabidopsis thaliana]
 gb|AEC09877.1| Nucleic acid-binding, OB-fold-like protein [Arabidopsis thaliana]
Length=171

 Score =   175 bits (443),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 113/150 (75%), Gaps = 3/150 (2%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLK+A  ++   L++ QSI QVV LRGSN IE++DA GE SLA+FPAKF++SMWI+RG+F
Sbjct  7    NLKQAASDQDFTLEECQSIAQVVSLRGSNQIEIMDAKGENSLALFPAKFRESMWIRRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSA--VVETSKENLER  304
            VV+D +G+E+A ESG KV  IV +VLF++QVR  QKSPEWPEIFK    +       +E+
Sbjct  67   VVIDHTGKEKAQESGSKVTSIVCKVLFFEQVRLLQKSPEWPEIFKDTRPIPAEKSSPIEQ  126

Query  303  HTSQTQDIEDSSDDDGLPPLEANTNRLKPF  214
            H    + ++ S DDDG+PPL+ANTNRL+PF
Sbjct  127  HEDDGE-VDSSDDDDGMPPLQANTNRLRPF  155



>ref|XP_004986009.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Setaria 
italica]
Length=167

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAI-LQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGN  481
            NL+RA  E  A+ L +G+SIMQV+ LRGSN+IEV+D  G KSLA+FPAKFQ+S WIK G+
Sbjct  7    NLRRACDEGAAVTLAEGESIMQVLTLRGSNVIEVMDGEGVKSLALFPAKFQRSFWIKSGS  66

Query  480  FVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERH  301
            FVVVD SGR++A+ESG K+ C+V+QVLF++QVR  QKS  WP IFKS   E S+   +  
Sbjct  67   FVVVDASGRDQALESGSKIACVVSQVLFHEQVRALQKSGNWPAIFKSTANEGSQAGTQVQ  126

Query  300  TSQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
            T+Q  + +DS +DD LPPLEANTNR + ++
Sbjct  127  TTQVDEEQDSDEDDDLPPLEANTNRNRLYE  156



>gb|EYU30448.1| hypothetical protein MIMGU_mgv1a021159mg [Erythranthe guttata]
Length=152

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = -2

Query  627  AILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREE  448
            A L+QGQ+I+QVV+LRGSN+ EV+D+ GEK +A FPAKF KSMWIK+GNFVVVDESGREE
Sbjct  2    ATLEQGQTIVQVVELRGSNLTEVMDSKGEKFIACFPAKFHKSMWIKQGNFVVVDESGREE  61

Query  447  AIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLE-RHTSQTQDIEDS  271
            A ESGRKV   V QVL++DQ+R  +KS EWPEIFKS   E  K+ LE   T +  D + S
Sbjct  62   AEESGRKVAGFVRQVLYHDQIRLLRKSLEWPEIFKSTSHENPKQALECCSTCRKDDQDSS  121

Query  270  SDDDGLPPLEANTNRLKPFQ  211
            SDDDG+PPLEANTNR+ P  
Sbjct  122  SDDDGMPPLEANTNRVNPLH  141



>ref|NP_001048742.1| Os03g0114200 [Oryza sativa Japonica Group]
 gb|AAO17021.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF93629.1| LOC496359 protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10656.1| Os03g0114200 [Oryza sativa Japonica Group]
 gb|EAY88265.1| hypothetical protein OsI_09718 [Oryza sativa Indica Group]
 dbj|BAG98203.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58204.1| hypothetical protein OsJ_09157 [Oryza sativa Japonica Group]
Length=167

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NL+RA  E    L +G+SIMQV+ LRGSN+IEV+DA G KSLA+FPAKFQKS WIK GNF
Sbjct  7    NLRRACSEGAVTLGEGESIMQVLALRGSNVIEVMDAKGVKSLALFPAKFQKSFWIKNGNF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVD SGR++A+ESG K+ C+V+QVLF+DQVR  +KS EWP IFKS   E S+   +  T
Sbjct  67   VVVDASGRDQALESGSKIACVVSQVLFHDQVRAMEKSEEWPAIFKSTSKEGSEAGTQEGT  126

Query  297  S-QTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
              Q ++  DS +DD LPPLEANTNR +PF+
Sbjct  127  RPQIEEEPDSDEDDDLPPLEANTNRQRPFE  156



>dbj|BAK04858.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=168

 Score =   167 bits (424),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 111/151 (74%), Gaps = 4/151 (3%)
 Frame = -2

Query  657  NLKRAGKEKTAI-LQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGN  481
            NL+RA +E TA+ L +G+SIMQVV LRGSN+IEV D  G KSLA+FPAKFQKS WIK GN
Sbjct  7    NLRRACQEGTAVTLAEGESIMQVVTLRGSNLIEVTDGEGVKSLALFPAKFQKSFWIKNGN  66

Query  480  FVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERH  301
            FVVVD SGR+EA+ESG K+ C+V++VLF+DQVR  +KS EWP IFKS          E  
Sbjct  67   FVVVDASGRDEALESGSKIACVVSRVLFHDQVRALEKSGEWPAIFKS-TPNGWATGPEGT  125

Query  300  TSQT--QDIEDSSDDDGLPPLEANTNRLKPF  214
            TSQ   +   D  +DD +PPLEANTNR +PF
Sbjct  126  TSQVEEEQNSDEDEDDDMPPLEANTNRNRPF  156



>ref|XP_010532381.1| PREDICTED: probable RNA-binding protein EIF1AD [Tarenaya hassleriana]
 ref|XP_010532382.1| PREDICTED: probable RNA-binding protein EIF1AD [Tarenaya hassleriana]
Length=134

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 97/118 (82%), Gaps = 3/118 (3%)
 Frame = -2

Query  558  LDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGRKVGCIVTQVLFYDQVRE  379
            +D  GEKSLA+FPAKFQKSMWIKRG+FVVVD++G+E+A+ESG KV CIV +VLFY+QVR 
Sbjct  1    MDVKGEKSLALFPAKFQKSMWIKRGSFVVVDQTGKEKALESGSKVACIVCRVLFYEQVRA  60

Query  378  YQKSPEWPEIFKSAVVETSKENLERHTSQTQ---DIEDSSDDDGLPPLEANTNRLKPF  214
             +KSPEWPEIF+    + + EN +R T++ +   +I+ S DDDGLPPLEANTNR+KPF
Sbjct  61   LRKSPEWPEIFRETKSKEADENSQRQTTEQEENGEIDTSDDDDGLPPLEANTNRMKPF  118



>ref|XP_002879695.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55954.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=172

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLK+A  E+   L++ QSI QVV LRGSN IE++DA GE SLA+FPAKF++SMWI+RG+F
Sbjct  7    NLKQAASEQDFTLEECQSIAQVVSLRGSNQIEIMDAKGENSLALFPAKFRESMWIRRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSA--VVETSKENLER  304
            VV+D +G+E+A ESG KV  IV +VLF++QVR  QKSPEWPEIFK    +       +E+
Sbjct  67   VVIDHTGKEKAQESGSKVTSIVCKVLFFEQVRLLQKSPEWPEIFKDTKPIPADKSSPIEQ  126

Query  303  HTSQTQDIEDSSDDDGLPPLEANTNRLKPF  214
            H    +      DDDG+PPLEANTNRL+PF
Sbjct  127  HEDDGEIDSSDDDDDGMPPLEANTNRLRPF  156



>ref|XP_004951619.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Setaria 
italica]
Length=167

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAI-LQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGN  481
            NL+RA  E  A+ L +G+SIMQV+ LRGSN+IEV+D  G KSLA+FPAKFQKS WIK G+
Sbjct  7    NLRRACDEGAAVTLAEGESIMQVLTLRGSNVIEVMDGEGVKSLALFPAKFQKSFWIKSGS  66

Query  480  FVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERH  301
            FVVVD SGRE+A+ESG K+ C+V+QVLF++QVR  QKS  WP IFKS   E S+   +  
Sbjct  67   FVVVDASGREQALESGSKIACVVSQVLFHEQVRALQKSGNWPVIFKSTPNEGSETGTQAQ  126

Query  300  TSQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
            T+Q  +  DS +DD LPPLEANTNR +P++
Sbjct  127  TAQIDEEPDSDEDDDLPPLEANTNRNRPYE  156



>gb|EMT10805.1| Putative RNA-binding protein EIF1AD [Aegilops tauschii]
Length=168

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 111/151 (74%), Gaps = 4/151 (3%)
 Frame = -2

Query  657  NLKRAGKEKTAI-LQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGN  481
            NL+RA +E TA+ L +G+SIMQVV LRGSN+IEV D  G KSLA+FPAKFQKS WIK GN
Sbjct  7    NLRRACEEGTAVTLAEGESIMQVVTLRGSNLIEVTDGEGVKSLALFPAKFQKSFWIKNGN  66

Query  480  FVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERH  301
            FVVVD SGR+EA+ESG K+ C+V++VLF+DQVR  +KS +WP IFKS          +  
Sbjct  67   FVVVDASGRDEALESGSKIACVVSRVLFHDQVRALEKSGQWPAIFKS-TPNGWATGPQGT  125

Query  300  TSQT--QDIEDSSDDDGLPPLEANTNRLKPF  214
            TSQ   +   D  DDD +PPLEANTNR +PF
Sbjct  126  TSQAEEEQNSDEDDDDDMPPLEANTNRNRPF  156



>ref|XP_006411345.1| hypothetical protein EUTSA_v10017311mg [Eutrema salsugineum]
 gb|ESQ52798.1| hypothetical protein EUTSA_v10017311mg [Eutrema salsugineum]
Length=176

 Score =   165 bits (417),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 115/154 (75%), Gaps = 6/154 (4%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLK+A  E+   L++ QSI QVV LRGSN IE++DA GE SLA+FPAKF++SMWI+RG+F
Sbjct  7    NLKQAASEQEFTLEECQSIAQVVSLRGSNQIEIMDAKGENSLALFPAKFRESMWIRRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VV+D +G+E+A ESG K+  IV +VLF++QVR  QKSPEWPE+FK+     + E+ +   
Sbjct  67   VVIDHTGKEKAQESGSKITSIVCKVLFFEQVRLLQKSPEWPEVFKNTKPIPADESSQIPI  126

Query  297  SQTQD------IEDSSDDDGLPPLEANTNRLKPF  214
            +Q +D       +D  DDDG+PPLEANTNRL+PF
Sbjct  127  AQQEDDVEIDSSDDDDDDDGMPPLEANTNRLRPF  160



>ref|XP_006649259.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Oryza brachyantha]
Length=167

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NL+RA  E    L +G+SIMQV+ LRGSN+IEV+DA G +SLA+FPAKFQKS WIK+GNF
Sbjct  7    NLRRACSEGAVTLAEGESIMQVLALRGSNVIEVMDAKGVQSLALFPAKFQKSFWIKKGNF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVD  GR++A+ESG K+ C+V+QVLF+DQVR  +KS  WP IFKS   E S+   +  T
Sbjct  67   VVVDAGGRDQALESGSKIACVVSQVLFHDQVRAMEKSDGWPVIFKSTSKEGSEAGTQDGT  126

Query  297  S-QTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
            + Q ++  DS +DD LPPLEANTNR +PF+
Sbjct  127  TPQIEEEPDSDEDDDLPPLEANTNRQRPFE  156



>gb|KFK36949.1| hypothetical protein AALP_AA4G193000 [Arabis alpina]
Length=176

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 112/157 (71%), Gaps = 14/157 (9%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLK+A  E+   L++ QSI QVV LRGSN IE++DA GE SLA+FPAKF++SMWI+RG+F
Sbjct  7    NLKQAASEQDFTLEECQSIAQVVSLRGSNQIEIMDAKGENSLALFPAKFRESMWIRRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VV+D +G+E+A E GRKV  IV +VLF++QVR  QKSPEWPEIF+ A +  + E     +
Sbjct  67   VVIDHTGKEKAQEFGRKVTSIVCKVLFFEQVRLLQKSPEWPEIFRDAKLIPADE-----S  121

Query  297  SQTQDIEDSSDDD---------GLPPLEANTNRLKPF  214
            SQ   ++  +D +          +PPLEANTNRL+PF
Sbjct  122  SQVPIVQQENDGEVDSSDDDDDDMPPLEANTNRLRPF  158



>ref|XP_006295098.1| hypothetical protein CARUB_v10024173mg [Capsella rubella]
 gb|EOA27996.1| hypothetical protein CARUB_v10024173mg [Capsella rubella]
Length=174

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 111/152 (73%), Gaps = 4/152 (3%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLK+A  E+   L++ QSI QVV LRGSN IE++DA GE SLA+FPAKF++SMWI+RG+F
Sbjct  7    NLKQAASEQDFTLEECQSIAQVVSLRGSNQIEIMDAKGESSLALFPAKFRESMWIRRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSA----VVETSKENL  310
            VV+D +G+E+A ESG KV  IV +VLF++QVR  QKSP+WPEIFK        E+S+  +
Sbjct  67   VVIDHTGKEKAQESGSKVTSIVCKVLFFEQVRLLQKSPDWPEIFKDTKPIPADESSQIPI  126

Query  309  ERHTSQTQDIEDSSDDDGLPPLEANTNRLKPF  214
                +  +      DDDG+PPLEANTNRL+PF
Sbjct  127  PPQENDGEIDSSDDDDDGMPPLEANTNRLRPF  158



>ref|XP_010067623.1| PREDICTED: probable RNA-binding protein EIF1AD [Eucalyptus grandis]
 ref|XP_010067624.1| PREDICTED: probable RNA-binding protein EIF1AD [Eucalyptus grandis]
Length=190

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 113/166 (68%), Gaps = 17/166 (10%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLK A +E+   LQ GQ+I+Q V  RGSN++EV+DA G K LA+ PAK QK  WI RG F
Sbjct  7    NLKWAAEEREVTLQDGQNIVQAVSHRGSNLVEVMDAQGSKLLALIPAKIQKKYWIGRGTF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VVVD+SG+E+A+ESG KVGCIV++VLFY+QVRE +KSP+WPE FKS++  +S++ L  + 
Sbjct  67   VVVDDSGKEKALESGSKVGCIVSRVLFYEQVRELKKSPDWPEAFKSSMDSSSEKVLAVNN  126

Query  297  SQTQD-----------------IEDSSDDDGLPPLEANTNRLKPFQ  211
            S  Q                   E+  ++DGLPPLE NTNR+ P +
Sbjct  127  SSKQKNDPDSNDGDNNNDDEEDEEEEEEEDGLPPLEPNTNRVGPVE  172



>ref|XP_002465992.1| hypothetical protein SORBIDRAFT_01g049700 [Sorghum bicolor]
 gb|EER92990.1| hypothetical protein SORBIDRAFT_01g049700 [Sorghum bicolor]
Length=168

 Score =   159 bits (402),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 112/151 (74%), Gaps = 2/151 (1%)
 Frame = -2

Query  657  NLKRAGKEKTAI-LQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGN  481
            NL+RA  E  A+ L +G+SIMQV+ LRGSN+IEV+D  G KSLA+FPAKFQKS WIK G+
Sbjct  7    NLRRACDEGAAVTLAEGESIMQVLTLRGSNVIEVMDGEGVKSLALFPAKFQKSFWIKNGS  66

Query  480  FVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERH  301
            FV VD SGR++A+ESG K+ C+V+QVLF++QVR  +KS  WP IF S   E S+   +  
Sbjct  67   FVAVDASGRDQALESGSKIACVVSQVLFHEQVRALEKSGNWPAIFSSTTNEASEAGTQAQ  126

Query  300  T-SQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
            T +Q  +  DS +DD LPPLEANTNR +P++
Sbjct  127  TAAQIDEEPDSDEDDDLPPLEANTNRNRPYE  157



>ref|XP_010505829.1| PREDICTED: probable RNA-binding protein EIF1AD [Camelina sativa]
Length=173

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 111/151 (74%), Gaps = 3/151 (2%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLK+A  E+   L++ QSI QVV LRGSN IE++DA GE SLA+FPAKF++SMWI+RG+F
Sbjct  7    NLKQAASEQDFTLEECQSIAQVVSLRGSNQIEIMDAKGENSLALFPAKFRESMWIRRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLE---  307
            VV+D +G+E+A ESG KV  IV +VLF++QVR  QKSPEWPEIFK      + E+ +   
Sbjct  67   VVIDHTGKEKAQESGSKVTSIVCKVLFFEQVRLLQKSPEWPEIFKDTKPIPADESSQIPI  126

Query  306  RHTSQTQDIEDSSDDDGLPPLEANTNRLKPF  214
                   + + S DDDG+PPLEANTNRL+PF
Sbjct  127  PEQEDDGEDDSSDDDDGMPPLEANTNRLRPF  157



>ref|XP_010517517.1| PREDICTED: probable RNA-binding protein EIF1AD [Camelina sativa]
Length=173

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 112/156 (72%), Gaps = 13/156 (8%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            NLK+A  E+   L++ QSI QVV LRGSN IE++DA GE SLA+FPAKF++SMWI+RG+F
Sbjct  7    NLKQAASEQDFTLEECQSIAQVVSLRGSNQIEIMDAKGENSLALFPAKFRESMWIRRGSF  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            VV+D +G+E+A ESG KV  IV +VLF++QVR  QKSPEWPE+FK      +K      +
Sbjct  67   VVIDHTGKEKAQESGSKVTSIVCKVLFFEQVRLLQKSPEWPEVFKD-----TKPIPADES  121

Query  297  SQTQDIED--------SSDDDGLPPLEANTNRLKPF  214
            SQT   E         S DDDG+PPLEANTNRL+PF
Sbjct  122  SQTPIPEQEDDGEDDSSDDDDGMPPLEANTNRLRPF  157



>ref|XP_008788116.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X2 [Phoenix 
dactylifera]
Length=144

 Score =   155 bits (393),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  573  NIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGRKVGCIVTQVLFY  394
            +I+ V+DA   KSLA+FPAKFQ+S WIK+GNFVVVDESGRE+A+ESG K+ C+V++VLF+
Sbjct  9    DIMLVMDAKAVKSLALFPAKFQRSFWIKKGNFVVVDESGREKALESGSKIVCMVSRVLFH  68

Query  393  DQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIEDSSDDDGLPPLEANTNRLKPF  214
            DQVR+ +KSPEWP IF++ +V+ SK +++R TS  ++  +S  DD LPPLEAN NR +P 
Sbjct  69   DQVRKLEKSPEWPAIFRTTMVDDSKSHVQRPTSGGEEGSNSDVDDSLPPLEANLNRNRPV  128

Query  213  Q  211
            +
Sbjct  129  E  129



>ref|NP_001149105.1| RNA binding protein [Zea mays]
 gb|ACG34207.1| RNA binding protein [Zea mays]
 gb|ACG35554.1| RNA binding protein [Zea mays]
 gb|ACN28748.1| unknown [Zea mays]
 tpg|DAA42899.1| TPA: RNA binding protein [Zea mays]
Length=170

 Score =   156 bits (395),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 107/153 (70%), Gaps = 4/153 (3%)
 Frame = -2

Query  657  NLKRAGKEKTAI-LQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGN  481
            NL+RA  E  A+ L +G+SIMQV+ LRGSN+IEV+D  G +SLA+FPAKFQKS WIK G+
Sbjct  7    NLRRACDEGAAVTLAEGESIMQVLTLRGSNVIEVMDGVGVRSLALFPAKFQKSFWIKNGS  66

Query  480  FVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERH  301
            FVVVD SGR++A+ESG K+ C+V++VLF++QVR  QKS  WP IF SA            
Sbjct  67   FVVVDASGRDQALESGSKIACVVSRVLFHEQVRALQKSGNWPAIFNSAPTPNEASEAGAE  126

Query  300  TSQ---TQDIEDSSDDDGLPPLEANTNRLKPFQ  211
                   ++ +   +DD LPPLEANTNR +P++
Sbjct  127  AQAAQVDEEPDSDEEDDDLPPLEANTNRNRPYE  159



>ref|XP_008238340.1| PREDICTED: probable RNA-binding protein EIF1AD [Prunus mume]
Length=133

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 91/116 (78%), Gaps = 2/116 (2%)
 Frame = -2

Query  558  LDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGRKVGCIVTQVLFYDQVRE  379
            +DA GEKSLA+F AKFQKSMWIK+ +FVVVD S +E+ +ESG KV CIV QVLFY QVR 
Sbjct  1    MDAQGEKSLALFLAKFQKSMWIKQRSFVVVDASEKEKVVESGSKVACIVLQVLFYKQVRA  60

Query  378  YQKSPEWPEIFKSAVVETSKENLERHTSQTQDIE--DSSDDDGLPPLEANTNRLKP  217
             +KSPEWPEIFKSA+ +    +L+  T+  Q+    DSSDDDGLPPLEANTNR+KP
Sbjct  61   LKKSPEWPEIFKSAIPDGCNASLQGDTTSQQEENELDSSDDDGLPPLEANTNRMKP  116



>gb|ABK21882.1| unknown [Picea sitchensis]
Length=178

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 104/155 (67%), Gaps = 8/155 (5%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNF  478
            N K+   E    + +GQ++MQVV  RGSN+IEV+D  G K+LA+FPAKF KS+WIKRGN+
Sbjct  7    NSKKEALEACFEIPEGQTVMQVVSSRGSNLIEVMDDTGFKTLALFPAKFHKSLWIKRGNY  66

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIF----KSAVVETSKENL  310
            V+V+ES RE A+E+G KV C + QVLF +QVR  +KS  WP+ F    +SAV  T+  + 
Sbjct  67   VLVEESDRERALEAGNKVTCAIVQVLFEEQVRTLRKSSRWPQGFNVDKRSAVTATAGSDA  126

Query  309  ERHT----SQTQDIEDSSDDDGLPPLEANTNRLKP  217
              H     S+ +  E+ S D+GLPPLEAN NR  P
Sbjct  127  NVHKLDLHSEKEQYEEYSSDEGLPPLEANCNRHYP  161



>ref|NP_001118488.1| Nucleic acid-binding, OB-fold-like protein [Arabidopsis thaliana]
 gb|AEC09878.1| Nucleic acid-binding, OB-fold-like protein [Arabidopsis thaliana]
Length=132

 Score =   142 bits (357),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 89/117 (76%), Gaps = 3/117 (3%)
 Frame = -2

Query  558  LDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGRKVGCIVTQVLFYDQVRE  379
            +DA GE SLA+FPAKF++SMWI+RG+FVV+D +G+E+A ESG KV  IV +VLF++QVR 
Sbjct  1    MDAKGENSLALFPAKFRESMWIRRGSFVVIDHTGKEKAQESGSKVTSIVCKVLFFEQVRL  60

Query  378  YQKSPEWPEIFKSA--VVETSKENLERHTSQTQDIEDSSDDDGLPPLEANTNRLKPF  214
             QKSPEWPEIFK    +       +E+H    + ++ S DDDG+PPL+ANTNRL+PF
Sbjct  61   LQKSPEWPEIFKDTRPIPAEKSSPIEQHEDDGE-VDSSDDDDGMPPLQANTNRLRPF  116



>ref|XP_010318364.1| PREDICTED: uncharacterized protein LOC101254068 [Solanum lycopersicum]
Length=130

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 77/93 (83%), Gaps = 2/93 (2%)
 Frame = -2

Query  486  GNFVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKE-NL  310
            GNFVVVDESGREEA ESGRKVGC+VTQVL+YDQVR  QKSPEWPEIFKS  VE+SK+ N 
Sbjct  26   GNFVVVDESGREEATESGRKVGCVVTQVLYYDQVRVLQKSPEWPEIFKSTAVESSKQDNT  85

Query  309  ERHTSQTQDIEDSSDDDGLPPLEANTNRLKPFQ  211
            +    Q  + EDSS DDGLPPLEANTNRL PFQ
Sbjct  86   QSQNFQMNESEDSS-DDGLPPLEANTNRLNPFQ  117



>ref|XP_001775606.1| predicted protein [Physcomitrella patens]
 gb|EDQ59553.1| predicted protein [Physcomitrella patens]
Length=170

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 86/132 (65%), Gaps = 3/132 (2%)
 Frame = -2

Query  612  GQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESG  433
            G  +M+VV LRG NI+E  +A GE +L + PAKFQK++W+K G  V+VDE+ RE+AIE+G
Sbjct  23   GHVLMRVVGLRGGNIVEAENAAGENTLCLLPAKFQKTIWVKTGTIVIVDEADREKAIEAG  82

Query  432  RKVGCIVTQVLFYDQVREYQKSPE-WPEIFKSAVVETSKENLERHTSQTQDIEDS--SDD  262
             KV   VT+VL  DQ R  +KS   WPE FK   V +     ER     +  E+S  SDD
Sbjct  83   SKVTGTVTRVLLEDQARALRKSVSWWPESFKDERVASKDAKGERDGDGGESGEESCESDD  142

Query  261  DGLPPLEANTNR  226
            DGLPPLEAN NR
Sbjct  143  DGLPPLEANLNR  154



>gb|ACG45606.1| RNA binding protein [Zea mays]
Length=130

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 3/119 (3%)
 Frame = -2

Query  558  LDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGRKVGCIVTQVLFYDQVRE  379
            +D  G +SLA+FPAKFQKS WIK G+FVVVD SGR++A+ESG K+ C+V++VLF++QVR 
Sbjct  1    MDGVGVRSLALFPAKFQKSFWIKNGSFVVVDASGRDQALESGSKIACVVSRVLFHEQVRA  60

Query  378  YQKSPEWPEIFKSAVVETSKENLERHTSQ---TQDIEDSSDDDGLPPLEANTNRLKPFQ  211
             QKS  WP IF SA                   ++ +   +DD LPPLEANTNR +P++
Sbjct  61   LQKSGNWPAIFNSAPTPNEASEAGAEAQAAQVDEEPDSDEEDDDLPPLEANTNRNRPYE  119



>gb|KDO67561.1| hypothetical protein CISIN_1g030718mg [Citrus sinensis]
Length=125

 Score =   117 bits (292),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = -2

Query  486  GNFVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLE  307
            G+FVVVDESG+E+AI+ G KV CIVT+VLFY+QVR  QKS EWPEIFKS   + +  +LE
Sbjct  17   GSFVVVDESGKEKAIKDGSKVACIVTKVLFYEQVRALQKSTEWPEIFKSTNSDDANGSLE  76

Query  306  RHTSQTQ--DIEDSSDDDGLPPLEANTNRLKPFQ  211
            R     +  D  +S DDDGLPPLEAN NR+KP +
Sbjct  77   RQACNHEENDQSESDDDDGLPPLEANINRMKPME  110



>gb|ABE65899.1| hypothetical protein At2g40780 [Arabidopsis thaliana]
Length=113

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 3/98 (3%)
 Frame = -2

Query  501  MWIKRGNFVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSA--VVE  328
            MWI+RG+FVV+D +G+E+A ESG KV  IV +VLF++QVR  QKSPEWPEIFK    +  
Sbjct  1    MWIRRGSFVVIDHTGKEKAQESGSKVTSIVCKVLFFEQVRLLQKSPEWPEIFKDTRPIPA  60

Query  327  TSKENLERHTSQTQDIEDSSDDDGLPPLEANTNRLKPF  214
                 +E+H    + ++ S DDDG+PPL+ANTNRL+PF
Sbjct  61   EKSSPIEQHEDDGE-VDSSDDDDGMPPLQANTNRLRPF  97



>gb|ABK28532.1| unknown [Arabidopsis thaliana]
Length=114

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 3/98 (3%)
 Frame = -2

Query  501  MWIKRGNFVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSA--VVE  328
            MWI+RG+FVV+D +G+E+A ESG KV  IV +VLF++QVR  QKSPEWPEIFK    +  
Sbjct  1    MWIRRGSFVVIDHTGKEKAQESGSKVTSIVCKVLFFEQVRLLQKSPEWPEIFKDTRPIPA  60

Query  327  TSKENLERHTSQTQDIEDSSDDDGLPPLEANTNRLKPF  214
                 +E+H    + ++ S DDDG+PPL+ANTNRL+PF
Sbjct  61   EKSSPIEQHEDDGE-VDSSDDDDGMPPLQANTNRLRPF  97



>gb|KCW65795.1| hypothetical protein EUGRSUZ_G031471, partial [Eucalyptus grandis]
Length=126

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 72/107 (67%), Gaps = 17/107 (16%)
 Frame = -2

Query  480  FVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERH  301
            FVVVD+SG+E+A+ESG KVGCIV++VLFY+QVRE +KSP+WPE FKS++  +S++ L  +
Sbjct  2    FVVVDDSGKEKALESGSKVGCIVSRVLFYEQVRELKKSPDWPEAFKSSMDSSSEKVLAVN  61

Query  300  TSQTQD-----------------IEDSSDDDGLPPLEANTNRLKPFQ  211
             S  Q                   E+  ++DGLPPLE NTNR+ P +
Sbjct  62   NSSKQKNDPDSNDGDNNNDDEEDEEEEEEEDGLPPLEPNTNRVGPVE  108



>ref|XP_003294850.1| hypothetical protein DICPUDRAFT_159921 [Dictyostelium purpureum]
 gb|EGC28627.1| hypothetical protein DICPUDRAFT_159921 [Dictyostelium purpureum]
Length=171

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 62/92 (67%), Gaps = 5/92 (5%)
 Frame = -2

Query  621  LQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAI  442
            L+Q QSI++VVD+RG N+IEV  AN  K LAI P KF K +WIK+GN+ +VD+       
Sbjct  19   LEQDQSIVKVVDIRGGNVIEVQYANESKVLAILPQKFNKVLWIKKGNYAIVDKED-----  73

Query  441  ESGRKVGCIVTQVLFYDQVREYQKSPEWPEIF  346
            ES ++V C+V+ +L  + ++   KS EWP+ F
Sbjct  74   ESSKQVRCVVSHILSKENIKGLVKSNEWPKEF  105



>gb|EPS62852.1| hypothetical protein M569_11936, partial [Genlisea aurea]
Length=62

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRG  484
            NLKRA +E +  L++  SIMQV DLRGSN+IEV+D+  +K L IFPAKFQ+SMW+KRG
Sbjct  5    NLKRASEENSVTLERSHSIMQVADLRGSNLIEVMDSKRQKFLTIFPAKFQRSMWMKRG  62



>ref|XP_001965340.1| GF24643 [Drosophila ananassae]
 gb|EDV33474.1| GF24643 [Drosophila ananassae]
Length=162

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 81/144 (56%), Gaps = 18/144 (13%)
 Frame = -2

Query  654  LKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKS-LAIFPAKFQKSMWIKRGNF  478
            +K   ++  A+    Q I++VV  RG+N+ EV  A  E++ L   P KF+KSMW+KRG+F
Sbjct  15   IKEMMEDDFALPTDQQKIVRVVSSRGNNLHEVEAATNEENFLVSMPNKFRKSMWVKRGDF  74

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            +++      E IE G KV   + ++L  + V+EY K+  WPE F      T K   E  +
Sbjct  75   LLI------EPIEEGDKVKAEICKILTTEHVKEYTKAGIWPEKF------TKKSGQEETS  122

Query  297  SQTQDIEDSSDDDGLPPLEANTNR  226
            +Q QD  DS  +D LPP   NTNR
Sbjct  123  AQNQD--DSDFEDDLPP---NTNR  141



>gb|EMS61943.1| hypothetical protein TRIUR3_07127 [Triticum urartu]
Length=89

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = -2

Query  657  NLKRAGKEKTAI-LQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRG  484
            NL+RA +E TA+ L +G+SIMQVV LRGSN+IEV D  G KSLA+FPAKFQKS WIK G
Sbjct  7    NLRRACEEGTAVTLAEGESIMQVVTLRGSNLIEVTDGEGVKSLALFPAKFQKSFWIKNG  65



>emb|CDY09266.1| BnaC03g62960D [Brassica napus]
Length=126

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 63/92 (68%), Gaps = 5/92 (5%)
 Frame = -2

Query  477  VVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            ++ D  G+E+A ESG KV  I+ +VLF++Q+R  QKSP+WPEIFK A    + E+ +   
Sbjct  24   LLTDHIGKEKAQESGSKVTSIICKVLFFEQLRLLQKSPDWPEIFKDAKPVPADESSQIPM  83

Query  297  SQTQDI--EDSSDDDGL--PPLEANTNRLKPF  214
            +Q QD+  E  S DDG+  PPLEA TNRL+PF
Sbjct  84   AQ-QDVDGEIDSSDDGMPPPPLEAYTNRLRPF  114



>emb|CDY40524.1| BnaC01g19880D [Brassica napus]
Length=104

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%), Gaps = 9/95 (9%)
 Frame = -2

Query  486  GNFVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLE  307
            GN +     G+E+A ESG KV  I+ +VLF++Q+R  QKSP+WPEIF+ A    + E+ +
Sbjct  3    GNMI----KGKEKAQESGSKVTSIICKVLFFEQLRLLQKSPDWPEIFRDAKPVPADESSQ  58

Query  306  RHTSQTQDIE---DSSDDD-GLPPLEANTNRLKPF  214
               +Q QD++   DSSDD   LPPLEA TNRL+PF
Sbjct  59   IPMAQ-QDVDGEIDSSDDSMPLPPLEAYTNRLRPF  92



>ref|XP_009515592.1| hypothetical protein PHYSODRAFT_474031 [Phytophthora sojae]
 gb|EGZ28317.1| hypothetical protein PHYSODRAFT_474031 [Phytophthora sojae]
Length=192

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (62%), Gaps = 3/102 (3%)
 Frame = -2

Query  618  QQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDES-GREEAI  442
            ++ + I++V  LRGSN+ EV+DA G KS+ + P KF+K +W+KRG+F++V E  G E   
Sbjct  26   KENELIVRVTALRGSNLFEVVDAEGAKSVTMLPTKFRKLIWVKRGDFLIVGEGDGGEATT  85

Query  441  ESGRK--VGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETS  322
              G+K  V  IV  +L+ DQ++  ++   WP  F  +   T+
Sbjct  86   AKGKKGAVTSIVEHILYKDQIKNLKRKDLWPAAFDDSSASTA  127



>ref|XP_002115905.1| hypothetical protein TRIADDRAFT_59800 [Trichoplax adhaerens]
 gb|EDV21757.1| hypothetical protein TRIADDRAFT_59800 [Trichoplax adhaerens]
Length=160

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 80/139 (58%), Gaps = 16/139 (12%)
 Frame = -2

Query  621  LQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAI  442
            L + Q I+++V  RG+N+ EV+ A+GE  L+  P+KF++ +WIKRG++V+VD       I
Sbjct  21   LAESQQIVKIVASRGNNLHEVVTASGETFLSSMPSKFRRVIWIKRGDYVIVD------PI  74

Query  441  ESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLER-HTSQTQDI-----  280
            E G KV   ++ VL  DQ++  ++   WPE F +      +EN  + H    +D+     
Sbjct  75   EEGNKVRAEISSVLNADQIKSLKEENLWPEEFVTNNASMHRENSAKTHEDLDEDLDKDAS  134

Query  279  EDSSDDDGLPPLEANTNRL  223
            E +SDDD    L  NTNR+
Sbjct  135  ESASDDD----LFVNTNRI  149



>gb|ETO69353.1| hypothetical protein F444_14060 [Phytophthora parasitica P1976]
Length=196

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = -2

Query  618  QQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDES-GREEAI  442
            ++ + I++V  LRGSN+ EV+DANG KS+ + P KF+K +W+KRG+F++V E  G E   
Sbjct  26   KENELIVRVTALRGSNLFEVVDANGVKSVTMLPTKFRKLIWVKRGDFLIVGEGDGGEATT  85

Query  441  ESGRK--VGCIVTQVLFYDQVREYQKSPEWPEIF  346
             +G+K  V  IV  +L+ +Q++  ++   WP  F
Sbjct  86   ATGKKGAVTSIVEHILYKEQIKNLKRKELWPAAF  119



>gb|ETI40666.1| hypothetical protein F443_14028 [Phytophthora parasitica P1569]
 gb|ETK80765.1| hypothetical protein L915_13672 [Phytophthora parasitica]
 gb|ETL34180.1| hypothetical protein L916_13571 [Phytophthora parasitica]
 gb|ETL87466.1| hypothetical protein L917_13378 [Phytophthora parasitica]
 gb|ETM40661.1| hypothetical protein L914_13466 [Phytophthora parasitica]
 gb|ETP10423.1| hypothetical protein F441_13956 [Phytophthora parasitica CJ01A1]
Length=196

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = -2

Query  618  QQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDES-GREEAI  442
            ++ + I++V  LRGSN+ EV+DANG KS+ + P KF+K +W+KRG+F++V E  G E   
Sbjct  26   KENELIVRVTALRGSNLFEVVDANGVKSVTMLPTKFRKLIWVKRGDFLIVGEGDGGEATT  85

Query  441  ESGRK--VGCIVTQVLFYDQVREYQKSPEWPEIF  346
             +G+K  V  IV  +L+ +Q++  ++   WP  F
Sbjct  86   ATGKKGAVTSIVEHILYKEQIKNLKRKELWPAAF  119



>ref|XP_004627267.1| PREDICTED: probable RNA-binding protein EIF1AD [Octodon degus]
Length=165

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 77/138 (56%), Gaps = 15/138 (11%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT-----SQTQDIEDS-S  268
            KV   ++ VL  D VR  QK   WPE F S V E    N  R T     ++ Q  E+S S
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGFWPEAF-SEVAEKDNNNRSRQTEPELPAEPQSSEESGS  137

Query  267  DDDGLPPLEANTNRLKPF  214
            +DD    L  NTNR + F
Sbjct  138  EDDS--DLFVNTNRRQYF  153



>ref|XP_002906548.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY65949.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=196

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 58/89 (65%), Gaps = 3/89 (3%)
 Frame = -2

Query  603  IMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDES-GREEAIESGRK  427
            I++V  LRGSN+ EV DANG KS+ + P KF+K +W+KRG+F++V E  G E    +G+K
Sbjct  31   IVRVTALRGSNLFEVEDANGAKSVTMLPTKFRKLIWVKRGDFLIVGEGDGGETTTATGKK  90

Query  426  --VGCIVTQVLFYDQVREYQKSPEWPEIF  346
              V  IV  +L+ +Q++  ++   WP  F
Sbjct  91   GAVTSIVEHILYKEQIKNLKRKELWPATF  119



>ref|XP_004901767.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X1 [Heterocephalus 
glaber]
 ref|XP_004901768.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X2 [Heterocephalus 
glaber]
 ref|XP_004852402.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X1 [Heterocephalus 
glaber]
 ref|XP_004852403.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X2 [Heterocephalus 
glaber]
 gb|EHB13773.1| Putative RNA-binding protein EIF1AD [Heterocephalus glaber]
Length=166

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTS-------QTQDIEDS  271
            KV   ++ VL  D VR  QK   WPE F S V E    N  R T        Q+   E  
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGYWPEAF-SEVAEKGSSNRNRQTQPELPAEPQSSGEESG  137

Query  270  SDDDGLPPLEANTNRLKPF  214
            S+DD    L  NTNR + +
Sbjct  138  SEDDS--DLFVNTNRRQYY  154



>ref|XP_002001752.1| GI15299 [Drosophila mojavensis]
 gb|EDW11194.1| GI15299 [Drosophila mojavensis]
Length=162

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 79/143 (55%), Gaps = 15/143 (10%)
 Frame = -2

Query  654  LKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFV  475
            LK   ++  ++  + Q I++VV  RG+N+ EV  A  E  L   P KF+K++W+KRG+++
Sbjct  13   LKEMMEDDYSLPTEQQQIVRVVSSRGNNLHEVESATAENFLVSMPNKFRKNVWVKRGDYI  72

Query  474  VVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTS  295
            +V      E IE G KV   ++++L  + ++E+ K+  WPE F  A   T+  +   H+ 
Sbjct  73   LV------EPIEEGDKVKAEISKILTPEHIKEFTKAGIWPERF--AKKPTTPSSKAEHSG  124

Query  294  QTQDIEDSSDDDGLPPLEANTNR  226
             +     S  DD LPP   NTNR
Sbjct  125  AS----GSDSDDSLPP---NTNR  140



>ref|XP_005384493.1| PREDICTED: probable RNA-binding protein EIF1AD [Chinchilla lanigera]
Length=166

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 73/139 (53%), Gaps = 16/139 (12%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPTKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTS-------QTQDIEDS  271
            KV   ++ VL  D VR  QK   WPE F S V E    N  R T        Q+   E  
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGFWPEAF-SEVAEKDNNNRNRQTQPELPAEPQSSGEESG  137

Query  270  SDDDGLPPLEANTNRLKPF  214
            S+DD    L  NTNR + F
Sbjct  138  SEDDS--DLFVNTNRRQYF  154



>ref|XP_629853.1| hypothetical protein DDB_G0292138 [Dictyostelium discoideum AX4]
 gb|EAL61425.1| hypothetical protein DDB_G0292138 [Dictyostelium discoideum AX4]
Length=183

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 76/138 (55%), Gaps = 13/138 (9%)
 Frame = -2

Query  621  LQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAI  442
            L+  Q+I++V+D+RG N++EV   NG   LAI P+KF+  +WIK+GN+ ++D   +E+  
Sbjct  19   LENDQNIVKVIDMRGGNVVEVQYPNGSTVLAIIPSKFKNILWIKKGNYAIID---KEDES  75

Query  441  ESGRKVGCIVTQVLFYDQVREYQKSPEWPEIF----KSAVVETSKENLERHTSQTQDIED  274
                +V C V  +L  + V+   KS +WP+ F    K+   +  K  L   T+ T D ED
Sbjct  76   SKSSQVKCSVVHILSKENVKGLVKSRDWPKEFDLEDKNQRQQPQKPLL--LTAPTSDDED  133

Query  273  SSDDDGLPPLEANTNRLK  220
                 GL  L  N NR K
Sbjct  134  G----GLSDLGVNPNRKK  147



>ref|XP_008588467.1| PREDICTED: probable RNA-binding protein EIF1AD [Galeopterus variegatus]
 ref|XP_008588468.1| PREDICTED: probable RNA-binding protein EIF1AD [Galeopterus variegatus]
Length=166

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 72/135 (53%), Gaps = 16/135 (12%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G+  L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQHFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTS-------QTQDIEDS  271
            KV   ++ VL  D VR  QK   WPE F S V E    N  R T        Q+   + S
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAF-SEVAEKHNSNRNRQTQPELPAEPQSSGEKSS  137

Query  270  SDDDGLPPLEANTNR  226
            S+DD    L  NTNR
Sbjct  138  SEDDS--DLFVNTNR  150



>gb|ETP38599.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=491

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 59/89 (66%), Gaps = 3/89 (3%)
 Frame = -2

Query  603  IMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDES-GREEAIESGRK  427
            I++V  LRGSN+ EV+DANG KS+ + P KF+K +W+KRG+F++V E  G E    +G+K
Sbjct  31   IVRVTALRGSNLFEVVDANGVKSVTMLPTKFRKLIWVKRGDFLIVGEGDGGEATTATGKK  90

Query  426  --VGCIVTQVLFYDQVREYQKSPEWPEIF  346
              V  IV  +L+ +Q++  ++   WP  F
Sbjct  91   GAVTSIVEHILYKEQIKNLKRKELWPAAF  119



>ref|XP_008909485.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETN05015.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
Length=491

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 59/89 (66%), Gaps = 3/89 (3%)
 Frame = -2

Query  603  IMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDES-GREEAIESGRK  427
            I++V  LRGSN+ EV+DANG KS+ + P KF+K +W+KRG+F++V E  G E    +G+K
Sbjct  31   IVRVTALRGSNLFEVVDANGVKSVTMLPTKFRKLIWVKRGDFLIVGEGDGGEATTATGKK  90

Query  426  --VGCIVTQVLFYDQVREYQKSPEWPEIF  346
              V  IV  +L+ +Q++  ++   WP  F
Sbjct  91   GAVTSIVEHILYKEQIKNLKRKELWPAAF  119



>ref|XP_006002516.1| PREDICTED: probable RNA-binding protein EIF1AD [Latimeria chalumnae]
Length=176

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 69/123 (56%), Gaps = 12/123 (10%)
 Frame = -2

Query  636  EKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESG  457
            E+  +  + Q I++V    G+N+ EV  A GE+ L   P KF+K++WIKRG+FV+VD   
Sbjct  16   EEYIVPSEQQQIVKVTRSPGNNLHEVETAEGERFLVSMPTKFRKNIWIKRGDFVIVD---  72

Query  456  REEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVE-----TSKENLERHTSQ  292
                IE G KV   +T +L+ D +   +K   WP +F  +V E     TS+  LE H+S 
Sbjct  73   ---PIEEGEKVKAEITFILYKDHISHLKKEGLWPNVFSDSVEEPFNTVTSQTQLE-HSST  128

Query  291  TQD  283
             QD
Sbjct  129  AQD  131



>ref|NP_722949.1| CG31957, isoform A [Drosophila melanogaster]
 ref|NP_001260011.1| CG31957, isoform B [Drosophila melanogaster]
 sp|Q8IQ13.1|EIF1A_DROME RecName: Full=Probable RNA-binding protein EIF1AD; AltName: Full=Eukaryotic 
translation initiation factor 1A domain-containing 
protein [Drosophila melanogaster]
 gb|AAN10365.1| CG31957, isoform A [Drosophila melanogaster]
 gb|ABG02155.1| IP07317p [Drosophila melanogaster]
 gb|AGB92547.1| CG31957, isoform B [Drosophila melanogaster]
Length=159

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 76/143 (53%), Gaps = 18/143 (13%)
 Frame = -2

Query  654  LKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFV  475
            +K   ++  A+  + Q I +V+  RG+N+ EV +   E  L   P KF+KSMW+KRG+F+
Sbjct  15   MKEMMEDDYALPTETQQIARVISSRGNNLHEV-ETVDETFLVSMPNKFRKSMWVKRGDFL  73

Query  474  VVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTS  295
            +V      E IE G KV   + ++L  + ++EY K+  WP+ F      T K   E  TS
Sbjct  74   LV------EPIEEGDKVKAEICKILTPEHIKEYTKAAIWPDKF------TKKPVQEEATS  121

Query  294  QTQDIEDSSDDDGLPPLEANTNR  226
            Q +D  D  DD     L  NTNR
Sbjct  122  QNKDDSDFEDD-----LLPNTNR  139



>ref|XP_004019735.1| PREDICTED: probable RNA-binding protein EIF1AD [Ovis aries]
Length=166

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+FV+VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFVIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  QK   WPE F S V E    N  R T
Sbjct  79   KVKAEISFVLCKDHVRSLQKDGHWPEAF-SQVAEKHNNNRNRQT  121



>ref|XP_005333462.1| PREDICTED: probable RNA-binding protein EIF1AD [Ictidomys tridecemlineatus]
Length=164

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 74/135 (55%), Gaps = 18/135 (13%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTS-------QTQDIEDS  271
            KV   ++ VL  D VR  QK   WPE F S V E  K N  R T        Q+   E +
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAF-SEVAE--KHNRNRQTQPELPAEPQSSGEESA  135

Query  270  SDDDGLPPLEANTNR  226
            S+DD    L  NTNR
Sbjct  136  SEDDS--DLFVNTNR  148



>gb|ETP38598.1| hypothetical protein F442_13870 [Phytophthora parasitica P10297]
Length=669

 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 59/89 (66%), Gaps = 3/89 (3%)
 Frame = -2

Query  603  IMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDES-GREEAIESGRK  427
            I++V  LRGSN+ EV+DANG KS+ + P KF+K +W+KRG+F++V E  G E    +G+K
Sbjct  31   IVRVTALRGSNLFEVVDANGVKSVTMLPTKFRKLIWVKRGDFLIVGEGDGGEATTATGKK  90

Query  426  --VGCIVTQVLFYDQVREYQKSPEWPEIF  346
              V  IV  +L+ +Q++  ++   WP  F
Sbjct  91   GAVTSIVEHILYKEQIKNLKRKELWPAAF  119



>ref|XP_008909484.1| hypothetical protein PPTG_23530 [Phytophthora parasitica INRA-310]
 gb|ETN05014.1| hypothetical protein PPTG_23530 [Phytophthora parasitica INRA-310]
Length=669

 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 59/89 (66%), Gaps = 3/89 (3%)
 Frame = -2

Query  603  IMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDES-GREEAIESGRK  427
            I++V  LRGSN+ EV+DANG KS+ + P KF+K +W+KRG+F++V E  G E    +G+K
Sbjct  31   IVRVTALRGSNLFEVVDANGVKSVTMLPTKFRKLIWVKRGDFLIVGEGDGGEATTATGKK  90

Query  426  --VGCIVTQVLFYDQVREYQKSPEWPEIF  346
              V  IV  +L+ +Q++  ++   WP  F
Sbjct  91   GAVTSIVEHILYKEQIKNLKRKELWPAAF  119



>ref|XP_004682664.1| PREDICTED: probable RNA-binding protein EIF1AD [Condylura cristata]
Length=166

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++KS+WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKSIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   +  VL  D VR  QK   WPE F S VVE    N  R T
Sbjct  79   KVKAEICFVLCKDHVRALQKDGLWPEAF-SGVVEKHNSNRNRQT  121



>ref|XP_003970161.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Takifugu 
rubripes]
Length=178

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 56/88 (64%), Gaps = 6/88 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I+++V  RG+N+ EVL + G+  L   P KF+K++WIKRG+FV+VD       IE G 
Sbjct  25   QQIVKIVGSRGNNLHEVLTSQGDTFLVSMPTKFRKNIWIKRGDFVIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIF  346
            KV   ++ +L+ D V+  +K  +WPE F
Sbjct  79   KVKAEISSILYKDHVQHLKKQQQWPEGF  106



>ref|XP_002078090.1| GD22725 [Drosophila simulans]
 gb|EDX03675.1| GD22725 [Drosophila simulans]
Length=159

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 76/143 (53%), Gaps = 18/143 (13%)
 Frame = -2

Query  654  LKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFV  475
            +K   ++  A+  + Q I +V+  RG+N+ EV +   E  L   P KF+KSMW+KRG+F+
Sbjct  15   MKEMMEDDYALPTETQQIARVISSRGNNLHEV-ETVDETFLVSMPNKFRKSMWVKRGDFL  73

Query  474  VVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTS  295
            +V      E IE G KV   + ++L  + ++EY K+  WP+ F      T K   +  TS
Sbjct  74   LV------EPIEEGDKVKAEICKILTPEHIKEYTKAAIWPDKF------TKKPAEQEATS  121

Query  294  QTQDIEDSSDDDGLPPLEANTNR  226
            Q +D  D  DD     L  NTNR
Sbjct  122  QNKDDSDFEDD-----LLPNTNR  139



>ref|XP_004073614.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Oryzias 
latipes]
Length=172

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 72/135 (53%), Gaps = 15/135 (11%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            + Q I++VV  RG+N+ E + A GE  L   P KF+K++WIKRG+FV+VD       IE 
Sbjct  23   ENQQIVKVVGSRGNNLHEAVTAQGETFLVSMPTKFRKNIWIKRGDFVIVD------PIEE  76

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVE----TSKENLE-RHTSQTQDIEDS  271
            G KV   ++ +L+ D ++  QK   WPE F   +      T +E+ E +H  +     + 
Sbjct  77   GEKVKAEISFILYKDHIQNLQKQQLWPEGFTEKLPHNNENTRQEDAETKHEEEEGCSSEE  136

Query  270  SDDDGLPPLEANTNR  226
             D D    L  NTNR
Sbjct  137  DDSD----LFVNTNR  147



>ref|XP_010731168.1| PREDICTED: probable RNA-binding protein EIF1AD [Larimichthys 
crocea]
Length=185

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 63/115 (55%), Gaps = 12/115 (10%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+  RG+N+ E + A GE  L   P KF+K++WIKRG++V+VD       IE G 
Sbjct  25   QQIVKVIGSRGNNLHEAVTAQGETFLVSMPTKFRKNLWIKRGDYVIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIEDSSD  265
            KV   +  +L+ D ++  QK   WPE F     E  K      T + Q+ ED ++
Sbjct  79   KVKAEINFILYKDHIQHLQKQQHWPEGFMEEPSEQDK------TDKQQEKEDGTE  127



>ref|XP_002037774.1| GM18117 [Drosophila sechellia]
 gb|EDW54192.1| GM18117 [Drosophila sechellia]
Length=160

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 76/143 (53%), Gaps = 18/143 (13%)
 Frame = -2

Query  654  LKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFV  475
            +K   ++  A+  + Q I +V+  RG+N+ EV +   E  L   P KF+KSMW+KRG+F+
Sbjct  15   MKEMMEDDYALPTETQQIARVISSRGNNLHEV-ETVDETFLVSMPNKFRKSMWVKRGDFL  73

Query  474  VVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTS  295
            +V      E IE G KV   + ++L  + ++EY K+  WP+ F      T K   +  TS
Sbjct  74   LV------EPIEEGDKVKAEICKILTPEHIKEYTKAAIWPDKF------TKKPAEQEATS  121

Query  294  QTQDIEDSSDDDGLPPLEANTNR  226
            Q +D  D  DD     L  NTNR
Sbjct  122  QNKDDSDFEDD-----LLPNTNR  139



>ref|XP_005699967.1| PREDICTED: probable RNA-binding protein EIF1AD [Capra hircus]
 ref|XP_005960258.1| PREDICTED: probable RNA-binding protein EIF1AD [Pantholops hodgsonii]
Length=166

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  QK   WPE F S V E    N  R T
Sbjct  79   KVKAEISFVLCKDHVRSLQKDGHWPEAF-SQVAEKHNNNRNRQT  121



>ref|NP_001069861.1| probable RNA-binding protein EIF1AD [Bos taurus]
 gb|AAI20114.1| Eukaryotic translation initiation factor 1A domain containing 
[Bos taurus]
Length=166

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 63/108 (58%), Gaps = 10/108 (9%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q IM+V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIMRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQ  286
            KV   ++ VL  D VR  QK   WPE F      T K+N +R   QTQ
Sbjct  79   KVKAEISFVLCKDHVRSLQKDGHWPEAFSQV---TEKDNNDR-NRQTQ  122



>ref|XP_007518823.1| PREDICTED: probable RNA-binding protein EIF1AD [Erinaceus europaeus]
Length=167

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 73/131 (56%), Gaps = 11/131 (8%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV    G++ L   P+K++KS+WIKRG+F++VD       IE G 
Sbjct  26   QQIVRVLRTPGNNLHEVETPQGQRFLVSMPSKYRKSIWIKRGDFLLVD------PIEEGA  79

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVET--SKENLERHTSQTQDIEDS-SDDD  259
            KV   ++ VL  D VR  QK   WPE F  A  E   S+E      ++ Q  E+S S+DD
Sbjct  80   KVKAEISFVLCKDHVRALQKEGFWPEAFSEAAEEHNRSRETQPELPAEPQSSEESNSEDD  139

Query  258  GLPPLEANTNR  226
                L  NTNR
Sbjct  140  S--DLFVNTNR  148



>ref|XP_005894089.1| PREDICTED: probable RNA-binding protein EIF1AD [Bos mutus]
 ref|XP_010836070.1| PREDICTED: probable RNA-binding protein EIF1AD [Bison bison bison]
 ref|XP_010836071.1| PREDICTED: probable RNA-binding protein EIF1AD [Bison bison bison]
 ref|XP_010836073.1| PREDICTED: probable RNA-binding protein EIF1AD [Bison bison bison]
 gb|ELR57526.1| Putative RNA-binding protein EIF1AD [Bos mutus]
Length=166

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  QK   WPE F S V E    N  R T
Sbjct  79   KVKAEISFVLCKDHVRSLQKDGHWPEAF-SQVTEKDNNNRNRQT  121



>ref|XP_006056493.1| PREDICTED: probable RNA-binding protein EIF1AD [Bubalus bubalis]
Length=166

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  QK   WPE F S V E    N  R T
Sbjct  79   KVKAEISFVLCKDHVRSLQKDGHWPEAF-SQVAEKDNNNRNRQT  121



>ref|XP_002064533.1| GK23772 [Drosophila willistoni]
 gb|EDW75519.1| GK23772 [Drosophila willistoni]
Length=158

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 73/144 (51%), Gaps = 21/144 (15%)
 Frame = -2

Query  654  LKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFV  475
            LK   ++  A+  + Q I++V+  RG+N+ EV     +  L   P KF+K++W+KRG+F+
Sbjct  15   LKEMMEDDYALPTEHQQIVRVIASRGNNLHEVETPEEDTFLVSMPCKFRKNLWVKRGDFI  74

Query  474  VVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTS  295
            +V      E IE G KV   + +VL  D V+EY K+  WP  F                 
Sbjct  75   LV------EPIEEGDKVKAEICKVLTTDHVKEYTKAGIWPVRFAKKKE----------EE  118

Query  294  QTQDIEDSSDDDGLPPLEANTNRL  223
            +  D  DS DD  LPP   NTNR+
Sbjct  119  EKPDHSDSEDD--LPP---NTNRM  137



>ref|XP_002087885.1| GE14789 [Drosophila yakuba]
 gb|EDW87597.1| GE14789 [Drosophila yakuba]
Length=159

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 76/143 (53%), Gaps = 18/143 (13%)
 Frame = -2

Query  654  LKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFV  475
            +K   ++  A+  + Q I +V+  RG+N+ EV +   E  L   P KF+KSMW+KRG+++
Sbjct  15   MKEMMEDDYALPTETQQIARVISSRGNNLHEV-ETVEESFLVSMPNKFRKSMWVKRGDYL  73

Query  474  VVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTS  295
            +V      E IE G KV   + ++L  + ++EY K+  WP+ F      T K   E  TS
Sbjct  74   LV------EPIEEGDKVKAEICKILTPEHIKEYTKAGIWPDKF------TKKPVPEEGTS  121

Query  294  QTQDIEDSSDDDGLPPLEANTNR  226
            Q +D  D  DD     L  NTNR
Sbjct  122  QNKDDSDFEDD-----LLPNTNR  139



>ref|XP_002051920.1| GJ17268 [Drosophila virilis]
 gb|EDW64075.1| GJ17268 [Drosophila virilis]
Length=165

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 78/147 (53%), Gaps = 19/147 (13%)
 Frame = -2

Query  654  LKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDAN--GEKSLAIFPAKFQKSMWIKRGN  481
            LK   ++  ++  + Q I+ VV  RG+N+ EV+ A    +  L   P KF+K++W+KRG+
Sbjct  13   LKEMMEDDYSLPTERQQIVCVVSSRGNNLHEVVPAGLASDNFLVSMPNKFRKNVWVKRGD  72

Query  480  FVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIF--KSAVVETSKENLE  307
            +V+V      E I  G KV   + ++L  + V+EY K+  WP+ F  KSA    S +N  
Sbjct  73   YVLV------EPIAEGDKVKAEICKILTPEHVKEYTKAGIWPQRFAKKSAQASQSPDNAA  126

Query  306  RHTSQTQDIEDSSDDDGLPPLEANTNR  226
               S      DS  DD LPP   NTNR
Sbjct  127  AEHS------DSDTDDSLPP---NTNR  144



>ref|XP_004393967.1| PREDICTED: probable RNA-binding protein EIF1AD [Odobenus rosmarus 
divergens]
Length=166

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  QK   WPE F S V E    N  R T
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAF-SEVAEKHNNNRHRQT  121



>ref|XP_006179578.1| PREDICTED: probable RNA-binding protein EIF1AD [Camelus ferus]
 ref|XP_010954940.1| PREDICTED: probable RNA-binding protein EIF1AD [Camelus bactrianus]
 ref|XP_010994268.1| PREDICTED: probable RNA-binding protein EIF1AD [Camelus dromedarius]
 gb|EQB77705.1| putative RNA-binding protein EIF1AD isoform 1 [Camelus ferus]
Length=166

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  QK   WPE F S V E    N  R T
Sbjct  79   KVKAEISFVLCKDHVRSLQKDGLWPEAF-SQVAEKHSNNRNRQT  121



>ref|XP_006740233.1| PREDICTED: probable RNA-binding protein EIF1AD [Leptonychotes 
weddellii]
Length=166

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  QK   WPE F S V E    N  R T
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAF-SEVAEKHNNNRNRQT  121



>ref|XP_003468301.1| PREDICTED: probable RNA-binding protein EIF1AD [Cavia porcellus]
Length=165

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 72/137 (53%), Gaps = 13/137 (9%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTS-----QTQDIEDSSD  265
            KV   ++ VL  D VR  QK   WPE F     + +  N +         Q+   E  S+
Sbjct  79   KVKAEISFVLCKDHVRALQKEGFWPEAFSEVAEKDNNRNRQAQPELPAEPQSSGEESGSE  138

Query  264  DDGLPPLEANTNRLKPF  214
            DD    L  NTNR + F
Sbjct  139  DDS--DLFVNTNRRQYF  153



>gb|KFM27151.1| putative RNA-binding protein EIF1AD [Auxenochlorella protothecoides]
Length=129

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 67/121 (55%), Gaps = 12/121 (10%)
 Frame = -2

Query  567  IEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGRKVGCIVTQVLFYDQ  388
            +EV    G ++L + PA+F K +WIK GNF++V+E    +A  SG+     + +VL+ D 
Sbjct  1    MEVEFPCGRRTLCLIPARFHKKLWIKNGNFLIVEEVEAIDAAVSGQ-----IVKVLYADH  55

Query  387  VREYQKSPE-WPEIFKSAVVETSKENLERHTSQTQDIE------DSSDDDGLPPLEANTN  229
            V++ Q+ P  WPE F++A      +N      + +  E       SS+DDGLPPLE   N
Sbjct  56   VKQLQRIPGVWPEEFRAAGSPAVPDNPSMEQEKREAREPGCLDGSSSEDDGLPPLERINN  115

Query  228  R  226
            R
Sbjct  116  R  116



>ref|XP_533226.1| PREDICTED: probable RNA-binding protein EIF1AD isoform 1 [Canis 
lupus familiaris]
Length=166

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  QK   WPE F S V E    N  R T
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAF-SEVAEKHNNNRNRQT  121



>ref|XP_004437693.1| PREDICTED: probable RNA-binding protein EIF1AD isoform 1 [Ceratotherium 
simum simum]
 ref|XP_004437694.1| PREDICTED: probable RNA-binding protein EIF1AD isoform 2 [Ceratotherium 
simum simum]
Length=166

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  QK   WPE F S V E    N  R T
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAF-SEVAEKHNNNRNRQT  121



>ref|XP_001968629.1| GG24398 [Drosophila erecta]
 gb|EDV57688.1| GG24398 [Drosophila erecta]
Length=160

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 77/143 (54%), Gaps = 18/143 (13%)
 Frame = -2

Query  654  LKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFV  475
            +K   ++  A+  + Q I +V+  RG+N+ EV +   E+ L   P KF+KSMW+KRG+F+
Sbjct  15   MKEMMEDDYALPTETQQIARVLSSRGNNLHEV-ETVEERFLVSMPNKFRKSMWVKRGDFL  73

Query  474  VVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTS  295
            +V      E IE G KV   + +++  + ++EY K+  WP+ F      T K   E  +S
Sbjct  74   LV------EPIEEGDKVKAEICKIITTEHIKEYTKAGIWPDKF------TKKPVQEEASS  121

Query  294  QTQDIEDSSDDDGLPPLEANTNR  226
            Q +D  D  DD     L  NTNR
Sbjct  122  QNKDDSDFEDD-----LLPNTNR  139



>ref|XP_004051608.1| PREDICTED: probable RNA-binding protein EIF1AD isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004051609.1| PREDICTED: probable RNA-binding protein EIF1AD isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_004051610.1| PREDICTED: probable RNA-binding protein EIF1AD isoform 3 [Gorilla 
gorilla gorilla]
 ref|XP_004051611.1| PREDICTED: probable RNA-binding protein EIF1AD isoform 4 [Gorilla 
gorilla gorilla]
 ref|XP_004051612.1| PREDICTED: probable RNA-binding protein EIF1AD isoform 5 [Gorilla 
gorilla gorilla]
Length=166

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  QK   WPE F S V E    N  R T
Sbjct  79   KVKAEISFVLCKDHVRSLQKDGFWPEAF-SEVAEKHNNNRNRQT  121



>ref|NP_001088978.1| probable RNA-binding protein EIF1AD [Xenopus laevis]
 sp|Q5HZM1.1|EIF1A_XENLA RecName: Full=Probable RNA-binding protein EIF1AD; AltName: Full=Eukaryotic 
translation initiation factor 1A domain-containing 
protein [Xenopus laevis]
 gb|AAH88961.1| LOC496359 protein [Xenopus laevis]
Length=169

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 74/135 (55%), Gaps = 13/135 (10%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            QSI++V+   G+N+ EV  A GE+ LA  P KF+K++WIKRG+F++VD       I  G 
Sbjct  25   QSIVKVLGSPGNNLHEVETAEGERFLASMPTKFRKNIWIKRGDFLIVD------PIVEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIF---KSAVVETSKENLERHTSQTQ---DIEDSS  268
            KV   +  +L+ D  R  QK   WPE F   K+ +V   KE+    +++ Q     EDS 
Sbjct  79   KVKAEIAFILYKDHQRLLQKEGLWPEGFTQDKTGLVAKEKESSGIQSTEAQAKPQGEDSE  138

Query  267  DDDGLPPLEANTNRL  223
             DD    L  NTN +
Sbjct  139  TDDD-SGLFVNTNHV  152



>ref|XP_508567.2| PREDICTED: probable RNA-binding protein EIF1AD [Pan troglodytes]
 ref|XP_003828701.1| PREDICTED: probable RNA-binding protein EIF1AD [Pan paniscus]
 ref|XP_008952344.1| PREDICTED: probable RNA-binding protein EIF1AD [Pan paniscus]
 ref|XP_008952345.1| PREDICTED: probable RNA-binding protein EIF1AD [Pan paniscus]
 ref|XP_008952346.1| PREDICTED: probable RNA-binding protein EIF1AD [Pan paniscus]
 ref|XP_008952347.1| PREDICTED: probable RNA-binding protein EIF1AD [Pan paniscus]
Length=166

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  QK   WPE F S V E    N  R T
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGFWPEAF-SEVAEKHNNNRNRQT  121



>ref|NP_001127270.1| probable RNA-binding protein EIF1AD [Pongo abelii]
 ref|XP_002833668.1| PREDICTED: probable RNA-binding protein EIF1AD [Pongo abelii]
 sp|Q5RD29.1|EIF1A_PONAB RecName: Full=Probable RNA-binding protein EIF1AD; AltName: Full=Eukaryotic 
translation initiation factor 1A domain-containing 
protein [Pongo abelii]
 emb|CAH90328.1| hypothetical protein [Pongo abelii]
Length=166

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  QK   WPE F S V E    N  R T
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGFWPEAF-SEVAEKHNNNRNRQT  121



>sp|Q58CY2.1|EIF1A_BOVIN RecName: Full=Probable RNA-binding protein EIF1AD; AltName: Full=Eukaryotic 
translation initiation factor 1A domain-containing 
protein [Bos taurus]
 gb|AAX46662.1| hypothetical protein MGC11102 [Bos taurus]
 tpg|DAA13590.1| TPA: probable RNA-binding protein EIF1AD [Bos taurus]
Length=166

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 63/108 (58%), Gaps = 10/108 (9%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQ  286
            KV   ++ VL  D VR  QK   WPE F      T K+N +R   QTQ
Sbjct  79   KVKAEISFVLCKDHVRSLQKDGHWPEAFSQV---TEKDNNDR-NRQTQ  122



>ref|XP_010634230.1| PREDICTED: probable RNA-binding protein EIF1AD [Fukomys damarensis]
 ref|XP_010634231.1| PREDICTED: probable RNA-binding protein EIF1AD [Fukomys damarensis]
 gb|KFO28385.1| Putative RNA-binding protein EIF1AD [Fukomys damarensis]
Length=165

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  QK   WPE F S V E    N  R T
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGFWPEAF-SEVAEKHNSNRNRQT  121



>ref|XP_009006746.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X1 [Callithrix 
jacchus]
 ref|XP_009006747.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X1 [Callithrix 
jacchus]
 ref|XP_009006748.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X1 [Callithrix 
jacchus]
 ref|XP_009006749.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X1 [Callithrix 
jacchus]
Length=194

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 62/108 (57%), Gaps = 6/108 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQ  286
            KV   ++ VL  D +R  QK   WPE F   V + S  N + H +  Q
Sbjct  79   KVKAEISFVLCKDHMRSLQKQGLWPEAFSEVVEKHSNMNSQPHGAAGQ  126



>ref|XP_008820461.1| PREDICTED: probable RNA-binding protein EIF1AD [Nannospalax galili]
Length=165

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 75/132 (57%), Gaps = 12/132 (9%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVKVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETS---KENLERHTSQTQDIEDS-SDD  262
            KV   ++ VL  D VR  QK   WP  F     + S   ++N    +++ Q +E+S S+D
Sbjct  79   KVKAEISFVLCKDHVRSLQKDGLWPAAFSEEAEKHSSVNRQNQPELSAEPQLLEESGSED  138

Query  261  DGLPPLEANTNR  226
            D    L  NTNR
Sbjct  139  DS--DLFVNTNR  148



>ref|XP_008271697.1| PREDICTED: probable RNA-binding protein EIF1AD [Oryctolagus cuniculus]
Length=164

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   +  VL  D VR  Q+   WPE F SAV E    +  R T
Sbjct  79   KVKAEICFVLCKDHVRSLQREGRWPEAF-SAVAEDHSNSRSRQT  121



>ref|XP_004901769.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X3 [Heterocephalus 
glaber]
 ref|XP_004852404.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X3 [Heterocephalus 
glaber]
Length=164

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 72/135 (53%), Gaps = 18/135 (13%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTS-------QTQDIEDS  271
            KV   ++ VL  D VR  QK  E PE F S V E    N  R T        Q+   E  
Sbjct  79   KVKAEISFVLCKDHVRSLQK--EGPEAF-SEVAEKGSSNRNRQTQPELPAEPQSSGEESG  135

Query  270  SDDDGLPPLEANTNR  226
            S+DD    L  NTNR
Sbjct  136  SEDDS--DLFVNTNR  148



>ref|NP_001016696.1| probable RNA-binding protein EIF1AD [Xenopus (Silurana) tropicalis]
 sp|Q0V9J5.1|EIF1A_XENTR RecName: Full=Probable RNA-binding protein EIF1AD; AltName: Full=Eukaryotic 
translation initiation factor 1A domain-containing 
protein [Xenopus (Silurana) tropicalis]
 gb|AAI21519.1| hypothetical protein LOC549450 [Xenopus (Silurana) tropicalis]
Length=179

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 73/140 (52%), Gaps = 19/140 (14%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  + GE+ LA  P KF+K++WIKRG+F++VD       I  G 
Sbjct  25   QRIVKVLGSPGNNLHEVETSEGERFLASMPTKFRKNIWIKRGDFLIVD------PIAEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIF---KSAVVETSKEN--------LERHTSQTQD  283
            KV   +  +L+ D  R  QK   WPE F   K+ VV    EN        L    ++ Q 
Sbjct  79   KVKAEIAFILYKDHQRLLQKEGLWPEGFTQDKTGVVTKENENNGIQSTEALSTAQAKEQG  138

Query  282  IEDSSDDDGLPPLEANTNRL  223
             +  +DDD    L  NTNR+
Sbjct  139  EDSETDDDS--GLFVNTNRV  156



>ref|XP_008707249.1| PREDICTED: probable RNA-binding protein EIF1AD [Ursus maritimus]
 ref|XP_008707250.1| PREDICTED: probable RNA-binding protein EIF1AD [Ursus maritimus]
Length=166

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  QK   WPE F S + E    N  R T
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAF-SEMAEKQNNNRNRQT  121



>ref|XP_007438971.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X2 [Python 
bivittatus]
Length=167

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 74/140 (53%), Gaps = 8/140 (6%)
 Frame = -2

Query  636  EKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESG  457
            E+  +  + Q I++V+   G+N+ EV  A G++ L   P KF+K++WIKRG+F++VD   
Sbjct  16   EEYVVPSERQQIVRVLGTPGNNLHEVETAEGKRFLVSMPTKFRKNIWIKRGDFLLVD---  72

Query  456  REEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQT--QD  283
                IE G KV   ++ VL+ D VR  +K   WP+ F   V  T     ER   Q+  Q 
Sbjct  73   ---PIEEGEKVKAEISFVLYKDHVRYLKKEGYWPDAFLGDVKGTRSSTKEREGVQSPPQS  129

Query  282  IEDSSDDDGLPPLEANTNRL  223
              +   +D    L  NTNR+
Sbjct  130  SGEEDSEDDDTDLFVNTNRI  149



>gb|KFM80501.1| putative RNA-binding protein EIF1AD, partial [Stegodyphus mimosarum]
Length=151

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 70/136 (51%), Gaps = 20/136 (15%)
 Frame = -2

Query  633  KTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGR  454
            K  I  + Q I++V+   G+N+ E+    GE  L   P KF+K +WIKRG+FVV+D    
Sbjct  17   KYEITAENQKIVKVLRSCGNNLHEITTPEGETFLVSMPTKFRKHIWIKRGDFVVID----  72

Query  453  EEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIED  274
               I  G KV   + Q+L  DQ++ ++    WP+ F       S +N  RH+S       
Sbjct  73   --PITEGVKVKGEIAQILLKDQIKYFKDQGIWPDTFAE---NNSTKNERRHSS-------  120

Query  273  SSDDDGLPPLEANTNR  226
            +SDD+    L  NTNR
Sbjct  121  NSDDE----LFVNTNR  132



>ref|XP_005092024.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Aplysia 
californica]
Length=206

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 61/97 (63%), Gaps = 6/97 (6%)
 Frame = -2

Query  636  EKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESG  457
            E+  + +  + +++VV  RG+N+ EV+ + GEK L   P+KF+K +WIKRG+F++V    
Sbjct  35   EEYPLPEGSRQVVKVVASRGNNLHEVVTSRGEKFLVSMPSKFRKHVWIKRGDFILV----  90

Query  456  REEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIF  346
              E IE G KV   ++ +LF +Q++  Q+   WPE F
Sbjct  91   --EPIEEGDKVKAEISHILFKEQIKHIQEQNLWPEEF  125



>ref|XP_007438970.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X1 [Python 
bivittatus]
Length=168

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 76/141 (54%), Gaps = 9/141 (6%)
 Frame = -2

Query  636  EKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESG  457
            E+  +  + Q I++V+   G+N+ EV  A G++ L   P KF+K++WIKRG+F++VD   
Sbjct  16   EEYVVPSERQQIVRVLGTPGNNLHEVETAEGKRFLVSMPTKFRKNIWIKRGDFLLVD---  72

Query  456  REEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVET---SKENLERHTSQTQ  286
                IE G KV   ++ VL+ D VR  +K   WP+ F   V  T   +KE+ E   S  Q
Sbjct  73   ---PIEEGEKVKAEISFVLYKDHVRYLKKEGYWPDAFLGDVKGTRSSTKESREGVQSPPQ  129

Query  285  DIEDSSDDDGLPPLEANTNRL  223
               +   +D    L  NTNR+
Sbjct  130  SSGEEDSEDDDTDLFVNTNRI  150



>emb|CDQ79129.1| unnamed protein product [Oncorhynchus mykiss]
Length=198

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 6/90 (7%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            + Q I++V+  RG+N+ E + A GE  L   P KF+K++WIKRG++V+VD       IE 
Sbjct  24   ENQQIVRVLGSRGNNLHEAVTAQGENFLISMPPKFRKNLWIKRGDYVIVD------PIEE  77

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWPEIF  346
            G KV   ++ +L+ D ++  QK   WPE F
Sbjct  78   GEKVRGEISFILYRDHIQHLQKLTLWPEAF  107



>ref|XP_001989084.1| GH10238 [Drosophila grimshawi]
 gb|EDW03951.1| GH10238 [Drosophila grimshawi]
Length=158

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 76/145 (52%), Gaps = 21/145 (14%)
 Frame = -2

Query  654  LKRAGKEKTAILQQGQSIMQVVDLRGSNI--IEVLDANGEKSLAIFPAKFQKSMWIKRGN  481
            LK   ++  ++    Q I++VV  RG+N+  +E    + +  L   P KF+K++W+KRG+
Sbjct  13   LKEMMEDDYSLPTDQQQIVRVVSSRGNNLHEVEAPTTDADNFLVSMPNKFRKNVWVKRGD  72

Query  480  FVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERH  301
            +++V      E IE G KV   ++++L  + V+EY KS  WPE F            ++ 
Sbjct  73   YLLV------EPIEEGDKVKAEISKILTPEHVKEYTKSGIWPERF-----------AKKA  115

Query  300  TSQTQDIEDSSDDDGLPPLEANTNR  226
            T   Q  + +SD D   PL  NTNR
Sbjct  116  TQAPQRTDSNSDSDE--PLSPNTNR  138



>ref|XP_006036924.1| PREDICTED: probable RNA-binding protein EIF1AD [Alligator sinensis]
Length=163

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 68/131 (52%), Gaps = 12/131 (9%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++VV   G+N+ EV    G + LA  P KF+ ++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVVGSPGNNLHEVEAPGGGRFLASMPPKFRHNLWIKRGDFLLVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAV-VETSKENLERHTSQTQDIEDSSDDDGL  253
            KV   ++ VL+ D +R  Q+   WPE F  A     S ++        Q+ EDS  D   
Sbjct  79   KVKAEISFVLYKDHMRYLQQEGLWPEAFSDAPNRRPSPQSRVGEPPAAQEDEDSDSD---  135

Query  252  PPLEANTNRLK  220
              L  N NRL+
Sbjct  136  --LFVNPNRLR  144



>ref|XP_007091923.1| PREDICTED: probable RNA-binding protein EIF1AD [Panthera tigris 
altaica]
Length=166

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 62/111 (56%), Gaps = 7/111 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIE  277
            KV   ++ VL  D VR  QK   WPE F S V E    +  R T     +E
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAF-SEVAEKHNNSRNRQTPPELPVE  128



>ref|XP_002755658.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X2 [Callithrix 
jacchus]
 ref|XP_009006750.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X2 [Callithrix 
jacchus]
Length=166

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 61/104 (59%), Gaps = 8/104 (8%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D +R  QK   WPE F   V + S  N+ R T
Sbjct  79   KVKAEISFVLCKDHMRSLQKQGLWPEAFSEVVEKHS--NMNRQT  120



>ref|XP_003993702.1| PREDICTED: probable RNA-binding protein EIF1AD [Felis catus]
Length=166

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 62/111 (56%), Gaps = 7/111 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIE  277
            KV   ++ VL  D VR  QK   WPE F S V E    +  R T     +E
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAF-SEVAEKHNNSRNRQTPPELPVE  128



>ref|XP_006210711.1| PREDICTED: probable RNA-binding protein EIF1AD [Vicugna pacos]
Length=166

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  QK   WPE F S V E    +  R T
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAF-SQVAEKHSNSRNRQT  121



>ref|XP_001697455.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
 gb|EDP00117.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
Length=197

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 71/120 (59%), Gaps = 9/120 (8%)
 Frame = -2

Query  612  GQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESG  433
            GQ+I++ +  RGSN+IEV   +G ++L + PAKF K +W+KRG FV+V++S + E     
Sbjct  22   GQAIVRALGSRGSNVIEVEFPDGRQTLVLMPAKFNKKLWVKRGGFVMVEDSAQAEG---D  78

Query  432  RKVGCIVTQVLFYDQVREYQKSPE-WPEIFKSAVVETSKENLERHTSQTQDIEDSSDDDG  256
             KV   +  VL+ DQ+++ QK    WP+ F     +  K +LE     + D E+S  ++G
Sbjct  79   TKVTGTIVSVLYDDQIKQLQKMEGVWPKEF----AKDGKASLEDMMPPS-DSEESDQEEG  133



>ref|XP_006771634.1| PREDICTED: probable RNA-binding protein EIF1AD [Myotis davidii]
 gb|ELK24318.1| Putative RNA-binding protein EIF1AD [Myotis davidii]
Length=165

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 60/104 (58%), Gaps = 8/104 (8%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVKVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  QK   WPE F+  V E    N  R T
Sbjct  79   KVKAEISFVLCKDHVRSLQKDGLWPEAFE--VAEKHNNNRNRPT  120



>dbj|GAM27717.1| hypothetical protein SAMD00019534_108930 [Acytostelium subglobosum 
LB1]
Length=153

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 67/128 (52%), Gaps = 13/128 (10%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            QSI++++DLRG NI+EV   +G   LA+ P KF+  +WIK GN+ +V+   REE  E+  
Sbjct  23   QSIVKIIDLRGGNIVEVQYPDGATVLAMIPTKFKGKLWIKLGNYAIVE---REE--ETTS  77

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIEDSSDDDGLP  250
            KV   +  ++  D ++  +K   WP  F   V        ++ T   +D  DS  D GL 
Sbjct  78   KVRTSIVHLISADNLKYMKKQGIWPSEFDDVV--------QKQTLVQEDNGDSDSDGGLD  129

Query  249  PLEANTNR  226
             +  N N 
Sbjct  130  SMGFNPNH  137



>ref|XP_005811172.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Xiphophorus 
maculatus]
Length=179

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 6/90 (7%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            + Q I++V   RG+N+ E + A GE  L   P KF+K++WIKRG++V+VD       IE 
Sbjct  23   ENQQIVKVTGSRGNNLHETITAQGETFLVSMPTKFRKNIWIKRGDYVIVD------PIEE  76

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWPEIF  346
            G KV   ++ +L+ D ++  QK   WPE F
Sbjct  77   GEKVKAEISFILYKDHIQYLQKQQLWPEGF  106



>ref|XP_006149985.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X1 [Tupaia 
chinensis]
 ref|XP_006149986.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X2 [Tupaia 
chinensis]
 ref|XP_006149987.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X3 [Tupaia 
chinensis]
 gb|ELW65138.1| putative RNA-binding protein EIF1AD [Tupaia chinensis]
Length=167

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 6/99 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
            KV   ++ VL  D VR  QK   WPE F     + +  N
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGHWPEAFSEVAEKQNNRN  117



>ref|XP_006893481.1| PREDICTED: probable RNA-binding protein EIF1AD [Elephantulus 
edwardii]
Length=140

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 55/88 (63%), Gaps = 6/88 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIF  346
            KV   ++ VL+ D VR  QK   WPE F
Sbjct  79   KVKAEISFVLYKDHVRALQKEGLWPEAF  106



>ref|XP_008613654.1| hypothetical protein SDRG_09494 [Saprolegnia diclina VS20]
 ref|XP_008613655.1| hypothetical protein, variant [Saprolegnia diclina VS20]
 gb|EQC32968.1| hypothetical protein SDRG_09494 [Saprolegnia diclina VS20]
 gb|EQC32969.1| hypothetical protein, variant [Saprolegnia diclina VS20]
Length=200

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 68/119 (57%), Gaps = 6/119 (5%)
 Frame = -2

Query  612  GQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESG  433
            G+ I+QV  LRG N+ EV    G+K LA+ P K++K +WI+RG+F++V  SG ++A +  
Sbjct  28   GELIVQVKSLRGGNLFEVETPTGDKGLAMLPTKYRKLIWIRRGDFLIV--SGADDAKKGA  85

Query  432  RKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIEDSSDDDG  256
              V   V  +L+ DQ++  +    WP++F     ET +E  E  ++    + D S  +G
Sbjct  86   --VNFSVEHILYKDQIKNLKAKDLWPDVFVED--ETKREYDESLSALADKVADVSQGNG  140



>ref|XP_008280428.1| PREDICTED: probable RNA-binding protein EIF1AD [Stegastes partitus]
Length=180

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 6/90 (7%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            + Q I++V   RG+N+ E + A G+  L   P KF+K++WIKRG++V+VD       IE 
Sbjct  23   ENQQIVKVTGSRGNNLHETVTAQGDTFLVSMPTKFRKNIWIKRGDYVIVD------PIEE  76

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWPEIF  346
            G KV   +T +L+ D ++  QK   WPE F
Sbjct  77   GEKVKAEITVILYKDHIQYLQKQQLWPEGF  106



>ref|XP_010765813.1| PREDICTED: probable RNA-binding protein EIF1AD [Notothenia coriiceps]
Length=179

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 70/136 (51%), Gaps = 14/136 (10%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            + Q I++V   RG+N+ E + A G   L   P KF+K++WIKRG++V+VD       IE 
Sbjct  23   ENQQIVKVTGSRGNNLHEAVTAQGVTFLVSMPPKFRKNLWIKRGDYVIVD------PIEE  76

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSK------ENLERHTSQTQDIED  274
            G KV   ++ +L+ D ++  QK   WPE F    +E  K      +  +      +D  D
Sbjct  77   GEKVKAEISFILYKDHIQNLQKQQLWPEGFTEEPLEPEKIKKGQEKREDTEDKDEEDFSD  136

Query  273  SSDDDGLPPLEANTNR  226
            S DD+    L  NTNR
Sbjct  137  SEDDES--DLFVNTNR  150



>ref|XP_007568418.1| PREDICTED: probable RNA-binding protein EIF1AD [Poecilia formosa]
 ref|XP_008418048.1| PREDICTED: probable RNA-binding protein EIF1AD [Poecilia reticulata]
Length=178

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 6/90 (7%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            + Q I++V   RG+N+ E + A GE  L   P KF+K++WIKRG++V+VD       IE 
Sbjct  23   ENQQIVKVTGSRGNNLHEAVTAQGETFLVSMPTKFRKNIWIKRGDYVIVD------PIEE  76

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWPEIF  346
            G KV   ++ +L+ D ++  QK   WPE F
Sbjct  77   GEKVKAEISFILYKDHIQYLQKQQLWPEGF  106



>ref|XP_007648227.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X2 [Cricetulus 
griseus]
 ref|XP_007608904.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X2 [Cricetulus 
griseus]
Length=139

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 59/103 (57%), Gaps = 6/103 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVKVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERH  301
            KV   ++ VL  + VR  QK   WPE F     + +  N + H
Sbjct  79   KVKAEISFVLCKNHVRSLQKEGHWPEAFSEVAEKQNSMNRQYH  121



>ref|XP_005064072.1| PREDICTED: probable RNA-binding protein EIF1AD [Mesocricetus 
auratus]
Length=168

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 72/135 (53%), Gaps = 17/135 (13%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVKVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTS-------QTQDIEDS  271
            KV   ++ VL  + VR  QK   WPE F S V E  + N+ R +        Q    E  
Sbjct  79   KVKAEISFVLCKNHVRSLQKEGHWPEAF-SEVAE-KQNNMNRQSQPELPAEPQLSGDESG  136

Query  270  SDDDGLPPLEANTNR  226
            S+DD    L  NTN 
Sbjct  137  SEDDS--DLFVNTNH  149



>ref|XP_004264439.1| PREDICTED: probable RNA-binding protein EIF1AD [Orcinus orca]
Length=165

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 58/99 (59%), Gaps = 6/99 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAEGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
            KV   ++ VL  D VR  QK   WPE F     + + +N
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAFSEVAEKHNNQN  117



>emb|CBK22524.2| unnamed protein product [Blastocystis hominis]
Length=182

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -2

Query  624  ILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEA  445
            + ++G+SI ++   RG N+ EV   NGEK LA+ P KF K +W+KRG++V+V ES  +  
Sbjct  24   VPKEGESIARISIGRGGNVFEVELPNGEKQLALLPTKFNKLIWMKRGDYVIVTESEGQFT  83

Query  444  IESGRK--VGCIVTQVLFYDQVREYQKSPEWPE  352
              SG++  V  ++  +L  DQ+   +K   WP+
Sbjct  84   TASGKQNGVSSLIEHILMKDQIHHIKKEGLWPK  116



>ref|XP_007462030.1| PREDICTED: probable RNA-binding protein EIF1AD [Lipotes vexillifer]
Length=165

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 58/99 (59%), Gaps = 6/99 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAEGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
            KV   ++ VL  D VR  QK   WPE F     + + +N
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAFSEVAEKHNNQN  117



>ref|XP_004563246.1| PREDICTED: probable RNA-binding protein EIF1AD-like isoform X1 
[Maylandia zebra]
 ref|XP_004563247.1| PREDICTED: probable RNA-binding protein EIF1AD-like isoform X2 
[Maylandia zebra]
Length=175

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 63/106 (59%), Gaps = 8/106 (8%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            + Q I++V   RG+N+ + + A GE  L   P KF+K++WIKRG++V+VD       IE 
Sbjct  23   ENQQIVKVTGSRGNNLHDAVTAQGETFLVSMPTKFRKNIWIKRGDYVIVD------PIEE  76

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWPEIF--KSAVVETSKENLER  304
            G KV   ++ +L+ D ++  QK   WPE F  + +  + +K+ LE+
Sbjct  77   GEKVKAEISFILYKDHIQYLQKQNLWPEGFMDEHSTQDKTKKKLEK  122



>ref|XP_004656526.1| PREDICTED: probable RNA-binding protein EIF1AD [Jaculus jaculus]
Length=165

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 60/104 (58%), Gaps = 8/104 (8%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+KF+K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVKVLRTPGNNLHEVETAQGQRFLVSMPSKFRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  +K   WPE F    V+    N+ R +
Sbjct  79   KVKAEISFVLCKDHVRSLKKDGRWPEAFSE--VDEKHNNINRQS  120



>ref|XP_005719522.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Pundamilia 
nyererei]
 ref|XP_005916684.1| PREDICTED: probable RNA-binding protein EIF1AD-like isoform X1 
[Haplochromis burtoni]
 ref|XP_005916685.1| PREDICTED: probable RNA-binding protein EIF1AD-like isoform X2 
[Haplochromis burtoni]
Length=177

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 63/106 (59%), Gaps = 8/106 (8%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            + Q I++V   RG+N+ + + A GE  L   P KF+K++WIKRG++V+VD       IE 
Sbjct  23   ENQQIVKVTGSRGNNLHDAVTAQGETFLVSMPTKFRKNIWIKRGDYVIVD------PIEE  76

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWPEIF--KSAVVETSKENLER  304
            G KV   ++ +L+ D ++  QK   WPE F  + +  + +K+ LE+
Sbjct  77   GEKVKAEISFILYKDHIQYLQKQNLWPEGFMDEHSTQDKTKKKLEK  122



>ref|XP_003419627.1| PREDICTED: probable RNA-binding protein EIF1AD [Loxodonta africana]
Length=166

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 59/104 (57%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G+  L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQHFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  QK   WPE F S V E    +  R T
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAF-SEVAEKHNNSRNRQT  121



>ref|XP_006980664.1| PREDICTED: probable RNA-binding protein EIF1AD [Peromyscus maniculatus 
bairdii]
Length=171

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 72/135 (53%), Gaps = 17/135 (13%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVKVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTS-------QTQDIEDS  271
            KV   ++ VL  + VR  QK   WPE F S V E  + N+ R +        Q    E  
Sbjct  79   KVKAEISFVLCKNHVRSLQKEGHWPEAF-SEVAE-KQNNINRQSQPELPTGPQLSGEESG  136

Query  270  SDDDGLPPLEANTNR  226
            S+DD    L  NTN 
Sbjct  137  SEDDS--DLFVNTNH  149



>ref|XP_005190715.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Musca domestica]
Length=170

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 75/123 (61%), Gaps = 11/123 (9%)
 Frame = -2

Query  654  LKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDAN--GEKSLAIFPAKFQKSMWIKRGN  481
            LK   ++   + ++ Q I++VV  RG+N+ EV  AN   E+ L   P KF+K++W+KRG+
Sbjct  11   LKEMMEDDYELPKENQQIVRVVCSRGNNLHEVETANVDDERFLVTMPNKFRKNVWVKRGD  70

Query  480  FVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERH  301
            F++V      E IE G KV   + ++L  + ++EY+K+  WPE F    ++++KEN + +
Sbjct  71   FILV------EPIEEGDKVKGEICKILTPEHIKEYKKAGVWPERF---AMKSNKENYQTN  121

Query  300  TSQ  292
             ++
Sbjct  122  AAK  124



>ref|XP_006781910.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Neolamprologus 
brichardi]
Length=177

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 63/106 (59%), Gaps = 8/106 (8%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            + Q I++V   RG+N+ + + A GE  L   P KF+K++WIKRG++V+VD       IE 
Sbjct  23   ENQQIVKVTGSRGNNLHDAVTAQGETFLVSMPTKFRKNIWIKRGDYVIVD------PIEE  76

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWPEIF--KSAVVETSKENLER  304
            G KV   ++ +L+ D ++  QK   WPE F  + +  + +K+ LE+
Sbjct  77   GEKVKAEISFILYKDHIQYLQKQNLWPEGFMDEHSTPDKTKKELEK  122



>ref|XP_004311800.1| PREDICTED: probable RNA-binding protein EIF1AD [Tursiops truncatus]
Length=165

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 58/99 (59%), Gaps = 6/99 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAEGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
            KV   ++ VL  D VR  QK   WPE F     + + +N
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNQN  117



>ref|XP_003509487.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X1 [Cricetulus 
griseus]
 ref|XP_007648226.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X1 [Cricetulus 
griseus]
 gb|EGV99355.1| putative RNA-binding protein EIF1AD [Cricetulus griseus]
 gb|ERE77860.1| putative RNA-binding protein EIF1AD-like protein [Cricetulus 
griseus]
Length=171

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 64/118 (54%), Gaps = 6/118 (5%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVKVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIEDSSDDDG  256
            KV   ++ VL  + VR  QK   WPE F     + +  N +       + + S D+ G
Sbjct  79   KVKAEISFVLCKNHVRSLQKEGHWPEAFSEVAEKQNSMNRQSQPELPAEPQLSGDESG  136



>ref|XP_006860966.1| PREDICTED: probable RNA-binding protein EIF1AD [Chrysochloris 
asiatica]
Length=165

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 57/99 (58%), Gaps = 6/99 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLKTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
            KV   ++ VL  D VR  QK   WPE F     + S  N
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAFSEVAEKHSIRN  117



>ref|XP_001844517.1| obelix [Culex quinquefasciatus]
 gb|EDS37307.1| obelix [Culex quinquefasciatus]
Length=160

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 78/146 (53%), Gaps = 28/146 (19%)
 Frame = -2

Query  654  LKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDA---NGEKSLAIFPAKFQKSMWIKRG  484
            LK    ++  + +  QSI+++V  RG+N+ EV  A   +GE+ L   P KF+K++WIKRG
Sbjct  11   LKEQEADEFDVPKDNQSIVRIVASRGNNLHEVESAAEGDGERFLVSMPVKFRKNVWIKRG  70

Query  483  NFVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLER  304
            +FV+V      E IE G KV   + ++L  + ++ ++K   WP+ F              
Sbjct  71   DFVLV------EPIEEGNKVKAEICRILTAEHIKLFEKEGVWPKRF--------------  110

Query  303  HTSQTQDIEDSSDDDGLPPLEANTNR  226
              ++ +++ED  D DGL     NTNR
Sbjct  111  --TRKRELEDDLDADGLV---RNTNR  131



>gb|EFB26195.1| hypothetical protein PANDA_004772 [Ailuropoda melanoleuca]
Length=115

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIF  346
            KV   ++ VL  D VR  QK   WPE F
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAF  106



>ref|XP_003798735.1| PREDICTED: probable RNA-binding protein EIF1AD [Otolemur garnettii]
Length=164

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 6/99 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
            KV   ++ VL  D VR  QK   WPE F     + +  N
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAFSEVAKKHNNRN  117



>ref|XP_003702317.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Megachile 
rotundata]
Length=149

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 75/139 (54%), Gaps = 23/139 (17%)
 Frame = -2

Query  636  EKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESG  457
            E  ++  + QSI+++++ RG+N+ EV +A G++ L   P KF++++W+KRG+FV+V    
Sbjct  15   EDLSVPTESQSIVRIIESRGNNLHEVENATGDQYLVSMPTKFRRNIWVKRGDFVLV----  70

Query  456  REEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIE  277
              E I  G KV   + ++L  +  + Y+K   WP  F  +             +  +D E
Sbjct  71   --EPIPEGDKVKAEIVKILTQEHKKWYRKQNCWPREFDES------------ANAKEDAE  116

Query  276  DSSDDDGLPPLEANTNRLK  220
            + SDD     +  NTNR++
Sbjct  117  EESDD-----IFVNTNRIQ  130



>ref|NP_081512.1| probable RNA-binding protein EIF1AD [Mus musculus]
 sp|Q3THJ3.2|EIF1A_MOUSE RecName: Full=Probable RNA-binding protein EIF1AD; AltName: Full=Eukaryotic 
translation initiation factor 1A domain-containing 
protein [Mus musculus]
 gb|AAH24640.1| Eukaryotic translation initiation factor 1A domain containing 
[Mus musculus]
 dbj|BAE31794.1| unnamed protein product [Mus musculus]
 dbj|BAE34752.1| unnamed protein product [Mus musculus]
 dbj|BAE40465.1| unnamed protein product [Mus musculus]
 gb|EDL33116.1| RIKEN cDNA 2010003J03 [Mus musculus]
Length=170

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 58/101 (57%), Gaps = 6/101 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVKVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLE  307
            KV   ++ VL  + VR  QK   WPE F     + +  N E
Sbjct  79   KVKAEISFVLCKNHVRSLQKEGHWPEAFSEVAEKQNNMNRE  119



>ref|XP_007171039.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007171040.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X2 [Balaenoptera 
acutorostrata scammoni]
Length=165

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 6/99 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
            KV   ++ VL  D VR  QK   WPE F     + +  N
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAFSEVAEKHNNRN  117



>pdb|2DGY|A Chain A, Solution Structure Of The Eukaryotic Initiation Factor 
1a In Mgc11102 Protein
Length=111

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  16   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  69

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIF  346
            KV   ++ VL  D VR  QK   WPE F
Sbjct  70   KVKAEISFVLCKDHVRSLQKEGFWPEAF  97



>ref|XP_010346650.1| PREDICTED: probable RNA-binding protein EIF1AD [Saimiri boliviensis 
boliviensis]
 ref|XP_010346651.1| PREDICTED: probable RNA-binding protein EIF1AD [Saimiri boliviensis 
boliviensis]
 ref|XP_010346652.1| PREDICTED: probable RNA-binding protein EIF1AD [Saimiri boliviensis 
boliviensis]
 ref|XP_010346653.1| PREDICTED: probable RNA-binding protein EIF1AD [Saimiri boliviensis 
boliviensis]
Length=165

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 61/104 (59%), Gaps = 8/104 (8%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D +R  QK   WPE F S V E    N+ R T
Sbjct  79   KVKAEISFVLCKDHMRSLQKQGLWPEAF-SEVAEKHN-NMNRQT  120



>ref|XP_007128281.1| PREDICTED: probable RNA-binding protein EIF1AD [Physeter catodon]
Length=165

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 6/99 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAEGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
            KV   ++ VL  D VR  QK   WPE F     + +  N
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAFSEVAEKHNNRN  117



>ref|XP_006911142.1| PREDICTED: probable RNA-binding protein EIF1AD [Pteropus alecto]
 gb|ELK13320.1| Putative RNA-binding protein EIF1AD [Pteropus alecto]
Length=164

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 6/99 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
            KV   ++ VL  D VR  QK   WPE F     + +  N
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAFSEVAEKHNNRN  117



>gb|EFA83297.1| hypothetical protein PPL_04087 [Polysphondylium pallidum PN500]
Length=168

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 55/87 (63%), Gaps = 5/87 (6%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            +GQSI++++ LRG NI +V  ANG   LA+ P+KF+  +WIK+G + ++     E+  E+
Sbjct  21   EGQSIVKIIGLRGGNITDVQYANGSTVLAMIPSKFKGKLWIKKGAYAII-----EKEDET  75

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWP  355
             +K+   +  +L  D V+  +KS EWP
Sbjct  76   TKKIRTSIVHLLTPDNVKYIKKSNEWP  102



>ref|XP_005351780.1| PREDICTED: probable RNA-binding protein EIF1AD [Microtus ochrogaster]
Length=168

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 6/99 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVKVLRTPGNNLHEVETAEGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
            KV   ++ VL  + VR  QK   WPE F     + S  N
Sbjct  79   KVKAEISFVLCKNHVRSLQKEGHWPEAFSEVTEKQSNMN  117



>ref|XP_004770037.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X1 [Mustela 
putorius furo]
 ref|XP_004770038.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X2 [Mustela 
putorius furo]
 ref|XP_004770039.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X3 [Mustela 
putorius furo]
 ref|XP_004770040.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X4 [Mustela 
putorius furo]
 ref|XP_004808288.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X1 [Mustela 
putorius furo]
 ref|XP_004808289.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X2 [Mustela 
putorius furo]
 ref|XP_004808290.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X3 [Mustela 
putorius furo]
 ref|XP_004808291.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X4 [Mustela 
putorius furo]
 ref|XP_004808292.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X5 [Mustela 
putorius furo]
Length=165

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 6/99 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
            KV   ++ VL  D VR  QK   WPE F     + +  N
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAFSEVAEKHNNRN  117



>gb|ABD57202.1| hypothetical protein MGC11102 [Bos taurus]
Length=137

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 56/99 (57%), Gaps = 7/99 (7%)
 Frame = -2

Query  594  VVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGRKVGCI  415
            V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G KV   
Sbjct  1    VLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGEKVKAE  54

Query  414  VTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            ++ VL  D VR  QK   WPE F S V E    +  R T
Sbjct  55   ISFVLCKDHVRSLQKDGHWPEAF-SQVTEKDNNDRNRQT  92



>ref|XP_004383964.1| PREDICTED: probable RNA-binding protein EIF1AD [Trichechus manatus 
latirostris]
Length=170

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 6/99 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
            KV   ++ VL  D VR  QK   WPE F     + +  N
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAFSEVAEKHNSRN  117



>ref|NP_001008306.1| probable RNA-binding protein EIF1AD [Rattus norvegicus]
 sp|Q5RKI6.1|EIF1A_RAT RecName: Full=Probable RNA-binding protein EIF1AD; AltName: Full=Eukaryotic 
translation initiation factor 1A domain-containing 
protein [Rattus norvegicus]
 gb|AAH85818.1| Eukaryotic translation initiation factor 1A domain containing 
[Rattus norvegicus]
 gb|EDM12475.1| similar to 2010003J03Rik protein, isoform CRA_a [Rattus norvegicus]
Length=167

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 58/101 (57%), Gaps = 6/101 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVKVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLE  307
            KV   ++ VL  + VR  QK   WPE F     + +  N E
Sbjct  79   KVKAEISFVLCKNHVRSLQKEGHWPEAFSEVAEKQNNVNRE  119



>ref|XP_005864329.1| PREDICTED: probable RNA-binding protein EIF1AD [Myotis brandtii]
 ref|XP_006101645.1| PREDICTED: probable RNA-binding protein EIF1AD [Myotis lucifugus]
 gb|EPQ06550.1| Putative RNA-binding protein EIF1AD [Myotis brandtii]
Length=165

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 60/104 (58%), Gaps = 8/104 (8%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  D VR  +K   WPE F+  V E    N  R T
Sbjct  79   KVKAEISFVLCKDHVRSLKKDGLWPEAFE--VAEKHNNNRNRPT  120



>ref|XP_002916670.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Ailuropoda 
melanoleuca]
Length=166

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIF  346
            KV   ++ VL  D VR  QK   WPE F
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAF  106



>ref|NP_001181454.1| probable RNA-binding protein EIF1AD [Macaca mulatta]
 ref|XP_001111740.1| PREDICTED: probable RNA-binding protein EIF1AD-like isoform 2 
[Macaca mulatta]
 gb|EHH22673.1| Eukaryotic translation initiation factor 1A domain-containing 
protein [Macaca mulatta]
Length=165

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 6/99 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
            KV   ++ VL  D VR  QK   WPE F     + +  N
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNRN  117



>ref|XP_006129731.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X3 [Pelodiscus 
sinensis]
Length=174

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 58/106 (55%), Gaps = 6/106 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G + L   P KF+K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLGTPGNNLHEVETAEGTRFLVSMPTKFRKNIWIKRGDFLLVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQ  292
            KV   +  VL+ D +R  +K   WPE F S   E+   +  R   Q
Sbjct  79   KVKAEINFVLYKDHMRYLKKEGLWPEAFSSDTAESQPSSEAREEQQ  124



>emb|CCI47563.1| unnamed protein product [Albugo candida]
Length=169

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 65/119 (55%), Gaps = 7/119 (6%)
 Frame = -2

Query  603  IMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGRKV  424
            ++ VV  RGSNI EVL  NG+ SL + P +F K +WIKRG+F++V     E  +++   V
Sbjct  17   VVCVVASRGSNIFEVLHTNGQASLTMLPQRFHKLIWIKRGDFLIVTFGDTE--VDNKDAV  74

Query  423  GCIVTQVLFYDQVREYQKSPEWPEIF---KSAVVETSK--ENLERHTSQTQDIEDSSDD  262
              +V  +L+ DQ++  ++   WP  F    S  ++  +  E L    S  +D+E  S D
Sbjct  75   KSMVLHILYKDQIKHLKRKQLWPSEFYNVDSGWLDRQRPLEPLSNEASHPKDLEARSTD  133



>ref|XP_003122556.1| PREDICTED: probable RNA-binding protein EIF1AD-like isoformX1 
[Sus scrofa]
 ref|XP_003122557.1| PREDICTED: probable RNA-binding protein EIF1AD-like isoformX2 
[Sus scrofa]
 ref|XP_003353821.1| PREDICTED: probable RNA-binding protein EIF1AD-like isoformX1 
[Sus scrofa]
 ref|XP_003353822.1| PREDICTED: probable RNA-binding protein EIF1AD-like isoformX2 
[Sus scrofa]
 ref|XP_005660729.1| PREDICTED: probable RNA-binding protein EIF1AD-like isoform X3 
[Sus scrofa]
 ref|XP_005660731.1| PREDICTED: probable RNA-binding protein EIF1AD-like isoform X3 
[Sus scrofa]
Length=166

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G+  L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQHFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHT  298
            KV   ++ VL  + VR  QK   WP+ F S V E   +N  R T
Sbjct  79   KVKAEISFVLCRNHVRALQKEGLWPQAF-SEVAEKHDDNSNRQT  121



>gb|EHH56067.1| Eukaryotic translation initiation factor 1A domain-containing 
protein [Macaca fascicularis]
Length=165

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 6/99 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
            KV   ++ VL  D VR  QK   WPE F     + +  N
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNRN  117



>ref|NP_115701.2| probable RNA-binding protein EIF1AD [Homo sapiens]
 ref|NP_001229411.1| probable RNA-binding protein EIF1AD [Homo sapiens]
 ref|NP_001229410.1| probable RNA-binding protein EIF1AD [Homo sapiens]
 ref|NP_001229412.1| probable RNA-binding protein EIF1AD [Homo sapiens]
 ref|NP_001229413.1| probable RNA-binding protein EIF1AD [Homo sapiens]
 ref|NP_001229414.1| probable RNA-binding protein EIF1AD [Homo sapiens]
 ref|NP_001229415.1| probable RNA-binding protein EIF1AD [Homo sapiens]
 ref|NP_001270921.1| probable RNA-binding protein EIF1AD [Macaca fascicularis]
 ref|XP_003909586.1| PREDICTED: probable RNA-binding protein EIF1AD [Papio anubis]
 ref|XP_003909587.1| PREDICTED: probable RNA-binding protein EIF1AD [Papio anubis]
 ref|XP_005577254.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X1 [Macaca 
fascicularis]
 ref|XP_007977303.1| PREDICTED: probable RNA-binding protein EIF1AD [Chlorocebus sabaeus]
 ref|XP_007977384.1| PREDICTED: probable RNA-binding protein EIF1AD [Chlorocebus sabaeus]
 ref|XP_007977471.1| PREDICTED: probable RNA-binding protein EIF1AD [Chlorocebus sabaeus]
 ref|XP_007977531.1| PREDICTED: probable RNA-binding protein EIF1AD [Chlorocebus sabaeus]
 ref|XP_007977595.1| PREDICTED: probable RNA-binding protein EIF1AD [Chlorocebus sabaeus]
 ref|XP_009183869.1| PREDICTED: probable RNA-binding protein EIF1AD [Papio anubis]
 ref|XP_010364740.1| PREDICTED: probable RNA-binding protein EIF1AD [Rhinopithecus 
roxellana]
 ref|XP_010364741.1| PREDICTED: probable RNA-binding protein EIF1AD [Rhinopithecus 
roxellana]
 ref|XP_010364742.1| PREDICTED: probable RNA-binding protein EIF1AD [Rhinopithecus 
roxellana]
 ref|XP_010364743.1| PREDICTED: probable RNA-binding protein EIF1AD [Rhinopithecus 
roxellana]
 sp|Q8N9N8.1|EIF1A_HUMAN RecName: Full=Probable RNA-binding protein EIF1AD; AltName: Full=Eukaryotic 
translation initiation factor 1A domain-containing 
protein; AltName: Full=Haponin [Homo sapiens]
 sp|Q4R354.1|EIF1A_MACFA RecName: Full=Probable RNA-binding protein EIF1AD; AltName: Full=Eukaryotic 
translation initiation factor 1A domain-containing 
protein [Macaca fascicularis]
 dbj|BAC04293.1| unnamed protein product [Homo sapiens]
 dbj|BAE02465.1| unnamed protein product [Macaca fascicularis]
 gb|EAW74478.1| hypothetical protein MGC11102, isoform CRA_a [Homo sapiens]
 gb|EAW74479.1| hypothetical protein MGC11102, isoform CRA_a [Homo sapiens]
 gb|EAW74480.1| hypothetical protein MGC11102, isoform CRA_a [Homo sapiens]
 gb|EAW74481.1| hypothetical protein MGC11102, isoform CRA_a [Homo sapiens]
 gb|EAW74482.1| hypothetical protein MGC11102, isoform CRA_a [Homo sapiens]
 dbj|BAG34832.1| unnamed protein product [Homo sapiens]
Length=165

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 6/99 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
            KV   ++ VL  D VR  QK   WPE F     + +  N
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNRN  117



>gb|AAH05131.1| EIF1AD protein [Homo sapiens]
 gb|ADQ32823.1| hypothetical protein MGC11102 [synthetic construct]
 gb|AIC57326.1| EIF1AD, partial [synthetic construct]
Length=165

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 6/99 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
            KV   ++ VL  D VR  QK   WPE F     + +  N
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNRN  117



>ref|XP_001689185.1| AGAP010181-PA [Anopheles gambiae str. PEST]
 gb|EDO63458.1| AGAP010181-PA [Anopheles gambiae str. PEST]
Length=136

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 78/149 (52%), Gaps = 31/149 (21%)
 Frame = -2

Query  654  LKRAGKEKTA----ILQQGQSIMQVVDLRGSNIIEVLDANG--EKSLAIFPAKFQKSMWI  493
            +K   KE+ A    + ++ Q I+++V  RG+N+ EV  A    E+ L   P KF+K++WI
Sbjct  7    IKHVLKEQEADDFDVPKENQQIVRIVASRGNNLHEVETAQDGEERFLVSMPVKFRKNVWI  66

Query  492  KRGNFVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
            KRGNFV+V      E IE G KV   + ++L  + ++ ++K   WP  F           
Sbjct  67   KRGNFVLV------EPIEEGNKVKAEICRILTPEHIKVFEKEGVWPRKF-----------  109

Query  312  LERHTSQTQDIEDSSDDDGLPPLEANTNR  226
                 S+ +++ED  D+DGL     NTNR
Sbjct  110  -----SRKRELEDDLDEDGLF---RNTNR  130



>ref|XP_008559878.1| PREDICTED: probable RNA-binding protein EIF1AD [Microplitis demolitor]
Length=153

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 77/138 (56%), Gaps = 14/138 (10%)
 Frame = -2

Query  639  KEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDES  460
            +E  +I  + QSI+Q+V+ RG+N+ EV D+ GE+ L   P+ F+ ++++KRG+FV+V   
Sbjct  14   QEDFSIPLESQSIVQLVEPRGNNLHEVSDSTGERFLVSMPSIFRNNVYVKRGDFVLV---  70

Query  459  GREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDI  280
               E+I  G KV   + +VL  + ++ Y+    WP+ F       +KE      +++ + 
Sbjct  71   ---ESIPEGDKVKAEIIKVLTEEHIKYYRSQSVWPKEFDKT---EAKEKEPHPVNKSNND  124

Query  279  EDSSDDDGLPPLEANTNR  226
             D+ DD     L  NTNR
Sbjct  125  SDNEDD-----LFINTNR  137



>ref|XP_006129729.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X1 [Pelodiscus 
sinensis]
 ref|XP_006129730.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X2 [Pelodiscus 
sinensis]
Length=175

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 55/95 (58%), Gaps = 6/95 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G + L   P KF+K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLGTPGNNLHEVETAEGTRFLVSMPTKFRKNIWIKRGDFLLVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVET  325
            KV   +  VL+ D +R  +K   WPE F S   E+
Sbjct  79   KVKAEINFVLYKDHMRYLKKEGLWPEAFSSDTAES  113



>dbj|BAB25440.1| unnamed protein product [Mus musculus]
Length=170

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 58/101 (57%), Gaps = 6/101 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       +E G 
Sbjct  25   QQIVKVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PVEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLE  307
            KV   ++ VL  + VR  QK   WPE F     + +  N E
Sbjct  79   KVKAEISFVLCKNHVRSLQKEGHWPEAFSEVAEKQNNMNRE  119



>ref|XP_007943150.1| PREDICTED: probable RNA-binding protein EIF1AD [Orycteropus afer 
afer]
Length=164

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIF  346
            KV   ++ VL  D VR  QK   WPE F
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAF  106



>ref|XP_001379488.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X1 [Monodelphis 
domestica]
Length=163

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLGTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIF  346
            KV   ++ VL  D VR  QK   WPE F
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAF  106



>emb|CCI47564.1| unnamed protein product [Albugo candida]
Length=184

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 65/119 (55%), Gaps = 7/119 (6%)
 Frame = -2

Query  603  IMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGRKV  424
            ++ VV  RGSNI EVL  NG+ SL + P +F K +WIKRG+F++V     E  +++   V
Sbjct  32   VVCVVASRGSNIFEVLHTNGQASLTMLPQRFHKLIWIKRGDFLIVTFGDTE--VDNKDAV  89

Query  423  GCIVTQVLFYDQVREYQKSPEWPEIF---KSAVVETSK--ENLERHTSQTQDIEDSSDD  262
              +V  +L+ DQ++  ++   WP  F    S  ++  +  E L    S  +D+E  S D
Sbjct  90   KSMVLHILYKDQIKHLKRKQLWPSEFYNVDSGWLDRQRPLEPLSNEASHPKDLEARSTD  148



>tpg|DAA42900.1| TPA: hypothetical protein ZEAMMB73_687067, partial [Zea mays]
Length=224

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 67/127 (53%), Gaps = 28/127 (22%)
 Frame = -2

Query  519  AKFQKSMWIKRGNFVVVDESGREEAIESGRKVGCIVTQVLFYDQVREYQKS---------  367
            A+ Q+     RG+FVVVD SGR++A+ESG K+ C+V++VLF++QVR  QKS         
Sbjct  91   ARLQR----HRGSFVVVDASGRDQALESGSKIACVVSRVLFHEQVRALQKSGNCILLILT  146

Query  366  ----------PEW--PEIFKSAVVETSKENLERHTSQ---TQDIEDSSDDDGLPPLEANT  232
                      P +  P IF SA                   ++ +   +DD LPPLEANT
Sbjct  147  YGIGCSDQFVPSYVRPAIFNSAPTPNEASEAGAEAQAAQVDEEPDSDEEDDDLPPLEANT  206

Query  231  NRLKPFQ  211
            NR +P++
Sbjct  207  NRNRPYE  213



>ref|XP_001491132.1| PREDICTED: probable RNA-binding protein EIF1AD [Equus caballus]
 ref|XP_008531305.1| PREDICTED: probable RNA-binding protein EIF1AD [Equus przewalskii]
Length=165

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 6/99 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       I  G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIAEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
            KV   ++ VL  D VR  QK   WPE F  A  + +  N
Sbjct  79   KVKAEISFVLCKDHVRSLQKEGLWPEAFSEAAEKQNNRN  117



>ref|XP_008059207.1| PREDICTED: probable RNA-binding protein EIF1AD [Tarsius syrichta]
Length=164

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+FV+VD       IE G 
Sbjct  25   QEIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFVIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIF  346
            KV   ++ VL  + VR  QK   WPE F
Sbjct  79   KVKAEISFVLCKNHVRSLQKEGLWPEAF  106



>ref|XP_008145152.1| PREDICTED: probable RNA-binding protein EIF1AD [Eptesicus fuscus]
Length=164

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 6/91 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSA  337
            KV   ++ VL  D VR  +K   WPE F+ A
Sbjct  79   KVKAEISFVLCKDHVRSLKKDGLWPEAFEVA  109



>ref|XP_005305562.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X2 [Chrysemys 
picta bellii]
Length=174

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 68/131 (52%), Gaps = 8/131 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G + L   P KF+K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLGTPGNNLHEVETAEGTRFLVSMPTKFRKNIWIKRGDFLLVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQT-QDIEDSSDDDGL  253
            KV   +  VL+ D VR  +K   WPE F S   E+   +  R   QT        D D  
Sbjct  79   KVKAEINFVLYKDHVRYLKKEGLWPEAF-SDTAESQPSSEAREGEQTAARSSGEEDSDDD  137

Query  252  PPLEANTNRLK  220
              L  NTNRL+
Sbjct  138  SDLFVNTNRLR  148



>ref|XP_003451850.1| PREDICTED: probable RNA-binding protein EIF1AD-like isoform X1 
[Oreochromis niloticus]
 ref|XP_005456382.1| PREDICTED: probable RNA-binding protein EIF1AD-like isoform X2 
[Oreochromis niloticus]
Length=179

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 54/90 (60%), Gaps = 6/90 (7%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            + Q I++V   RG+N+ + + A GE  L   P KF+K++WIKRG++V+VD       IE 
Sbjct  23   ENQQIVKVTGSRGNNLHDAVTAQGETFLVSMPTKFRKNIWIKRGDYVIVD------PIEE  76

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWPEIF  346
            G KV   ++ +L+ D ++  QK   WPE F
Sbjct  77   GEKVKAEISFILYKDHIQYLQKQNLWPEGF  106



>ref|XP_005305561.1| PREDICTED: probable RNA-binding protein EIF1AD isoform X1 [Chrysemys 
picta bellii]
Length=175

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 64/131 (49%), Gaps = 7/131 (5%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G + L   P KF+K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLGTPGNNLHEVETAEGTRFLVSMPTKFRKNIWIKRGDFLLVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQT-QDIEDSSDDDGL  253
            KV   +  VL+ D VR  +K   WPE F             R   QT        D D  
Sbjct  79   KVKAEINFVLYKDHVRYLKKEGLWPEAFSDTAESQPSSEASREGEQTAARSSGEEDSDDD  138

Query  252  PPLEANTNRLK  220
              L  NTNRL+
Sbjct  139  SDLFVNTNRLR  149



>ref|XP_005844079.1| hypothetical protein CHLNCDRAFT_27264 [Chlorella variabilis]
 gb|EFN51977.1| hypothetical protein CHLNCDRAFT_27264 [Chlorella variabilis]
Length=101

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 54/84 (64%), Gaps = 5/84 (6%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            +GQ I++ V  RGSN+IEV   +G  +L + PAKF K +W+K+GN++VV+ +  E+   +
Sbjct  20   EGQHIVRAVGSRGSNLIEVEFPDGRTALCLLPAKFHKKLWVKKGNYLVVEGAAEEDTRVT  79

Query  435  GRKVGCIVTQVLFYDQVREYQKSP  364
            G      ++ VLF D V++ ++ P
Sbjct  80   GE-----ISAVLFADHVKQLKRMP  98



>ref|XP_004618596.1| PREDICTED: probable RNA-binding protein EIF1AD [Sorex araneus]
Length=173

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 63/108 (58%), Gaps = 13/108 (12%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQ  286
            KV   ++ VL  D VR  QK   WP  F S VVE      +R + QTQ
Sbjct  79   KVKAEISFVLCKDHVRSMQKDGLWPTEF-SEVVE------KRESRQTQ  119



>emb|CEF62493.1| Probable RNA-binding protein EIF1AD [Strongyloides ratti]
Length=172

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 69/125 (55%), Gaps = 10/125 (8%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            +GQ I QV+   G+N++EV D N EK L   P+KF+K +W+KRG FVV+        I+ 
Sbjct  23   EGQMIAQVLSSCGNNLLEVEDENSEKYLVSMPSKFRKCIWVKRGQFVVI------VPIKE  76

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIEDSS--DD  262
            G +V   V  +L  + +   ++  +WP+ F+   ++ ++E   +  ++  ++E     D 
Sbjct  77   GDRVRAEVEHILDEENILYIREHKQWPDKFEEHALKMTRE--AKRNTKDSNLESHCGIDA  134

Query  261  DGLPP  247
            D LPP
Sbjct  135  DMLPP  139



>ref|XP_006268167.1| PREDICTED: probable RNA-binding protein EIF1AD [Alligator mississippiensis]
Length=142

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 64/126 (51%), Gaps = 12/126 (10%)
 Frame = -2

Query  594  VVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGRKVGCI  415
            VV   G+N+ EV    G + LA  P KF+ ++WIKRG+F++VD       IE G KV   
Sbjct  9    VVGSPGNNLHEVEAPGGGRFLASMPPKFRHNLWIKRGDFLLVD------PIEEGEKVKAE  62

Query  414  VTQVLFYDQVREYQKSPEWPEIFKSAV-VETSKENLERHTSQTQDIEDSSDDDGLPPLEA  238
            ++ VL+ D +R  Q+   WPE F  A     S ++        Q+ EDS  D     L  
Sbjct  63   ISFVLYKDHMRYLQQEGLWPEAFSDAPNRRPSPQSRVGEPPAAQEDEDSDSD-----LFV  117

Query  237  NTNRLK  220
            N NRL+
Sbjct  118  NPNRLR  123



>emb|CDJ95875.1| S1 domain containing protein [Haemonchus contortus]
Length=184

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 67/128 (52%), Gaps = 12/128 (9%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            +G  I QV + RG+N+ EV D NGE  +A  P+KF+K++WI+RG FVV+        IE 
Sbjct  23   EGDIIAQVRNARGNNLHEVEDENGETYVASMPSKFRKAIWIRRGQFVVL------RPIEE  76

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIEDSS-DDD  259
            G KV   +  VL  + +   +   +WP  F     E     + R   +    ED+  DDD
Sbjct  77   GDKVKAEIEHVLDEENILYIRSINKWPARF-----EEQARMMTRDAKRGGKGEDTMIDDD  131

Query  258  GLPPLEAN  235
             LPP +++
Sbjct  132  MLPPTDSD  139



>ref|XP_003429077.1| PREDICTED: LOW QUALITY PROTEIN: probable RNA-binding protein 
EIF1AD [Ornithorhynchus anatinus]
Length=181

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 59/101 (58%), Gaps = 6/101 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ E+  A G++ L   P+K++K++WIKRG++++VD       IE G 
Sbjct  29   QQIVRVLGTPGNNLHEIETAQGQRFLVSMPSKYRKNIWIKRGDYLIVD------PIEEGE  82

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLE  307
            KV   ++ VL  D VR  Q+   WPE F +   +   +N E
Sbjct  83   KVKAEISFVLCKDHVRSLQEDGLWPEAFSAGAGKPDGKNRE  123



>gb|EYC02527.1| hypothetical protein Y032_0099g3166 [Ancylostoma ceylanicum]
Length=185

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 63/123 (51%), Gaps = 10/123 (8%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            +G  I QV   RG+N+ EV D NGE  +A  P+KF+K++WI+RG FVV+        IE 
Sbjct  23   EGDIIAQVRSARGNNLHEVEDENGEMYVASMPSKFRKAVWIRRGQFVVL------RPIEE  76

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIEDSSDDDG  256
            G KV   +  VL  + V   +   +WP  F+      +++     T +   I    DDD 
Sbjct  77   GDKVKAEIEHVLDEENVLYIRSQNKWPSRFEEQARLMTRDAKRGTTGENAMI----DDDM  132

Query  255  LPP  247
            LPP
Sbjct  133  LPP  135



>ref|XP_005113461.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Aplysia 
californica]
Length=121

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 58/93 (62%), Gaps = 6/93 (6%)
 Frame = -2

Query  636  EKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESG  457
            E+  + +  + +++VV  RG+N+ EV+ + GEK L   P+KF+K +WIKRG+F++V    
Sbjct  35   EEYPLPEGSRQVVKVVASRGNNLHEVVTSRGEKFLVSMPSKFRKHVWIKRGDFILV----  90

Query  456  REEAIESGRKVGCIVTQVLFYDQVREYQKSPEW  358
              E IE G KV   ++ +LF +Q++  Q+   W
Sbjct  91   --EPIEEGDKVKAEISHILFNEQIKHIQEQNLW  121



>gb|KIH50265.1| putative translation initiation factor eIF-1A [Ancylostoma duodenale]
Length=136

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 63/123 (51%), Gaps = 10/123 (8%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            +G  I QV   RG+N+ EV D NGE  +A  P+KF+K++WI+RG FVV+        IE 
Sbjct  23   EGDIIAQVRSARGNNLHEVEDENGEMYVASMPSKFRKAVWIRRGQFVVL------RPIEE  76

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIEDSSDDDG  256
            G KV   +  VL  + V   +   +WP  F+      +++     T +   I    DDD 
Sbjct  77   GDKVKAEIEHVLDEENVLYIRSQNKWPSRFEEQARLMTRDAKRGTTGENVMI----DDDM  132

Query  255  LPP  247
            LPP
Sbjct  133  LPP  135



>ref|XP_008325733.1| PREDICTED: probable RNA-binding protein EIF1AD [Cynoglossus semilaevis]
Length=166

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 60/105 (57%), Gaps = 8/105 (8%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            + Q I+++   RG+N+ E + A GE  L   P KF+K++WIKRG++V+VD       IE 
Sbjct  23   ENQMIVKITGSRGNNLHETVTAEGEIFLVSMPTKFRKNIWIKRGDYVIVD------PIEE  76

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWPEIF--KSAVVETSKENLE  307
            G KV   ++ +L+ D +   QK   WP  F   ++  + +KE LE
Sbjct  77   GEKVKAEISFILYKDHIHYLQKQQLWPAGFVEDTSGEDNTKEQLE  121



>gb|EHJ64807.1| translation initiation factor 1a [Danaus plexippus]
Length=153

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 61/102 (60%), Gaps = 6/102 (6%)
 Frame = -2

Query  618  QQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIE  439
            ++ QSI++V+  RG+N+ E+    GE+ L   P KF+K++W+KRG++++V      E IE
Sbjct  23   KENQSIVKVLKSRGNNLHEIQTPTGEEYLVSMPGKFRKNIWVKRGDYILV------EPIE  76

Query  438  SGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKEN  313
             G KV   + +++    ++ Y+++  WP+ F     E  KEN
Sbjct  77   EGDKVKAEIVKIMNKGSIKYYKENNVWPKEFDDNKKEELKEN  118



>gb|ACQ58150.1| Probable RNA-binding protein EIF1AD [Anoplopoma fimbria]
Length=177

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 6/90 (7%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            + Q I++V   RG+N+ E + A G   L   P KF+K++WIKRG++V+VD       IE 
Sbjct  23   ENQQIVKVTGSRGNNLHEAVTAQGVTFLVSMPPKFRKNLWIKRGDYVIVD------PIEE  76

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWPEIF  346
            G KV   ++ +L+ D ++  QK   WPE F
Sbjct  77   GEKVKAEISFILYKDHIQYLQKQQLWPEGF  106



>ref|XP_011068773.1| PREDICTED: probable RNA-binding protein EIF1AD [Acromyrmex echinatior]
 ref|XP_011068774.1| PREDICTED: probable RNA-binding protein EIF1AD [Acromyrmex echinatior]
 gb|EGI69293.1| Putative RNA-binding protein EIF1AD [Acromyrmex echinatior]
Length=157

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 70/134 (52%), Gaps = 17/134 (13%)
 Frame = -2

Query  612  GQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESG  433
             QSI+Q+V  RG N+ E++   GE+ +   P KF++++WIKRG+++V+      E I  G
Sbjct  24   SQSIVQIVQARGHNLHEIVTPAGEQYIVSMPTKFRQNIWIKRGDYIVI------EPIVEG  77

Query  432  RKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIEDSSDDDGL  253
            +KV   + ++L  D ++ Y++   WP  F         E+ +R+         + DD+  
Sbjct  78   KKVKGEIVKILTKDHIKWYREQNCWPPEF--------DEDPKRNGCLIATNYTTCDDEE-  128

Query  252  PPLEANTNRLKPFQ  211
              L  NTNR  P Q
Sbjct  129  --LFVNTNRCAPNQ  140



>ref|NP_956762.1| probable RNA-binding protein EIF1AD [Danio rerio]
 sp|Q7SY07.1|EIF1A_DANRE RecName: Full=Probable RNA-binding protein EIF1AD; AltName: Full=Eukaryotic 
translation initiation factor 1A domain-containing 
protein [Danio rerio]
 gb|AAH55173.1| Zgc:63631 [Danio rerio]
Length=172

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 55/89 (62%), Gaps = 6/89 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q IM+V+   G+N+ E +  +GE+ L   P KF+K++WIKRG+FV+VD       I+ G 
Sbjct  25   QQIMRVLGSNGNNLHEAVTGSGERFLLSMPTKFRKNIWIKRGDFVIVD------PIKEGG  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFK  343
            KV   ++ +L+ D ++  +K   WPE F+
Sbjct  79   KVKGEISFILYRDHIQHLRKLGVWPEGFQ  107



>ref|XP_008116415.1| PREDICTED: interferon-inducible double-stranded RNA-dependent 
protein kinase activator A [Anolis carolinensis]
Length=503

 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 58/97 (60%), Gaps = 6/97 (6%)
 Frame = -2

Query  636  EKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESG  457
            E+  +  + Q +++V+   G+N+ EV   +G + LA  P KF+K++WIKRG+F++VD   
Sbjct  16   EEYVVPSERQQVVRVLGTPGNNLHEVETPDGTRFLASMPTKFRKNIWIKRGDFLLVD---  72

Query  456  REEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIF  346
                IE G KV   ++ VL+ D VR  +K   WPE F
Sbjct  73   ---PIEEGEKVKAEISFVLYKDHVRYLKKEGYWPEAF  106



>ref|XP_004521699.1| PREDICTED: probable RNA-binding protein EIF1AD-like [Ceratitis 
capitata]
Length=185

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 55/88 (63%), Gaps = 6/88 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++++  RG+N+ EV  A  E+ L   P KF++++W+KRGN+VVV      E IE G 
Sbjct  26   QQIVRILGSRGNNLHEVETATAERFLVSMPNKFRRNIWVKRGNYVVV------ENIEEGV  79

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIF  346
            KV   + ++L  + V+EY K+  WP+ F
Sbjct  80   KVRGEICKILTPEHVKEYTKAGVWPKEF  107



>ref|XP_004596714.1| PREDICTED: probable RNA-binding protein EIF1AD [Ochotona princeps]
Length=165

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+KF+K++WIKRG+F++VD       I+ G+
Sbjct  25   QQIVKVLRTPGNNLHEVETAQGQRFLVSMPSKFRKNIWIKRGDFLIVD------PIKEGQ  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIF  346
            KV   +  VL  D VR  Q+   WPE F
Sbjct  79   KVKAEICFVLCKDHVRSLQEEGLWPEAF  106



>ref|XP_008864748.1| hypothetical protein H310_02855 [Aphanomyces invadans]
 gb|ETW06673.1| hypothetical protein H310_02855 [Aphanomyces invadans]
Length=180

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 54/91 (59%), Gaps = 4/91 (4%)
 Frame = -2

Query  618  QQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIE  439
            + G+ I+QV  +RGSN+ E++ ++GE  +A+ P K++K +WI+RG+F++V          
Sbjct  26   EAGELIVQVQAMRGSNLFEIVTSDGETGVAMLPTKYRKLIWIRRGDFLIV----AAAHGA  81

Query  438  SGRKVGCIVTQVLFYDQVREYQKSPEWPEIF  346
                V   V  +L+ DQ++  +K   WPE F
Sbjct  82   HKGAVNYSVEHILYKDQIKHLKKENLWPESF  112



>ref|XP_009838388.1| hypothetical protein H257_12776 [Aphanomyces astaci]
 gb|ETV71945.1| hypothetical protein H257_12776 [Aphanomyces astaci]
Length=175

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 72/142 (51%), Gaps = 13/142 (9%)
 Frame = -2

Query  624  ILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEA  445
            + + G+ I+QV  +RGSN+ E++ + GE  +A+ P K++K +WI+RG+F++V        
Sbjct  24   VPEAGEVIVQVQAMRGSNLFEIVTSEGETGIAMLPTKYRKLIWIRRGDFLIV----AAAH  79

Query  444  IESGRKVGCIVTQVLFYDQVREYQKSPEWPEIF---------KSAVVETSKENLERHTSQ  292
                  V   V  +L+ DQ+++ +K   WP+ F         K+A  + +    +     
Sbjct  80   GAHKGAVNYSVEHILYKDQIKQLKKQNLWPDSFNVDEADLEPKAADGDAASALGKMALGS  139

Query  291  TQDIEDSSDDDGLPPLEANTNR  226
            T++  D  + D  P L  N NR
Sbjct  140  TKETSDDLECDSDPMLFVNRNR  161



>ref|XP_002950217.1| hypothetical protein VOLCADRAFT_104609 [Volvox carteri f. nagariensis]
 gb|EFJ48885.1| hypothetical protein VOLCADRAFT_104609 [Volvox carteri f. nagariensis]
Length=544

 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 64/107 (60%), Gaps = 6/107 (6%)
 Frame = -2

Query  612  GQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESG  433
            GQSI++ +  RGSN+I V   +G ++L + PAKF K +W+KRG +++V++S    A    
Sbjct  22   GQSIVRALGSRGSNLIAVEFPDGRQTLVLMPAKFNKKLWVKRGGYLLVEDS---PAAGGD  78

Query  432  RKVGCIVTQVLFYDQVREYQKSPE-WPEIFKSAVVETSKENLERHTS  295
             KV   +  VL+ DQ+++  K P  WP+ F S   + S +  +RH S
Sbjct  79   SKVTGTILSVLYDDQIKQLAKMPGIWPKEFASKEDKGSLD--DRHAS  123



>ref|XP_004367104.1| hypothetical protein DFA_07241 [Dictyostelium fasciculatum]
 gb|EGG20121.1| hypothetical protein DFA_07241 [Dictyostelium fasciculatum]
Length=171

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 55/90 (61%), Gaps = 5/90 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGN-FVVVDESGREEAIESG  433
            QSI++VVD+RG  + EV  +NG  +LAI P+KF K +WIK+G+ + ++D+   +E     
Sbjct  22   QSIVKVVDIRGGKLTEVQYSNGTTTLAILPSKFNKKLWIKKGSTYAIIDQEDTQET----  77

Query  432  RKVGCIVTQVLFYDQVREYQKSPEWPEIFK  343
             KV   +  +L  DQ++   K   WP+ F+
Sbjct  78   SKVRTSIVSILGEDQIKHLVKVNLWPKEFQ  107



>gb|EKC24483.1| Putative RNA-binding protein EIF1AD [Crassostrea gigas]
Length=161

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 54/90 (60%), Gaps = 6/90 (7%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            + Q +++V   RG+N+ EV  A  E+ L   P +F+K++WIKRG+FV+V      E IE 
Sbjct  23   ENQQVVRVTAGRGNNLHEVETAKKERFLVSMPTRFRKNVWIKRGDFVLV------EPIEE  76

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWPEIF  346
            G KV   +  +L+ DQ++  Q+  +WP  F
Sbjct  77   GEKVKAEIISILYKDQIKYIQEEGKWPPEF  106



>emb|CEI86597.1| hypothetical protein RMCBS344292_01032 [Rhizopus microsporus]
Length=148

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 66/132 (50%), Gaps = 16/132 (12%)
 Frame = -2

Query  621  LQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAI  442
            LQ+GQ   + +  RG++  EV   +G + L   P +F+  +W+KRG+FV+VD +    A 
Sbjct  17   LQEGQKYAKSLGPRGNHQHEVEFTDGARKLVTLPPRFRNLVWLKRGHFVIVDPT----AG  72

Query  441  ESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIEDSSDD  262
                KVG  +  VL+   ++E +   EWPE F     +  +E  +R        +DS DD
Sbjct  73   TVSEKVGGEIVHVLYPKDIKELKAKGEWPEEFTDKKAQDEEEEEKR--------QDSDDD  124

Query  261  DGLPPLEANTNR  226
            D    L  N NR
Sbjct  125  D----LFVNNNR  132



>gb|KCW65794.1| hypothetical protein EUGRSUZ_G031472, partial [Eucalyptus grandis]
Length=170

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -2

Query  657  NLKRAGKEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKR  487
            NLK A +E+   LQ GQ+I+Q V  RGSN++EV+DA G K LA+ PAK QK  WI R
Sbjct  114  NLKWAAEEREVTLQDGQNIVQAVSHRGSNLVEVMDAQGSKLLALIPAKIQKKYWIGR  170



>dbj|BAE40073.1| unnamed protein product [Mus musculus]
 dbj|BAE40203.1| unnamed protein product [Mus musculus]
Length=170

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 57/101 (56%), Gaps = 6/101 (6%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVKVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLE  307
            KV   ++ VL  + VR  QK   W E F     + +  N E
Sbjct  79   KVKAEISFVLCKNHVRSLQKEGHWREAFSEVAEKQNNMNRE  119



>gb|AAY66860.1| unknown [Ixodes scapularis]
Length=156

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 62/106 (58%), Gaps = 9/106 (8%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++++  +G+N+ EV D +G   L   P KF+K++W+KRG+ V+V      E IE G 
Sbjct  25   QQIVRILSGKGNNLHEVEDPSGSTYLVSMPTKFRKNIWVKRGDLVIV------EPIEEGD  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQ  292
            KV   + ++L+ +QV+  ++  +WP+ F       +K + E H+ +
Sbjct  79   KVKAEIVRILYREQVKYIKEEGKWPKAFDDG---KAKGDAEHHSPE  121



>gb|KHN80746.1| putative RNA-binding protein EIF1AD [Toxocara canis]
Length=203

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 58/108 (54%), Gaps = 6/108 (6%)
 Frame = -2

Query  639  KEKTAILQQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDES  460
            K +  + + G  I Q++  RG+N+ EV DA+GEK L   P KF+KS+W+KRG FV +   
Sbjct  15   KSEFVLPEDGDMIAQILGTRGNNLHEVEDASGEKYLVSMPTKFRKSVWVKRGQFVFI---  71

Query  459  GREEAIESGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKE  316
                 IE G KV   +T VL  + V   ++   WP  F+      ++E
Sbjct  72   ---RPIEEGDKVKAEITNVLDDENVLYIREQKLWPLRFEQDAERLTRE  116



>gb|EFX69139.1| hypothetical protein DAPPUDRAFT_329420 [Daphnia pulex]
Length=163

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 56/91 (62%), Gaps = 6/91 (7%)
 Frame = -2

Query  618  QQGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIE  439
            +  Q I++++  +G+N+ E+  + GEK L   P KF+K++WIKRG+FV++      + IE
Sbjct  22   EDNQKIVKILGGKGNNLHEIETSEGEKYLVSMPTKFRKNVWIKRGDFVLI------QPIE  75

Query  438  SGRKVGCIVTQVLFYDQVREYQKSPEWPEIF  346
             G KV   +  +L+ +Q++  Q   +WP+ F
Sbjct  76   EGEKVKAEIVAILYAEQIKYIQSQGKWPKEF  106



>ref|XP_003774157.1| PREDICTED: probable RNA-binding protein EIF1AD [Sarcophilus harrisii]
Length=161

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 6/83 (7%)
 Frame = -2

Query  594  VVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGRKVGCI  415
            V+   G+N+ EV  A G++ L   P+K++K++WIKRG+F++VD       IE G KV   
Sbjct  28   VLGTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVD------PIEEGEKVKAE  81

Query  414  VTQVLFYDQVREYQKSPEWPEIF  346
            ++ VL  D VR  QK   WPE F
Sbjct  82   ISFVLCKDHVRSLQKEGLWPEAF  104



>ref|XP_004364155.1| eukaryotic translation initiation factor 1A [Capsaspora owczarzaki 
ATCC 30864]
 gb|EFW45310.1| eukaryotic translation initiation factor 1A [Capsaspora owczarzaki 
ATCC 30864]
Length=187

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 65/118 (55%), Gaps = 8/118 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            + I++V+  RG+N+ EV   +G++ L + P KF+K +WIKRG++++  +    E +    
Sbjct  26   EHIVRVIATRGNNLHEVEFPDGQRILCMMPTKFRKKIWIKRGDYLIAQKLEGSEKLNL--  83

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIEDSSDDDG  256
            +V   +  VL+ DQ++E +    WPE F+ A V T        +++ Q +   +  DG
Sbjct  84   RVQAEINHVLYPDQLKELRAMAIWPERFRDAPVSTPA------SAEAQSVRKEAQADG  135



>ref|XP_007056214.1| PREDICTED: probable RNA-binding protein EIF1AD [Chelonia mydas]
 gb|EMP39216.1| Putative RNA-binding protein EIF1AD [Chelonia mydas]
Length=173

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 59/107 (55%), Gaps = 7/107 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            Q I++V+   G+N+ +V  A G + L   P KF+K++WIKRG+F++VD       IE G 
Sbjct  25   QQIVRVLGTPGNNLHDVETAEGTRFLVSMPTKFRKNIWIKRGDFLLVD------PIEEGE  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQT  289
            KV   +  VL+ D V+  +K   WPE F S   E+   +  R   QT
Sbjct  79   KVKAEINFVLYKDHVQYLKKEGLWPEAF-SDTAESQPSSEAREEEQT  124



>ref|NP_505624.1| Protein ZK856.11 [Caenorhabditis elegans]
 sp|Q23646.1|EIF1A_CAEEL RecName: Full=Probable RNA-binding protein EIF1AD; AltName: Full=Eukaryotic 
translation initiation factor 1A domain-containing 
protein [Caenorhabditis elegans]
 emb|CAA94859.1| Protein ZK856.11 [Caenorhabditis elegans]
Length=175

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 61/119 (51%), Gaps = 11/119 (9%)
 Frame = -2

Query  603  IMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGRKV  424
            I QV   RG+N+ EVLD NG+  +   P KF+KS+W++R  FVVV        I  G KV
Sbjct  27   IAQVRQSRGNNLHEVLDQNGDSYVVSMPTKFRKSVWLRRDQFVVV------RPITEGDKV  80

Query  423  GCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIEDSSDDDGLPP  247
               +  +L  D V   ++  +WP  F+   ++ ++E     TS     +   DDD LPP
Sbjct  81   KGEIEYILDQDNVLYIRELGKWPTCFEENALKMTREAKRGQTS-----DKMIDDDMLPP  134



>ref|XP_001749622.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ85673.1| predicted protein [Monosiga brevicollis MX1]
Length=160

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 66/128 (52%), Gaps = 9/128 (7%)
 Frame = -2

Query  609  QSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGR  430
            QSI++V+  RG+N+ E   A+GE  L   P KF+K +WIKRG F++V      E I    
Sbjct  25   QSIVRVIAPRGNNLHEAEWADGETGLVSMPPKFRKHVWIKRGMFLIV------EPIPEND  78

Query  429  KVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIEDSSDDDGLP  250
            KV   +  VL  + +R  ++  +WP  F +     + +N+   TS+ +D    +DD   P
Sbjct  79   KVKAEIIFVLQSEHIRHLKQIDQWPTAFGAEAGTAADDNVVDDTSEPEDEYLDADD---P  135

Query  249  PLEANTNR  226
                N NR
Sbjct  136  FAGGNPNR  143



>ref|XP_007246458.1| PREDICTED: LOW QUALITY PROTEIN: probable RNA-binding protein 
EIF1AD-like [Astyanax mexicanus]
Length=178

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 56/93 (60%), Gaps = 6/93 (6%)
 Frame = -2

Query  615  QGQSIMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIES  436
            + Q IM++    G+N+ E +  +GEK L   P KF+K++WIKRG+FV+VD       IE 
Sbjct  23   ESQQIMRIQGSNGNNLHEAVTESGEKFLLSMPTKFRKNIWIKRGDFVIVD------PIEE  76

Query  435  GRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSA  337
            G KV   ++ +L+ D ++  +K   WP+ F++ 
Sbjct  77   GDKVKGEISFILYRDHIQYLRKLGVWPKGFEAG  109



>emb|CCA24116.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=185

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = -2

Query  603  IMQVVDLRGSNIIEVLDANGEKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGRKV  424
            I+ V+  RGSNI EVL  NGE  L + P K+ K +WIKRG+F++V     E  +++   V
Sbjct  32   IVCVLASRGSNIFEVLHTNGEVRLTMLPQKYHKLIWIKRGDFLIVTVGDAE--MDNKGAV  89

Query  423  GCIVTQVLFYDQVREYQKSPEWPEIF  346
              +V  +L+ DQ++  ++   WP  F
Sbjct  90   KSLVLHILYKDQIKYLRRKELWPSGF  115



>ref|XP_001656497.1| translation initiation factor 1A, putative [Aedes aegypti]
 ref|XP_001656498.1| translation initiation factor 1A, putative [Aedes aegypti]
 gb|EAT45582.1| AAEL003174-PB [Aedes aegypti]
 gb|EAT45583.1| AAEL003174-PA [Aedes aegypti]
Length=156

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 71/131 (54%), Gaps = 27/131 (21%)
 Frame = -2

Query  612  GQSIMQVVDLRGSNIIEVLDANG--EKSLAIFPAKFQKSMWIKRGNFVVVDESGREEAIE  439
             Q+I++VV  RG+N+ EV  AN   E+ L   P KF+K++WIKRG+FV+V      E IE
Sbjct  25   NQTIVRVVASRGNNLHEVESANEGEERFLVSMPVKFRKNVWIKRGDFVLV------EPIE  78

Query  438  SGRKVGCIVTQVLFYDQVREYQKSPEWPEIFKSAVVETSKENLERHTSQTQDIEDSSDDD  259
             G KV   + ++L  + ++ +++   WP+ F                ++ ++ +D  D+D
Sbjct  79   EGNKVKAEICRILTPEHIKVFEQEGVWPKRF----------------TKKREHDDDLDED  122

Query  258  GLPPLEANTNR  226
            GL     NTNR
Sbjct  123  GLV---RNTNR  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3249488224448