BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24970_g2_i2 len=1389 path=[2838:0-59 2898:60-83 7582:84-178
3017:179-203 3042:204-309 3148:310-345 1851:346-377 1883:378-412
3247:413-503 8820:504-506 3341:507-605 2591:606-671 1420:672-713
1462:714-785 1534:786-842 9125:843-877 3707:878-926 2088:927-955
6071:956-1040 6156:1041-1047 6163:1048-1067 9255:1068-1091
6205:1092-1388]

Length=1389
                                                                      Score     E

ref|XP_009612480.1|  PREDICTED: polygalacturonase-like                  452   1e-152   
ref|XP_009764608.1|  PREDICTED: polygalacturonase-like                  451   3e-152   
ref|XP_009599317.1|  PREDICTED: polygalacturonase                       447   1e-150   
ref|XP_009804151.1|  PREDICTED: polygalacturonase-like                  446   2e-150   
pir||S46530  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...    444   1e-149
dbj|BAO02513.1|  predicted polygalacturonase ortholog                   444   2e-149   
ref|XP_004253347.1|  PREDICTED: polygalacturonase-like                  444   2e-149   
sp|Q05967.1|PGLR_TOBAC  RecName: Full=Polygalacturonase; Short=PG...    442   1e-148   Nicotiana tabacum [American tobacco]
pir||S46529  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...    441   1e-148
emb|CAA50335.1|  polygalacturonase                                      440   5e-148   Nicotiana tabacum [American tobacco]
ref|XP_009601010.1|  PREDICTED: polygalacturonase-like                  440   7e-148   
ref|XP_009780910.1|  PREDICTED: polygalacturonase                       436   3e-146   
emb|CDP18013.1|  unnamed protein product                                418   2e-139   
emb|CDP04348.1|  unnamed protein product                                417   5e-139   
ref|XP_006366630.1|  PREDICTED: polygalacturonase-like                  413   1e-137   
emb|CDP04343.1|  unnamed protein product                                412   6e-137   
ref|XP_004243884.1|  PREDICTED: polygalacturonase-like                  405   2e-134   
ref|XP_007009871.1|  Pectin lyase-like superfamily protein, putative    405   4e-134   
gb|KHN24677.1|  Polygalacturonase                                       400   1e-132   
dbj|BAA89477.1|  polygalacturonase                                      399   3e-132   Salix gilgiana
ref|XP_003552049.1|  PREDICTED: polygalacturonase                       399   8e-132   
dbj|BAA89478.1|  polygalacturonase                                      397   2e-131   Salix gilgiana
dbj|BAA89476.1|  polygalacturonase                                      397   3e-131   Salix gilgiana
ref|XP_006371366.1|  hypothetical protein POPTR_0019s09500g             396   5e-131   
ref|XP_003522976.1|  PREDICTED: polygalacturonase-like                  396   7e-131   
ref|XP_003522977.1|  PREDICTED: polygalacturonase-like                  395   1e-130   
ref|XP_006387858.1|  hypothetical protein POPTR_0519s00220g             395   1e-130   
ref|XP_010999488.1|  PREDICTED: exopolygalacturonase-like               394   4e-130   
ref|XP_006371367.1|  hypothetical protein POPTR_0019s09510g             392   1e-129   
dbj|BAA89479.1|  polygalacturonase                                      392   3e-129   Salix gilgiana
ref|XP_006469749.1|  PREDICTED: polygalacturonase-like                  392   4e-129   
ref|XP_003522975.1|  PREDICTED: polygalacturonase-like                  392   4e-129   
ref|XP_010999485.1|  PREDICTED: exopolygalacturonase-like               391   7e-129   
ref|XP_002325639.2|  hypothetical protein POPTR_0019s09470g             392   7e-129   Populus trichocarpa [western balsam poplar]
ref|XP_010999486.1|  PREDICTED: exopolygalacturonase-like               389   5e-128   
ref|XP_010067918.1|  PREDICTED: exopolygalacturonase-like               389   5e-128   
ref|XP_010067907.1|  PREDICTED: exopolygalacturonase-like               389   5e-128   
ref|XP_011069588.1|  PREDICTED: polygalacturonase-like                  389   7e-128   
ref|XP_006447720.1|  hypothetical protein CICLE_v10015423mg             389   7e-128   
ref|XP_010040513.1|  PREDICTED: exopolygalacturonase-like               388   8e-128   
ref|XP_010042694.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    388   1e-127   
ref|XP_010040848.1|  PREDICTED: exopolygalacturonase-like               388   1e-127   
ref|XP_010536243.1|  PREDICTED: exopolygalacturonase-like               389   1e-127   
ref|XP_010038565.1|  PREDICTED: exopolygalacturonase-like               388   1e-127   
ref|XP_010999532.1|  PREDICTED: exopolygalacturonase-like               387   2e-127   
ref|XP_010042444.1|  PREDICTED: exopolygalacturonase-like               387   2e-127   
gb|KHN15656.1|  Polygalacturonase                                       385   4e-127   
ref|XP_003544118.1|  PREDICTED: polygalacturonase-like isoform X1       387   4e-127   
gb|KHN46909.1|  Polygalacturonase                                       386   4e-127   
gb|KCW88710.1|  hypothetical protein EUGRSUZ_A01065                     389   6e-127   
ref|XP_010042729.1|  PREDICTED: exopolygalacturonase-like               386   8e-127   
ref|XP_010532220.1|  PREDICTED: exopolygalacturonase-like               386   2e-126   
ref|XP_010038564.1|  PREDICTED: exopolygalacturonase-like               388   2e-126   
ref|XP_007009872.1|  Pectin lyase-like superfamily protein, putative    385   2e-126   
ref|XP_010536244.1|  PREDICTED: exopolygalacturonase-like               385   2e-126   
ref|XP_010999487.1|  PREDICTED: exopolygalacturonase-like               384   4e-126   
ref|XP_003527123.1|  PREDICTED: polygalacturonase-like                  384   4e-126   
ref|XP_011097041.1|  PREDICTED: polygalacturonase-like                  384   5e-126   
ref|XP_007049259.1|  Polygalacturonase                                  384   6e-126   
gb|KHN10402.1|  Polygalacturonase                                       382   8e-126   
ref|XP_010112808.1|  hypothetical protein L484_020040                   382   1e-125   
ref|XP_002274096.1|  PREDICTED: exopolygalacturonase                    382   2e-125   Vitis vinifera
ref|XP_006595658.1|  PREDICTED: polygalacturonase-like isoform X2       381   3e-125   
ref|XP_011097079.1|  PREDICTED: polygalacturonase-like                  382   4e-125   
ref|XP_008379967.1|  PREDICTED: exopolygalacturonase-like               381   5e-125   
ref|XP_009365185.1|  PREDICTED: exopolygalacturonase-like               380   2e-124   
ref|XP_007049261.1|  Pectin lyase-like superfamily protein, putative    383   3e-124   
ref|XP_007152047.1|  hypothetical protein PHAVU_004G097300g             379   4e-124   
ref|XP_004488391.1|  PREDICTED: polygalacturonase-like                  379   4e-124   
ref|XP_008379966.1|  PREDICTED: exopolygalacturonase-like               379   6e-124   
ref|XP_010093135.1|  hypothetical protein L484_009327                   378   1e-123   
ref|XP_003595659.1|  Polygalactorunase PG11                             378   2e-123   
ref|XP_009365184.1|  PREDICTED: exopolygalacturonase-like               377   2e-123   
gb|AES65915.2|  polygalacturonase 11c, putative                         377   3e-123   
ref|XP_009365186.1|  PREDICTED: exopolygalacturonase-like               376   5e-123   
gb|KCW46858.1|  hypothetical protein EUGRSUZ_K00662                     375   1e-122   
sp|Q40312.1|PGLR_MEDSA  RecName: Full=Polygalacturonase; Short=PG...    375   2e-122   Medicago sativa [alfalfa]
gb|AFK41055.1|  unknown                                                 374   3e-122   
ref|XP_011097055.1|  PREDICTED: polygalacturonase-like                  374   4e-122   
ref|XP_002282594.1|  PREDICTED: exopolygalacturonase                    374   5e-122   Vitis vinifera
emb|CDP04350.1|  unnamed protein product                                372   3e-121   
gb|ADC53480.1|  polygalacturonase                                       372   4e-121   Gossypium hirsutum [American cotton]
ref|XP_002282573.1|  PREDICTED: exopolygalacturonase                    371   5e-121   Vitis vinifera
ref|XP_010038561.1|  PREDICTED: exopolygalacturonase-like               374   8e-121   
ref|XP_002274125.1|  PREDICTED: exopolygalacturonase                    368   7e-120   Vitis vinifera
ref|XP_010112811.1|  hypothetical protein L484_020043                   367   1e-119   
ref|XP_009134996.1|  PREDICTED: polygalacturonase-like                  367   1e-119   
ref|XP_011097018.1|  PREDICTED: polygalacturonase-like                  367   1e-119   
ref|XP_004173029.1|  PREDICTED: polygalacturonase-like                  367   3e-119   
gb|ABN13878.1|  polygalacturonase                                       366   5e-119   
ref|XP_007142511.1|  hypothetical protein PHAVU_008G286900g             365   6e-119   
ref|XP_010112807.1|  hypothetical protein L484_020039                   365   7e-119   
emb|CBI22050.3|  unnamed protein product                                366   9e-119   
ref|XP_008467043.1|  PREDICTED: exopolygalacturonase-like               364   1e-118   
ref|XP_011099769.1|  PREDICTED: polygalacturonase-like                  365   1e-118   
gb|KFK38253.1|  hypothetical protein AALP_AA3G089200                    365   1e-118   
ref|NP_187441.1|  polygalacturonase-like protein                        365   2e-118   Arabidopsis thaliana [mouse-ear cress]
sp|Q6H9K0.1|PGLR2_PLAAC  RecName: Full=Exopolygalacturonase; AltN...    363   2e-118   Platanus x hispanica [London plane tree]
ref|XP_008229848.1|  PREDICTED: exopolygalacturonase-like               364   2e-118   
ref|XP_008342227.1|  PREDICTED: exopolygalacturonase clone GBGA48...    364   3e-118   
ref|XP_008455553.1|  PREDICTED: exopolygalacturonase-like               364   4e-118   
emb|CBI28390.3|  unnamed protein product                                365   5e-118   
ref|XP_008459709.1|  PREDICTED: exopolygalacturonase-like               364   5e-118   
gb|ABL63521.1|  pollen-specific protein MF9l                            363   6e-118   Brassica oleracea var. alboglabra
gb|ADP09681.1|  polygalacturonase                                       363   8e-118   
emb|CDY07974.1|  BnaC03g35490D                                          363   9e-118   
gb|ABG38468.1|  pollen-expressed protein MF9c                           362   1e-117   Brassica oleracea
ref|XP_011097019.1|  PREDICTED: polygalacturonase-like                  362   2e-117   
ref|XP_010038563.1|  PREDICTED: exopolygalacturonase-like               361   3e-117   
ref|XP_008441641.1|  PREDICTED: exopolygalacturonase-like               362   3e-117   
emb|CAA05892.1|  polygalacturonase                                      361   3e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008460220.1|  PREDICTED: exopolygalacturonase-like               361   4e-117   
ref|XP_008245681.1|  PREDICTED: exopolygalacturonase clone GBGA48...    361   4e-117   
ref|NP_187439.1|  polygalacturonase-like protein                        360   5e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004140444.1|  PREDICTED: exopolygalacturonase-like               361   6e-117   
ref|XP_006407791.1|  hypothetical protein EUTSA_v10020866mg             360   6e-117   
gb|KCW46859.1|  hypothetical protein EUGRSUZ_K00664                     360   6e-117   
sp|P24548.1|PGLR_OENOR  RecName: Full=Exopolygalacturonase; Short...    359   9e-117   Oenothera organensis
ref|XP_010112809.1|  hypothetical protein L484_020041                   360   1e-116   
ref|XP_009334235.1|  PREDICTED: exopolygalacturonase-like               360   1e-116   
ref|XP_009365183.1|  PREDICTED: exopolygalacturonase-like               359   2e-116   
ref|XP_008349086.1|  PREDICTED: exopolygalacturonase-like               358   5e-116   
ref|XP_003633345.1|  PREDICTED: exopolygalacturonase                    358   7e-116   
gb|EYU42735.1|  hypothetical protein MIMGU_mgv1a007533mg                358   8e-116   
gb|EYU42739.1|  hypothetical protein MIMGU_mgv1a007536mg                358   1e-115   
ref|XP_004162875.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    357   1e-115   
gb|EYU42734.1|  hypothetical protein MIMGU_mgv1a007528mg                357   1e-115   
ref|XP_004153076.1|  PREDICTED: polygalacturonase-like                  357   2e-115   
ref|XP_002884668.1|  polygalacturonase 3                                357   2e-115   
ref|XP_008381794.1|  PREDICTED: exopolygalacturonase-like               357   2e-115   
ref|XP_006299274.1|  hypothetical protein CARUB_v10015428mg             357   2e-115   
ref|XP_004308599.1|  PREDICTED: exopolygalacturonase-like               357   2e-115   
ref|XP_008391258.1|  PREDICTED: exopolygalacturonase-like               357   2e-115   
ref|XP_003595656.1|  Polygalactorunase PG11                             357   3e-115   
gb|AAO62938.1|  polygalactorunase PG11 precursor                        356   4e-115   Medicago sativa [alfalfa]
emb|CBI22052.3|  unnamed protein product                                375   4e-115   
ref|XP_008449697.1|  PREDICTED: exopolygalacturonase-like               356   4e-115   
gb|EYU42736.1|  hypothetical protein MIMGU_mgv1a007545mg                356   6e-115   
ref|XP_004491599.1|  PREDICTED: polygalacturonase-like                  355   6e-115   
ref|XP_010458152.1|  PREDICTED: polygalacturonase-like                  355   7e-115   
gb|EYU42733.1|  hypothetical protein MIMGU_mgv1a007538mg                355   9e-115   
ref|XP_004490643.1|  PREDICTED: polygalacturonase-like                  354   2e-114   
ref|XP_002884669.1|  hypothetical protein ARALYDRAFT_478121             354   2e-114   
gb|KHN43962.1|  Polygalacturonase                                       354   2e-114   
ref|XP_003518573.1|  PREDICTED: polygalacturonase-like                  353   3e-114   
ref|XP_008449696.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    354   3e-114   
ref|NP_187440.1|  polygalacturonase-like protein                        353   4e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464425.1|  PREDICTED: polygalacturonase-like                  353   4e-114   
gb|KFK38252.1|  hypothetical protein AALP_AA3G089100                    353   6e-114   
ref|XP_004295347.1|  PREDICTED: polygalacturonase-like                  353   6e-114   
ref|XP_010657416.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    353   6e-114   
ref|XP_010486355.1|  PREDICTED: polygalacturonase-like                  353   6e-114   
ref|XP_010547226.1|  PREDICTED: polygalacturonase-like                  353   7e-114   
gb|AFK35534.1|  unknown                                                 353   9e-114   
ref|XP_006407793.1|  hypothetical protein EUTSA_v10020872mg             352   1e-113   
ref|XP_003544285.1|  PREDICTED: polygalacturonase-like                  351   2e-113   
sp|Q39786.1|PGLR_GOSHI  RecName: Full=Polygalacturonase; Short=PG...    352   2e-113   Gossypium hirsutum [American cotton]
ref|XP_010418169.1|  PREDICTED: polygalacturonase-like                  352   2e-113   
gb|ABY21306.1|  pollen allergen Pla o 2                                 350   3e-113   Platanus orientalis
ref|XP_004170151.1|  PREDICTED: polygalacturonase-like                  351   3e-113   
gb|KGN43464.1|  hypothetical protein Csa_7G037910                       351   4e-113   
ref|XP_009334234.1|  PREDICTED: exopolygalacturonase-like               351   4e-113   
ref|XP_011039263.1|  PREDICTED: exopolygalacturonase-like               350   5e-113   
ref|XP_010248093.1|  PREDICTED: exopolygalacturonase-like               349   5e-113   
ref|XP_002865611.1|  hypothetical protein ARALYDRAFT_494865             350   5e-113   
ref|XP_010548798.1|  PREDICTED: polygalacturonase-like                  350   5e-113   
ref|XP_004167279.1|  PREDICTED: exopolygalacturonase-like               350   8e-113   
ref|XP_010548800.1|  PREDICTED: polygalacturonase-like                  350   8e-113   
ref|XP_002310765.1|  hypothetical protein POPTR_0007s11860g             350   8e-113   Populus trichocarpa [western balsam poplar]
gb|KHN40047.1|  Polygalacturonase                                       349   2e-112   
emb|CAN65676.1|  hypothetical protein VITISV_002011                     355   2e-112   Vitis vinifera
ref|XP_004165943.1|  PREDICTED: polygalacturonase-like                  349   2e-112   
gb|KFK31316.1|  hypothetical protein AALP_AA6G096900                    348   3e-112   
ref|NP_199625.1|  putative polygalacturonase / pectinase                348   3e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407792.1|  hypothetical protein EUTSA_v10020872mg             348   3e-112   
gb|ADK92878.1|  polygalacturonase                                       348   6e-112   
sp|Q39766.1|PGLR_GOSBA  RecName: Full=Polygalacturonase; Short=PG...    348   8e-112   Gossypium barbadense [Egyptian cotton]
ref|XP_008229849.1|  PREDICTED: exopolygalacturonase-like               347   2e-111   
ref|XP_008229852.1|  PREDICTED: exopolygalacturonase-like               347   2e-111   
ref|XP_004305963.1|  PREDICTED: exopolygalacturonase-like               346   2e-111   
ref|XP_010439352.1|  PREDICTED: polygalacturonase-like                  346   2e-111   
ref|XP_010667847.1|  PREDICTED: exopolygalacturonase-like               345   7e-111   
ref|XP_006395214.1|  hypothetical protein EUTSA_v10004361mg             345   9e-111   
ref|XP_009124109.1|  PREDICTED: polygalacturonase-like                  344   1e-110   
ref|XP_008231346.1|  PREDICTED: exopolygalacturonase-like               345   1e-110   
emb|CAA72003.1|  polygalacturonase                                      344   1e-110   Medicago sativa [alfalfa]
ref|XP_006299382.1|  hypothetical protein CARUB_v10015541mg             344   2e-110   
ref|XP_010482057.1|  PREDICTED: polygalacturonase-like                  343   3e-110   
ref|XP_008245680.1|  PREDICTED: exopolygalacturonase-like               343   4e-110   
ref|XP_006299755.1|  hypothetical protein CARUB_v10015950mg             345   4e-110   
ref|XP_010675884.1|  PREDICTED: exopolygalacturonase-like               343   4e-110   
ref|XP_008465833.1|  PREDICTED: exopolygalacturonase-like               343   4e-110   
ref|XP_008229862.1|  PREDICTED: polygalacturonase-like                  353   4e-110   
ref|XP_010464426.1|  PREDICTED: polygalacturonase-like                  342   2e-109   
ref|XP_011003515.1|  PREDICTED: exopolygalacturonase clone GBGA48...    342   2e-109   
emb|CDY22137.1|  BnaC01g39640D                                          341   3e-109   
ref|XP_004292143.1|  PREDICTED: polygalacturonase-like                  344   3e-109   
ref|XP_008245812.1|  PREDICTED: exopolygalacturonase-like               341   5e-109   
ref|XP_010442229.1|  PREDICTED: polygalacturonase-like                  340   5e-109   
ref|XP_006489998.1|  PREDICTED: exopolygalacturonase-like               340   5e-109   
ref|XP_008222765.1|  PREDICTED: exopolygalacturonase-like               340   6e-109   
ref|XP_006279754.1|  hypothetical protein CARUB_v10027711mg             340   7e-109   
emb|CDY05701.1|  BnaC02g38360D                                          339   2e-108   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    365   3e-108   
emb|CDX86325.1|  BnaA06g30420D                                          338   4e-108   
emb|CDY22140.1|  BnaC01g39610D                                          338   5e-108   
ref|XP_009134997.1|  PREDICTED: polygalacturonase                       338   5e-108   
gb|AAM74219.1|AF518563_1  putative pollen polygalacturonase             337   6e-108   Brassica oleracea
ref|XP_004161033.1|  PREDICTED: exopolygalacturonase-like               337   7e-108   
gb|AAP42648.1|  polygalacturonase                                       337   8e-108   Brassica napus [oilseed rape]
gb|ACP74159.1|  putative polygalacturonase                              337   1e-107   
ref|XP_009129707.1|  PREDICTED: polygalacturonase-like                  337   1e-107   
ref|XP_009151612.1|  PREDICTED: polygalacturonase                       336   2e-107   
ref|XP_008455507.1|  PREDICTED: exopolygalacturonase-like               336   2e-107   
ref|XP_010675930.1|  PREDICTED: exopolygalacturonase-like               337   2e-107   
ref|XP_004144529.1|  PREDICTED: polygalacturonase-like                  336   3e-107   
ref|XP_009124086.1|  PREDICTED: polygalacturonase                       335   3e-107   
ref|XP_006492955.1|  PREDICTED: exopolygalacturonase-like               336   4e-107   
emb|CDP04342.1|  unnamed protein product                                331   6e-107   
ref|XP_004163433.1|  PREDICTED: polygalacturonase-like                  335   1e-106   
ref|XP_010038560.1|  PREDICTED: exopolygalacturonase                    334   1e-106   
ref|XP_006495222.1|  PREDICTED: exopolygalacturonase-like               334   2e-106   
emb|CDY54512.1|  BnaC07g49180D                                          333   5e-106   
ref|XP_004295350.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    332   5e-106   
ref|XP_004154764.1|  PREDICTED: polygalacturonase-like                  332   6e-106   
gb|AAO24261.1|  putative pollen polygalacturonase                       332   7e-106   Turnera subulata [white alder]
ref|XP_004293444.1|  PREDICTED: polygalacturonase-like                  332   1e-105   
ref|XP_004514023.1|  PREDICTED: polygalacturonase-like                  331   2e-105   
sp|P35337.1|PGLR_BRANA  RecName: Full=Polygalacturonase; Short=PG...    331   2e-105   Brassica napus [oilseed rape]
ref|XP_008366919.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    333   2e-105   
gb|ABE77145.1|  putative polygalacturonase                              330   4e-105   Fragaria x ananassa
ref|XP_010675940.1|  PREDICTED: exopolygalacturonase-like               330   6e-105   
ref|XP_006371365.1|  hypothetical protein POPTR_0019s09490g             327   7e-105   
emb|CAN65674.1|  hypothetical protein VITISV_002009                     350   7e-105   Vitis vinifera
gb|ABR26683.1|  polygalacturonase                                       330   7e-105   Fragaria chiloensis
gb|AHL24657.1|  Sal k 6.01 allergen                                     329   8e-105   
ref|XP_002526193.1|  hypothetical protein RCOM_0764760                  329   8e-105   Ricinus communis
gb|AAP37458.1|  polygalacturonase                                       329   1e-104   Fragaria x ananassa
ref|XP_010999531.1|  PREDICTED: polygalacturonase-like                  326   2e-104   
ref|XP_009350286.1|  PREDICTED: exopolygalacturonase-like               328   3e-104   
ref|XP_010668126.1|  PREDICTED: exopolygalacturonase clone GBGA48...    324   4e-103   
ref|XP_010557773.1|  PREDICTED: exopolygalacturonase clone GBGA48...    325   6e-103   
ref|XP_004162885.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    325   8e-103   
ref|XP_004144612.1|  PREDICTED: exopolygalacturonase clone GBGA48...    324   1e-102   
ref|XP_010689005.1|  PREDICTED: exopolygalacturonase-like               323   4e-102   
ref|XP_008462107.1|  PREDICTED: exopolygalacturonase clone GBGA483      321   2e-101   
ref|XP_010675916.1|  PREDICTED: exopolygalacturonase-like               318   2e-100   
ref|XP_010253373.1|  PREDICTED: exopolygalacturonase-like               315   6e-100   
ref|XP_004169306.1|  PREDICTED: polygalacturonase-like                  316   2e-99    
ref|XP_002884670.1|  exopolygalacturonase                               317   4e-99    
ref|XP_010675951.1|  PREDICTED: exopolygalacturonase-like isoform X1    315   4e-99    
ref|XP_004289173.1|  PREDICTED: polygalacturonase-like                  315   4e-99    
ref|XP_010099972.1|  hypothetical protein L484_014009                   315   4e-99    
ref|XP_006375551.1|  hypothetical protein POPTR_0014s16040g             314   7e-99    
ref|XP_006407789.1|  hypothetical protein EUTSA_v10020501mg             318   1e-98    
ref|XP_002526191.1|  Polygalacturonase precursor, putative              312   4e-98    Ricinus communis
ref|XP_008367231.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    310   7e-98    
ref|XP_004144611.1|  PREDICTED: polygalacturonase-like                  315   8e-98    
ref|XP_004292620.1|  PREDICTED: polygalacturonase-like                  317   1e-97    
ref|XP_004296118.1|  PREDICTED: polygalacturonase-like                  312   1e-97    
ref|XP_008462134.1|  PREDICTED: exopolygalacturonase-like               312   8e-97    
ref|XP_008229865.1|  PREDICTED: polygalacturonase                       307   9e-97    
ref|XP_010464428.1|  PREDICTED: exopolygalacturonase clone GBGA48...    310   2e-96    
ref|XP_010675960.1|  PREDICTED: exopolygalacturonase clone GBGA48...    304   6e-96    
ref|XP_010486356.1|  PREDICTED: exopolygalacturonase clone GBGA48...    307   2e-95    
ref|XP_010458380.1|  PREDICTED: exopolygalacturonase clone GBGA48...    306   3e-95    
ref|XP_011073814.1|  PREDICTED: exopolygalacturonase clone GBGA48...    303   8e-95    
ref|XP_007143499.1|  hypothetical protein PHAVU_007G076800g             301   1e-94    
ref|XP_004142607.1|  PREDICTED: polygalacturonase-like                  300   2e-94    
ref|XP_010458261.1|  PREDICTED: exopolygalacturonase clone GBGA48...    303   3e-94    
ref|XP_002862616.1|  polygalacturonase                                  303   4e-94    
ref|XP_010064300.1|  PREDICTED: exopolygalacturonase-like               301   5e-94    
ref|XP_002885005.1|  polygalacturonase                                  303   5e-94    
ref|XP_004289111.1|  PREDICTED: exopolygalacturonase-like               302   7e-94    
ref|XP_009147020.1|  PREDICTED: exopolygalacturonase clone GBGA48...    303   9e-94    
gb|KCW46857.1|  hypothetical protein EUGRSUZ_K00661                     300   1e-93    
ref|XP_007143501.1|  hypothetical protein PHAVU_007G0769002g            295   1e-93    
ref|XP_004153799.1|  PREDICTED: polygalacturonase-like                  298   2e-93    
ref|XP_006299516.1|  hypothetical protein CARUB_v10015686mg             301   3e-93    
ref|XP_006421347.1|  hypothetical protein CICLE_v10006970mg             298   5e-93    
gb|KDP24950.1|  hypothetical protein JCGZ_24417                         299   1e-92    
emb|CBI28399.3|  unnamed protein product                                296   3e-92    
ref|XP_008227080.1|  PREDICTED: exopolygalacturonase-like               297   3e-92    
emb|CDX80531.1|  BnaC07g29130D                                          297   5e-92    
emb|CDX74027.1|  BnaA03g30200D                                          297   6e-92    
emb|CDY07972.1|  BnaC03g35510D                                          297   6e-92    
emb|CDP04349.1|  unnamed protein product                                291   6e-92    
ref|XP_009134998.1|  PREDICTED: exopolygalacturonase clone GBGA48...    297   6e-92    
ref|XP_010913888.1|  PREDICTED: exopolygalacturonase-like               296   9e-92    
emb|CAA51692.1|  exopolygalacturonase                                   296   2e-91    
ref|XP_010064302.1|  PREDICTED: exopolygalacturonase-like               295   3e-91    
ref|XP_010324136.1|  PREDICTED: exopolygalacturonase-like               293   7e-91    
ref|NP_188020.1|  exopolygalacturonase / galacturan 1,4-alpha-gal...    295   1e-90    
emb|CAA11160.1|  polygalacturonase                                      295   1e-90    
gb|AAL32525.1|  polygalacturonase; pectinase                            295   1e-90    
ref|NP_187442.1|  polygalacturonase-like protein                        294   2e-90    
gb|KDP27317.1|  hypothetical protein JCGZ_21001                         293   2e-90    
gb|KCW66880.1|  hypothetical protein EUGRSUZ_F00634                     292   2e-90    
emb|CAA51033.1|  exopolygalacturonase                                   293   3e-90    
ref|XP_002437276.1|  hypothetical protein SORBIDRAFT_10g024020          292   3e-90    
ref|XP_003617998.1|  Polygalacturonase                                  289   5e-90    
emb|CDY22139.1|  BnaC01g39620D                                          290   6e-90    
ref|XP_007020651.1|  Pectin lyase-like superfamily protein, putative    291   6e-90    
ref|XP_009147021.1|  PREDICTED: exopolygalacturonase clone GBGA48...    295   8e-90    
gb|KFK38239.1|  hypothetical protein AALP_AA3G087400                    294   9e-90    
ref|XP_009596400.1|  PREDICTED: exopolygalacturonase-like               290   1e-89    
ref|XP_009767891.1|  PREDICTED: exopolygalacturonase-like               290   2e-89    
ref|XP_004174175.1|  PREDICTED: exopolygalacturonase-like               284   3e-89    
ref|XP_010690734.1|  PREDICTED: exopolygalacturonase                    289   4e-89    
ref|XP_007199143.1|  hypothetical protein PRUPE_ppa019563mg             288   4e-89    
ref|XP_006492953.1|  PREDICTED: exopolygalacturonase clone GBGA48...    287   6e-89    
ref|XP_008798766.1|  PREDICTED: exopolygalacturonase-like               288   2e-88    
ref|XP_006656242.1|  PREDICTED: exopolygalacturonase-like               287   2e-88    
ref|NP_001152243.1|  polygalacturonase precursor                        287   2e-88    
ref|XP_009589812.1|  PREDICTED: exopolygalacturonase-like               287   3e-88    
ref|XP_004306136.1|  PREDICTED: exopolygalacturonase-like               285   3e-88    
ref|XP_004967187.1|  PREDICTED: polygalacturonase-like                  286   5e-88    
ref|XP_010536242.1|  PREDICTED: polygalacturonase-like                  283   5e-88    
dbj|BAK05779.1|  predicted protein                                      286   6e-88    
ref|NP_001141808.1|  uncharacterized protein LOC100273946 precursor     286   6e-88    
gb|AAQ63000.1|  oil palm polygalacturonase allergen PEST643             286   1e-87    
ref|XP_008805455.1|  PREDICTED: exopolygalacturonase-like               285   1e-87    
ref|XP_010913952.1|  PREDICTED: exopolygalacturonase-like               286   1e-87    
ref|XP_010266273.1|  PREDICTED: exopolygalacturonase-like               286   1e-87    
gb|EMT33862.1|  putative Exopolygalacturonase                           285   1e-87    
gb|EYU35786.1|  hypothetical protein MIMGU_mgv1a026431mg                285   2e-87    
gb|KHN44923.1|  Polygalacturonase                                       281   2e-87    
ref|XP_006647023.1|  PREDICTED: exopolygalacturonase-like               284   2e-87    
ref|XP_010469513.1|  PREDICTED: exopolygalacturonase-like               284   4e-87    
ref|XP_010530386.1|  PREDICTED: exopolygalacturonase                    285   4e-87    
ref|XP_009776874.1|  PREDICTED: exopolygalacturonase-like               284   4e-87    
ref|XP_010259724.1|  PREDICTED: exopolygalacturonase-like               284   2e-86    
ref|XP_004171844.1|  PREDICTED: polygalacturonase-like                  277   2e-86    
ref|XP_002273801.1|  PREDICTED: exopolygalacturonase                    281   3e-86    
gb|EYU42737.1|  hypothetical protein MIMGU_mgv1a0087912mg               276   3e-86    
ref|XP_010259722.1|  PREDICTED: exopolygalacturonase-like               284   3e-86    
ref|XP_006838947.1|  hypothetical protein AMTR_s00002p00270640          281   4e-86    
gb|EYU29596.1|  hypothetical protein MIMGU_mgv1a020057mg                280   4e-86    
ref|XP_002272193.1|  PREDICTED: exopolygalacturonase                    282   6e-86    
gb|KDO58458.1|  hypothetical protein CISIN_1g045893mg                   278   6e-86    
ref|XP_008349920.1|  PREDICTED: exopolygalacturonase-like               280   6e-86    
ref|XP_011085138.1|  PREDICTED: polygalacturonase                       280   6e-86    
ref|XP_003560585.2|  PREDICTED: exopolygalacturonase-like               280   1e-85    
ref|XP_008366452.1|  PREDICTED: exopolygalacturonase-like               279   1e-85    
ref|XP_007143503.1|  hypothetical protein PHAVU_007G0770001g            275   2e-85    
ref|XP_002312795.2|  hypothetical protein POPTR_0009s17010g             280   2e-85    
ref|XP_004144607.1|  PREDICTED: polygalacturonase-like                  281   2e-85    
ref|XP_008645431.1|  PREDICTED: exopolygalacturonase-like               280   3e-85    
ref|XP_008235914.1|  PREDICTED: exopolygalacturonase                    284   3e-85    
ref|XP_009333810.1|  PREDICTED: exopolygalacturonase-like               280   3e-85    
emb|CDP06168.1|  unnamed protein product                                279   4e-85    
ref|XP_010269646.1|  PREDICTED: exopolygalacturonase-like               281   4e-85    
ref|XP_002451722.1|  hypothetical protein SORBIDRAFT_04g006610          280   6e-85    
ref|XP_006845389.1|  hypothetical protein AMTR_s00019p00055210          278   7e-85    
ref|XP_006410452.1|  hypothetical protein EUTSA_v10017763mg             278   8e-85    
ref|XP_010540121.1|  PREDICTED: exopolygalacturonase                    278   9e-85    
ref|XP_008645416.1|  PREDICTED: exopolygalacturonase-like               279   9e-85    
ref|XP_006353088.1|  PREDICTED: exopolygalacturonase-like               277   1e-84    
ref|XP_004134494.1|  PREDICTED: exopolygalacturonase-like               278   1e-84    
ref|XP_009341510.1|  PREDICTED: exopolygalacturonase-like               278   1e-84    
ref|XP_006442242.1|  hypothetical protein CICLE_v10023493mg             277   1e-84    
ref|XP_011083305.1|  PREDICTED: exopolygalacturonase-like               277   1e-84    
ref|XP_008357338.1|  PREDICTED: exopolygalacturonase-like               278   1e-84    
ref|XP_010509923.1|  PREDICTED: exopolygalacturonase-like               277   2e-84    
emb|CBI36886.3|  unnamed protein product                                277   2e-84    
ref|XP_008377875.1|  PREDICTED: exopolygalacturonase-like               277   2e-84    
gb|KDO51597.1|  hypothetical protein CISIN_1g046411mg                   276   3e-84    
ref|XP_008649074.1|  PREDICTED: exopolygalacturonase                    277   3e-84    
ref|XP_010472056.1|  PREDICTED: exopolygalacturonase-like               276   3e-84    
dbj|BAD25264.1|  putative exopolygalacturonase precursor                277   3e-84    
ref|XP_008649075.1|  PREDICTED: exopolygalacturonase-like               276   3e-84    
ref|XP_010652203.1|  PREDICTED: exopolygalacturonase                    276   4e-84    
ref|NP_001046194.1|  Os02g0196700                                       277   5e-84    
gb|EAZ01647.1|  hypothetical protein OsI_23683                          276   5e-84    
ref|XP_008449197.1|  PREDICTED: exopolygalacturonase-like               274   7e-84    
ref|XP_009419161.1|  PREDICTED: exopolygalacturonase-like               275   8e-84    
ref|XP_004146727.1|  PREDICTED: polygalacturonase-like                  273   8e-84    
emb|CAA40910.1|  polygalacturonase                                      275   8e-84    
gb|KCW66879.1|  hypothetical protein EUGRSUZ_F00633                     274   8e-84    
emb|CAA46680.1|  polygalacturonase                                      275   9e-84    
gb|ABD79098.1|  Zea m 13 allergen                                       275   9e-84    
ref|XP_006656147.1|  PREDICTED: exopolygalacturonase-like               276   9e-84    
ref|NP_001105432.1|  exopolygalacturonase precursor                     275   1e-83    
ref|XP_008364854.1|  PREDICTED: exopolygalacturonase-like               275   1e-83    
ref|NP_177961.2|  pectin lyase-like superfamily protein                 275   1e-83    
ref|XP_008231357.1|  PREDICTED: exopolygalacturonase-like               272   1e-83    
emb|CAA40851.1|  polygalacturonase                                      275   1e-83    
ref|XP_011000860.1|  PREDICTED: exopolygalacturonase-like               276   1e-83    
ref|XP_006493147.1|  PREDICTED: polygalacturonase-like                  275   1e-83    
gb|KCW80887.1|  hypothetical protein EUGRSUZ_C02251                     275   1e-83    
gb|AFW76314.1|  hypothetical protein ZEAMMB73_313945                    275   1e-83    
ref|XP_006856226.1|  hypothetical protein AMTR_s00059p00207710          275   1e-83    
sp|P35338.1|PGLR2_MAIZE  RecName: Full=Exopolygalacturonase; Shor...    275   1e-83    
pir||S16998  polygalacturonase (EC 3.2.1.15) - maize                    273   2e-83 
gb|ACN85237.1|  exopolygalacturonase precursor                          275   2e-83    
emb|CDY52447.1|  BnaA07g39240D                                          274   2e-83    
ref|XP_008438909.1|  PREDICTED: exopolygalacturonase-like               275   2e-83    
ref|XP_006477959.1|  PREDICTED: exopolygalacturonase-like               275   3e-83    
ref|XP_007050989.1|  Polygalacturonase 4, putative                      275   3e-83    
ref|XP_002529091.1|  Polygalacturonase precursor, putative              273   3e-83    
ref|XP_010251320.1|  PREDICTED: exopolygalacturonase-like               274   3e-83    
ref|XP_009106547.1|  PREDICTED: exopolygalacturonase                    274   3e-83    
emb|CDX88444.1|  BnaC06g38880D                                          273   3e-83    
ref|XP_010270548.1|  PREDICTED: exopolygalacturonase-like               274   4e-83    
ref|XP_006389987.1|  hypothetical protein EUTSA_v10018650mg             273   4e-83    
ref|NP_001058060.1|  Os06g0611400                                       274   4e-83    
ref|XP_008660316.1|  PREDICTED: exopolygalacturonase-like               273   5e-83    
ref|XP_006486583.1|  PREDICTED: exopolygalacturonase-like               274   5e-83    
ref|XP_009398783.1|  PREDICTED: exopolygalacturonase-like               273   6e-83    
ref|XP_010317352.1|  PREDICTED: exopolygalacturonase-like               272   6e-83    
gb|EAZ37619.1|  hypothetical protein OsJ_21954                          273   6e-83    
ref|XP_004965898.1|  PREDICTED: exopolygalacturonase-like               273   8e-83    
ref|XP_010650742.1|  PREDICTED: polygalacturonase                       272   9e-83    
gb|ABE65925.1|  polygalacturonase/pectinase                             268   1e-82    
ref|XP_009379685.1|  PREDICTED: exopolygalacturonase-like               272   1e-82    
ref|XP_006659306.1|  PREDICTED: exopolygalacturonase-like               273   1e-82    
ref|XP_006447721.1|  hypothetical protein CICLE_v10017883mg             270   1e-82    
ref|XP_010413907.1|  PREDICTED: exopolygalacturonase-like               271   1e-82    
ref|XP_003519756.1|  PREDICTED: exopolygalacturonase clone GBGE18...    273   1e-82    
ref|XP_007043095.1|  Pectin lyase-like superfamily protein isoform 1    273   2e-82    
ref|XP_006656243.1|  PREDICTED: exopolygalacturonase-like               272   2e-82    
ref|XP_006856225.1|  hypothetical protein AMTR_s00059p00207430          271   2e-82    
ref|XP_008451196.1|  PREDICTED: exopolygalacturonase isoform X3         270   2e-82    
ref|XP_008451195.1|  PREDICTED: exopolygalacturonase isoform X2         271   3e-82    
ref|XP_004149595.1|  PREDICTED: exopolygalacturonase-like               270   3e-82    
ref|XP_010277789.1|  PREDICTED: polygalacturonase-like                  271   3e-82    
gb|AES67852.2|  polygalacturonase                                       270   3e-82    
gb|KGN43365.1|  hypothetical protein Csa_7G027810                       272   3e-82    
ref|XP_008451194.1|  PREDICTED: exopolygalacturonase isoform X1         271   4e-82    
ref|XP_002437275.1|  hypothetical protein SORBIDRAFT_10g024010          271   4e-82    
ref|XP_011083297.1|  PREDICTED: exopolygalacturonase-like               271   4e-82    
ref|XP_006845467.1|  hypothetical protein AMTR_s00019p00130680          270   4e-82    
ref|XP_008678508.1|  PREDICTED: exopolygalacturonase-like               270   5e-82    
ref|XP_008383110.1|  PREDICTED: exopolygalacturonase-like               270   6e-82    
ref|XP_010508362.1|  PREDICTED: polygalacturonase-like                  270   6e-82    
ref|XP_010431549.1|  PREDICTED: exopolygalacturonase-like               270   6e-82    
gb|KCW80886.1|  hypothetical protein EUGRSUZ_C02249                     270   8e-82    
ref|XP_004986318.1|  PREDICTED: exopolygalacturonase-like               270   1e-81    
gb|EEC80963.1|  hypothetical protein OsI_23684                          270   1e-81    
emb|CAN69218.1|  hypothetical protein VITISV_012014                     281   1e-81    
ref|XP_004974598.1|  PREDICTED: exopolygalacturonase-like               269   1e-81    
emb|CDP18456.1|  unnamed protein product                                269   1e-81    
gb|AIL01321.1|  group 13 allergen Sor h 13.02                           270   1e-81    
ref|XP_003571072.1|  PREDICTED: exopolygalacturonase-like               270   2e-81    
ref|XP_002438528.1|  hypothetical protein SORBIDRAFT_10g021590          270   2e-81    
ref|XP_009411633.1|  PREDICTED: exopolygalacturonase-like               270   2e-81    
gb|ACN85300.1|  exopolygalacturonase precursor                          270   2e-81    
ref|XP_008465729.1|  PREDICTED: polygalacturonase-like                  269   2e-81    
ref|XP_010277790.1|  PREDICTED: polygalacturonase-like                  269   2e-81    
ref|XP_002444237.1|  hypothetical protein SORBIDRAFT_07g016970          269   2e-81    
gb|EMT26517.1|  Exopolygalacturonase                                    267   2e-81    
ref|XP_008649072.1|  PREDICTED: exopolygalacturonase-like               269   3e-81    
emb|CDY30445.1|  BnaA04g25460D                                          268   3e-81    
ref|XP_006493146.1|  PREDICTED: polygalacturonase-like                  268   3e-81    
ref|XP_004143823.1|  PREDICTED: polygalacturonase-like                  268   4e-81    
ref|XP_008803528.1|  PREDICTED: exopolygalacturonase-like               268   4e-81    
ref|NP_001105862.1|  exopolygalacturonase precursor                     268   5e-81    
gb|EEE66006.1|  hypothetical protein OsJ_21955                          268   5e-81    
ref|NP_001058061.1|  Os06g0611500                                       268   6e-81    
ref|XP_002879431.1|  hypothetical protein ARALYDRAFT_902380             268   6e-81    
emb|CDY71093.1|  BnaCnng71300D                                          263   6e-81    
gb|KEH33414.1|  polygalacturonase/glycoside hydrolase family protein    267   7e-81    
ref|XP_004495937.1|  PREDICTED: exopolygalacturonase clone GBGE18...    268   8e-81    
ref|NP_001057815.1|  Os06g0545400                                       268   8e-81    
ref|XP_009142235.1|  PREDICTED: polygalacturonase-like                  267   8e-81    
gb|EAZ01276.1|  hypothetical protein OsI_23299                          268   8e-81    
ref|XP_009367790.1|  PREDICTED: exopolygalacturonase-like               267   9e-81    
ref|XP_008460791.1|  PREDICTED: polygalacturonase-like                  267   1e-80    
gb|AAF71796.1|AC013430_5  F3F9.9                                        268   1e-80    
ref|XP_010324075.1|  PREDICTED: exopolygalacturonase-like               267   1e-80    
gb|EPS61275.1|  polygalacturonase                                       261   1e-80    
sp|P35339.1|PGLR3_MAIZE  RecName: Full=Exopolygalacturonase; Shor...    267   1e-80    
gb|EMS46493.1|  Exopolygalacturonase                                    266   1e-80    
gb|KHN08670.1|  Galacturan 1,4-alpha-galacturonidase4                   267   1e-80    
emb|CDY23407.1|  BnaC04g49350D                                          266   1e-80    
ref|XP_004295855.1|  PREDICTED: exopolygalacturonase-like               267   2e-80    
gb|AIL01320.1|  group 13 allergen Sor h 13.01                           267   2e-80    
ref|XP_006301427.1|  hypothetical protein CARUB_v10021845mg             267   2e-80    
ref|XP_006296295.1|  hypothetical protein CARUB_v10025465mg             266   2e-80    
gb|KDO51598.1|  hypothetical protein CISIN_1g041973mg                   266   2e-80    
gb|KGN43436.1|  Polygalacturonase                                       264   2e-80    
ref|XP_003591491.1|  Polygalacturonase                                  266   2e-80    
gb|EMT18530.1|  Exopolygalacturonase                                    266   2e-80    
ref|XP_006492954.1|  PREDICTED: exopolygalacturonase-like               265   3e-80    
gb|ABD79097.1|  Zea m 13 allergen                                       266   3e-80    
ref|XP_002889191.1|  predicted protein                                  266   3e-80    
emb|CDY28013.1|  BnaC05g44150D                                          269   3e-80    
gb|KGN66774.1|  hypothetical protein Csa_1G689640                       266   3e-80    
ref|XP_010324757.1|  PREDICTED: polygalacturonase-like                  267   3e-80    
ref|XP_004288736.1|  PREDICTED: polygalacturonase-like                  266   3e-80    
emb|CDX79512.1|  BnaC03g18480D                                          266   3e-80    
ref|XP_010506294.1|  PREDICTED: polygalacturonase-like                  266   3e-80    
ref|XP_007140804.1|  hypothetical protein PHAVU_008G143500g             266   4e-80    
ref|XP_011073040.1|  PREDICTED: exopolygalacturonase-like               269   4e-80    
ref|XP_003535015.1|  PREDICTED: polygalacturonase-like                  265   4e-80    
ref|XP_010526674.1|  PREDICTED: polygalacturonase                       265   5e-80    
gb|AHL24656.1|  Ole e 13.01 allergen                                    265   5e-80    
ref|NP_172057.1|  pectin lyase-like protein                             265   5e-80    
ref|XP_009132913.1|  PREDICTED: exopolygalacturonase-like               265   6e-80    
ref|XP_002301488.2|  hypothetical protein POPTR_0002s20330g             265   7e-80    



>ref|XP_009612480.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=401

 Score =   452 bits (1163),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 226/392 (58%), Positives = 278/392 (71%), Gaps = 13/392 (3%)
 Frame = +1

Query  52    ISYCAFTFILFLLAHFGESA---------IINVAAKANVDVGPLLMKAWKEACAATTAST  204
             + + +F F+L   A  G++          +    A  N D+   ++ A+KEACAAT+ ST
Sbjct  3     LKFTSFAFLLLFFARIGDAQPTASPGVFDVTKYGATTNGDISKAVLDAFKEACAATSPST  62

Query  205   IVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGG  384
             IVIPKGT+ M QV L+GPCKAPVEL++ AILKAP DPK +    EWL V  +D FTLSGG
Sbjct  63    IVIPKGTYQMNQVKLQGPCKAPVELQVQAILKAPSDPKQLSADIEWLTVNYIDRFTLSGG  122

Query  385   GTLDGQGNVQVYPSKEKGFKG-DKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNL  561
             G  DGQG      +  K  K    LPNNLS NFLTNS I+DIT+ +SKLFH+NV G KNL
Sbjct  123   GVFDGQGKQAWGQNNCKDSKSCSNLPNNLSFNFLTNSTIQDITSQDSKLFHINVNGCKNL  182

Query  562   TFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPG  741
             TF    + AP  S NTDGIH+AR   + + D VIGTGDDCIS+GD LE L IT VTCGPG
Sbjct  183   TFIRVNITAPQESINTDGIHVARSSNVNITDCVIGTGDDCISVGDELEQLHITRVTCGPG  242

Query  742   HGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDV  921
             HGISVGSLG+TPGE+PV G++V N  FI TDNGVR+KTWP SH GVVTD+HY  I +++V
Sbjct  243   HGISVGSLGKTPGEKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTDLHYEDIIVQNV  302

Query  922   KNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIG  1101
              NPIVIDQ YCP N+C+K  PSKVKISKVS K+I+GTS T++ V+L CS G PC+ VE+G
Sbjct  303   SNPIVIDQVYCPYNQCNKDLPSKVKISKVSIKNIRGTSRTQDAVLLLCSKGAPCDGVEVG  362

Query  1102  EIDLTF---KGGAKTICSNVKPKLTGKQCPKV  1188
             +ID+T+   +G AK+ C NVKPKL GKQ P +
Sbjct  363   DIDITYNGKEGPAKSSCENVKPKLVGKQNPPI  394



>ref|XP_009764608.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=401

 Score =   451 bits (1160),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 225/392 (57%), Positives = 279/392 (71%), Gaps = 13/392 (3%)
 Frame = +1

Query  52    ISYCAFTFILFLLAHFGESA---------IINVAAKANVDVGPLLMKAWKEACAATTAST  204
             + + +F F+L  LA  G++          +    A  N D+   ++ A+KEACAAT+ ST
Sbjct  3     LKFISFAFLLLFLARIGDAQPTTSPGVFDVTKYGATTNGDISKAVLDAFKEACAATSPST  62

Query  205   IVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGG  384
             IVIPKGT+ M QV L+GPCKAPVEL++ AILKAP DPK ++   EWL V  +D FTLSGG
Sbjct  63    IVIPKGTYQMNQVKLQGPCKAPVELQVQAILKAPSDPKQLNADVEWLTVNYIDRFTLSGG  122

Query  385   GTLDGQGNVQVYPSKEKGFKG-DKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNL  561
             G  DGQG      +  K  K    LPNNLS NFLTNS I+DIT+ +SKLFH+NV G KNL
Sbjct  123   GVFDGQGKQAWDQNNCKDSKSCSNLPNNLSFNFLTNSTIQDITSQDSKLFHINVNGCKNL  182

Query  562   TFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPG  741
             TF    + AP  S NTDGIH+AR   + + D VIGTGDDCIS+GD LE L IT VTCGPG
Sbjct  183   TFIRVNITAPPESINTDGIHVARSSNVNITDCVIGTGDDCISVGDELEQLHITRVTCGPG  242

Query  742   HGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDV  921
             HGISVGSLG+TPGE+PV G++V N  FI TDNGVR+KTWP SH GVVTD+HY  I +++V
Sbjct  243   HGISVGSLGKTPGEKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTDLHYEDIIVQNV  302

Query  922   KNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIG  1101
              NPIVIDQ YCP N+C+K  PS+VKISKVS K+I+GTS T++ V+L CS G PC+ VE+G
Sbjct  303   SNPIVIDQVYCPYNQCNKDLPSQVKISKVSIKNIRGTSRTQDAVLLLCSKGAPCDGVEVG  362

Query  1102  EIDLTF---KGGAKTICSNVKPKLTGKQCPKV  1188
             +ID+T+   +G AK+ C NVKPK  GKQ P +
Sbjct  363   DIDITYNGKEGPAKSSCENVKPKFVGKQNPPI  394



>ref|XP_009599317.1| PREDICTED: polygalacturonase [Nicotiana tomentosiformis]
Length=396

 Score =   447 bits (1149),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 225/382 (59%), Positives = 272/382 (71%), Gaps = 11/382 (3%)
 Frame = +1

Query  67    FTFILFLLAHFGESA-----IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFP  231
             F  +L  LAHFGES      I    A +N D+   L+ A+KEAC +T+ STIVIPKGTF 
Sbjct  9     FALVLLFLAHFGESQTGVFDITKYGANSNADISEALLNAFKEACQSTSPSTIVIPKGTFT  68

Query  232   MTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV  411
             M QV LEGPCK+P+EL+I A LKAP DP  +    EWL V ++D FT+SGGG LDGQ   
Sbjct  69    MNQVKLEGPCKSPLELQIQATLKAPSDPSQLK-VGEWLTVNKLDQFTMSGGGILDGQAAA  127

Query  412   QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAP  591
                  + K  K +KLPNNLS N LTNS I+DITTL+SK FHVNV   KNLTF  F V AP
Sbjct  128   AWECKQSK--KCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAP  185

Query  592   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  771
              NSPNTDGIH++R   + + DS   TGDDCIS+GD  E L IT VTCGPGHGISVGSLG 
Sbjct  186   ANSPNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGG  245

Query  772   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEY  951
              P E+PV G+FV N  F  TDNGVRIKTWP SHPGVV D+H+  I +++V NP+VIDQ Y
Sbjct  246   NPDEKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVY  305

Query  952   CPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---K  1122
             CP N+C+K  PS+VKISKVS+++IKGTS T++ V L CS GVPCE +E+G+ID+T+   +
Sbjct  306   CPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKE  365

Query  1123  GGAKTICSNVKPKLTGKQCPKV  1188
             G AK+ C N+KP L GKQ P V
Sbjct  366   GPAKSSCENIKPSLKGKQNPPV  387



>ref|XP_009804151.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=401

 Score =   446 bits (1148),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 222/386 (58%), Positives = 275/386 (71%), Gaps = 11/386 (3%)
 Frame = +1

Query  64    AFTFILFLLAHFGES--AIINVAA-----KANVDVGPLLMKAWKEACAATTASTIVIPKG  222
             +F F L  L H GES  A+ +V        +N D+   L+ A+KEAC +   S +VIPKG
Sbjct  8     SFAFALLFLVHIGESQPAVFDVTKFGAKPDSNEDISKALLSAFKEACNSKIPSKVVIPKG  67

Query  223   TFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQ  402
             T+ M QV LEG CKAP+EL+I A LKAPP+P  +    EWL +  +DHFTLSGGG  DGQ
Sbjct  68    TYLMNQVRLEGNCKAPIELEIQATLKAPPNPSQLKKDMEWLTINHIDHFTLSGGGIFDGQ  127

Query  403   GNVQVYPSKEKGFKG-DKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFT  579
             G      +  K  +   KLPNNLS NFLTNS+IRDIT+L+SKLFH+NVLG KNLTF    
Sbjct  128   GEQGWAQNDCKNSESCGKLPNNLSFNFLTNSIIRDITSLDSKLFHINVLGCKNLTFIGVN  187

Query  580   VKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVG  759
             +KAP  S NTDGIH+AR  G+ + +S IGTGDDCIS+GDG++ + IT VTCGPGHGISVG
Sbjct  188   IKAPAQSLNTDGIHVARSRGLNITNSQIGTGDDCISIGDGIQQMYITNVTCGPGHGISVG  247

Query  760   SLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVI  939
             SLG+TPGE PV G+FV N  FI TDNGVR+KTWP SH GVV D+HY  I +++V NP+VI
Sbjct  248   SLGKTPGELPVVGVFVQNCTFIDTDNGVRVKTWPASHNGVVRDLHYEDIIVQNVSNPVVI  307

Query  940   DQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF  1119
             DQ YCP N+C K  PS+VKISKVS+K+I+GTS T++ + + CS GVPCE VE+G+ID+T+
Sbjct  308   DQLYCPYNQCKKDLPSQVKISKVSFKNIRGTSRTQDAIKINCSKGVPCEGVEVGDIDITY  367

Query  1120  KGG---AKTICSNVKPKLTGKQCPKV  1188
              G    AK+ C NV P   GKQ P V
Sbjct  368   NGNEGPAKSTCQNVDPSFVGKQIPPV  393



>pir||S46530 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.X and clone 
pC27.Y) - common tobacco (fragment)
 emb|CAA50334.1| polygalacturonase [Nicotiana tabacum]
 emb|CAA50336.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   444 bits (1141),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 224/379 (59%), Positives = 271/379 (72%), Gaps = 11/379 (3%)
 Frame = +1

Query  76    ILFLLAHFGESA-----IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQ  240
             +L  LAHFGES      I    A +N D+   L+ A+KEAC +T+ STIVIPKGTF M Q
Sbjct  1     VLLFLAHFGESQTGVFDITKYGANSNADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQ  60

Query  241   VSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVY  420
             V LEGPCK+P+EL+I A LKAP DP  +    EWL V ++D FT+SGGG LDGQ      
Sbjct  61    VKLEGPCKSPLELQIQATLKAPSDPSQLK-VGEWLTVNKLDQFTMSGGGILDGQAAAAWE  119

Query  421   PSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNS  600
               + K  K +KLPNNLS N LTNS I+DITTL+SK FHVNV   KNLTF  F V AP NS
Sbjct  120   CKQSK--KCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPANS  177

Query  601   PNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPG  780
             PNTDGIH++R   + + DS   TGDDCIS+GD  E L IT VTCGPGHGISVGSLG  P 
Sbjct  178   PNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNPD  237

Query  781   ERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPN  960
             E+PV G+FV N  F  TDNGVRIKTWP SHPGVV D+H+  I +++V NP+VIDQ YCP 
Sbjct  238   EKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPF  297

Query  961   NECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGA  1131
             N+C+K  PS+VKISKVS+++IKGTS T++ V L CS GVPCE +E+G+ID+T+   +G A
Sbjct  298   NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPA  357

Query  1132  KTICSNVKPKLTGKQCPKV  1188
             K+ C N+KP L GKQ P V
Sbjct  358   KSSCENIKPSLKGKQNPPV  376



>dbj|BAO02513.1| predicted polygalacturonase ortholog [Nicotiana alata]
Length=401

 Score =   444 bits (1141),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 224/382 (59%), Positives = 271/382 (71%), Gaps = 11/382 (3%)
 Frame = +1

Query  67    FTFILFLLAHFGESA-----IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFP  231
             F  +L  LAHFGES      I    A +N D+   L+ A+KEAC +T+ STIVIPKGTF 
Sbjct  9     FALVLLFLAHFGESQTGVFDITKYGANSNADISEALLSAFKEACQSTSPSTIVIPKGTFT  68

Query  232   MTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV  411
             M QV LEGPCK+P+EL+I A LKAP DP  +    EWL V ++D FT+SGGG LDGQ   
Sbjct  69    MNQVKLEGPCKSPLELQIQATLKAPSDPSQLK-VGEWLTVNKIDQFTMSGGGILDGQAAA  127

Query  412   QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAP  591
                    K  K +KLPNNLS N LTNS I+DITTL+SK FHVNV   KNLTF  F V AP
Sbjct  128   AWECKNSK--KCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAP  185

Query  592   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  771
              NSPNTDGIH++R   + + DS   TGDDCIS+GD  E L IT VTCGPGHGISVGSLG 
Sbjct  186   ANSPNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGG  245

Query  772   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEY  951
              P E+PV G+FV N  F  TDNGVRIKTWP SHPGVV D+H+  I +++V NP+VIDQ Y
Sbjct  246   NPDEKPVIGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVY  305

Query  952   CPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---K  1122
             CP N+C+K  PS+VKISKVS+++IKGTS T++ V L CS GVPCE +E+G+ID+++   +
Sbjct  306   CPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDISYSGKE  365

Query  1123  GGAKTICSNVKPKLTGKQCPKV  1188
             G AK+ C N+KP L GKQ P V
Sbjct  366   GPAKSSCENIKPSLKGKQNPPV  387



>ref|XP_004253347.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=403

 Score =   444 bits (1141),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 228/387 (59%), Positives = 274/387 (71%), Gaps = 11/387 (3%)
 Frame = +1

Query  52    ISYCAFTFILFLLAHFGESA-----IINVAAKANVDVGPLLMKAWKEACAATTASTIVIP  216
             I +  F   +  LAHFGES      I    A AN D+   + KA+KEACA+T+ STIVIP
Sbjct  5     IKFVYFGLGVLFLAHFGESQNATFDITKYGATANADISEAVGKAFKEACASTSPSTIVIP  64

Query  217   KGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLD  396
             KGTF M QV LEGPCK P+EL+I AILKAP DP N     EWL V ++D FT+SGGGTLD
Sbjct  65    KGTFQMNQVLLEGPCKGPIELQIQAILKAPTDP-NAIKTGEWLTVNKLDFFTMSGGGTLD  123

Query  397   GQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHF  576
             GQG       K K  K  KLPNNLS N LTNS+I+DITTL+SK FHVNV   KNLTF  F
Sbjct  124   GQGKEAWECKKSK--KCTKLPNNLSFNSLTNSIIKDITTLDSKAFHVNVNQCKNLTFTKF  181

Query  577   TVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISV  756
              V AP +SPNTDGIH+AR   + + +S   TGDDCIS+GD  E L IT VTCGPGHGISV
Sbjct  182   NVSAPADSPNTDGIHVARASSVNITESSFSTGDDCISIGDETEQLYITKVTCGPGHGISV  241

Query  757   GSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIV  936
             GSLG  PGE+PV G+FV N   + TDNGVRIKTWP SHPGVV+DIH+  I +++V NPIV
Sbjct  242   GSLGGNPGEKPVVGVFVKNCTLVSTDNGVRIKTWPASHPGVVSDIHFEDIIVQNVSNPIV  301

Query  937   IDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLT  1116
             IDQ YCP+ +C+K  PS+VKISKVS ++IKGTS T+  + L CS G PCE VE+G++D++
Sbjct  302   IDQVYCPSGKCNKDLPSQVKISKVSIQNIKGTSRTQNAISLTCSKGSPCEGVEVGDVDIS  361

Query  1117  F---KGGAKTICSNVKPKLTGKQCPKV  1188
             +   +G AK+ C N+KP   GKQ P V
Sbjct  362   YSGKEGPAKSSCENIKPTFKGKQTPAV  388



>sp|Q05967.1|PGLR_TOBAC RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA50338.1| polygalacturonase [Nicotiana tabacum]
Length=396

 Score =   442 bits (1136),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 224/382 (59%), Positives = 271/382 (71%), Gaps = 11/382 (3%)
 Frame = +1

Query  67    FTFILFLLAHFGESA-----IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFP  231
             F  +L  LAHFGES      I    A +N D+   L+ A+KEAC +T+ STIVIPKGTF 
Sbjct  9     FALVLLFLAHFGESQTGVFDITKYGANSNADISEALLNAFKEACQSTSPSTIVIPKGTFT  68

Query  232   MTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV  411
             M QV LEGPCK+P+EL+I A LKAP DP  +    EWL V ++D FT+SGGG LDGQ   
Sbjct  69    MNQVKLEGPCKSPLELQIQATLKAPSDPSQLK-VGEWLTVNKLDQFTMSGGGILDGQAAA  127

Query  412   QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAP  591
                  + K  K +KLPNNLS N LTNS I+DITTL+SK FHVNV   KNLTF  F V AP
Sbjct  128   AWECKQSK--KCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAP  185

Query  592   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  771
              NSPNTDGIH++R   + + DS   TGDDCIS+GD  E L IT VTCGPGHGISVGSLG 
Sbjct  186   ANSPNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGG  245

Query  772   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEY  951
              P E+PV G+FV N  F  TDNGVRIKTWP SHPGVV D+H+  I +++V NP+VIDQ Y
Sbjct  246   NPDEKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVY  305

Query  952   CPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---K  1122
             CP N+C+K  PS+VKISKVS+++IKGTS T++ V L  S GVPCE +E+G+ID+T+   +
Sbjct  306   CPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLRSKGVPCEGIEVGDIDITYSGKE  365

Query  1123  GGAKTICSNVKPKLTGKQCPKV  1188
             G AK+ C N+KP L GKQ P V
Sbjct  366   GPAKSSCENIKPSLKGKQNPPV  387



>pir||S46529 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.W) - common 
tobacco (fragment)
 emb|CAA50337.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   441 bits (1135),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 223/379 (59%), Positives = 270/379 (71%), Gaps = 11/379 (3%)
 Frame = +1

Query  76    ILFLLAHFGESA-----IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQ  240
             +L  LAHFGES      I    A +N D+   L+ A+KEAC +T+ STIVIPKGTF M Q
Sbjct  1     VLLFLAHFGESQTGVFDITKYGANSNADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQ  60

Query  241   VSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVY  420
             V LEGPCK+P+EL+I A LKAP DP  +    EWL V ++D FT+SGGG LDGQ      
Sbjct  61    VKLEGPCKSPLELQIQATLKAPSDPSQLK-VGEWLTVNKLDQFTMSGGGILDGQAAAAWE  119

Query  421   PSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNS  600
               + K  K +KLPNNLS N LTNS I+DITTL+SK FHVNV   KNLTF  F V AP NS
Sbjct  120   CKQSK--KCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPANS  177

Query  601   PNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPG  780
             PNTDGIH++R   + + DS   TGDDCIS+GD  E L IT VTCGPGHGISVGSLG  P 
Sbjct  178   PNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNPD  237

Query  781   ERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPN  960
             E+PV G+FV N  F  TDNGVRIKTWP SHPGVV D+H+  I +++V NP+VIDQ YCP 
Sbjct  238   EKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPF  297

Query  961   NECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGA  1131
             N+C+K  PS+VKISKVS+++IKGTS T++ V L CS GVPCE +E+G+ID+T+   +G A
Sbjct  298   NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPA  357

Query  1132  KTICSNVKPKLTGKQCPKV  1188
             K+ C N+KP L  KQ P V
Sbjct  358   KSSCENIKPSLKDKQNPPV  376



>emb|CAA50335.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   440 bits (1131),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 222/379 (59%), Positives = 270/379 (71%), Gaps = 11/379 (3%)
 Frame = +1

Query  76    ILFLLAHFGESA-----IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQ  240
             +L  LAHFGES      I    A +N D+   L+ A+KEAC +T+ STIVIPKGTF M Q
Sbjct  1     VLLFLAHFGESQTGVFDITKYGANSNADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQ  60

Query  241   VSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVY  420
             V LEGPCK+P+EL+I A LKAP DP  +    EWL V ++D FT+SGGG LDGQ      
Sbjct  61    VKLEGPCKSPLELQIQATLKAPSDPSQLK-VGEWLTVNKLDQFTMSGGGILDGQAAAAWE  119

Query  421   PSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNS  600
               + K  K +KLPNNLS N LTNS ++DITTL+SK FHVNV   KNLTF  F V AP NS
Sbjct  120   CKQSK--KCNKLPNNLSFNSLTNSTVKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPANS  177

Query  601   PNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPG  780
             PNTDGIH++R   + + DS   TGDDCIS+GD  E L IT VTCGPGHGISVGSLG  P 
Sbjct  178   PNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNPD  237

Query  781   ERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPN  960
             E+PV G+FVSN     TDNGVRIKTWP SHPGVV D+ +  I +++V NP+VIDQ YCP 
Sbjct  238   EKPVVGVFVSNCTVTNTDNGVRIKTWPASHPGVVNDVRFEDIIVQNVSNPVVIDQVYCPF  297

Query  961   NECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGA  1131
             N+C+K  PS+VKISKVS+++IKGTS T++ V L CS GVPCE +E+G+ID+T+   +G A
Sbjct  298   NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPA  357

Query  1132  KTICSNVKPKLTGKQCPKV  1188
             K+ C N+KP L GKQ P V
Sbjct  358   KSSCENIKPSLKGKQNPPV  376



>ref|XP_009601010.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=401

 Score =   440 bits (1131),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 220/385 (57%), Positives = 273/385 (71%), Gaps = 11/385 (3%)
 Frame = +1

Query  67    FTFILFLLAHFGES--AIINVAA-----KANVDVGPLLMKAWKEACAATTASTIVIPKGT  225
             F F L  L + GES  A+ +V        +N D+   L+ A+KEAC +   S +VIPKG 
Sbjct  9     FAFALVFLVYTGESQPAVFDVTKFGAKPDSNEDISKALLSAFKEACNSKIPSKVVIPKGI  68

Query  226   FPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQG  405
             + M QV LEG CKAP+EL+I A LKAPP+P  +    EWL +  +DHFTLSGGG  DGQG
Sbjct  69    YLMNQVRLEGNCKAPIELQIQATLKAPPNPSQLKKDMEWLTINHIDHFTLSGGGIFDGQG  128

Query  406   NVQVYPSKEKGFKG-DKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTV  582
                   +  K  +   KLPNNLS NFLTNS+IRDIT+L+SKLFH+NVLG KNLTF    +
Sbjct  129   EQGWAQNDCKNSESCGKLPNNLSFNFLTNSIIRDITSLDSKLFHINVLGCKNLTFIGVNI  188

Query  583   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  762
             KAP  S NTDGIH+AR  G+ + +S IGTGDDCIS+GDG++ + IT VTCGPGHGISVGS
Sbjct  189   KAPAQSLNTDGIHVARSRGVNITNSEIGTGDDCISIGDGVQQMYITNVTCGPGHGISVGS  248

Query  763   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVID  942
             LG+TPGE PV G+FV N  FI TDNGVR+KTWP SH GVV D+HY  I +++V NP+VID
Sbjct  249   LGKTPGELPVVGVFVQNCTFIDTDNGVRVKTWPASHNGVVRDLHYEDIIVQNVSNPVVID  308

Query  943   QEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFK  1122
             Q YCP N+C K  PS+VKISKVS+K+I+GTS T++ + + CS GVPCE VE+G+ID+T+ 
Sbjct  309   QLYCPYNQCKKDLPSQVKISKVSFKNIRGTSRTQDAIQINCSKGVPCEGVEVGDIDITYN  368

Query  1123  GG---AKTICSNVKPKLTGKQCPKV  1188
             G    AK+ C NV P   GKQ P V
Sbjct  369   GNEGPAKSSCQNVDPSFVGKQNPPV  393



>ref|XP_009780910.1| PREDICTED: polygalacturonase [Nicotiana sylvestris]
Length=402

 Score =   436 bits (1120),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 220/373 (59%), Positives = 267/373 (72%), Gaps = 11/373 (3%)
 Frame = +1

Query  94    HFGESA-----IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGP  258
             HFGES      I    A +N D+   L+ A+KEAC +T+ STIVIPKGTF M QV LEGP
Sbjct  19    HFGESQTGVFDITKYGANSNADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQVKLEGP  78

Query  259   CKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKG  438
             CK+P+EL+I A LKAP DP  +    EWL V ++D FT+SGGG LDGQ        + K 
Sbjct  79    CKSPLELQIQATLKAPSDPSQLK-VGEWLTVNKIDQFTMSGGGILDGQAAAAWECKQSK-  136

Query  439   FKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGI  618
              K +KLPNNLS N LTNS ++DITTL+SK FHVNV   KNLTF  F V AP NSPNTDGI
Sbjct  137   -KCNKLPNNLSFNSLTNSTVKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPANSPNTDGI  195

Query  619   HIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKG  798
             H++R   + + DS   TGDDCIS+GD  E L IT VTCGPGHGISVGSLG  P E+PV G
Sbjct  196   HVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNPDEKPVVG  255

Query  799   IFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQ  978
             +FV N  F  TDNGVRIKTWP SHPGVV D+H+  I +++V NP+VIDQ YCP N+C+K 
Sbjct  256   VFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPFNKCNKD  315

Query  979   KPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSN  1149
              PS+VKISKVS+++IKGTS T++ V L CS GVPCE +E+G+ID+T+   +G AK+ C N
Sbjct  316   LPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPAKSSCEN  375

Query  1150  VKPKLTGKQCPKV  1188
             +KP L GKQ P V
Sbjct  376   IKPSLKGKQNPPV  388



>emb|CDP18013.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   418 bits (1075),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 205/384 (53%), Positives = 269/384 (70%), Gaps = 9/384 (2%)
 Frame = +1

Query  61    CAFTFILFLL-AHFGESAIINVAAK--ANVDVGPLLMKAWKEACAATTASTIVIPKGTFP  231
             C++ F   ++ A  G   +  + AK   + D+  +L  AWK+AC +TTASTI+IPKGTF 
Sbjct  11    CSWLFFTCIVQAQTGPIDVTQLGAKPDGSADMSQVLADAWKQACNSTTASTILIPKGTFL  70

Query  232   MTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV  411
             + + SL GPCKAPVE++I  I+KAP DP  +    EW+ +  VD  TLSGGGTLDGQG  
Sbjct  71    LKEASLAGPCKAPVEIQIQGIIKAPEDPAQISKDNEWMTIKYVDQLTLSGGGTLDGQG-A  129

Query  412   QVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVK  585
             + +   E   K +  KLPN LSLNF+ N+VIRD+T+LNSKLFHVN+ G  N+TF HFT+ 
Sbjct  130   KAWTQNECRVKTECSKLPNTLSLNFVNNTVIRDLTSLNSKLFHVNLFGCNNITFQHFTIT  189

Query  586   APGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSL  765
             APG+SPNTDGIHI    G+ + DS IGTGDDCIS+GDG + + I+ VTCGPGHGISVGSL
Sbjct  190   APGDSPNTDGIHIGHSTGVVITDSNIGTGDDCISIGDGAKQVNISKVTCGPGHGISVGSL  249

Query  766   GRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQ  945
             GR   E PV+GIFV++    GT NGVR+K+WP +  G  T++H+  I M++V NP++IDQ
Sbjct  250   GRYDNELPVEGIFVTDCTISGTLNGVRVKSWPAAKSGSATNMHFEGIIMQNVSNPVIIDQ  309

Query  946   EYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKG  1125
             EYCPNN+C+   PS VKI++VS+K+I GTSAT   V L CS  +PC+ VEI +IDL + G
Sbjct  310   EYCPNNQCTNTAPSSVKIAQVSFKNITGTSATPAAVTLLCSKSIPCDGVEIADIDLAYNG  369

Query  1126  GAKTI---CSNVKPKLTGKQCPKV  1188
                 +   C+NVKP L+GK  P +
Sbjct  370   NQGNVSSNCANVKPALSGKLNPPI  393



>emb|CDP04348.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   417 bits (1073),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 206/390 (53%), Positives = 271/390 (69%), Gaps = 9/390 (2%)
 Frame = +1

Query  43    MATISYCAFTFILFLL-AHFGESAIINVAAK--ANVDVGPLLMKAWKEACAATTASTIVI  213
             + T   C++ F   ++ A  G   +  + AK   + D+  +L  AWK+AC +TT STI+I
Sbjct  5     LGTTLLCSWLFFTCIVQAQTGPIDVTQLGAKPDGSADMSQVLADAWKQACNSTTPSTILI  64

Query  214   PKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTL  393
             PKGTF + + SL GPCKAPVE++I   +KAP DP  +   KEW+ +  VD  TLSGGGTL
Sbjct  65    PKGTFLLKEASLAGPCKAPVEVQIQGTVKAPEDPAQITKDKEWMSIIYVDQLTLSGGGTL  124

Query  394   DGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTF  567
             DGQG  + +   E   K +  KLPN LSLNF+ N+VIRD+T+LNSKLFHVN+ G  N+TF
Sbjct  125   DGQG-AKAWTQNECRVKTECSKLPNTLSLNFVNNTVIRDLTSLNSKLFHVNLFGCNNITF  183

Query  568   DHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHG  747
              HFT+ APG+SPNTDGIHI    G+ + DS IGTGDDCIS+GDG + + I+ VTCGPGHG
Sbjct  184   QHFTIIAPGDSPNTDGIHIGHSTGVVITDSNIGTGDDCISIGDGAKQVNISKVTCGPGHG  243

Query  748   ISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKN  927
             ISVGSLGR   E PV+GIFV++    GT NGVR+K+WP S  G  T++H+  I M++V N
Sbjct  244   ISVGSLGRYDNELPVEGIFVTDCTISGTLNGVRVKSWPASKSGSATNMHFEGIIMQNVSN  303

Query  928   PIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEI  1107
             P++IDQEYCPNN+C+   PS VKI++VS+K+I GTSAT   V L CS  +PCE VE+ +I
Sbjct  304   PVIIDQEYCPNNQCTNTAPSSVKIAQVSFKNITGTSATPAAVTLLCSKSIPCEGVEVADI  363

Query  1108  DLTFKGGAKTI---CSNVKPKLTGKQCPKV  1188
             DL + G   ++   C+NVKP L+GK  P +
Sbjct  364   DLAYNGNQGSVSSNCANVKPALSGKLNPPI  393



>ref|XP_006366630.1| PREDICTED: polygalacturonase-like [Solanum tuberosum]
Length=384

 Score =   413 bits (1062),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 209/378 (55%), Positives = 262/378 (69%), Gaps = 9/378 (2%)
 Frame = +1

Query  79    LFLLAHFGESA-----IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQV  243
             +  LA  G +      +    A  N D+   ++ A+KEACA+T+AS I++PKG F M QV
Sbjct  1     MLFLARLGAAQAGVFDVTKFGATPNGDISKAILDAFKEACASTSASRIIVPKGRFQMKQV  60

Query  244   SLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYP  423
              LEGPCKAP+E ++   L+A PDPK +  + EW  V  ++ FTLSG G  DGQG      
Sbjct  61    KLEGPCKAPLEFQLQGTLEASPDPKILP-EGEWFTVNYLNQFTLSGTGIFDGQGKAAWAQ  119

Query  424   SKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  603
             +     K   LP NLS NFL +S I+DIT+ +SK FH+NV G  NLTF+  T+ AP  S 
Sbjct  120   NDCAKTKCAHLPYNLSFNFLNSSTIQDITSKDSKNFHMNVNGCNNLTFNRITITAPKESI  179

Query  604   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  783
             NTDGIH+AR   + + DSVIGTGDDCIS+GD LE L IT VTCGPGHGISVGSLG+TPGE
Sbjct  180   NTDGIHVARSKNVNITDSVIGTGDDCISVGDELEQLHITKVTCGPGHGISVGSLGKTPGE  239

Query  784   RPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNN  963
             +PV G++V N  FI TDNGVR+KTWP SH GVVT++HY  I +++V NPIVIDQ YCP N
Sbjct  240   KPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTELHYEDIIVQNVSNPIVIDQVYCPYN  299

Query  964   ECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAK  1134
             +C+K  PS VKISKVS K++KGTS T++ V+L CS GVPCE VE+G+ID+T+   +G AK
Sbjct  300   QCNKDLPSLVKISKVSIKNVKGTSRTQDAVLLLCSKGVPCEGVEVGDIDITYNGKEGPAK  359

Query  1135  TICSNVKPKLTGKQCPKV  1188
             T C NVKP   G Q P V
Sbjct  360   TSCENVKPTFVGNQNPPV  377



>emb|CDP04343.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   412 bits (1058),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 203/384 (53%), Positives = 268/384 (70%), Gaps = 9/384 (2%)
 Frame = +1

Query  61    CAFTFILFLL-AHFGESAIINVAAKAN--VDVGPLLMKAWKEACAATTASTIVIPKGTFP  231
             C++ F   ++ A  G   +I + AK +   D+  +L  AWK+AC +TTASTI+IPKGTF 
Sbjct  11    CSWLFFTCIVQARTGPIDVIQLGAKRDGRADMSQVLANAWKQACNSTTASTILIPKGTFL  70

Query  232   MTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV  411
             + + SL GPCKAP+ ++I   +KAP DP  +   KEW+ +  V+  TLSGGGTLDGQG  
Sbjct  71    LKEASLVGPCKAPITIQIQGTIKAPADPAQISKDKEWITIMYVNQLTLSGGGTLDGQG-A  129

Query  412   QVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVK  585
             + +   E   K +  KLPN LSLNF+ N+VIRD+T+LNSKLFHVN+    N+TF HFT+ 
Sbjct  130   KAWTQNECRVKTECSKLPNTLSLNFVNNTVIRDLTSLNSKLFHVNLFACNNVTFQHFTIT  189

Query  586   APGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSL  765
             APG+SPNTDGIHI    G+ + +S IGTGDDCIS+GDG + + I+ VTCGPGHGISVGSL
Sbjct  190   APGDSPNTDGIHIGHSTGVVITNSNIGTGDDCISIGDGAKQVNISKVTCGPGHGISVGSL  249

Query  766   GRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQ  945
             GR   E PV+GIFV++    GT NGVR+K+WP S  G  T++H+  I M++V NP++IDQ
Sbjct  250   GRYDNELPVEGIFVTDCTISGTLNGVRVKSWPASKRGSATNMHFEGIIMQNVSNPVIIDQ  309

Query  946   EYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKG  1125
             EYCPNN+C+   PS+VKI++VS+K I GTSAT   V L CS  +PCE VE+  IDL + G
Sbjct  310   EYCPNNQCTNTAPSRVKIAQVSFKHITGTSATPAAVTLLCSKSIPCEGVEVAHIDLAYNG  369

Query  1126  GAKTI---CSNVKPKLTGKQCPKV  1188
                T+   C+NVKP L+GK  P +
Sbjct  370   KQGTLSSKCANVKPVLSGKLNPPI  393



>ref|XP_004243884.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=392

 Score =   405 bits (1041),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 201/362 (56%), Positives = 254/362 (70%), Gaps = 4/362 (1%)
 Frame = +1

Query  112   IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMA  291
             +    A  N D+   ++ A+KEACA+T+ S +++PKGTF M QV LEGPCKAP+E ++  
Sbjct  25    VTKFGATPNGDISKAILDAFKEACASTSPSRVIVPKGTFQMKQVKLEGPCKAPLEFQLQG  84

Query  292   ILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLS  471
              L+A PDPK +  + EW  V  V+ FTLSG G  DGQG      +     K   LP NLS
Sbjct  85    TLQASPDPKALP-EGEWFTVNYVNQFTLSGTGIFDGQGKAAWAQNDCAKTKCAHLPYNLS  143

Query  472   LNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVK  651
              N+L +S I+DIT+ +SK FH+NV G  N T +  T+ AP  S NTDGIH+AR   + + 
Sbjct  144   FNYLNSSTIQDITSKDSKNFHMNVNGCNNFTLNRVTISAPKESINTDGIHVARSKNVNIT  203

Query  652   DSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGT  831
             D VIGTGDDCIS+GD LE L IT VTCGPGHGISVGSLG+TPGE+PV G++V N  FI T
Sbjct  204   DCVIGTGDDCISIGDELEQLHITKVTCGPGHGISVGSLGKTPGEKPVVGVYVKNCTFINT  263

Query  832   DNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVS  1011
             DNGVR+KTWP SH GVVT++HY  I +++V NP+VIDQ YCP N+C+K  PS VKISKVS
Sbjct  264   DNGVRVKTWPASHQGVVTELHYEDIVVQNVSNPVVIDQVYCPYNQCNKDLPSLVKISKVS  323

Query  1012  YKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTGKQCP  1182
              K++KGTS+T++ V L CS GVPCE VE+G+ID+ +   +G AKT C NVKP   GKQ P
Sbjct  324   IKNVKGTSSTQDAVQLLCSKGVPCEGVEVGDIDIAYNGKEGPAKTSCENVKPTFVGKQNP  383

Query  1183  KV  1188
              V
Sbjct  384   PV  385



>ref|XP_007009871.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18681.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=400

 Score =   405 bits (1040),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 198/364 (54%), Positives = 261/364 (72%), Gaps = 8/364 (2%)
 Frame = +1

Query  112   IINVAAKA--NVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKI  285
             ++N  AKA    D+   LM AW+EACA  + S +VIP+G + ++QV+L GPCKAPVE+++
Sbjct  31    VMNFGAKAGGKTDISQALMAAWREACALVSPSKVVIPEGEYVLSQVTLAGPCKAPVEVQV  90

Query  286   MAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKE--KGFKGDKLP  459
                LKAP DP   +    W+   R+DHFTLSG GT DGQG    +   +  +  K +KLP
Sbjct  91    RGNLKAPADPSKFNNVPSWVTFQRIDHFTLSGAGTFDGQGGYAAWAQNDCKQSKKCNKLP  150

Query  460   NNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIG  639
              N+  NF+TN ++RDIT+++SK FH+N+LG KNLTF + T+ AP  SPNTDGIHI R  G
Sbjct  151   INIRFNFVTNGLVRDITSVDSKQFHINLLGCKNLTFANITINAPDQSPNTDGIHIGRSSG  210

Query  640   ITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSK  819
             I + DS I TGDDCISLG G +N+ I+ VTCGPGHGISVGSLG+   E PV GI V N  
Sbjct  211   IDITDSRISTGDDCISLGGGSQNITISRVTCGPGHGISVGSLGKYKDE-PVFGINVVNCA  269

Query  820   FIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKI  999
              I T NGVR+KTWP S  G+ +D+H+  I M +V NP++IDQEYCP+N+C+ + PS+VKI
Sbjct  270   LINTSNGVRVKTWPASLEGIASDMHFEDIVMVNVSNPVLIDQEYCPSNKCNLKAPSRVKI  329

Query  1000  SKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTG  1170
             S VS+K+I+GTSAT+  V LACSSG+PCE+VEIG+I+L++   KG A + CSNVKP + G
Sbjct  330   SNVSFKNIRGTSATQVAVKLACSSGIPCENVEIGDINLSYIGTKGPATSQCSNVKPTIAG  389

Query  1171  KQCP  1182
             +Q P
Sbjct  390   RQTP  393



>gb|KHN24677.1| Polygalacturonase [Glycine soja]
Length=389

 Score =   400 bits (1028),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 203/384 (53%), Positives = 259/384 (67%), Gaps = 6/384 (2%)
 Frame = +1

Query  37    LKMATISYCAFTFIL-FLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVI  213
             +K A I+     F+L F  A  G+  I     K N ++G   + AW +ACA+ TA  IVI
Sbjct  1     MKFAIITILFSLFLLDFGFAQQGDLDISRFGGKPNTNIGQAFLSAWTQACASPTAVKIVI  60

Query  214   PKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTL  393
             P GT+ M  V ++GPCKAP+E+++   ++AP +P ++    +W +V  V+ FTLSG G  
Sbjct  61    PAGTYQMGAVDVKGPCKAPIEVQVDGTIQAPANPTDLKAAHQWFVVQYVNSFTLSGKGVF  120

Query  394   DGQGNVQVYPSKEKGFKGDK-LPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFD  570
             DGQG      +     K  K L  N   NFL NS++RDIT+ +SK FHVNVLG  N TFD
Sbjct  121   DGQGATAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNFTFD  180

Query  571   HFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGI  750
              F V AP +SPNTDGIHI R   + + ++ I TGDDC+SLGDG +N+ +  V CGPGHGI
Sbjct  181   GFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGCKNITVQNVNCGPGHGI  240

Query  751   SVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHYHKIEMEDVK  924
             SVGSLG+   E PV G+ V N    GTDNGVRIKTWPN+ PG   +TD+H+  + M +V 
Sbjct  241   SVGSLGKYDAEEPVAGLLVKNCTLNGTDNGVRIKTWPNT-PGAITITDMHFEDLTMNNVT  299

Query  925   NPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGE  1104
             NPI+IDQEYCP N+CSKQ PSK+KISKVS+K+IKGTS TKE V+L CSSGVPCE VE+ +
Sbjct  300   NPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGTKEGVVLVCSSGVPCEAVEMAD  359

Query  1105  IDLTFKGGAKTI-CSNVKPKLTGK  1173
             IDLTF G A T  C+NVKP +TGK
Sbjct  360   IDLTFNGSAATAKCANVKPTITGK  383



>dbj|BAA89477.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   399 bits (1026),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 201/349 (58%), Positives = 250/349 (72%), Gaps = 9/349 (3%)
 Frame = +1

Query  142   DVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKN  321
             D+   L  AWK+ACA+T  S ++IP GT+ + QV+L GPCKA +EL++  ILKAP +P  
Sbjct  41    DITEALNNAWKDACASTNPSKVLIPSGTYSLRQVTLAGPCKAAIELQVNGILKAPVNPDQ  100

Query  322   MDGKKEWLIVGRVDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNLSLNFLTNS  492
               G   W+    +D  TLSG GT DGQGNV   +   SK K  +G  LP N+  +F+TN 
Sbjct  101   FSGS-HWVNFRYIDQLTLSGSGTFDGQGNVAWSKSTCSKNKNCEG--LPMNIRFDFITNG  157

Query  493   VIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  672
             ++RDITT +SK FHVNVLG KNLTF HFTV AP  S NTDGIHI R  GI + DS IGTG
Sbjct  158   LVRDITTRDSKNFHVNVLGCKNLTFQHFTVTAPAESINTDGIHIGRSTGIYIIDSKIGTG  217

Query  673   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  852
             DDCIS+GDG E L +TGVTCGPGHGISVGSLGR P E+PV GIFV N     T NGVRIK
Sbjct  218   DDCISVGDGTEELHVTGVTCGPGHGISVGSLGRYPNEKPVSGIFVKNCTISNTANGVRIK  277

Query  853   TWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGT  1032
             +WP+ + GV +++H+  I M +V+NPI++DQ YCP N+CS + PSKVKIS VS+K+I+GT
Sbjct  278   SWPDLYGGVASNMHFEDIVMNNVQNPILLDQVYCPWNQCSLKAPSKVKISDVSFKNIRGT  337

Query  1033  SATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKTICSNVKPKLTG  1170
             SAT   V LACSSG+PCE VE+  I+L + G    AK+ CSNVKPK++G
Sbjct  338   SATPVVVKLACSSGIPCEKVELANINLLYSGSEGPAKSQCSNVKPKISG  386



>ref|XP_003552049.1| PREDICTED: polygalacturonase [Glycine max]
Length=389

 Score =   399 bits (1024),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 202/384 (53%), Positives = 258/384 (67%), Gaps = 6/384 (2%)
 Frame = +1

Query  37    LKMATISYCAFTFIL-FLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVI  213
             +K A I+     F+L F  A  G+  I     K N ++G   + AW +ACA+ T   IVI
Sbjct  1     MKFAIITILFSLFLLDFGFAQQGDLDISRFGGKPNTNIGQAFLSAWTQACASPTTVKIVI  60

Query  214   PKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTL  393
             P GT+ M  V ++GPCKAP+E+++   ++AP +P ++    +W +V  V+ FTLSG G  
Sbjct  61    PAGTYQMGAVDVKGPCKAPIEVQVDGTIQAPANPTDLKAAHQWFVVQYVNSFTLSGKGVF  120

Query  394   DGQGNVQVYPSKEKGFKGDK-LPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFD  570
             DGQG      +     K  K L  N   NFL NS++RDIT+ +SK FHVNVLG  N TFD
Sbjct  121   DGQGATAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNFTFD  180

Query  571   HFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGI  750
              F V AP +SPNTDGIHI R   + + ++ I TGDDC+SLGDG +N+ +  V CGPGHGI
Sbjct  181   GFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGCKNITVQNVNCGPGHGI  240

Query  751   SVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHYHKIEMEDVK  924
             SVGSLG+   E PV G+ V N    GTDNGVRIKTWPN+ PG   +TD+H+  + M +V 
Sbjct  241   SVGSLGKYDAEEPVAGLLVKNCTLNGTDNGVRIKTWPNT-PGAITITDMHFEDLTMNNVM  299

Query  925   NPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGE  1104
             NPI+IDQEYCP N+CSKQ PSK+KISKVS+K+IKGTS TKE V+L CSSGVPCE VE+ +
Sbjct  300   NPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGTKEGVVLVCSSGVPCEAVEMAD  359

Query  1105  IDLTFKGGAKTI-CSNVKPKLTGK  1173
             IDLTF G A T  C+NVKP +TGK
Sbjct  360   IDLTFNGSAATAKCANVKPTITGK  383



>dbj|BAA89478.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   397 bits (1021),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 199/349 (57%), Positives = 250/349 (72%), Gaps = 9/349 (3%)
 Frame = +1

Query  142   DVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKN  321
             D+   L  AWK+ACA+T  S ++IP GT+ + QV+L GPCKA +EL++  ILKAP +P  
Sbjct  41    DITEALNNAWKDACASTNPSKVLIPSGTYSLRQVTLAGPCKAAIELQVDGILKAPVNPDQ  100

Query  322   MDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPS---KEKGFKGDKLPNNLSLNFLTNS  492
               G   W+    VD  TLSG GT DGQGNV    S   K+K  +G  LP N+  +F+TN 
Sbjct  101   FSGG-SWVDFRHVDQLTLSGSGTFDGQGNVAWSKSTCNKDKNCEG--LPMNIRFDFITNG  157

Query  493   VIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  672
             ++RDITT +SK FHVNVLG KNLTF HFT+ APG S NTDGIHI +  GI + DS IGTG
Sbjct  158   LVRDITTRDSKNFHVNVLGCKNLTFQHFTMTAPGESINTDGIHIGQSTGIYIIDSNIGTG  217

Query  673   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  852
             DDCIS+GDG E L +TGVTCGPGHGISVGSLGR P E+PV GIFV N     T NGVRIK
Sbjct  218   DDCISVGDGTEELHVTGVTCGPGHGISVGSLGRYPNEKPVSGIFVKNCTISNTANGVRIK  277

Query  853   TWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGT  1032
             +WP+ + G  +++H+  I M +V+NP+V+DQEYCP N+CS + PSKVKIS VS+K+I+GT
Sbjct  278   SWPDLYGGAASNMHFEDIVMNNVQNPVVVDQEYCPWNQCSLKSPSKVKISDVSFKNIRGT  337

Query  1033  SATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKTICSNVKPKLTG  1170
             SAT   V LACS G+PCE VE+ +I+L + G    AK+ CSNVKP ++G
Sbjct  338   SATPVVVKLACSGGIPCEKVELADINLVYSGSEGPAKSQCSNVKPTISG  386



>dbj|BAA89476.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   397 bits (1020),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 200/349 (57%), Positives = 249/349 (71%), Gaps = 9/349 (3%)
 Frame = +1

Query  142   DVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKN  321
             D+   L  AWK+ACA+T  S + IP GT+ + QV+L GPCK+ +EL++  ILKAP +P  
Sbjct  41    DITAALTNAWKDACASTKPSKVRIPSGTYSLRQVTLAGPCKSAIELQVNGILKAPVNPDQ  100

Query  322   MDGKKEWLIVGRVDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNLSLNFLTNS  492
               G   W+    +DH TLSG GT DGQGNV   +   SK K  +G  LP N+  +F+TN 
Sbjct  101   FSGG-HWVNFRYIDHLTLSGSGTFDGQGNVAWSKSTCSKNKNCEG--LPMNIRFDFITNG  157

Query  493   VIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  672
             ++RDITT +SK FHVNVLG KNLTF HFTV AP  S NTDGIHI R  GI + DS IGTG
Sbjct  158   LVRDITTRDSKNFHVNVLGCKNLTFQHFTVTAPAESINTDGIHIGRSTGIYIIDSKIGTG  217

Query  673   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  852
             DDCIS+GDG E L +T VTCGPGHGISVGSLGR P E+PV GIFV N     T NGVRIK
Sbjct  218   DDCISVGDGTEELHVTRVTCGPGHGISVGSLGRYPNEKPVSGIFVKNCTISNTANGVRIK  277

Query  853   TWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGT  1032
             +WP+ + GV +++H+  I M +V+NPI++DQ YCP N+CS + PSKVKIS VS+K+I+GT
Sbjct  278   SWPDLYGGVASNMHFEDIVMNNVQNPILLDQVYCPWNQCSLKAPSKVKISDVSFKNIRGT  337

Query  1033  SATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKTICSNVKPKLTG  1170
             SAT   V LACSSG+PCE VE+  I+L + G    AK+ CSNVKPK++G
Sbjct  338   SATPVVVKLACSSGIPCEKVELANINLVYSGSEGPAKSQCSNVKPKISG  386



>ref|XP_006371366.1| hypothetical protein POPTR_0019s09500g [Populus trichocarpa]
 gb|ERP49163.1| hypothetical protein POPTR_0019s09500g [Populus trichocarpa]
Length=393

 Score =   396 bits (1018),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 204/387 (53%), Positives = 263/387 (68%), Gaps = 10/387 (3%)
 Frame = +1

Query  37    LKMATISYCAFTFILFLL----AHFGESAIINVAAK-ANVDVGPLLMKAWKEACAATTAS  201
             + +  +S    +F LFLL    A      + +V    ++ D+   L  AWK+ACA+T  S
Sbjct  1     MGLKVVSSAIISFSLFLLLASTAKAQSKGVFDVTKYGSDKDITEALTNAWKDACASTNPS  60

Query  202   TIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSG  381
              ++IP GT+ + +++L GPCKA +EL++  +LKAP DP    G   W+  G VD FTLSG
Sbjct  61    KVLIPSGTYSLRKLTLAGPCKAAIELQVDGMLKAPVDPNQFSGG-HWVNFGHVDKFTLSG  119

Query  382   GGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKN  558
              GT DGQG      S  +K    D LP NL  +F+TN+++RDITT +SK FHVNVLG KN
Sbjct  120   SGTFDGQGKAAWSKSTCQKDKDCDSLPMNLRFDFITNALVRDITTRDSKNFHVNVLGCKN  179

Query  559   LTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGP  738
             LTF HFTV APG S NTDGIH+ +  GI + DS IGTGDDCIS+GDG E L ITGVTCGP
Sbjct  180   LTFQHFTVSAPGESVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITGVTCGP  239

Query  739   GHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMED  918
             GHGISVGSLG+ P E+PV GIFV N     T NGVRIK+WP  + GV +++H+  I M +
Sbjct  240   GHGISVGSLGKYPNEKPVSGIFVKNCTLSDTTNGVRIKSWPALYGGVASNMHFEDIVMNN  299

Query  919   VKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEI  1098
             V+NP++IDQ YCP N+CS + PSKVKIS VS+K+I+GTSAT   V +ACSSG PCE VE+
Sbjct  300   VQNPVIIDQVYCPWNQCSLKAPSKVKISGVSFKNIRGTSATPVVVQIACSSGFPCEKVEL  359

Query  1099  GEIDLTFK---GGAKTICSNVKPKLTG  1170
              +I + +    G AK+ CSNVKP ++G
Sbjct  360   ADIKVAYSGPDGPAKSQCSNVKPIISG  386



>ref|XP_003522976.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   396 bits (1017),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 200/375 (53%), Positives = 254/375 (68%), Gaps = 9/375 (2%)
 Frame = +1

Query  73    FILFLL----AHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQ  240
             F LFLL    A  G+  I     K N ++G   + AW +ACA+ TA  IVIP GT+ M  
Sbjct  10    FSLFLLDFGFAQQGDLDISRFGGKPNTNIGQAFLSAWTQACASPTAVKIVIPAGTYQMGA  69

Query  241   VSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVY  420
             V ++GPCKAP+E+++   ++AP +P ++    +W +V  V+ FTLSG G  DGQG     
Sbjct  70    VDVKGPCKAPIEVQVDGTIQAPANPTDLKAAHQWFVVQYVNSFTLSGKGVFDGQGATAWK  129

Query  421   PSKEKGFKGDK-LPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGN  597
              +     K  K L  N   NFL NS++RDIT+ +SK FHVNVLG  N TFD F V AP +
Sbjct  130   QNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNFTFDGFKVSAPKD  189

Query  598   SPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTP  777
             SPNTDGIHI R   + + ++ I TGDDC+SLGDG +N+ +  V CGPGHGISVGSLG+  
Sbjct  190   SPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGCKNITVQNVNCGPGHGISVGSLGKYD  249

Query  778   GERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHYHKIEMEDVKNPIVIDQEY  951
              E PV G  V N    GTDNGVRIKTWPN+ PG   +TD+H+  + M +V NPI+IDQEY
Sbjct  250   SEEPVAGFLVKNCTLNGTDNGVRIKTWPNT-PGAITITDMHFEDLTMNNVTNPIIIDQEY  308

Query  952   CPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGA  1131
             CP N+CSKQ PSK+KISKVS+K+IKGTS ++E V+L CSSGVPCE VE+ +IDLTF G A
Sbjct  309   CPWNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEGVEMADIDLTFNGAA  368

Query  1132  KTI-CSNVKPKLTGK  1173
              T  C+NVKP +TGK
Sbjct  369   ATAKCANVKPTITGK  383



>ref|XP_003522977.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   395 bits (1016),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 200/375 (53%), Positives = 254/375 (68%), Gaps = 9/375 (2%)
 Frame = +1

Query  73    FILFLL----AHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQ  240
             F LFLL    A  G+  I     K N ++G   + AW +ACA+ TA  IVIP GT+ M  
Sbjct  10    FSLFLLDFGFAQQGDLDISRFGGKPNTNIGQAFLSAWTQACASPTAVKIVIPAGTYQMGA  69

Query  241   VSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVY  420
             V ++GPCKAP+E+++   ++AP +P ++    +W +V  V+ FTLSG G  DGQG     
Sbjct  70    VDVKGPCKAPIEVQVDGTIQAPTNPTDLKAAHQWFVVQYVNSFTLSGKGVFDGQGATAWK  129

Query  421   PSKEKGFKGDK-LPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGN  597
              +     K  K L  N   NFL NS++RDIT+ +SK FHVNVLG  N TFD F V AP +
Sbjct  130   QNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNFTFDGFKVSAPKD  189

Query  598   SPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTP  777
             SPNTDGIHI R   + + ++ I TGDDC+SLGDG +N+ +  V CGPGHGISVGSLG+  
Sbjct  190   SPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGCKNITVQNVNCGPGHGISVGSLGKYD  249

Query  778   GERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHYHKIEMEDVKNPIVIDQEY  951
              E PV G  V N    GTDNGVRIKTWPN+ PG   +TD+H+  + M +V NPI+IDQEY
Sbjct  250   SEEPVAGFLVKNCTLNGTDNGVRIKTWPNT-PGAITITDMHFEDLTMNNVTNPIIIDQEY  308

Query  952   CPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGA  1131
             CP N+CSKQ PSK+KISKVS+K+IKGTS ++E V+L CSSGVPCE VE+ +IDLTF G A
Sbjct  309   CPWNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEGVEMADIDLTFNGAA  368

Query  1132  KTI-CSNVKPKLTGK  1173
              T  C+NVKP +TGK
Sbjct  369   ATAKCANVKPTITGK  383



>ref|XP_006387858.1| hypothetical protein POPTR_0519s00220g [Populus trichocarpa]
 gb|ERP46772.1| hypothetical protein POPTR_0519s00220g [Populus trichocarpa]
Length=393

 Score =   395 bits (1015),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 208/389 (53%), Positives = 263/389 (68%), Gaps = 14/389 (4%)
 Frame = +1

Query  37    LKMATISYCAFTFILFLLAHFGESAIIN-----VAAKANVDVGPLLMKAWKEACAATTAS  201
             + +  +S    +F LFLL      A  N         A  D+   L  AWK ACA+T  S
Sbjct  1     MGLEVVSSAIISFSLFLLLASTTQAQSNGVFDVTKYGAGKDITEALTNAWKSACASTKPS  60

Query  202   TIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSG  381
              ++IP GT+ + +V+L GPCKA ++L++  ILKAP DP  + G   W+    VD FTLSG
Sbjct  61    KVLIPSGTYWLRKVTLAGPCKAAIKLQVDGILKAPVDPNKLSGG-HWVNFRYVDQFTLSG  119

Query  382   GGTLDGQGNVQVYPS---KEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGG  552
              GT DGQG V    S   K+K  KG  LP NL  +F+TN+++RDITTL+SK FHVNVLG 
Sbjct  120   RGTFDGQGKVAWSKSTCHKDKNCKG--LPMNLRFDFITNALVRDITTLDSKNFHVNVLGC  177

Query  553   KNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTC  732
             KNLTF HFTV+APG S NTDGIHI R  GI + DS I TGDDCIS+GDG E L ITGVTC
Sbjct  178   KNLTFQHFTVRAPGESVNTDGIHIGRSTGIYIIDSKISTGDDCISVGDGTEELHITGVTC  237

Query  733   GPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEM  912
             GPGHGISVGSLG+ P E+PV GIFV N     T NGVRIK+WP  + GV +++H+  I M
Sbjct  238   GPGHGISVGSLGKYPNEKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVM  297

Query  913   EDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDV  1092
              +V+NP++IDQ YCP N+C+ + PSKVKIS VS+K I+GTSAT   V +ACSSG PC+ V
Sbjct  298   NNVQNPVIIDQGYCPWNQCTLKAPSKVKISDVSFKSIRGTSATPVVVRIACSSGFPCQKV  357

Query  1093  EIGEIDLTFK---GGAKTICSNVKPKLTG  1170
             ++  I+L ++   G AK+ CSNVKP ++G
Sbjct  358   KLANINLAYRGPGGPAKSQCSNVKPIISG  386



>ref|XP_010999488.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   394 bits (1012),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 205/389 (53%), Positives = 266/389 (68%), Gaps = 14/389 (4%)
 Frame = +1

Query  37    LKMATISYCAFTFILFLLAHFGESAIIN-----VAAKANVDVGPLLMKAWKEACAATTAS  201
             + +  +S    +F LFLL      A  N         A  D+   L  AWK+ACA+T  S
Sbjct  1     MGLEVVSSAIISFSLFLLLASTTQAQSNGVFDVTKYGAGKDITEALANAWKDACASTKPS  60

Query  202   TIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSG  381
              ++IP+GT+ + +V++ GPCKA ++L++  IL+AP DP  + G  +W+    VD FTLSG
Sbjct  61    KVLIPRGTYWLRKVTIAGPCKAAIKLQVDGILQAPVDPNKLSGG-DWVNFRYVDQFTLSG  119

Query  382   GGTLDGQGNVQVYPS---KEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGG  552
              GT DGQG V    S   ++K  KG  LP N+  +++TN+++RDITTL+SK FHVNVLG 
Sbjct  120   SGTFDGQGKVAWSRSTCHRDKNCKG--LPMNMRFDYITNALVRDITTLDSKNFHVNVLGC  177

Query  553   KNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTC  732
             KNLTF HFTV+AP  S NTDGIHI R  GI + DS I TGDDCIS+GDG E L ITGVTC
Sbjct  178   KNLTFQHFTVRAPRESVNTDGIHIGRSTGIYIIDSKISTGDDCISVGDGTEELHITGVTC  237

Query  733   GPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEM  912
             GPGHGISVGSLG+ P E+PV GIFV N     T NGVRIK+WP  + GV +++H+  I M
Sbjct  238   GPGHGISVGSLGKYPNEKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVM  297

Query  913   EDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDV  1092
              +V+NP++IDQ YCP N+CS + PSKVKIS VS+K+I+GTSAT   V +ACSSG PCE V
Sbjct  298   NNVQNPVIIDQGYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGFPCEKV  357

Query  1093  EIGEIDLTFK---GGAKTICSNVKPKLTG  1170
             ++  I+L +K   G AK+ CSNVKP ++G
Sbjct  358   KLANINLAYKGPGGPAKSQCSNVKPIISG  386



>ref|XP_006371367.1| hypothetical protein POPTR_0019s09510g, partial [Populus trichocarpa]
 gb|ERP49164.1| hypothetical protein POPTR_0019s09510g, partial [Populus trichocarpa]
Length=373

 Score =   392 bits (1007),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 196/347 (56%), Positives = 247/347 (71%), Gaps = 5/347 (1%)
 Frame = +1

Query  142   DVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKN  321
             D+   L  AWK+ACA+T  S ++IP GT+ + +++L GPCKA +EL++  +LKAP DP  
Sbjct  21    DITEALTNAWKDACASTNPSKVLIPSGTYSLRKLTLAGPCKAAIELQVDGMLKAPVDPNQ  80

Query  322   MDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVI  498
               G   W+  G VD FTLSG GT DGQG      S  +K    D LP NL  +F+TN+++
Sbjct  81    FSGG-HWVNFGHVDKFTLSGSGTFDGQGKAAWSKSTCQKDKDCDSLPMNLRFDFITNALV  139

Query  499   RDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDD  678
             RDITT +SK FHVNVLG KNLTF HFTV APG S NTDGIH+ +  GI + DS IGTGDD
Sbjct  140   RDITTRDSKNFHVNVLGCKNLTFQHFTVSAPGESVNTDGIHVGQSTGIYIIDSKIGTGDD  199

Query  679   CISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTW  858
             CIS+GDG E L ITGVTCGPGHGISVGSLG+ P E+PV GIFV N     T NGVRIK+W
Sbjct  200   CISVGDGTEELHITGVTCGPGHGISVGSLGKYPNEKPVSGIFVKNCTLSDTTNGVRIKSW  259

Query  859   PNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSA  1038
             P  + GV +++H+  I M +V+NP++IDQ YCP N+CS + PSKVKIS VS+K+I+GTSA
Sbjct  260   PALYGGVASNMHFEDIVMNNVQNPVIIDQVYCPWNQCSLKAPSKVKISGVSFKNIRGTSA  319

Query  1039  TKETVILACSSGVPCEDVEIGEIDLTFK---GGAKTICSNVKPKLTG  1170
             T   V +ACSSG PCE VE+ +I L +    G +K+ CSNVKP ++G
Sbjct  320   TPVVVQIACSSGFPCEKVELADIKLAYSGPDGPSKSQCSNVKPIISG  366



>dbj|BAA89479.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   392 bits (1007),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 198/349 (57%), Positives = 247/349 (71%), Gaps = 9/349 (3%)
 Frame = +1

Query  142   DVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKN  321
             D+   L  AWK+ACA+T  S + IP GT+ + QV+L GPCKA +EL++  ILKAP DP  
Sbjct  41    DITEALNNAWKDACASTNPSKVHIPSGTYSLRQVTLAGPCKAAIELQVDGILKAPVDPNQ  100

Query  322   MDGKKEWLIVGRVDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNLSLNFLTNS  492
               G   W+    VD  TLSG GT DGQG+V   +   SK+K  +G   P N+  +F+TN 
Sbjct  101   FSGG-HWVDFSHVDQLTLSGSGTFDGQGSVAWSKSTCSKDKNCEG--FPMNIRFDFITNG  157

Query  493   VIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  672
              +RDITT +SK FHVNVL  KNLTF HFTV AP  S NTDGIHI R  GI + DS IGTG
Sbjct  158   FVRDITTRDSKNFHVNVLECKNLTFQHFTVTAPAESINTDGIHIGRSTGIYIIDSKIGTG  217

Query  673   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  852
             DDCIS+GDG E+L +TGVTCGPGHGISVGSLGR P E+PV GIFV N     T NGVRIK
Sbjct  218   DDCISVGDGTEDLHVTGVTCGPGHGISVGSLGRYPNEKPVSGIFVKNCTISNTANGVRIK  277

Query  853   TWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGT  1032
             +WP+ + G  +++H+  I M +V+NP+ +DQEYCP N+CS + PSKVKIS VS+K+I+GT
Sbjct  278   SWPDLYGGDASNMHFEDIVMNNVQNPVAVDQEYCPWNQCSLKAPSKVKISDVSFKNIRGT  337

Query  1033  SATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKTICSNVKPKLTG  1170
             SAT   V LACSSG+PCE VE+ +I+L + G    AK+ CSNVKP ++G
Sbjct  338   SATPVVVKLACSSGIPCEKVELADINLVYSGSEGPAKSQCSNVKPIISG  386



>ref|XP_006469749.1| PREDICTED: polygalacturonase-like [Citrus sinensis]
Length=408

 Score =   392 bits (1007),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/356 (53%), Positives = 253/356 (71%), Gaps = 6/356 (2%)
 Frame = +1

Query  127   AKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAP  306
             AK N D+   L  AWKEACAATT S ++IP+GT+ ++ V++EGPCKA +EL++   LKA 
Sbjct  31    AKQNADISQALRDAWKEACAATTPSKVLIPQGTYQLSPVTMEGPCKAAIELQVKGTLKAL  90

Query  307   PDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFL  483
              DP N+     W+   +++H T+SGGGT DGQG   V PS+ EK     K P NLS N +
Sbjct  91    TDPANVKDAGSWVSFNKIEHLTVSGGGTFDGQG--AVAPSECEKDDYCKKRPINLSFNAI  148

Query  484   TNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVI  663
             TNSV++D+T+LNSK FH+NV+G KN TF   TV AP  S NTDGIH+ R  G+T+ DS I
Sbjct  149   TNSVVQDVTSLNSKQFHINVIGAKNFTFQRVTVTAPEESLNTDGIHVGRSSGVTITDSKI  208

Query  664   GTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGV  843
             GTGDDCIS+GDG + ++I  + CGPGHGISVGSLG+   E+PV GI V       T NGV
Sbjct  209   GTGDDCISIGDGTQQMEINKIDCGPGHGISVGSLGKYQNEQPVVGIRVRECNISNTSNGV  268

Query  844   RIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDI  1023
             RIKTWP S+PG  +D+H+  I+M +V NPI++DQ YCP+N+C+ + PS+VK+ +VS+K+I
Sbjct  269   RIKTWPASYPGTASDLHFEDIKMNNVSNPILLDQVYCPHNQCNAKVPSRVKLDRVSFKNI  328

Query  1024  KGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTGKQCP  1182
             +GTSAT   + LACS GVPCE VE+ +I LT+   +G  K+ C+N++PK +GK  P
Sbjct  329   RGTSATAVAIKLACSGGVPCEGVELADISLTYTGPEGPIKSECTNIQPKTSGKMNP  384



>ref|XP_003522975.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   392 bits (1006),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 198/375 (53%), Positives = 253/375 (67%), Gaps = 9/375 (2%)
 Frame = +1

Query  73    FILFLL----AHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQ  240
             F LFLL    A  G+  I     K N ++G   + AW +ACA+ TA  IVIP GT+ M  
Sbjct  10    FSLFLLDFGFAQQGDLDISRFGGKPNTNIGQAFLSAWTQACASPTAVKIVIPAGTYQMGA  69

Query  241   VSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVY  420
             V ++GPCKAP+E+++   ++AP +P ++    +W +V  V+ FTLSG G  DGQG     
Sbjct  70    VDVKGPCKAPIEVQVDGTIQAPANPTDLKAAHQWFVVQYVNSFTLSGKGVFDGQGATAWK  129

Query  421   PSKEKGFKGDK-LPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGN  597
              +     K  K L  N   NFL NS++RDIT+ +SK FHVNVLG  N TFD F V AP +
Sbjct  130   QNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNFTFDGFKVSAPKD  189

Query  598   SPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTP  777
             SPNTDGIHI R   + + ++ I TGDDC+SLGDG +N+ +  V CGPGHGISVGSLG+  
Sbjct  190   SPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGSKNITVQNVNCGPGHGISVGSLGKYD  249

Query  778   GERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHYHKIEMEDVKNPIVIDQEY  951
              E PV G  V N     TDNGVRIKTWPN+ PG   +TD+H+  + M +V NPI+IDQEY
Sbjct  250   SEEPVAGFLVKNCTLNETDNGVRIKTWPNT-PGAITITDMHFEDLTMNNVTNPIIIDQEY  308

Query  952   CPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGA  1131
             CP N+CSKQ PSK+KISKVS+K+IKGTS +++ V+L CSSGVPCE VE+ +IDLTF G A
Sbjct  309   CPWNQCSKQNPSKIKISKVSFKNIKGTSGSQDGVVLVCSSGVPCEGVEMADIDLTFNGAA  368

Query  1132  KTI-CSNVKPKLTGK  1173
              T  C+NVKP +TGK
Sbjct  369   ATAKCANVKPTITGK  383



>ref|XP_010999485.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   391 bits (1004),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 203/382 (53%), Positives = 261/382 (68%), Gaps = 10/382 (3%)
 Frame = +1

Query  52    ISYCAFTFILFLL----AHFGESAIINVAAK-ANVDVGPLLMKAWKEACAATTASTIVIP  216
             +S    +F LFLL    A      + +V    A+ D+   L  AWK+ACA+T  S ++IP
Sbjct  6     VSSAIISFSLFLLLASTAKAQSKGVFDVTKYGADKDITEALTNAWKDACASTNPSKVLIP  65

Query  217   KGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLD  396
              GT+ + +++L GPCKA +EL++  ILKAP DP    G   W+    VD FTLSG GT D
Sbjct  66    SGTYSLRKLTLAGPCKAAIELQVDGILKAPVDPNQFSGG-HWVNFRYVDKFTLSGSGTFD  124

Query  397   GQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDH  573
             GQG V    S  +K    D LP N+  +F+TN+++RDITT +SK FHVNVLG KNLTF H
Sbjct  125   GQGKVAWSKSTCQKDKDCDSLPMNIRFDFITNALVRDITTRDSKNFHVNVLGCKNLTFQH  184

Query  574   FTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGIS  753
             FTV APG+S NTDGIH+ +  GI + DS IGTGDDCIS+GDG E L IT VTCGPGHGIS
Sbjct  185   FTVSAPGDSVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITRVTCGPGHGIS  244

Query  754   VGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPI  933
             VGSLG+ P E+PV GIFV +     T NGVRIK+WP  + GV +++H+  I M +V+NP+
Sbjct  245   VGSLGKYPNEKPVSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPV  304

Query  934   VIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDL  1113
             +IDQ YCP N+CS + PSKVKIS VS+K+I+GTSAT   V +ACSSG+PCE VE+ +I L
Sbjct  305   IIDQVYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVELADIKL  364

Query  1114  TFK---GGAKTICSNVKPKLTG  1170
              +    G  K+ CSNVKP ++G
Sbjct  365   AYSGPDGPPKSQCSNVKPMISG  386



>ref|XP_002325639.2| hypothetical protein POPTR_0019s09470g, partial [Populus trichocarpa]
 gb|EEF00021.2| hypothetical protein POPTR_0019s09470g, partial [Populus trichocarpa]
Length=434

 Score =   392 bits (1008),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 200/352 (57%), Positives = 251/352 (71%), Gaps = 9/352 (3%)
 Frame = +1

Query  133   ANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPD  312
             A  D+   L  AWK ACA+T  S ++IP GT+ + +V+L GPCKA ++L++  ILKAP D
Sbjct  79    AGKDITEALTNAWKSACASTKPSKVLIPSGTYWLRKVTLAGPCKAAIKLQVDGILKAPVD  138

Query  313   PKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPS---KEKGFKGDKLPNNLSLNFL  483
             P  + G   W+    VD FTLSG GT DGQG V    S   K+K  KG  LP NL  +F+
Sbjct  139   PNKLSGG-HWVNFRYVDQFTLSGRGTFDGQGKVAWSKSTCHKDKNCKG--LPMNLRFDFI  195

Query  484   TNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVI  663
             TN+++RDITTL+SK FHVNVLG KNLTF HFTV+APG S NTDGIHI R  GI + DS I
Sbjct  196   TNALVRDITTLDSKNFHVNVLGCKNLTFQHFTVRAPGESVNTDGIHIGRSTGIYIIDSKI  255

Query  664   GTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGV  843
              TGDDCIS+GDG E L ITGVTCGPGHGISVGSLG+ P E+PV GIFV N     T NGV
Sbjct  256   STGDDCISVGDGTEELHITGVTCGPGHGISVGSLGKYPNEKPVSGIFVKNCTISDTTNGV  315

Query  844   RIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDI  1023
             RIK+WP  + GV +++H+  I M +V+NP++IDQ YCP N+C+ + PSKVKIS VS+K I
Sbjct  316   RIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQGYCPWNQCTLKAPSKVKISDVSFKSI  375

Query  1024  KGTSATKETVILACSSGVPCEDVEIGEIDLTFK---GGAKTICSNVKPKLTG  1170
             +GTSAT   V +ACSSG PC+ V++  I+L ++   G AK+ CSNVKP ++G
Sbjct  376   RGTSATPVVVRIACSSGFPCQKVKLANINLAYRGPGGPAKSQCSNVKPIISG  427



>ref|XP_010999486.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   389 bits (999),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 201/387 (52%), Positives = 263/387 (68%), Gaps = 10/387 (3%)
 Frame = +1

Query  37    LKMATISYCAFTFILFLL----AHFGESAIINVAAK-ANVDVGPLLMKAWKEACAATTAS  201
             + +  +S    +F LFLL    A+     + +V    A+ D+   L  AWK+ACA+T  S
Sbjct  1     MGLKVVSSAIISFSLFLLLASTANAQSKGVFDVTKYGADKDITEALTNAWKDACASTNPS  60

Query  202   TIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSG  381
              ++I  GT+ + +++L GPCKA +EL++  IL+AP DP    G   W+    VD FTLSG
Sbjct  61    KVLISSGTYSLRKLTLAGPCKAAIELQVDGILQAPVDPNQFSGG-HWVNFRYVDKFTLSG  119

Query  382   GGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKN  558
              GT DGQG V    S  +K    D LP N+  +F+TN+++RDITT +SK FHVNVLG KN
Sbjct  120   SGTFDGQGKVAWSKSTCQKDKDCDSLPMNIRFDFITNALVRDITTRDSKNFHVNVLGCKN  179

Query  559   LTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGP  738
             LTF HFTV APG+S NTDGIH+ +  GI + DS IGTGDDCIS+GDG E L IT VTCGP
Sbjct  180   LTFQHFTVSAPGDSVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITRVTCGP  239

Query  739   GHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMED  918
             GHGISVGSLG+ P E+PV GIFV +     T NGVRIK+WP  + GV +++H+  I M +
Sbjct  240   GHGISVGSLGKYPNEKPVSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNN  299

Query  919   VKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEI  1098
             V+NP++IDQ YCP N+CS + PSKVKIS VS+K+I+GTSAT   V +ACSSG+PCE VE+
Sbjct  300   VQNPVIIDQVYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVEL  359

Query  1099  GEIDLTFK---GGAKTICSNVKPKLTG  1170
              +I L +    G  K+ CSNVKP ++G
Sbjct  360   ADIKLAYSGPDGPPKSQCSNVKPIISG  386



>ref|XP_010067918.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW88713.1| hypothetical protein EUGRSUZ_A01068 [Eucalyptus grandis]
Length=401

 Score =   389 bits (999),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 195/394 (49%), Positives = 261/394 (66%), Gaps = 16/394 (4%)
 Frame = +1

Query  43    MATISYCAFTFILFLLAHFGESAIINVA-----AKANVDVGPLLMKAWKEACAATTASTI  207
             M  IS       L   A    S + ++A        + D+   L+ AWKEACAAT AS +
Sbjct  1     MGKISILPAAIALLFFASTARSLVCDIAKYGAGGGTSSDITQALVSAWKEACAATEASKV  60

Query  208   VIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNM--DGKKEWLIVGRVDHFTLSG  381
             ++P GT+ + +V LEGPCK+ +E+++   L+AP DP  M  DG   W+    VD  TLSG
Sbjct  61    LVPAGTYVLREVVLEGPCKSSIEVQVDGTLQAPADPAQMKTDG---WVAFRGVDLLTLSG  117

Query  382   GGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGK  555
              GT DGQG    +   +   K D   LP N+  + +TN +++DIT+L+SK FHVNVL  K
Sbjct  118   SGTFDGQGKT-AWTKNDCNLKTDCVTLPINIRFDSVTNGMVKDITSLDSKQFHVNVLNCK  176

Query  556   NLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCG  735
             NLTF H T+ APG+SPNTDGIHI R  GI + D+ I TGDDCIS+GDG E + ITGVTCG
Sbjct  177   NLTFQHVTITAPGDSPNTDGIHIGRSTGINIIDTGIKTGDDCISIGDGSEQMTITGVTCG  236

Query  736   PGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEME  915
             PGHGISVGSLG+ P E+PV G+ V N    GT NG+RIKTWP S  G  +D+H+  I ++
Sbjct  237   PGHGISVGSLGKYPNEQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLD  296

Query  916   DVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVE  1095
             +V NP++IDQ+YCP N+C  Q PS++KIS VS+  I+GTS+T+  V LACSS +PC +VE
Sbjct  297   NVGNPVIIDQQYCPWNQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVE  356

Query  1096  IGEIDLTF---KGGAKTICSNVKPKLTGKQCPKV  1188
             I +ID+ +   +G A ++CSNVKP ++GKQ P +
Sbjct  357   ISDIDIAYHGPEGPATSVCSNVKPTISGKQNPAI  390



>ref|XP_010067907.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=401

 Score =   389 bits (999),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 195/394 (49%), Positives = 261/394 (66%), Gaps = 16/394 (4%)
 Frame = +1

Query  43    MATISYCAFTFILFLLAHFGESAIINVA-----AKANVDVGPLLMKAWKEACAATTASTI  207
             M  IS       L   A    S + ++A        + D+   L+ AWKEACAAT AS +
Sbjct  1     MGKISILPAAIALLFFASTARSLVCDIAKYGAGGGTSSDITQALVSAWKEACAATEASKV  60

Query  208   VIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNM--DGKKEWLIVGRVDHFTLSG  381
             ++P GT+ + +V LEGPCK+ +E+++   L+AP DP  M  DG   W+    VD  TLSG
Sbjct  61    LVPAGTYVLREVVLEGPCKSSIEVQVDGTLQAPADPAQMKTDG---WVAFRGVDLLTLSG  117

Query  382   GGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGK  555
              GT DGQG    +   +   K D   LP N+  + +TN +++DIT+L+SK FHVNVL  K
Sbjct  118   SGTFDGQGKT-AWTKNDCNLKTDCVTLPINIRFDSVTNGMVKDITSLDSKQFHVNVLNCK  176

Query  556   NLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCG  735
             NLTF H T+ APG+SPNTDGIHI R  GI + D+ I TGDDCIS+GDG E + ITGVTCG
Sbjct  177   NLTFQHVTITAPGDSPNTDGIHIGRSTGINIIDTGIKTGDDCISIGDGSEQMTITGVTCG  236

Query  736   PGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEME  915
             PGHGISVGSLG+ P E+PV G+ V N    GT NG+RIKTWP S  G  +D+H+  I ++
Sbjct  237   PGHGISVGSLGKYPNEQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLD  296

Query  916   DVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVE  1095
             +V NP++IDQ+YCP N+C  Q PS++KIS VS+  I+GTS+T+  V LACSS +PC +VE
Sbjct  297   NVGNPVIIDQQYCPWNQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVE  356

Query  1096  IGEIDLTF---KGGAKTICSNVKPKLTGKQCPKV  1188
             I +ID+ +   +G A ++CSNVKP ++GKQ P +
Sbjct  357   ISDIDIAYHGPEGPATSVCSNVKPTISGKQNPAI  390



>ref|XP_011069588.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=401

 Score =   389 bits (999),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 196/366 (54%), Positives = 258/366 (70%), Gaps = 8/366 (2%)
 Frame = +1

Query  112   IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMA  291
             I    AK+  D+   LM AWKEAC +T+ STIVIP+GT+ ++QV L GP KAP+EL++  
Sbjct  29    ITKYGAKSGGDISQALMDAWKEACNSTSPSTIVIPRGTWSLSQVKLLGPNKAPLELQVQG  88

Query  292   ILKAPPDPKNMDGKK-EWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKE--KGFKGDKLPN  462
             IL+A P+P  +  K+ EW+ +  V++FTLSGGG  DGQG  Q +   +  K     KLP 
Sbjct  89    ILQANPNPGQLPNKEGEWITINYVNYFTLSGGGVFDGQGQ-QAWKQNDCHKNRNCAKLPM  147

Query  463   NLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGI  642
             NLS NF+ NS+IRD+TT +SK FHVN +G  N+TF  FTV APG+SPNTDGIH+ R   I
Sbjct  148   NLSFNFVNNSIIRDVTTKDSKNFHVNCIGSHNVTFLRFTVSAPGDSPNTDGIHLGRDTMI  207

Query  643   TVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKF  822
              +KDS+I TGDDC+S+GD  + + I  VTCGPGHGISVGSLG    E+ V+GIFV+N  F
Sbjct  208   NIKDSIIKTGDDCVSIGDESKEIHIQNVTCGPGHGISVGSLGGYAEEKDVQGIFVTNCTF  267

Query  823   IGTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKI  999
             IGT NGVR+KTWP++   + V+D+H+  + M++V +PI+IDQEYCP+N C K +PS +KI
Sbjct  268   IGTQNGVRVKTWPSAPAQLTVSDLHFEDLIMDNVSSPIIIDQEYCPHNLCKKDRPSSIKI  327

Query  1000  SKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGA---KTICSNVKPKLTG  1170
             S VS K+++GT+ + E V L CS   PCE+VE+G+IDLT+ G      T C NVKPK  G
Sbjct  328   SNVSIKNVRGTTNSAEAVTLICSGLKPCENVEVGDIDLTYNGNQGPITTKCMNVKPKFVG  387

Query  1171  KQCPKV  1188
             KQ P V
Sbjct  388   KQNPPV  393



>ref|XP_006447720.1| hypothetical protein CICLE_v10015423mg [Citrus clementina]
 gb|ESR60960.1| hypothetical protein CICLE_v10015423mg [Citrus clementina]
 gb|KDO58459.1| hypothetical protein CISIN_1g015254mg [Citrus sinensis]
Length=410

 Score =   389 bits (999),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 189/358 (53%), Positives = 254/358 (71%), Gaps = 8/358 (2%)
 Frame = +1

Query  127   AKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAP  306
             AK N D+   L  AWKEACAATT S ++IP+GT+ ++ V++EGPCKA +EL++   LKA 
Sbjct  31    AKQNADISQALRDAWKEACAATTPSKVLIPQGTYQLSPVTMEGPCKAAIELQVKGTLKAL  90

Query  307   PDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLP--NNLSLN  477
              DP N+     W+   +++H T+SGGGT DGQG   V PS+ EK     K P  +NLS N
Sbjct  91    TDPANVKDAGSWVSFNKIEHLTVSGGGTFDGQG--AVAPSECEKDDYCKKRPIVSNLSFN  148

Query  478   FLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDS  657
              +TNSV++D+T+LNSK FH+NV+G KN TF   TV AP  S NTDGIH+ R  G+T+ DS
Sbjct  149   AITNSVVQDVTSLNSKQFHINVIGAKNFTFQRVTVTAPEESLNTDGIHVGRSSGVTITDS  208

Query  658   VIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDN  837
              IGTGDDCIS+GDG + ++I  + CGPGHGISVGSLG+   E+PV GI V       T N
Sbjct  209   KIGTGDDCISIGDGTQQMEINKIDCGPGHGISVGSLGKYQNEQPVVGIRVRECNISNTSN  268

Query  838   GVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYK  1017
             GVRIKTWP S+PG  +D+H+  I+M +V NPI++DQ YCP+N+C+ + PS+VK+ +VS+K
Sbjct  269   GVRIKTWPASYPGTASDLHFEDIKMNNVSNPILLDQVYCPHNQCNAKVPSRVKLDRVSFK  328

Query  1018  DIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTGKQCP  1182
             +I+GTSAT   + LACS GVPCE VE+ +I LT+   +G  K+ C+N++PK +GK  P
Sbjct  329   NIRGTSATAVAIKLACSGGVPCEGVELADISLTYTGPEGPIKSECTNIQPKTSGKMNP  386



>ref|XP_010040513.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW45154.1| hypothetical protein EUGRSUZ_L01230 [Eucalyptus grandis]
Length=396

 Score =   388 bits (997),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 191/358 (53%), Positives = 248/358 (69%), Gaps = 9/358 (3%)
 Frame = +1

Query  142   DVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPK-  318
             D+   L+ AWKEACA+TT + ++IP GTF +T+V+L+GPCKAPVE ++   LKAP DP  
Sbjct  39    DISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFELQGTLKAPADPSL  98

Query  319   -NMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNS  492
                DG   W++   +D  T+SGGGT DGQG      +   K      LP NL  NF+TN+
Sbjct  99    FKTDG---WVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKNTNCRTLPTNLRFNFVTNA  155

Query  493   VIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  672
             +I D+TTL+SK F VNVLG KN+TF +F V AP +S NTDGIHI R  G+ + DS I TG
Sbjct  156   LIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRSDGVNILDSDIKTG  215

Query  673   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  852
             DDC+SLGDG   + + GVTCGPGHGISVGSLG+   E PV+G+FV+N   IG DNGVRIK
Sbjct  216   DDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTNCTIIGADNGVRIK  275

Query  853   TWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGT  1032
             TWP S PG  +D+H+  I+M++V NP+++DQ YCP N+C    PS +KISKVS+K I+GT
Sbjct  276   TWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAGVPSLIKISKVSFKKIRGT  335

Query  1033  SATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTGKQCPKVTCK  1197
             SA++  V + CS  VPCE+VEI +IDL +   +G A + C+NVKP L+GK  P    K
Sbjct  336   SASQVAVKVLCSRSVPCEEVEIADIDLVYNGPEGPATSECANVKPVLSGKLNPAACAK  393



>ref|XP_010042694.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Eucalyptus 
grandis]
Length=396

 Score =   388 bits (997),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/358 (53%), Positives = 249/358 (70%), Gaps = 9/358 (3%)
 Frame = +1

Query  142   DVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPK-  318
             D+   L+ AWKEACA+TT + ++IP GTF +T+V+L+GPCKAPVE ++   LKAP DP  
Sbjct  39    DISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFELQGTLKAPADPSL  98

Query  319   -NMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNS  492
                DG   W++  R+D  T+SGGGT DGQG      +   K      LP NL  NF+TN+
Sbjct  99    FKTDG---WVVFQRIDGLTVSGGGTFDGQGKTAWGQNDCAKNTNCRTLPTNLRFNFVTNA  155

Query  493   VIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  672
             +I D+TTL+SK F VNVLG KN+TF +F V AP +S NTDGIHI R  G+ + DS I TG
Sbjct  156   LIHDVTTLDSKNFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRSDGVNILDSDIKTG  215

Query  673   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  852
             DDC+SLGDG   + + GVTCGPGHGISVGSLG+   E PV+G+FV+N   IG DNGVRIK
Sbjct  216   DDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTNCTIIGADNGVRIK  275

Query  853   TWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGT  1032
             TWP S PG  +D+H+  I+M++V NP+++DQ YCP N+C    PS +KISKVS+K I+GT
Sbjct  276   TWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAGVPSLIKISKVSFKKIRGT  335

Query  1033  SATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTGKQCPKVTCK  1197
             SA++  V + CS  VPC++VEI +IDL +   +G A + C+NVKP L+GK  P    K
Sbjct  336   SASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECANVKPVLSGKLNPAACAK  393



>ref|XP_010040848.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW44869.1| hypothetical protein EUGRSUZ_L01551 [Eucalyptus grandis]
 gb|KCW46860.1| hypothetical protein EUGRSUZ_K00665 [Eucalyptus grandis]
Length=396

 Score =   388 bits (997),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 198/396 (50%), Positives = 263/396 (66%), Gaps = 14/396 (4%)
 Frame = +1

Query  43    MATISYCAFTFILFLLAHFGESAIINVAA-----KANVDVGPLLMKAWKEACAATTASTI  207
             MA  SY     +L   +    + + NVA+       + D+   L+ AWKEACA+TT + +
Sbjct  1     MAMKSYVGALLLLLSFSSSINAQVFNVASYGAKGDGSSDISQALLSAWKEACASTTPAKV  60

Query  208   VIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPK--NMDGKKEWLIVGRVDHFTLSG  381
             +IP GTF +T+V+L+GPCKAPVE ++   LKAP DP     DG   W++  R+D  T+SG
Sbjct  61    LIPGGTFALTEVALDGPCKAPVEFELQGTLKAPADPSLFKTDG---WVVFQRIDGLTVSG  117

Query  382   GGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKN  558
             GGT DGQG      +   K      LP NL  NF+TN++I D+TTL+SK F VNVLG KN
Sbjct  118   GGTFDGQGKTAWGQNDCAKNTNCRTLPTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKN  177

Query  559   LTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGP  738
             +TF +F V AP +S NTDGIHI R  G+ + DS I TGDDC+SLGDG   + + GVTCGP
Sbjct  178   MTFQNFHVNAPADSINTDGIHIGRSDGVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGP  237

Query  739   GHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMED  918
             GHGISVGSLG+   E PV+G+FV+N   IG DNGVRIKTWP S PG  +D+H+  I+M++
Sbjct  238   GHGISVGSLGKYENEEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDN  297

Query  919   VKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEI  1098
             V NP+++DQ YCP ++C    PS +KISKVS+K I+GTSA++  V + CS  VPC++VEI
Sbjct  298   VLNPVILDQGYCPFDQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEI  357

Query  1099  GEIDLTF---KGGAKTICSNVKPKLTGKQCPKVTCK  1197
              +IDL +   +G A + C+NVKP L+GK  P    K
Sbjct  358   ADIDLVYNGPEGPATSECANVKPVLSGKLNPAACAK  393



>ref|XP_010536243.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score =   389 bits (998),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 190/389 (49%), Positives = 259/389 (67%), Gaps = 10/389 (3%)
 Frame = +1

Query  28    VTNLKMATISYCAFTFILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTI  207
             VT+L +A+    A   + F +A++G      +    + D+      AWK AC++T+ S +
Sbjct  15    VTHLLVASFVQSAADSVTFSIANYG------LKGTEDEDITKAFSVAWKAACSSTSPSKL  68

Query  208   VIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGG  387
             ++PKGT+ + QV  EGPCKAP+EL++   +KAP DP +   K  W+   R+D F L G G
Sbjct  69    IVPKGTYVLRQVVFEGPCKAPLELQVHGTIKAPEDPSDFIEKAGWISFQRIDRFALVGNG  128

Query  388   TLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLT  564
             T DGQG+     +   K  + +KLP N+  NF+TN +++DIT+LNSKLFH+NVLG  NLT
Sbjct  129   TFDGQGSTAWSQNDCHKTGECNKLPINIRFNFITNGLVQDITSLNSKLFHINVLGCNNLT  188

Query  565   FDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGH  744
             F    +KAP +SPNTDGIHI R   I + DSV+ TGDDCIS+G G EN+ I  V CGPGH
Sbjct  189   FSRVNIKAPEDSPNTDGIHIGRSKNINITDSVMSTGDDCISMGRGSENIAIERVKCGPGH  248

Query  745   GISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVK  924
             GISVGSLGR   E PV GI V N  F  TDNGVR+KTW +S   + T +++  I + +V 
Sbjct  249   GISVGSLGRYTKEEPVSGIIVRNCTFFNTDNGVRVKTWMSSEKAIATGLYFQDIAVVNVS  308

Query  925   NPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGE  1104
             NP+VIDQEYCP N C  +KPS+VK+S +S+++I GTS+T+  + LACSSGVPCE+VEI +
Sbjct  309   NPVVIDQEYCPYNHCKAKKPSQVKLSNISFRNIHGTSSTQMAMKLACSSGVPCENVEISD  368

Query  1105  IDLTFKGG---AKTICSNVKPKLTGKQCP  1182
             ID+ + G    + + C+NV PK+ GKQ P
Sbjct  369   IDIKYTGSDGDSMSDCTNVSPKIFGKQYP  397



>ref|XP_010038565.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW46861.1| hypothetical protein EUGRSUZ_K00666 [Eucalyptus grandis]
Length=396

 Score =   388 bits (996),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 199/396 (50%), Positives = 262/396 (66%), Gaps = 14/396 (4%)
 Frame = +1

Query  43    MATISYCAFTFILFLLAHFGESAIINVAA-----KANVDVGPLLMKAWKEACAATTASTI  207
             MA  SY     +L   +    + + NVA+       + D+   L+ AWKEACA+TT + +
Sbjct  1     MAMKSYVGALLLLLSFSSSINAQVFNVASYGAKGDGSSDISQALLSAWKEACASTTPAKV  60

Query  208   VIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPK--NMDGKKEWLIVGRVDHFTLSG  381
             +IP GTF +T+V+L+GPCKAPVE ++   LKAP DP     DG   W++   +D  T+SG
Sbjct  61    LIPGGTFALTEVALDGPCKAPVEFELQGTLKAPADPSLFKTDG---WVVFQHIDGLTMSG  117

Query  382   GGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKN  558
             GGT DGQG      +   K      LP NL  NF+TN++I D+TTL+SK F VNVLG KN
Sbjct  118   GGTFDGQGKTAWGQNDCAKNTNCRTLPTNLRFNFVTNALIHDVTTLDSKNFQVNVLGAKN  177

Query  559   LTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGP  738
             +TF +F V AP +S NTDGIHI R  G+ + DS I TGDDC+SLGDG   + + GVTCGP
Sbjct  178   MTFQNFHVNAPADSINTDGIHIGRSDGVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGP  237

Query  739   GHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMED  918
             GHGISVGSLG+   E PV+G+FV+N   IG DNGVRIKTWP S PG  +D+H+  I+M++
Sbjct  238   GHGISVGSLGKYENEEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDN  297

Query  919   VKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEI  1098
             V NP+++DQ YCP N+C    PS +KISKVS+K I+GTSA++  V + CS  VPCE+VEI
Sbjct  298   VLNPVILDQGYCPFNQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSRSVPCEEVEI  357

Query  1099  GEIDLTF---KGGAKTICSNVKPKLTGKQCPKVTCK  1197
              +IDL +   +G A + C+NVKP L+GK  P    K
Sbjct  358   ADIDLVYNGPEGPATSECANVKPVLSGKLNPAACAK  393



>ref|XP_010999532.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=384

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 201/383 (52%), Positives = 260/383 (68%), Gaps = 10/383 (3%)
 Frame = +1

Query  37    LKMATISYCAFTFILFLL----AHFGESAIINVAAK-ANVDVGPLLMKAWKEACAATTAS  201
             + +  +S    +F +FLL    A      + +V    A+ D+   L  AWK+ACA+T  S
Sbjct  1     MGLKGVSSALISFSIFLLLSSTAKAQSKGVFDVTKYGADKDITEALTNAWKDACASTNPS  60

Query  202   TIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSG  381
              ++IP GT+ + +++L GPCKA +EL++  ILKAP DP    G   W+    VD FTLSG
Sbjct  61    KVLIPSGTYSLRKLTLAGPCKAAIELQVDGILKAPVDPNQFSGG-HWVNFRYVDKFTLSG  119

Query  382   GGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKN  558
              GT DGQG V    S  +K    D LP N+  +F+TN+++RDITT +SK FHVNVLG KN
Sbjct  120   SGTFDGQGKVAWSKSTCQKDKDCDSLPMNIRFDFITNALVRDITTRDSKNFHVNVLGCKN  179

Query  559   LTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGP  738
             LTF HFTV APG+S NTDGIH+ +  GI + DS IGTGDDCIS+GDG E L IT VTCGP
Sbjct  180   LTFQHFTVSAPGDSVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITRVTCGP  239

Query  739   GHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMED  918
             GHGISVGSLG+ P E+P  GIFV +     T NGVRIK+WP  + GV +++H+  I M +
Sbjct  240   GHGISVGSLGKYPNEKPFSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNN  299

Query  919   VKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEI  1098
             V+NP++IDQ YCP N+CS + PSKVKIS VS+K+I+GTSAT   V +ACSSG PCE V++
Sbjct  300   VQNPVIIDQVYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGFPCEKVKL  359

Query  1099  GEIDLTFK---GGAKTICSNVKP  1158
               I+L +K   G AK+ CSNVKP
Sbjct  360   ANINLAYKGPGGPAKSQCSNVKP  382



>ref|XP_010042444.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 190/358 (53%), Positives = 248/358 (69%), Gaps = 9/358 (3%)
 Frame = +1

Query  142   DVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPK-  318
             D+   L+ AWKEACA+TT + ++IP GTF +T+V+L+GPCKAPVE ++   LKAP DP  
Sbjct  39    DISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFELQGTLKAPTDPSL  98

Query  319   -NMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNS  492
                DG   W++   +D  T+SGGGT DGQG      +   K      LP NL  NF+TN+
Sbjct  99    FKTDG---WVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKNTNCRTLPTNLRFNFVTNA  155

Query  493   VIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  672
             +I D+TTL+SK F VNVLG KN+TF +F V AP +S NTDGIHI R  G+ + DS I TG
Sbjct  156   LIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRSDGVNILDSDIKTG  215

Query  673   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  852
             DDC+SLGDG   + + GVTCGPGHGISVGSLG+   E PV+G+FV+N   IG DNGVRIK
Sbjct  216   DDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTNCTIIGADNGVRIK  275

Query  853   TWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGT  1032
             TWP S PG  +D+H+  I+M++V NP+++DQ YCP N+C    PS +KISKVS+K I+GT
Sbjct  276   TWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAGVPSLIKISKVSFKKIRGT  335

Query  1033  SATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTGKQCPKVTCK  1197
             SA++  V + CS  VPC++VEI +IDL +   +G A + C+NVKP L+GK  P    K
Sbjct  336   SASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECANVKPVLSGKLNPAACAK  393



>gb|KHN15656.1| Polygalacturonase, partial [Glycine soja]
Length=350

 Score =   385 bits (989),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 189/343 (55%), Positives = 240/343 (70%), Gaps = 5/343 (1%)
 Frame = +1

Query  157   LMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKK  336
              + AW +ACA+ TA  IVIP GT+ M  V ++GPCKAP+E+++   ++AP +P ++    
Sbjct  3     FLSAWTQACASPTAVKIVIPAGTYQMGAVDVKGPCKAPIEVQVDGTIQAPANPTDLKAAH  62

Query  337   EWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDK-LPNNLSLNFLTNSVIRDITT  513
             +W +V  V+ FTLSG G  DGQG      +     K  K L  N   NFL NS++RDIT+
Sbjct  63    QWFVVQYVNSFTLSGKGVFDGQGATAWKQNDCTTNKNCKMLCMNFGFNFLNNSIVRDITS  122

Query  514   LNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLG  693
              +SK FHVNVLG  N TFD F V AP +SPNTDGIHI R   + + ++ I TGDDC+SLG
Sbjct  123   KDSKNFHVNVLGCNNFTFDGFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLG  182

Query  694   DGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHP  873
             DG +N+ +  V CGPGHGISVGSLG+   E PV G  V N    GTDNGVRIKTWPN+ P
Sbjct  183   DGCKNITVQNVNCGPGHGISVGSLGKYDSEEPVAGFLVKNCTLNGTDNGVRIKTWPNT-P  241

Query  874   GV--VTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKE  1047
             G   +TD+H+  + M +V NPI+IDQEYCP N+CSKQ PSK+KISKVS+K+IKGTS ++E
Sbjct  242   GAITITDMHFEDLTMNNVTNPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQE  301

Query  1048  TVILACSSGVPCEDVEIGEIDLTFKGGAKTI-CSNVKPKLTGK  1173
              V+L CSSGVPCE VE+ +IDLTF G A T  C+NVKP +TGK
Sbjct  302   GVVLVCSSGVPCEAVEMADIDLTFNGSAATAKCANVKPTITGK  344



>ref|XP_003544118.1| PREDICTED: polygalacturonase-like isoform X1 [Glycine max]
Length=392

 Score =   387 bits (993),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 201/380 (53%), Positives = 252/380 (66%), Gaps = 9/380 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAA-KANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSL  249
             F+L  ++   +S  IN+       D+   L KAW+EACAAT+AS IVIP G++ M  V L
Sbjct  14    FLLLAISSTTQSVDINIKKFGGGADITQALTKAWEEACAATSASKIVIPGGSYKMEAVDL  73

Query  250   EGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK  429
             +GPC AP+E++    L+AP DP  +DG  EWL V  V+ FTLSG G  DGQG    +   
Sbjct  74    KGPCMAPIEIQFDGTLQAPADPNALDGADEWLKVQHVNFFTLSGKGVFDGQG-ATAWKQN  132

Query  430   EKGFKGD--KLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  603
             + G   +  K   N   NFL NS++RDIT+ +SK FHVNVLG  N TFD F V AP  S 
Sbjct  133   DCGTNKNCKKRSKNFGFNFLNNSMVRDITSKDSKNFHVNVLGCNNFTFDGFHVSAPNTSI  192

Query  604   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  783
             NTDGIHI R   + + ++ I TGDDC+SLGDG + + +  V CGPGHGISVGSLG+ P E
Sbjct  193   NTDGIHIGRSTDVKILNTNIATGDDCVSLGDGSKKITVQNVNCGPGHGISVGSLGKYPEE  252

Query  784   RPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHYHKIEMEDVKNPIVIDQEYCP  957
              PV+ + V N     TDNGVRIKTWP+S PG   +TD+H+  I M DV NP++IDQEYCP
Sbjct  253   EPVEQLLVKNCTLTNTDNGVRIKTWPSS-PGASPITDMHFEDITMVDVMNPVIIDQEYCP  311

Query  958   NNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKT  1137
              N+CSKQ PSK+KISKV++K+I+GTS TKE V L CS GVPCEDVE+  + LTF G    
Sbjct  312   WNQCSKQAPSKIKISKVTFKNIQGTSKTKEGVTLICSKGVPCEDVELNNVALTFNGAPIV  371

Query  1138  I-CSNVKPKLTGKQCPKVTC  1194
               C+NVKP +TGK  P  TC
Sbjct  372   AKCANVKPIVTGKA-PACTC  390



>gb|KHN46909.1| Polygalacturonase [Glycine soja]
Length=390

 Score =   386 bits (992),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 201/380 (53%), Positives = 252/380 (66%), Gaps = 9/380 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAA-KANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSL  249
             F+L  ++   +S  IN+       D+   L KAW+EACAAT+AS IVIP G++ M  V L
Sbjct  12    FLLLAISSTTQSVDINIKKFGGGADITQALTKAWEEACAATSASKIVIPGGSYKMEAVDL  71

Query  250   EGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK  429
             +GPC AP+E++    L+AP DP  +DG  EWL V  V+ FTLSG G  DGQG    +   
Sbjct  72    KGPCMAPIEIQFDGTLQAPADPNALDGADEWLKVQHVNFFTLSGKGVFDGQG-ATAWKQN  130

Query  430   EKGFKGD--KLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  603
             + G   +  K   N   NFL NS++RDIT+ +SK FHVNVLG  N TFD F V AP  S 
Sbjct  131   DCGTNKNCKKRSKNFGFNFLNNSMVRDITSKDSKNFHVNVLGCNNFTFDGFHVSAPNTSI  190

Query  604   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  783
             NTDGIHI R   + + ++ I TGDDC+SLGDG + + +  V CGPGHGISVGSLG+ P E
Sbjct  191   NTDGIHIGRSTDVKILNTNIATGDDCVSLGDGSKKITVQNVNCGPGHGISVGSLGKYPEE  250

Query  784   RPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHYHKIEMEDVKNPIVIDQEYCP  957
              PV+ + V N     TDNGVRIKTWP+S PG   +TD+H+  I M DV NP++IDQEYCP
Sbjct  251   EPVEQLLVKNCTLTNTDNGVRIKTWPSS-PGASPITDMHFEDITMVDVMNPVIIDQEYCP  309

Query  958   NNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKT  1137
              N+CSKQ PSK+KISKV++K+I+GTS TKE V L CS GVPCEDVE+  + LTF G    
Sbjct  310   WNQCSKQAPSKIKISKVTFKNIQGTSKTKEGVTLICSKGVPCEDVELNNVALTFNGAPIV  369

Query  1138  I-CSNVKPKLTGKQCPKVTC  1194
               C+NVKP +TGK  P  TC
Sbjct  370   AKCANVKPIVTGKA-PACTC  388



>gb|KCW88710.1| hypothetical protein EUGRSUZ_A01065 [Eucalyptus grandis]
Length=466

 Score =   389 bits (998),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 195/396 (49%), Positives = 263/396 (66%), Gaps = 16/396 (4%)
 Frame = +1

Query  37    LKMATISYCAFTFILFLLAHFGESAIINVA-----AKANVDVGPLLMKAWKEACAATTAS  201
             ++M  IS       L   A    S + ++A        + D+   L+ AWKEACAAT AS
Sbjct  64    VEMGKISILPAAIALLFFASTARSLVCDIAKYGAGGGTSSDITQALVSAWKEACAATEAS  123

Query  202   TIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNM--DGKKEWLIVGRVDHFTL  375
              +++P GT+ + +V LEGPCK+ +E+++   L+AP DP  M  DG   W+    VD  TL
Sbjct  124   KVLVPAGTYVLREVVLEGPCKSSIEVQVDGTLQAPADPAQMKTDG---WVAFRGVDLLTL  180

Query  376   SGGGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLG  549
             SG GT DGQG    +   +   K D   LP N+  + +TN +++DIT+L+SK FHVNVL 
Sbjct  181   SGSGTFDGQGKT-AWTKNDCNLKTDCVTLPINIRFDSVTNGMVKDITSLDSKQFHVNVLN  239

Query  550   GKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVT  729
              KNLTF H T+ APG+SPNTDGIHI R  GI + D+ I TGDDCIS+GDG E + ITGVT
Sbjct  240   CKNLTFQHVTITAPGDSPNTDGIHIGRSTGINIIDTGIKTGDDCISIGDGSEQMTITGVT  299

Query  730   CGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIE  909
             CGPGHGISVGSLG+ P E+PV G+ V N    GT NG+RIKTWP S  G  +D+H+  I 
Sbjct  300   CGPGHGISVGSLGKYPNEQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDIT  359

Query  910   MEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCED  1089
             +++V NP++IDQ+YCP N+C  Q PS++KIS VS+  I+GTS+T+  V LACSS +PC +
Sbjct  360   LDNVGNPVIIDQQYCPWNQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTE  419

Query  1090  VEIGEIDLTF---KGGAKTICSNVKPKLTGKQCPKV  1188
             VEI +ID+ +   +G A ++CSNVKP ++GKQ P +
Sbjct  420   VEISDIDIAYHGPEGPATSVCSNVKPTISGKQNPAI  455



>ref|XP_010042729.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score =   386 bits (991),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 189/358 (53%), Positives = 248/358 (69%), Gaps = 9/358 (3%)
 Frame = +1

Query  142   DVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPK-  318
             D+   L+ AWKEACA+TT + ++IP GTF +T+V+L+GPCKAPVE ++   LKAP DP  
Sbjct  39    DISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFELQGTLKAPADPSL  98

Query  319   -NMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNS  492
                DG   W++   +D  T+SGGGT DGQG      +   K      LP NL  NF+TN+
Sbjct  99    FKTDG---WVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKNTNCRTLPTNLRFNFVTNA  155

Query  493   VIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  672
             +I D+TTL+SK F VNVLG KN+TF +F V AP +S NTDGIHI R  G+ + DS I TG
Sbjct  156   LIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRSDGVNILDSDIKTG  215

Query  673   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  852
             DDC+SLGDG   + + GVTCGPGHGISVGSLG+   E PV+G+FV+N   IG DNGVRIK
Sbjct  216   DDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTNCTIIGADNGVRIK  275

Query  853   TWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGT  1032
             TWP S PG  +D+H+  I+M++V NP+++DQ YCP ++C    PS +KISKVS+K I+GT
Sbjct  276   TWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFDQCKAGVPSLIKISKVSFKKIRGT  335

Query  1033  SATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTGKQCPKVTCK  1197
             SA++  V + CS  VPC++VEI +IDL +   +G A + C+NVKP L+GK  P    K
Sbjct  336   SASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECANVKPVLSGKLNPAACAK  393



>ref|XP_010532220.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=436

 Score =   386 bits (992),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 188/351 (54%), Positives = 242/351 (69%), Gaps = 4/351 (1%)
 Frame = +1

Query  142   DVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKN  321
             D+      AWK AC++ + S +VIP G++ + QV  EGPCKAP+EL++  I+KAP DP +
Sbjct  75    DITKAFSIAWKAACSSPSLSQLVIPNGSYILRQVRFEGPCKAPLELQVHGIIKAPEDPSD  134

Query  322   MDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQ-VYPSKEKGFKGDKLPNNLSLNFLTNSVI  498
                K  W+   R+DHFTL G GT DGQG+    +    K  + +KLP N+  NF+TN ++
Sbjct  135   FIEKAGWITFQRIDHFTLVGNGTFDGQGSTAWSHNDCHKTGECNKLPINIRFNFITNGLV  194

Query  499   RDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDD  678
             +DIT+LNSKLFH+NVLG  NLTFD   +KAP +SPNTDGIHI R   I + DS + TGDD
Sbjct  195   QDITSLNSKLFHINVLGCTNLTFDRVKIKAPEDSPNTDGIHIGRSKNINIIDSEMSTGDD  254

Query  679   CISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTW  858
             CIS+G G EN+ I  V CGPGHGISVGSLGR   E PV GI V N  F  TDNGVR+KTW
Sbjct  255   CISMGRGSENITIERVKCGPGHGISVGSLGRYTKEEPVSGIIVRNCTFFNTDNGVRVKTW  314

Query  859   PNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSA  1038
              +S   + T +H+H I + +V NPIVIDQEYCP + C  +KPS+VK+S +S+K+I GTS+
Sbjct  315   LSSEKAIATGLHFHDITVVNVSNPIVIDQEYCPYDHCKAKKPSQVKLSNISFKNIHGTSS  374

Query  1039  TKETVILACSSGVPCEDVEIGEIDLTFKGG---AKTICSNVKPKLTGKQCP  1182
             TK  + LACSSGVPCE+VEI  ID+ + G    + + C+NV PK  GKQ P
Sbjct  375   TKMAMKLACSSGVPCENVEISNIDIKYIGSDGVSMSDCTNVSPKTFGKQYP  425



>ref|XP_010038564.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=474

 Score =   388 bits (996),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 199/399 (50%), Positives = 264/399 (66%), Gaps = 14/399 (4%)
 Frame = +1

Query  43    MATISYCAFTFILFLLAHFGESAIINVAA-----KANVDVGPLLMKAWKEACAATTASTI  207
             MA  SY     +L   +    + + NVA+       + D+   L+ AWKEACA+TT + +
Sbjct  1     MAMKSYVGALLLLLSFSSSINAQVFNVASYGAKGDGSSDISQALLSAWKEACASTTPAKV  60

Query  208   VIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPK--NMDGKKEWLIVGRVDHFTLSG  381
             +IP GTF +T+V+L+GPCKAPVE ++   LKAP DP     DG   W++  R+D  T+SG
Sbjct  61    LIPGGTFALTEVALDGPCKAPVEFELQGTLKAPADPSLFKTDG---WVVFQRIDGLTVSG  117

Query  382   GGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKN  558
             GGT DGQG      +   K      LP NL  NF+TN++I D+TTL+SK F VNVLG KN
Sbjct  118   GGTFDGQGKTAWGQNDCAKNTNCRTLPTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKN  177

Query  559   LTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGP  738
             +TF +F V AP +S NTDGIHI R  G+ + DS I TGDDC+SLGDG   + + GVTCGP
Sbjct  178   MTFQNFHVNAPADSINTDGIHIGRSDGVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGP  237

Query  739   GHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMED  918
             GHGISVGSLG+   E PV+G+FV+N   IG DNGVRIKTWP S PG  +D+H+  I+M++
Sbjct  238   GHGISVGSLGKYENEEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDN  297

Query  919   VKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEI  1098
             V NP+++DQ YCP ++C    PS +KISKVS+K I+GTSA++  V + CS  VPC++VEI
Sbjct  298   VLNPVILDQGYCPFDQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEI  357

Query  1099  GEIDLTF---KGGAKTICSNVKPKLTGKQCPKVTCK*EI  1206
              +IDL +   +G A + C+NVKP L+GK  P    K  I
Sbjct  358   ADIDLVYNGPEGPATSECANVKPVLSGKLNPAACAKPHI  396


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 47/67 (70%), Gaps = 3/67 (4%)
 Frame = +1

Query  982   PSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNV  1152
             P+KVKIS VS++DI+GTSAT     L C  GVPC+ +E+ +I+L +    G A + C+NV
Sbjct  397   PTKVKISDVSFRDIRGTSATPLAEKLGCGRGVPCQKLELADINLRYNGRNGAATSQCANV  456

Query  1153  KPKLTGK  1173
             KP +TGK
Sbjct  457   KPTITGK  463



>ref|XP_007009872.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18682.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=399

 Score =   385 bits (989),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 193/365 (53%), Positives = 257/365 (70%), Gaps = 11/365 (3%)
 Frame = +1

Query  112   IINVAAKAN--VDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKI  285
             ++N  AKA+   D+   LM AW++ACA  + S +VIP+G + ++QV+L GPCKAP+E+++
Sbjct  31    VMNFGAKADGKTDISQALMAAWRKACAVVSPSKVVIPEGEYILSQVTLAGPCKAPLEVQV  90

Query  286   MAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPS---KEKGFKGDKL  456
                LKA  DP   +    W+   R+D FTLSG GT DGQG    +     K+ G + +KL
Sbjct  91    RGTLKATADPSKFNNVPTWVTFQRIDRFTLSGAGTFDGQGGKAAWAQNDCKQVG-RCNKL  149

Query  457   PNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARII  636
             P NL  N +TN ++RDIT+++SK  H+N+L  KNLTF + TV AP  SPNTDGIHI R  
Sbjct  150   PINLRFNAVTNGLVRDITSVDSKQTHINLLSCKNLTFANITVNAPAQSPNTDGIHIGRSS  209

Query  637   GITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNS  816
             GI + DS I TGDDC+SLG+G + + +  VTCGPGHGISVGSLGR   E PV GI V+N 
Sbjct  210   GINITDSRISTGDDCVSLGEGSQKITVRRVTCGPGHGISVGSLGRYR-EDPVFGITVANC  268

Query  817   KFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVK  996
               I T NGVR+KTWP S  G+ +D+H+  I M +V NP++IDQEYCP N+C+K  PS+VK
Sbjct  269   TLINTSNGVRVKTWPASLEGIASDMHFEDIVMVNVSNPVLIDQEYCPGNKCAK-APSRVK  327

Query  997   ISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLT  1167
             IS VS+K+I+GTSAT+  V L CSSG+PCE+VEIG+I+L++   +G A + CSNVKP +T
Sbjct  328   ISNVSFKNIRGTSATQVAVELRCSSGIPCENVEIGDINLSYIGTEGPATSRCSNVKPIIT  387

Query  1168  GKQCP  1182
             GKQ P
Sbjct  388   GKQTP  392



>ref|XP_010536244.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score =   385 bits (989),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 190/389 (49%), Positives = 257/389 (66%), Gaps = 10/389 (3%)
 Frame = +1

Query  28    VTNLKMATISYCAFTFILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTI  207
             VT+L +A+    A   I F + ++G      +    + D+      AW+ AC++T+ S +
Sbjct  15    VTHLLVASFVQSAADSITFSITNYG------LKGTEDEDITKAFSVAWEAACSSTSPSKL  68

Query  208   VIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGG  387
             ++PKGT+ + QV  EGPCKAP+EL++   +KAP DP     K  W+   R+D F L G G
Sbjct  69    IVPKGTYVLRQVVFEGPCKAPLELQVHGTIKAPEDPSYFIEKAGWISFQRIDRFALVGNG  128

Query  388   TLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLT  564
             T DGQG+     +   K  + +KLP N+  NF+TN +++DIT+LNSKLFH+NVLG  NLT
Sbjct  129   TFDGQGSTAWSQNDCHKTGECNKLPINIRFNFITNGLVQDITSLNSKLFHINVLGCNNLT  188

Query  565   FDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGH  744
             F    +KAP +SPNTDGIHI R   I + DSV+ TGDDCIS+G G EN+ I  V CGPGH
Sbjct  189   FSRVNIKAPEDSPNTDGIHIGRSKNINITDSVMSTGDDCISMGRGSENIAIERVKCGPGH  248

Query  745   GISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVK  924
             GISVGSLGR   E PV GI V N  F  TDNGVR+KTW +S   + T +++  I + +V 
Sbjct  249   GISVGSLGRYTKEEPVSGIIVRNCTFFNTDNGVRVKTWMSSEKAIATGLYFQDIAVVNVS  308

Query  925   NPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGE  1104
             NPIVIDQEYCP N C  +KPS+VK+S +S+++I GTS+T+  + LACSSGVPCE+VEI +
Sbjct  309   NPIVIDQEYCPYNHCKAKKPSQVKLSNISFRNIHGTSSTQMAMKLACSSGVPCENVEISD  368

Query  1105  IDLTFKGG---AKTICSNVKPKLTGKQCP  1182
             ID+ + G    + + C+NV PK+ GKQ P
Sbjct  369   IDIKYTGSDGDSMSDCTNVSPKIFGKQYP  397



>ref|XP_010999487.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   384 bits (986),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 199/387 (51%), Positives = 261/387 (67%), Gaps = 10/387 (3%)
 Frame = +1

Query  37    LKMATISYCAFTFILFLL----AHFGESAIINVAAK-ANVDVGPLLMKAWKEACAATTAS  201
             + +  +S    +F +FLL    A      + +V    A+ D+   L  AWK+ACA+T  S
Sbjct  1     MGLKGVSSALISFSIFLLLSSTAKAQSKGVFDVTKYGADKDITEALTNAWKDACASTNPS  60

Query  202   TIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSG  381
              ++IP GT+ + +++L GPCKA +EL++  ILKAP DP    G   W+    VD FTLSG
Sbjct  61    KVLIPSGTYSLRKLTLAGPCKAAIELQVDGILKAPVDPNQFSGG-HWVNFRYVDKFTLSG  119

Query  382   GGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKN  558
              GT DGQG +    S  +K    D LP N+  +F+TN+++RDITT +SK FHVNVLG KN
Sbjct  120   SGTFDGQGKLAWSKSTCQKDKDCDSLPMNIRFDFITNALVRDITTRDSKNFHVNVLGCKN  179

Query  559   LTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGP  738
             LTF HFTV APG+S NTDGIH+ +  GI + DS IGTGDDCIS+GDG E L IT VTCGP
Sbjct  180   LTFQHFTVSAPGDSVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITRVTCGP  239

Query  739   GHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMED  918
             GHGISVGSLG+ P E+P  GIFV +     T NGVRIK+WP  + G  +++H+  I M +
Sbjct  240   GHGISVGSLGKYPNEKPASGIFVKSCTISDTPNGVRIKSWPALYGGGASNMHFEDIVMNN  299

Query  919   VKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEI  1098
             V+NP++IDQ YCP N+CS + PSKVKIS VS+K+I+GTSAT   V +ACSSG+PCE VE+
Sbjct  300   VQNPVIIDQVYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVEL  359

Query  1099  GEIDLTFK---GGAKTICSNVKPKLTG  1170
              +I L +    G  K+ CSNVKP ++G
Sbjct  360   ADIKLAYSGPDGPPKSQCSNVKPIMSG  386



>ref|XP_003527123.1| PREDICTED: polygalacturonase-like [Glycine max]
 gb|KHN05204.1| Polygalacturonase [Glycine soja]
Length=389

 Score =   384 bits (985),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 197/382 (52%), Positives = 253/382 (66%), Gaps = 4/382 (1%)
 Frame = +1

Query  37    LKMATISYCAFTFILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIP  216
               + TI +  F  + F  A  G+  I     K N D+    + AW +ACA+TTA  IVIP
Sbjct  3     FTIITIFFSLF-LVDFGFAQQGDLDISRFGGKPNSDISQAFLSAWTQACASTTAVKIVIP  61

Query  217   KGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLD  396
              GT+ M  V ++GPCKAP+E+++   ++AP +  N+ G  +WL V  V+ FTLSG G  D
Sbjct  62    AGTYQMGAVDVKGPCKAPIEVQVDGTIQAPTNVVNLKGADQWLKVQHVNSFTLSGKGVFD  121

Query  397   GQGNVQVYPSKEKGFKGDK-LPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDH  573
             GQG      +     K  K L  N   NFL NS++RD+T+ +SK FHVNVLG  N+TFD 
Sbjct  122   GQGPTAWKQNDCTTNKNCKMLCMNFGFNFLNNSIVRDLTSKDSKNFHVNVLGCNNMTFDG  181

Query  574   FTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGIS  753
             F + AP  SPNTDGIHI R   + V ++ I TGDDCISLGDG +N+ +  V CGPGHGIS
Sbjct  182   FKISAPAESPNTDGIHIGRSTDVKVLNTNIATGDDCISLGDGNKNITVQNVNCGPGHGIS  241

Query  754   VGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVKNP  930
             VGSLGR   E  V+G+ V N     TDNG+RIKTWP++   + VTD+H+  I ME+V NP
Sbjct  242   VGSLGRYDNEEAVEGLLVKNCTLNNTDNGLRIKTWPSTPLTITVTDMHFEDITMENVSNP  301

Query  931   IVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEID  1110
             ++IDQEYCP N+CSK+ PSK+KISKVS+K+IKGTS TKE VI  CSS  PCE VE+ ++D
Sbjct  302   VIIDQEYCPWNQCSKKNPSKIKISKVSFKNIKGTSGTKEGVIFICSSVAPCEGVEMTDVD  361

Query  1111  LTFKGGAKTI-CSNVKPKLTGK  1173
             LTF G A T  C+NVKP +TGK
Sbjct  362   LTFNGAATTAKCANVKPVITGK  383



>ref|XP_011097041.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=401

 Score =   384 bits (986),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 199/393 (51%), Positives = 264/393 (67%), Gaps = 16/393 (4%)
 Frame = +1

Query  52    ISYCAFTFILFLLAHFGESA------IINVAAKANVDVGPLLMKAWKEACAATTASTIVI  213
             I++    F L LLA    +       I    AK+  D+   LM AWKEAC +T+ STIV+
Sbjct  3     INFITILFFLSLLAINVNAQGPMTYDITKYGAKSGGDISQALMDAWKEACNSTSPSTIVV  62

Query  214   PKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKK-EWLIVGRVDHFTLSGGGT  390
             P+GT+ ++QV L GP KAP+EL++   L+A P+P  +  K+ EW+ +  V++FTLSGGG 
Sbjct  63    PRGTWSLSQVKLLGPNKAPLELQVQGTLQANPNPGQLPNKEGEWITINYVNYFTLSGGGV  122

Query  391   LDGQGNVQVYPSKE--KGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLT  564
              DGQG  Q +   +  K     KLP NLS NF+ NS+IRD+TT +SK FHVN +   N+T
Sbjct  123   FDGQGQ-QAWKQNDCHKNRNCAKLPMNLSFNFVNNSIIRDVTTKDSKNFHVNCISSHNVT  181

Query  565   FDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGH  744
             F  FTV APG+SPNTDGIH+ R   I +KDS+I TGDDC+S+GD  + + I  VTCGPGH
Sbjct  182   FLRFTVSAPGDSPNTDGIHLGRDTMINIKDSIIKTGDDCVSIGDESKEIHIQNVTCGPGH  241

Query  745   GISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--DIHYHKIEMED  918
             GISVGSLG    E+ V+GI+V+N  FIGT NGVR+KTWP S P  +T  D+H+  + M++
Sbjct  242   GISVGSLGGYAEEKDVQGIYVTNCTFIGTTNGVRVKTWP-SAPATLTVSDLHFEDLIMDN  300

Query  919   VKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEI  1098
             V +PI+IDQEYCP+N C K +PS +KI+ VS K+++GT+ T E V   CS   PCE+VE+
Sbjct  301   VSSPIIIDQEYCPHNLCKKDRPSSIKITNVSIKNVRGTTNTAEAVTFICSGLKPCENVEV  360

Query  1099  GEIDLTFKGGA---KTICSNVKPKLTGKQCPKV  1188
             G+IDLT+ G      T C+NVKPK  GKQ P V
Sbjct  361   GDIDLTYNGNQGPITTKCANVKPKFVGKQNPPV  393



>ref|XP_007049259.1| Polygalacturonase [Theobroma cacao]
 gb|EOX93416.1| Polygalacturonase [Theobroma cacao]
Length=405

 Score =   384 bits (986),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 192/371 (52%), Positives = 257/371 (69%), Gaps = 11/371 (3%)
 Frame = +1

Query  100   GESAIINVAAK------ANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPC  261
              +S +++V AK         D+   L+ AWKEACA+TT S IVIPKGT+ +++ SL+GPC
Sbjct  24    AQSTVVDVVAKYGAKADEKTDLSTPLLNAWKEACASTTPSKIVIPKGTYRLSRASLDGPC  83

Query  262   KAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGN-VQVYPSKEKG  438
             K+ +EL++  I+KAP DP        W++   VDH T+SGGG  DGQG  V    +  K 
Sbjct  84    KSAIELQVSGIIKAPADPSAFK-DPNWVVFNHVDHLTISGGGVFDGQGAAVWGKNNCAKN  142

Query  439   FKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGI  618
                  LP NL  N+++N++++ ITT +SK FHVNVLG +N TF HFTV AP NS NTDGI
Sbjct  143   KYCAALPINLRFNYVSNAIVQGITTKDSKQFHVNVLGCRNFTFQHFTVSAPENSINTDGI  202

Query  619   HIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKG  798
             HI R  G+ V D+ I TGDDC+SLGDG +N+ +  VTCGPGHGISVGSLG+   E PV G
Sbjct  203   HIGRSNGVKVLDTNIKTGDDCVSLGDGSKNVIVERVTCGPGHGISVGSLGKFNDEEPVSG  262

Query  799   IFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQ  978
             IFV N     T NGVR+KTWP+SHPG  TD+H+  I + +V NPI+IDQEYCP N C+ +
Sbjct  263   IFVRNCTLSNTMNGVRVKTWPDSHPGSATDMHFEDIILNNVGNPILIDQEYCPWNLCNLK  322

Query  979   KPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFK---GGAKTICSN  1149
              PS++K+S +S+K I+GTS+T++ V L CS G+PC+ VE+ +ID+T+K   G A + C+N
Sbjct  323   VPSRIKLSNISFKKIRGTSSTQQAVRLVCSRGLPCDRVELADIDITYKGPGGPATSECTN  382

Query  1150  VKPKLTGKQCP  1182
             VKP+ +GKQ P
Sbjct  383   VKPRTSGKQNP  393



>gb|KHN10402.1| Polygalacturonase, partial [Glycine soja]
Length=350

 Score =   382 bits (980),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 188/343 (55%), Positives = 239/343 (70%), Gaps = 5/343 (1%)
 Frame = +1

Query  157   LMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKK  336
              + AW +ACA+ TA  IVIP GT+ M  V ++GPCKAP+E+++   ++AP +P ++    
Sbjct  3     FLSAWTQACASPTAVKIVIPAGTYQMGAVDVKGPCKAPIEVQVDGTIQAPANPTDLKAAH  62

Query  337   EWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDK-LPNNLSLNFLTNSVIRDITT  513
             +W +V  V+ FTLSG G  DGQG      +     K  K L  N   NFL NS++RDIT+
Sbjct  63    QWFVVQYVNSFTLSGKGVFDGQGATAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITS  122

Query  514   LNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLG  693
              +SK FHVNVLG  N TFD F V AP +SPNTDGIHI R   + + ++ I TGDDC+SLG
Sbjct  123   KDSKNFHVNVLGCNNFTFDGFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLG  182

Query  694   DGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHP  873
             DG +N+ +  V CGPGHGISVGSLG+   E PV G  V N     TDNGVRIKTWPN+ P
Sbjct  183   DGCKNITVQNVNCGPGHGISVGSLGKYDSEEPVAGFLVKNCTLNETDNGVRIKTWPNT-P  241

Query  874   GV--VTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKE  1047
             G   +TD+H+  + M +V NPI+IDQEYCP N+CSKQ PSK+KISKVS+K+IKGTS ++E
Sbjct  242   GAITITDMHFEDLTMNNVMNPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQE  301

Query  1048  TVILACSSGVPCEDVEIGEIDLTFKGGAKTI-CSNVKPKLTGK  1173
              V+L CSSGVPCE VE+ +IDLTF G A T  C+NVKP +TGK
Sbjct  302   GVVLVCSSGVPCEAVEMADIDLTFNGSAATAKCANVKPTITGK  344



>ref|XP_010112808.1| hypothetical protein L484_020040 [Morus notabilis]
 gb|EXC34923.1| hypothetical protein L484_020040 [Morus notabilis]
Length=394

 Score =   382 bits (982),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 181/360 (50%), Positives = 249/360 (69%), Gaps = 3/360 (1%)
 Frame = +1

Query  112   IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMA  291
             +    A+ N+D+   L  AWK+ACA+     ++IP+GT+ +++ +LEGPCK P+++++  
Sbjct  30    VTTYGAQLNMDITQALSNAWKDACASPIRGKVLIPRGTYKLSRATLEGPCKVPIKVQLQG  89

Query  292   ILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLS  471
              L+AP DP   +    W+    VD  TL+GGGT DGQG+     + E+     KLP N  
Sbjct  90    TLRAPTDPSGFNEGDGWVTFRNVDGLTLAGGGTFDGQGSAVWGKNCEQQQYCGKLPINFR  149

Query  472   LNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVK  651
              +F+TNS+IRDI +LNSK FH+NVLGG+N+TF    + AP +SPNTDGIHI R  GI++ 
Sbjct  150   FDFVTNSLIRDIISLNSKQFHINVLGGQNVTFSRVKIIAPEDSPNTDGIHIGRSSGISIT  209

Query  652   DSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGT  831
             D+VI TGDDC+SLGDG + + I  VTCGPGHGISVGSLG+   E PV+G+ V N     T
Sbjct  210   DTVIQTGDDCVSLGDGCKEISIRRVTCGPGHGISVGSLGKYSNEDPVEGVIVRNCTIRNT  269

Query  832   DNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVS  1011
              NGVR+KTWP+SH G+ +++H+  I ME+V NP++IDQEYCP N+C+ + PS++KIS VS
Sbjct  270   SNGVRVKTWPDSHDGLASNLHFEDIVMENVGNPVLIDQEYCPWNQCNAKVPSRIKISDVS  329

Query  1012  YKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI---CSNVKPKLTGKQCP  1182
             +K+I+GTS T   V L CSSG PC++VEI +IDL + G    I   C NVKP ++GKQ P
Sbjct  330   FKNIRGTSTTALAVNLVCSSGFPCQNVEIADIDLQYSGNDGPIMSQCKNVKPTISGKQNP  389



>ref|XP_002274096.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28389.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   382 bits (982),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 191/355 (54%), Positives = 245/355 (69%), Gaps = 2/355 (1%)
 Frame = +1

Query  127   AKAN-VDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKA  303
             AKA+  D+   L+ AWKEACA+ T S++++P GT+ + Q+  EGPCKAP+ L +   LKA
Sbjct  35    AKADGSDISQALLAAWKEACASPTPSSVLVPAGTYGLGQICFEGPCKAPINLIVEGTLKA  94

Query  304   PPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFL  483
             P D KN      W+    +DHFTLSG G  DGQG         +      LP NL  NFL
Sbjct  95    PVDTKNFKADAGWVAFQNIDHFTLSGKGVFDGQGPAVWGKKCARSSYCGALPINLKFNFL  154

Query  484   TNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVI  663
             TNS++RD+TT +SK FHVNVLG KNL+F HFTV AP  S NTDGIHI R  GI + ++ I
Sbjct  155   TNSMVRDVTTKDSKQFHVNVLGCKNLSFYHFTVSAPEESLNTDGIHIGRSSGINITNTNI  214

Query  664   GTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGV  843
              TGDDCIS+GDG E + I  VTCGPGHGISVGSLG+   E PV GI V+ S    T NG+
Sbjct  215   KTGDDCISIGDGSEQITIDQVTCGPGHGISVGSLGKYANEAPVVGIKVTGSTLTNTQNGI  274

Query  844   RIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDI  1023
             R+KTWP S  G+ +++H+  I M +V NPI+IDQEYCP ++C +Q PS+VKIS V++K+I
Sbjct  275   RVKTWPASPAGIASNMHFEDIIMNNVGNPILIDQEYCPYSQCKQQIPSRVKISDVTFKNI  334

Query  1024  KGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKT-ICSNVKPKLTGKQCPK  1185
             +GTS+T+  V L CSSGVPC++V++ +I+L F GGA T IC NVKP L G Q P+
Sbjct  335   RGTSSTELAVKLVCSSGVPCQNVQLTDINLKFNGGAPTSICKNVKPILGGVQQPR  389



>ref|XP_006595658.1| PREDICTED: polygalacturonase-like isoform X2 [Glycine max]
Length=386

 Score =   381 bits (979),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 200/375 (53%), Positives = 249/375 (66%), Gaps = 10/375 (3%)
 Frame = +1

Query  85    LLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCK  264
             LL   G   I+ +A    ++    L KAW+EACAAT+AS IVIP G++ M  V L+GPC 
Sbjct  15    LLMRDGAQVILPLAH--TIEHEEALTKAWEEACAATSASKIVIPGGSYKMEAVDLKGPCM  72

Query  265   APVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFK  444
             AP+E++    L+AP DP  +DG  EWL V  V+ FTLSG G  DGQG    +   + G  
Sbjct  73    APIEIQFDGTLQAPADPNALDGADEWLKVQHVNFFTLSGKGVFDGQG-ATAWKQNDCGTN  131

Query  445   GD--KLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGI  618
              +  K   N   NFL NS++RDIT+ +SK FHVNVLG  N TFD F V AP  S NTDGI
Sbjct  132   KNCKKRSKNFGFNFLNNSMVRDITSKDSKNFHVNVLGCNNFTFDGFHVSAPNTSINTDGI  191

Query  619   HIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKG  798
             HI R   + + ++ I TGDDC+SLGDG + + +  V CGPGHGISVGSLG+ P E PV+ 
Sbjct  192   HIGRSTDVKILNTNIATGDDCVSLGDGSKKITVQNVNCGPGHGISVGSLGKYPEEEPVEQ  251

Query  799   IFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHYHKIEMEDVKNPIVIDQEYCPNNECS  972
             + V N     TDNGVRIKTWP+S PG   +TD+H+  I M DV NP++IDQEYCP N+CS
Sbjct  252   LLVKNCTLTNTDNGVRIKTWPSS-PGASPITDMHFEDITMVDVMNPVIIDQEYCPWNQCS  310

Query  973   KQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI-CSN  1149
             KQ PSK+KISKV++K+I+GTS TKE V L CS GVPCEDVE+  + LTF G      C+N
Sbjct  311   KQAPSKIKISKVTFKNIQGTSKTKEGVTLICSKGVPCEDVELNNVALTFNGAPIVAKCAN  370

Query  1150  VKPKLTGKQCPKVTC  1194
             VKP +TGK  P  TC
Sbjct  371   VKPIVTGKA-PACTC  384



>ref|XP_011097079.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=401

 Score =   382 bits (980),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 198/393 (50%), Positives = 264/393 (67%), Gaps = 16/393 (4%)
 Frame = +1

Query  52    ISYCAFTFILFLLAHFGESA------IINVAAKANVDVGPLLMKAWKEACAATTASTIVI  213
             I++    F L LLA    +       I    AK+  D+   LM AWKEAC +T+ STIV+
Sbjct  3     INFITILFFLPLLAINVNAQGPMTYDITKYGAKSGGDISQALMDAWKEACNSTSPSTIVV  62

Query  214   PKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKK-EWLIVGRVDHFTLSGGGT  390
             P+GT+ ++QV L GP KAP+EL++   L+A P+P  +  K+ EW+ +  V++FTLSGGG 
Sbjct  63    PRGTWSLSQVKLLGPNKAPLELQVQGTLQANPNPGQLPNKEGEWITINYVNYFTLSGGGV  122

Query  391   LDGQGNVQVYPSKE--KGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLT  564
              DGQG  + +   +  K     KLP NLS NF+ NS+IRD+TT +SK FHVN +   N+T
Sbjct  123   FDGQGQ-EAWKQNDCHKNRNCAKLPMNLSFNFVNNSIIRDVTTKDSKNFHVNCISSHNVT  181

Query  565   FDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGH  744
             F  FTV APG+SPNTDGIH+ R   I +KDS+I TGDDC+S+GD  + + I  VTCGPGH
Sbjct  182   FLRFTVSAPGDSPNTDGIHLGRDTMINIKDSIIKTGDDCVSIGDESKEIHIQNVTCGPGH  241

Query  745   GISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--DIHYHKIEMED  918
             GISVGSLG    E+ V+GI+V+N  FIGT NGVR+KTWP S P  +T  D+H+  + M++
Sbjct  242   GISVGSLGGYAEEKDVQGIYVTNCTFIGTTNGVRVKTWP-SAPATLTVSDLHFEDLIMDN  300

Query  919   VKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEI  1098
             V +PI+IDQEYCP+N C K +PS +KI+ VS K+++GT+ T E V   CS   PCE+VE+
Sbjct  301   VSSPIIIDQEYCPHNLCKKDRPSSIKITNVSIKNVRGTTNTAEAVTFICSGLKPCENVEV  360

Query  1099  GEIDLTFKGGA---KTICSNVKPKLTGKQCPKV  1188
             G+IDLT+ G      T C+NVKPK  GKQ P V
Sbjct  361   GDIDLTYNGNQGPITTKCANVKPKFVGKQNPPV  393



>ref|XP_008379967.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=400

 Score =   381 bits (979),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 195/378 (52%), Positives = 253/378 (67%), Gaps = 14/378 (4%)
 Frame = +1

Query  67    FTFILFLLAHFGESAIINVAA-----KANVDVGPLLMKAWKEACAATTASTIVIPKGTFP  231
             F F+L +     +S+I +V +     KAN D+     KAW +ACA+T AS IV+P+GT+ 
Sbjct  12    FVFMLLVSTSNAKSSIYDVTSAKYGGKANSDISQAFSKAWTDACASTLASKIVVPRGTYK  71

Query  232   MTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV  411
                 + +GPCKAP+E+++   L+AP D   +     W+   R+D  TLSGGGT DGQG  
Sbjct  72    FVGATFKGPCKAPIEIQLQGTLQAPADGSKLPKADTWVGFERIDGLTLSGGGTFDGQGAT  131

Query  412   ---QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTV  582
                Q   +K K  K   +  NL  NF+TNS+IRDITT +SK FHVNVLG  N+ F HFTV
Sbjct  132   AWKQNDCNKNKNCKSIAI--NLRFNFVTNSIIRDITTKDSKNFHVNVLGCNNVVFQHFTV  189

Query  583   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  762
              AP  S NTDGIHI R  GI + DS IGTGDDCIS+GDG + L +T VTCGPGHGIS+GS
Sbjct  190   SAPKESMNTDGIHIGRSTGINITDSTIGTGDDCISIGDGTKQLHVTKVTCGPGHGISIGS  249

Query  763   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVI  939
             LGR   E PV GIF+ N     TDNGVRIKTWP S   GVV+D+H+  I M++V NP++I
Sbjct  250   LGRYQNEEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIMDNVGNPVII  309

Query  940   DQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF  1119
             DQEYCP N+C+ + PSKVKIS VS+K+IKG+S+T   + + CS G+PCE+V++ +IDLT+
Sbjct  310   DQEYCPWNQCTLKVPSKVKISNVSFKNIKGSSSTPVGIKIVCSGGLPCENVQLSDIDLTY  369

Query  1120  KGGAKTI---CSNVKPKL  1164
              G    I   C +VKP +
Sbjct  370   SGNKGPITSQCKHVKPTI  387



>ref|XP_009365185.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   380 bits (976),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 194/378 (51%), Positives = 255/378 (67%), Gaps = 14/378 (4%)
 Frame = +1

Query  67    FTFILFLLAHFGESAIINVAA-----KANVDVGPLLMKAWKEACAATTASTIVIPKGTFP  231
             F F+L +     +S+I +V +     KAN D+     KAW +ACA+T AS IV+P+GT+ 
Sbjct  12    FVFLLLVSTSNAKSSIYDVTSATYGGKANSDISRPFSKAWTDACASTLASKIVVPRGTYK  71

Query  232   MTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV  411
                 + +GPCKAP+E+++   L+AP D   +     W+   R+D  TLSGGGT DGQG  
Sbjct  72    FVGATFKGPCKAPIEIQLQGTLQAPVDGSKLSKADTWVGFERIDGLTLSGGGTFDGQGAT  131

Query  412   ---QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTV  582
                Q   +K K  K   +  NL  NF+TNS+IRDITT +SK FHVNVLG  N+ F HFTV
Sbjct  132   AWKQNDCNKNKNCKSIAI--NLRFNFVTNSIIRDITTKDSKNFHVNVLGCNNVAFQHFTV  189

Query  583   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  762
              AP  S NTDGIHI R  GI + DS+IGTGDDCIS+GDG + L +T VTCGPGHGIS+GS
Sbjct  190   SAPKESMNTDGIHIGRSTGINITDSIIGTGDDCISIGDGTKQLHVTKVTCGPGHGISIGS  249

Query  763   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVI  939
             LGR   E PV GIF+ N     TDNGVRIKTWP S   GVV+D+H+  I M++V NP++I
Sbjct  250   LGRYQNEEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIMDNVGNPVII  309

Query  940   DQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF  1119
             DQEYCP N+C+ + PSKVKIS VS+K+IKG+S++   + + CS G+PCE+V++ +IDLT+
Sbjct  310   DQEYCPWNQCTLKVPSKVKISNVSFKNIKGSSSSPVGIKIVCSGGLPCENVQLSDIDLTY  369

Query  1120  ---KGGAKTICSNVKPKL  1164
                KG   + C +VKP +
Sbjct  370   TGNKGPITSQCKHVKPTI  387



>ref|XP_007049261.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOX93418.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=515

 Score =   383 bits (984),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 201/394 (51%), Positives = 263/394 (67%), Gaps = 15/394 (4%)
 Frame = +1

Query  43    MATISYCAFTFILFLLAHF----GESAIINVAAK------ANVDVGPLLMKAWKEACAAT  192
             MA     A   IL LL        +S +++V AK         D+   L+ AWKEACA+T
Sbjct  1     MAVQLNIAVLSILLLLFSTSIPKAQSTVVDVVAKYGAKADEKTDLSTPLLHAWKEACAST  60

Query  193   TASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFT  372
             T S IVIPKGT+ +++ +L+GPCK+ +EL++   +KAP DP        W++   VDH T
Sbjct  61    TPSKIVIPKGTYRLSRATLDGPCKSAIELQVSGTIKAPADPSAFK-DPNWVVFNHVDHLT  119

Query  373   LSGGGTLDGQGN-VQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLG  549
             +SGGG  DGQG  V    +  K      LP NL  NF++N++++ ITT +SK FHVNVLG
Sbjct  120   ISGGGVFDGQGAAVWGKNNCAKNKYCAALPINLRFNFVSNAIVQGITTKDSKQFHVNVLG  179

Query  550   GKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVT  729
              KN TF HFTV AP NS NTDGIHI R  GI + D+ I TGDDC+SLGDG +N+ +  VT
Sbjct  180   CKNFTFQHFTVSAPENSINTDGIHIGRSNGIKILDTNIKTGDDCVSLGDGSKNVIVERVT  239

Query  730   CGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIE  909
             CGPGHGISVGSLG+  GE PV GIF+ N     T NGVR+KTWP+SHPG  TD+H+  I 
Sbjct  240   CGPGHGISVGSLGKFKGEEPVSGIFIRNCTISNTMNGVRVKTWPDSHPGSATDMHFEDII  299

Query  910   MEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCED  1089
             + +V NPI+IDQEYCP N C+ + PS+VK+S +S+K I GTS+T++ V L CS G+PC+ 
Sbjct  300   LNNVGNPILIDQEYCPWNLCNLKVPSRVKLSNISFKKIWGTSSTQQAVKLVCSRGLPCDR  359

Query  1090  VEIGEIDLTFK---GGAKTICSNVKPKLTGKQCP  1182
             VE+ +ID+T+K   G A + C NVKP+L+GKQ P
Sbjct  360   VELADIDITYKGPGGPAISQCINVKPRLSGKQNP  393



>ref|XP_007152047.1| hypothetical protein PHAVU_004G097300g [Phaseolus vulgaris]
 gb|ESW24041.1| hypothetical protein PHAVU_004G097300g [Phaseolus vulgaris]
Length=398

 Score =   379 bits (973),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 193/375 (51%), Positives = 249/375 (66%), Gaps = 10/375 (3%)
 Frame = +1

Query  79    LFLL-------AHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMT  237
             LFLL       A FG   I    A  N D+   L  AW +ACA+TT S +VI +G + + 
Sbjct  12    LFLLLVSSSATAQFGVFDISKYGAVPNGDITEALTNAWSDACASTTPSKVVIARGIYNLK  71

Query  238   QVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQG-NVQ  414
             Q+  +GPC AP+E+++   +KAP DP  ++G  +W+    ++  TLSG GT DGQG N  
Sbjct  72    QIEFKGPCMAPIEVQVDGTIKAPQDPNQLNGDAQWIKFTYINFLTLSGAGTFDGQGANAW  131

Query  415   VYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPG  594
                +  K     KL  N    FL N+++RDIT+ +SK FHVNVLG  N+TF +F + AP 
Sbjct  132   TQNNCAKNKSCKKLSMNFGFGFLNNTIVRDITSKDSKYFHVNVLGCNNITFTNFNIVAPA  191

Query  595   NSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRT  774
              SPNTDGIHI R   + + ++ I TGDDCISLGDG + + +  VTCGPGHGISVGSLG+ 
Sbjct  192   TSPNTDGIHIGRSTLVNIDNTNIATGDDCISLGDGSKQITVLNVTCGPGHGISVGSLGKY  251

Query  775   PGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEY  951
             P E+PV+  FVSN     TDNGVRIKTWP++   + VT +H+  I+M +VKNPI+IDQEY
Sbjct  252   PNEKPVEDFFVSNCILNNTDNGVRIKTWPDTPATITVTGMHFEDIKMINVKNPIIIDQEY  311

Query  952   CPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKG-G  1128
             CP N+C+KQ PSK+KIS VS+K+I GTS TKE V+L CSSGVPCEDV + +IDLTF G  
Sbjct  312   CPWNQCTKQNPSKIKISNVSFKNIIGTSGTKEGVVLICSSGVPCEDVMLTDIDLTFNGTS  371

Query  1129  AKTICSNVKPKLTGK  1173
             A    SNVKP + GK
Sbjct  372   AAAKLSNVKPIIQGK  386



>ref|XP_004488391.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=391

 Score =   379 bits (972),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 192/349 (55%), Positives = 243/349 (70%), Gaps = 5/349 (1%)
 Frame = +1

Query  136   NVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDP  315
             N D+    + AW EACA+TTA  IVIP GT+ M +V ++GPCKAP+E+++   +KAP +P
Sbjct  35    NADITQAFISAWNEACASTTAVKIVIPAGTYNMREVDVKGPCKAPIEIQVDGTIKAPANP  94

Query  316   KNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDK-LPNNLSLNFLTNS  492
               + G  +W+ +G  +  TLSG G  DGQG      +     K  K L  N   NFL NS
Sbjct  95    DELKGADQWVKIGYTNFLTLSGKGVFDGQGAAAWKQNDCSTNKNCKMLCMNFGFNFLNNS  154

Query  493   VIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  672
             ++RDIT+ +SK FHVNVLG  N TFD FTV AP  S NTDGIHI R   + V ++ IGTG
Sbjct  155   IVRDITSKDSKNFHVNVLGCNNFTFDGFTVTAPATSLNTDGIHIGRSTDVKVLNTNIGTG  214

Query  673   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  852
             DDC+SLGDG + + +  V CGPGHGISVGSLG+   E PV+G+ + N     TDNGVRIK
Sbjct  215   DDCVSLGDGDKQITVQNVHCGPGHGISVGSLGKYTTESPVEGVLIKNCTLTETDNGVRIK  274

Query  853   TWPNSHPG--VVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIK  1026
             TWP++ PG   VTD+++  I M +V+NPI+IDQEYCP N+CSK+ PSK+KISKVS+K+IK
Sbjct  275   TWPDA-PGTITVTDMNFEDITMVNVRNPIIIDQEYCPWNQCSKKNPSKIKISKVSFKNIK  333

Query  1027  GTSATKETVILACSSGVPCEDVEIGEIDLTFKGG-AKTICSNVKPKLTG  1170
             GTSAT E V+L CSSGVPC+ VE+  IDLTF G  AK  CSNVKP +TG
Sbjct  334   GTSATPEGVLLICSSGVPCDGVELNNIDLTFNGAPAKANCSNVKPIITG  382



>ref|XP_008379966.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=400

 Score =   379 bits (972),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 193/378 (51%), Positives = 251/378 (66%), Gaps = 14/378 (4%)
 Frame = +1

Query  67    FTFILFLLAHFGESAIINVAA-----KANVDVGPLLMKAWKEACAATTASTIVIPKGTFP  231
             F  +L +     +S + +V +     KAN D+   L KAW +ACA+T+AS IV+P GT+ 
Sbjct  12    FVSLLLVSTSNAQSGVYDVTSANYGGKANSDITQALSKAWTDACASTSASKIVVPSGTYK  71

Query  232   MTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV  411
                 + +GPCKAP+E ++   L+AP D   +     W+   R+D  TLSGGGT DG G  
Sbjct  72    FVGATFKGPCKAPIEFQLQGTLQAPEDGSQLPKADTWIGFERIDGLTLSGGGTFDGLGAT  131

Query  412   ---QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTV  582
                Q   +K K  K   +  NL  NF+TNS+IRDITT +SK FHVN+LG  N+ F HFTV
Sbjct  132   AWKQNDCNKNKNCKSIAI--NLRFNFVTNSIIRDITTKDSKNFHVNLLGCNNVAFQHFTV  189

Query  583   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  762
              AP  S NTDGIHI R  GI + D+ IGTGDDCIS+GDG + L +T VTCGPGHGIS+GS
Sbjct  190   SAPKESINTDGIHIGRSTGINITDTTIGTGDDCISIGDGTKQLHVTNVTCGPGHGISIGS  249

Query  763   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVI  939
             LG+   E PV GIF+ N     TDNGVRIKTWP S   GVV+D+H+  I M++VKNP++I
Sbjct  250   LGKYENEEPVSGIFIKNCTITNTDNGVRIKTWPASPANGVVSDVHFEDIIMDNVKNPVII  309

Query  940   DQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF  1119
             DQEYCP N+C+ Q PSKVKIS VS+K+IKG+S+T   + L CS G+PCE+VE+  IDLT+
Sbjct  310   DQEYCPYNQCTLQVPSKVKISNVSFKNIKGSSSTPVGIKLVCSGGLPCENVELSNIDLTY  369

Query  1120  KGGAKTI---CSNVKPKL  1164
              G   +I   C ++KP +
Sbjct  370   TGKEGSITSECKHIKPTI  387



>ref|XP_010093135.1| hypothetical protein L484_009327 [Morus notabilis]
 gb|EXB53587.1| hypothetical protein L484_009327 [Morus notabilis]
Length=394

 Score =   378 bits (970),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 251/386 (65%), Gaps = 3/386 (1%)
 Frame = +1

Query  37    LKMATISYCAFTFILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIP  216
             LKM TI    F  +   L++     +    A A VD+   L+K WK+ACA  + S ++IP
Sbjct  3     LKMNTIEIVLFMLVASNLSNAQVFDVTKNGANAKVDITQALLKTWKQACATKSRSQVLIP  62

Query  217   KGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLD  396
             KGTF ++Q + +GPCKAP+E  +   L AP    N  G   W+    +D  T++GGGT +
Sbjct  63    KGTFKVSQATFQGPCKAPIEFNLQGTLLAPAVDGNFKGGDSWISFEHIDSLTVTGGGTFN  122

Query  397   GQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHF  576
             GQG      +         LP N+  NFLTNSV++ +T+L+SK FHVNVLG KN+TF HF
Sbjct  123   GQGKTAWGKTCTSSQYCGNLPINVRFNFLTNSVVQYVTSLDSKQFHVNVLGCKNITFQHF  182

Query  577   TVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISV  756
              V APG+S NTDGIHI R   + V DS I TGDDCIS+G+G + + I  V CGPGHGIS+
Sbjct  183   KVSAPGDSLNTDGIHIGRSTDVKVLDSNIQTGDDCISIGEGSQQVTINKVNCGPGHGISI  242

Query  757   GSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIV  936
             GSLG    E  VKG+FV +     T NGVRIKTWP+S PG  +D+H+  I++++V NPIV
Sbjct  243   GSLGMYANEEAVKGVFVKSCTLKNTQNGVRIKTWPDSQPGTASDMHFEDIQLDNVGNPIV  302

Query  937   IDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLT  1116
             IDQEYCP N+C+ +  S+VK+S +S+K+I+G+S+T   V L CS G PC++V++ +I+L+
Sbjct  303   IDQEYCPWNKCNAKVSSRVKLSNISFKNIRGSSSTAVAVKLVCSKGYPCQNVQLSDINLS  362

Query  1117  FKGGAKTI---CSNVKPKLTGKQCPK  1185
             +KG    I   C NVKP L+GK+ P+
Sbjct  363   YKGSEGAITSECKNVKPILSGKENPR  388



>ref|XP_003595659.1| Polygalactorunase PG11 [Medicago truncatula]
 ref|XP_003595664.1| Polygalactorunase PG11 [Medicago truncatula]
 gb|AES65910.1| polygalacturonase 11c, putative [Medicago truncatula]
 gb|AFK38160.1| unknown [Medicago truncatula]
Length=419

 Score =   378 bits (970),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 190/388 (49%), Positives = 258/388 (66%), Gaps = 12/388 (3%)
 Frame = +1

Query  37    LKMATISYCAFTFIL-FLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVI  213
             +K +T+   +F F+  F  A  G   I     K N D+G  L  AWKEACA+TTA+ IVI
Sbjct  1     MKFSTVIIVSFLFLADFCAAQSGVLDIAKFGGKPNSDIGMALTAAWKEACASTTAAKIVI  60

Query  214   PKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTL  393
             P GT+ +  + L+GPCKAP+EL++   ++AP DP  + G ++W     +DH TLSG G  
Sbjct  61    PAGTYQLNGIELKGPCKAPIELQVDGTIQAPADPSVIKGTEQWFKFLYMDHLTLSGKGVF  120

Query  394   DGQGNVQVY----PSKEKGFKGDKLPN--NLSLNFLTNSVIRDITTLNSKLFHVNVLGGK  555
             DGQG   VY    P+     KG    N  N   NF+ NS++  +T+ +SK FHV V G  
Sbjct  121   DGQG-ASVYKKAQPAAAWSGKGGNSKNFMNFGFNFVNNSLVHGVTSKDSKNFHVMVFGCN  179

Query  556   NLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCG  735
             N+TFD FT+ APG+SPNTDGIH+ +  G+ + ++ IGTGDDC+S+GDG + + + GV CG
Sbjct  180   NITFDSFTITAPGDSPNTDGIHMGKSTGVKILNTNIGTGDDCVSIGDGSKQITVEGVKCG  239

Query  736   PGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--DIHYHKIE  909
             PGHG+S+GSLG+   E  V+GI + N     TDNGVRIKTWP++ PG +T  DIH+  I 
Sbjct  240   PGHGLSIGSLGKFTTEENVEGITIKNCTLTATDNGVRIKTWPDA-PGTITVSDIHFEDIT  298

Query  910   MEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCED  1089
             M +VKNP++IDQEYCP N CSK+ PSK+K+SK+++K++KGTS T E V+L CSS VPC+ 
Sbjct  299   MTNVKNPVIIDQEYCPWNACSKKNPSKIKLSKITFKNVKGTSGTAEGVVLICSSAVPCDG  358

Query  1090  VEIGEIDLTFKGGAKTI-CSNVKPKLTG  1170
             VE+  +DL F G   T  C+NVKP +TG
Sbjct  359   VELNNVDLKFNGAPTTAKCTNVKPIVTG  386



>ref|XP_009365184.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   377 bits (968),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 192/378 (51%), Positives = 251/378 (66%), Gaps = 14/378 (4%)
 Frame = +1

Query  67    FTFILFLLAHFGESAIINVAA-----KANVDVGPLLMKAWKEACAATTASTIVIPKGTFP  231
             F  +L +     +S + +V +     KAN D+   L KAW +ACA+T+A  IV+P GT+ 
Sbjct  12    FVSLLLVSTSNAQSGVYDVTSANYGGKANSDITQALSKAWTDACASTSAGKIVVPSGTYK  71

Query  232   MTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV  411
                 + +GPCKAP+E ++   L+AP D   +     W+   R+D  TLSGGGT DG G  
Sbjct  72    FVGATFKGPCKAPIEFQLQGTLQAPEDGSQLPKADTWIGFERIDGLTLSGGGTFDGLGAT  131

Query  412   ---QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTV  582
                Q   +K K  K   +  NL  NF+TNS+IRDITT +SK FHVN+LG  N+ F HFTV
Sbjct  132   AWKQNDCNKNKNCKSIAI--NLRFNFVTNSIIRDITTKDSKNFHVNLLGCNNVAFQHFTV  189

Query  583   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  762
              AP  S NTDGIHI R  GI + D+ IGTGDDCIS+GDG + L +T VTCGPGHGIS+GS
Sbjct  190   SAPKESINTDGIHIGRSTGINITDTTIGTGDDCISIGDGTKQLHVTNVTCGPGHGISIGS  249

Query  763   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHP-GVVTDIHYHKIEMEDVKNPIVI  939
             LG+   E PV GIF+ N     TDNGVRIKTWP S   GVV+D+H+  I M++VKNP++I
Sbjct  250   LGKYENEEPVSGIFIKNCTISNTDNGVRIKTWPASPANGVVSDVHFEDIIMDNVKNPVII  309

Query  940   DQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF  1119
             DQEYCP+N+C+ Q PSKVKIS VS+K+IKG+S+T   + L CS G+PCE+VE+  IDLT+
Sbjct  310   DQEYCPHNQCTLQVPSKVKISNVSFKNIKGSSSTPVGIKLVCSGGLPCENVELSNIDLTY  369

Query  1120  KGGAKTI---CSNVKPKL  1164
              G   +I   C ++KP +
Sbjct  370   TGKEGSITSECKHIKPTI  387



>gb|AES65915.2| polygalacturonase 11c, putative [Medicago truncatula]
Length=417

 Score =   377 bits (969),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 255/386 (66%), Gaps = 10/386 (3%)
 Frame = +1

Query  37    LKMATISYCAFTFIL-FLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVI  213
             +K +T+   +F F+  F  A  G   I     K N D+G  L  AWKEACA+TTA+ IVI
Sbjct  1     MKFSTVIIVSFLFLADFCAAQSGVLDIAKFGGKPNSDIGMALTAAWKEACASTTAAKIVI  60

Query  214   PKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTL  393
             P GT+ +  + L+GPCKAP+EL++   ++AP DP  + G ++W     +DH TLSG G  
Sbjct  61    PAGTYQLNGIELKGPCKAPIELQVDGTIQAPADPSVIKGTEQWFKFLYMDHLTLSGKGVF  120

Query  394   DGQGNVQVYPSKEKGFKGD----KLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNL  561
             DGQG   VY   +          +   N   NF+ NS++  +T+ +SK FHV V G  N+
Sbjct  121   DGQG-ASVYKKAQPAAAWSVFLVQFQQNFGFNFVNNSLVHGVTSKDSKNFHVMVFGCNNI  179

Query  562   TFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPG  741
             TFD FT+ APG+SPNTDGIH+ +  G+ + ++ IGTGDDC+S+GDG + + + GV CGPG
Sbjct  180   TFDSFTITAPGDSPNTDGIHMGKSTGVKILNTNIGTGDDCVSIGDGSKQITVEGVKCGPG  239

Query  742   HGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--DIHYHKIEME  915
             HG+S+GSLG+   E  V+GI + N     TDNGVRIKTWP++ PG +T  DIH+  I M 
Sbjct  240   HGLSIGSLGKFTTEENVEGITIKNCTLTATDNGVRIKTWPDA-PGTITVSDIHFEDITMT  298

Query  916   DVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVE  1095
             +VKNP++IDQEYCP N CSK+ PSK+K+SK+++K++KGTS T E V+L CSS VPC+ VE
Sbjct  299   NVKNPVIIDQEYCPWNACSKKNPSKIKLSKITFKNVKGTSGTAEGVVLICSSAVPCDGVE  358

Query  1096  IGEIDLTFKGGAKTI-CSNVKPKLTG  1170
             +  +DL F G   T  C+NVKP +TG
Sbjct  359   LNNVDLKFNGAPTTAKCTNVKPIVTG  384



>ref|XP_009365186.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   376 bits (966),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 193/378 (51%), Positives = 252/378 (67%), Gaps = 14/378 (4%)
 Frame = +1

Query  67    FTFILFLLAHFGESAIINVAA-----KANVDVGPLLMKAWKEACAATTASTIVIPKGTFP  231
             F F+L +     +S+I +V +     KAN D+     KAW +ACA+T AS IV+P+GT+ 
Sbjct  12    FVFLLLVSTSNAKSSIYDVTSATYGGKANSDISQAFSKAWTDACASTLASKIVVPRGTYK  71

Query  232   MTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV  411
                 + +GPCKAP+E+++   L+AP D   +     W+   R+D  TLSGGGT DGQG  
Sbjct  72    FVGATFKGPCKAPIEIQLQGTLQAPVDGSKLSKADTWVGFERIDGLTLSGGGTFDGQGAT  131

Query  412   ---QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTV  582
                Q   +K K  K   +  NL  NF+TNS+IRDITT +SK FHVNVLG  N+ F  FTV
Sbjct  132   AWKQNDCNKNKNCK--SIAINLRFNFVTNSIIRDITTKDSKNFHVNVLGCNNVAFQRFTV  189

Query  583   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  762
              AP  S NTDGIHI R  GI + DS+IGTGDDCIS+GDG + L +T VTCGPGHGIS+GS
Sbjct  190   SAPKESMNTDGIHIGRSTGINITDSIIGTGDDCISIGDGTKQLHVTKVTCGPGHGISIGS  249

Query  763   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVI  939
             LGR   E PV GIF+ N     TDNGVRIKTWP S   GVV+D+H+  I M++V NP++I
Sbjct  250   LGRYQNEEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIMDNVGNPVII  309

Query  940   DQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF  1119
             DQEYCP N+C+ + PSKVKIS VS+K+IKG+S     + + CS G+PCE+V++ +IDLT+
Sbjct  310   DQEYCPWNQCTLKVPSKVKISNVSFKNIKGSSVGIVGIKIVCSGGLPCENVQLSDIDLTY  369

Query  1120  ---KGGAKTICSNVKPKL  1164
                KG   + C +VKP +
Sbjct  370   TGNKGPITSQCKHVKPTI  387



>gb|KCW46858.1| hypothetical protein EUGRSUZ_K00662, partial [Eucalyptus grandis]
Length=395

 Score =   375 bits (963),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 185/353 (52%), Positives = 244/353 (69%), Gaps = 9/353 (3%)
 Frame = +1

Query  142   DVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKN  321
             D+   L+ AWK+ACA+TT + + I  GTF +++V LEGPCKA VE +I   L+AP DP  
Sbjct  40    DITQSLLGAWKKACASTTRAKVFIAGGTFALSEVVLEGPCKAHVEFEIRGRLQAPADPSR  99

Query  322   M--DGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNS  492
                DG   W++  R+D  T+SGGGT DGQG +    +  +K      LP NL  NF++N+
Sbjct  100   FKTDG---WVVFQRIDGLTVSGGGTFDGQGKIAWGQNDCDKNTNCRTLPTNLRFNFVSNA  156

Query  493   VIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  672
             +I ++TTL+SK FHVNVLG KNLTF++F V APG+S NTDGIHI R +G+ + D+ I TG
Sbjct  157   IIHNVTTLDSKNFHVNVLGAKNLTFENFHVNAPGDSVNTDGIHIGRSLGVNILDTNIKTG  216

Query  673   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  852
             DDC+SLGDG   + + GVTCGPGHGISVGSLG+   E PV G+FV+N    G  NG RIK
Sbjct  217   DDCVSLGDGSRQITVRGVTCGPGHGISVGSLGKYDNEEPVSGVFVTNCTITGATNGARIK  276

Query  853   TWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGT  1032
             TW  S  G+ TD+H+  ++M DV NP++IDQ YCP N+C  Q PS VKIS VS++ I+GT
Sbjct  277   TWLASKIGIATDMHFQDVQMNDVANPVLIDQGYCPFNQCQAQIPSLVKISNVSFERIRGT  336

Query  1033  SATKETVILACSSGVPCEDVEIGEIDLTFK---GGAKTICSNVKPKLTGKQCP  1182
             S+TK  V +ACS  +PCE VEI +I+L +K   G A + CSNV+P ++G Q P
Sbjct  337   SSTKVAVKIACSKRIPCEGVEIADINLVYKGPDGPATSECSNVRPLISGMQNP  389



>sp|Q40312.1|PGLR_MEDSA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Medicago sativa]
 gb|AAA62286.1| polygalacturonase [Medicago sativa]
Length=421

 Score =   375 bits (964),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 190/387 (49%), Positives = 256/387 (66%), Gaps = 10/387 (3%)
 Frame = +1

Query  37    LKMATISYCAFTFIL-FLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVI  213
             +K +T    +F FI  F  A  G   I     K N D+G  L  AW EACA+TTA+ IVI
Sbjct  1     MKFSTAIIVSFLFIADFCAAQSGVLDISKFGGKPNSDIGQALTSAWNEACASTTAAKIVI  60

Query  214   PKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTL  393
             P GT+ +  + L+GPCKAP+EL++   ++AP DP  + G ++W     +DH TLSG G  
Sbjct  61    PAGTYQLNGIELKGPCKAPIELQVDGTIQAPADPSVIKGTEQWFKFLYMDHLTLSGKGVF  120

Query  394   DGQG-NVQVYPSKEKGFKG----DKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKN  558
             DGQG  V    +    + G     K+  N   NF+ NS++R +T+ +SK FHV V G KN
Sbjct  121   DGQGATVYKKAAPASAWSGKNSNSKVFMNFGFNFVNNSIVRGVTSKDSKNFHVMVFGCKN  180

Query  559   LTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGP  738
             +TFD FT+ APG+SPNTDGIH+ +   + + ++ IGTGDDC+S+GDG + + + GV CGP
Sbjct  181   ITFDGFTITAPGDSPNTDGIHMGKSTDVKILNTNIGTGDDCVSIGDGSKQITVQGVNCGP  240

Query  739   GHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--DIHYHKIEM  912
             GHG+SVGSLG+   E  V+GI V N     TDNGVRIKTWP++ PG +T  DIH+  I M
Sbjct  241   GHGLSVGSLGKFTTEENVEGITVKNCTLTATDNGVRIKTWPDA-PGTITVSDIHFEDITM  299

Query  913   EDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDV  1092
              +VKNP++IDQEY P N+CSK+ PSK+K+SK+S+K++KGTS T E V+L CSS VPC+ V
Sbjct  300   TNVKNPVIIDQEYYPWNQCSKKNPSKIKLSKISFKNVKGTSGTAEGVVLICSSAVPCDGV  359

Query  1093  EIGEIDLTFKGGAKTI-CSNVKPKLTG  1170
             E+  +DL F G   T  C+NVKP +TG
Sbjct  360   ELNNVDLKFNGAPTTAKCTNVKPLVTG  386



>gb|AFK41055.1| unknown [Lotus japonicus]
Length=394

 Score =   374 bits (960),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 191/383 (50%), Positives = 254/383 (66%), Gaps = 6/383 (2%)
 Frame = +1

Query  37    LKMATISYCAFTFILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIP  216
             L +A I++ +F +  F  A      I       N D+      AWK+AC +TT++ IVIP
Sbjct  5     LNIAIIAFVSFLY-GFSTAQSWVLEISKFGGAPNADITQAFTNAWKKACESTTSAKIVIP  63

Query  217   KGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLD  396
              GT+ M  V ++GPCKA +E+++   +KAP +P+N  G   W+    +  FTLSG G  D
Sbjct  64    HGTYKMGAVQVQGPCKAHIEVQVDGTIKAPVNPRNFKGAGTWVQFSYISFFTLSGKGVFD  123

Query  397   GQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDH  573
             G G      +   K      LP N + N++ NS++RDIT+ +SK F+VNVLG  N TFD 
Sbjct  124   GVGETAWKRNDCSKNKHCTLLPMNFAFNYVNNSIVRDITSKDSKSFNVNVLGCNNFTFDG  183

Query  574   FTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGIS  753
             F + A   SPNTDGIH+ R   + + ++ IGTGDDC+SLGDG++N+ +  V CGPGHG+S
Sbjct  184   FKIVALALSPNTDGIHVGRSTDVKILNTNIGTGDDCVSLGDGIKNVLVRNVNCGPGHGVS  243

Query  754   VGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHYHKIEMEDVKN  927
             VGSLG+ P E+PV+G +V N     TDNGVRIKTWP S PG   +TD+H+  I M +VKN
Sbjct  244   VGSLGKYPDEKPVEGFYVKNCTLTNTDNGVRIKTWP-STPGTAPITDMHFEDIIMVNVKN  302

Query  928   PIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEI  1107
             PI+IDQEYCP N+CSK+ PSK+KISKVS+K+I+GTSAT E VIL CSSGVPC+ VE+  +
Sbjct  303   PIIIDQEYCPWNQCSKKSPSKIKISKVSFKNIRGTSATPEGVILICSSGVPCDTVELNGV  362

Query  1108  DLTFKGGAKTI-CSNVKPKLTGK  1173
             DLTF G   T  C+NVKP +TGK
Sbjct  363   DLTFNGAPATAKCANVKPIVTGK  385



>ref|XP_011097055.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=399

 Score =   374 bits (960),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 198/393 (50%), Positives = 263/393 (67%), Gaps = 18/393 (5%)
 Frame = +1

Query  52    ISYCAFTFILFLLAHFGESA------IINVAAKANVDVGPLLMKAWKEACAATTASTIVI  213
             I++    F L LLA    +       I    AK+  D+   LM AWKEAC +T+ STIVI
Sbjct  3     INFITILFFLPLLAININAQGPMTYDITKYGAKSGGDISQALMDAWKEACNSTSPSTIVI  62

Query  214   PKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKK-EWLIVGRVDHFTLSGGGT  390
             P+GT+ ++QV L GP KAP+EL++   L+A  +P  +  K+ EW+ +  V++FTLSGGG 
Sbjct  63    PRGTWSLSQVKLLGPNKAPLELQVQGTLQA--NPGQLPNKEGEWITINYVNYFTLSGGGV  120

Query  391   LDGQGNVQVYPSKE--KGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLT  564
              DG+G  + +   +  K     KLP NLS NF+ NS+IRD+TT +SK FHVN +   N+T
Sbjct  121   FDGRGQ-EAWKQNDCHKNKNCAKLPMNLSFNFVNNSIIRDVTTKDSKNFHVNCISSHNVT  179

Query  565   FDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGH  744
             F  FTV APG+SPNTDGIH+ R   I +KDS+I TGDDC+S+GD  + + I  VTCGPGH
Sbjct  180   FLRFTVSAPGDSPNTDGIHLGRDTMINIKDSIIKTGDDCVSIGDESKEIHIQNVTCGPGH  239

Query  745   GISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--DIHYHKIEMED  918
             GISVGSLG    E+ V+GI+V+N  FIGT NGVR+KTWP S P  +T  D+H+  + M++
Sbjct  240   GISVGSLGGYAEEKDVQGIYVTNCTFIGTTNGVRVKTWP-SAPATLTVSDLHFEDLIMDN  298

Query  919   VKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEI  1098
             V +PI+IDQEYCP+N C K +PS +KIS VS K+++GT+ T E V   CS   PCE+VE+
Sbjct  299   VSSPIIIDQEYCPHNLCKKDRPSSIKISNVSIKNVRGTTNTAEAVTFICSGLKPCENVEV  358

Query  1099  GEIDLTFKGGA---KTICSNVKPKLTGKQCPKV  1188
             G+IDLT+ G      T C+NVKPK  GKQ P V
Sbjct  359   GDIDLTYNGNQGPITTKCANVKPKFVGKQNPPV  391



>ref|XP_002282594.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   374 bits (959),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 177/374 (47%), Positives = 244/374 (65%), Gaps = 9/374 (2%)
 Frame = +1

Query  76    ILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEG  255
             I+F +  +G           N D+   L+KAW +AC++  AST++IP GT+ + Q+ + G
Sbjct  26    IIFDVTKYG------ARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAG  79

Query  256   PCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEK  435
             PCKAP+   +   + AP D      +  W+   ++D FTLSG G  DGQG +        
Sbjct  80    PCKAPINFVVQGTVMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKIVWGTKCLS  139

Query  436   GFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDG  615
                 ++LP NL  NF+TNS+++DIT+ +SK FH+N+LG KNLTF +  + AP  S NTDG
Sbjct  140   SAYCNQLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNIVISAPQESLNTDG  199

Query  616   IHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVK  795
             IHI R  GI + DS I TGDDC+S+GDG E + I  VTCGPGHGISVGSLG+ P E PV 
Sbjct  200   IHIGRSSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVV  259

Query  796   GIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSK  975
             GI V N     T NGVR+KTWP SH G  +++H+  I M +V NPI+IDQEYCP+N+C+ 
Sbjct  260   GISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNL  319

Query  976   QKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKTICS  1146
             + PS++KIS VS+++I+GT++T+  V L CS GVPC DVE+G+I+L + G    A + C 
Sbjct  320   KSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGVPCHDVELGDINLEYNGNEGPAMSQCK  379

Query  1147  NVKPKLTGKQCPKV  1188
             N+KP L G Q P++
Sbjct  380   NIKPNLLGVQLPRI  393



>emb|CDP04350.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   372 bits (954),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 190/357 (53%), Positives = 242/357 (68%), Gaps = 7/357 (2%)
 Frame = +1

Query  142   DVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKN  321
             D+   L+ AWK AC +   STIVIP+GTF + Q +LEGPCKAP+EL++   LKAP +P N
Sbjct  41    DISQALLSAWKAACNSPKPSTIVIPRGTFGLLQATLEGPCKAPIELQVQGTLKAPQNP-N  99

Query  322   MDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTNSV  495
             +    EW+ +  +DHFTLSG GT DGQG  + +   +     D  KLPNN S NFL NS+
Sbjct  100   LIKDGEWVTIQYLDHFTLSGSGTFDGQG-ARAWAQNDCAKASDCSKLPNNFSFNFLNNSI  158

Query  496   IRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGD  675
             I  I +LNSKLFH+N+LG  N+T    T+ APG S NTDGIH+ R  G+ + DS IGTGD
Sbjct  159   ISGIASLNSKLFHMNILGCNNVTLSRLTITAPGTSLNTDGIHVGRSSGVNITDSTIGTGD  218

Query  676   DCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKT  855
             DC+SLGDG + + IT V CGPGHGIS+GSLGR   E PV G+FV N   I T  GVR+K+
Sbjct  219   DCVSLGDGSKQVSITNVVCGPGHGISIGSLGRYKNEEPVVGVFVRNCTLINTLTGVRVKS  278

Query  856   WPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTS  1035
             WP++  G  TD+H+  I M +V +PIVIDQEYCPNN+C+   PS+VKISKVS+ +I+GTS
Sbjct  279   WPSATTGAATDVHFDDITMRNVTSPIVIDQEYCPNNQCTLGAPSRVKISKVSFNNIRGTS  338

Query  1036  ATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI---CSNVKPKLTGKQCPKVTCK  1197
             A+   V L CS   PCE VEIG+IDL + G    I   C+NV+P   G+Q P +  K
Sbjct  339   ASALAVKLVCSKTFPCEGVEIGDIDLAYHGSLGNITTNCANVQPTFMGRQNPPICAK  395



>gb|ADC53480.1| polygalacturonase [Gossypium hirsutum]
Length=412

 Score =   372 bits (955),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 191/376 (51%), Positives = 253/376 (67%), Gaps = 17/376 (5%)
 Frame = +1

Query  76    ILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEG  255
             ++ ++A FG        A    D+   L+ AWKEACA+T+ S IVIPKG + ++  +L+G
Sbjct  32    VIDVVAKFG------AKADEKTDLSKPLLDAWKEACASTSPSKIVIPKGIYFLSTATLDG  85

Query  256   PCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEK  435
             PCKAP+EL++   +KAP DP      K W+   R+++F LSGGG  DGQG       K +
Sbjct  86    PCKAPIELQVQGTVKAPADPGAFKEPK-WIAFNRIENFKLSGGGVFDGQGTTAY---KRE  141

Query  436   GFKGD----KLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  603
             G KG      LP NL  +FLTN++I+DITT +SK F  NVLG KN+TF+HFTV AP  SP
Sbjct  142   GCKGHDYCGSLPINLRFDFLTNAMIQDITTKDSKQFQANVLGCKNITFEHFTVSAPDESP  201

Query  604   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  783
             NTDGIHI R  G+ V +S I TGDDC+S+GDG +NL I GVTCGPGHGIS+GSLG    E
Sbjct  202   NTDGIHIGRSDGVNVLNSEIKTGDDCVSIGDGSKNLVINGVTCGPGHGISIGSLGLFKNE  261

Query  784   RPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNN  963
              PV G+ V N     T NGVRIKTWP + PG  ++IH+  I + +V +PI+IDQ+YCP N
Sbjct  262   EPVDGVTVKNCTMTNTSNGVRIKTWPGAEPGTCSNIHFEDITVTNVSSPIIIDQKYCPWN  321

Query  964   ECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFK---GGAK  1134
             +C   + SKVK+S +S+K+I GTSA  E V + CS+ +PCE+VE+ +I++T     G A 
Sbjct  322   KCKINEESKVKLSNISFKNIHGTSARPEAVKIICSATLPCENVELADIEITHSGPTGPAV  381

Query  1135  TICSNVKPKLTGKQCP  1182
             + CSNVKPK++GKQ P
Sbjct  382   SQCSNVKPKVSGKQNP  397



>ref|XP_002282573.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   371 bits (952),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 176/374 (47%), Positives = 243/374 (65%), Gaps = 9/374 (2%)
 Frame = +1

Query  76    ILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEG  255
             I+F +  +G           N D+   L+KAW +AC++  AST++IP GT+ + Q+ + G
Sbjct  26    IIFDVTKYG------ARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAG  79

Query  256   PCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEK  435
             PCKAP+   +   + AP D      +  W+   ++D FTLSG G  DGQG          
Sbjct  80    PCKAPINFVVQGTVMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKTVWGTKCLS  139

Query  436   GFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDG  615
                 ++LP NL  NF+TNS+++DIT+ +SK FH+N+LG KNLTF +  + AP  S NTDG
Sbjct  140   SSYCNQLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNVVISAPQESLNTDG  199

Query  616   IHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVK  795
             IHI R  GI + DS I TGDDC+S+GDG E + I  VTCGPGHGISVGSLG+ P E PV 
Sbjct  200   IHIGRSSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVV  259

Query  796   GIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSK  975
             GI V N     T NGVR+KTWP SH G  +++H+  I M +V NPI+IDQEYCP+N+C+ 
Sbjct  260   GISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNL  319

Query  976   QKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKTICS  1146
             + PS++KIS VS+++I+GT++T+  V L CS G PC+DVE+G+I+L + G    A + C 
Sbjct  320   KSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGEPCQDVELGDINLEYNGNEGPAMSQCK  379

Query  1147  NVKPKLTGKQCPKV  1188
             N+KP L G Q P++
Sbjct  380   NIKPNLLGVQLPRI  393



>ref|XP_010038561.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=501

 Score =   374 bits (961),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 185/353 (52%), Positives = 244/353 (69%), Gaps = 9/353 (3%)
 Frame = +1

Query  142   DVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKN  321
             D+   L+ AWK+ACA+TT + + I  GTF +++V LEGPCKA VE +I   L+AP DP  
Sbjct  73    DITQSLLGAWKKACASTTRAKVFIAGGTFALSEVVLEGPCKAHVEFEIRGRLQAPADPSR  132

Query  322   M--DGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNS  492
                DG   W++  R+D  T+SGGGT DGQG +    +  +K      LP NL  NF++N+
Sbjct  133   FKTDG---WVVFQRIDGLTVSGGGTFDGQGKIAWGQNDCDKNTNCRTLPTNLRFNFVSNA  189

Query  493   VIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  672
             +I ++TTL+SK FHVNVLG KNLTF++F V APG+S NTDGIHI R +G+ + D+ I TG
Sbjct  190   IIHNVTTLDSKNFHVNVLGAKNLTFENFHVNAPGDSVNTDGIHIGRSLGVNILDTNIKTG  249

Query  673   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  852
             DDC+SLGDG   + + GVTCGPGHGISVGSLG+   E PV G+FV+N    G  NG RIK
Sbjct  250   DDCVSLGDGSRQITVRGVTCGPGHGISVGSLGKYDNEEPVSGVFVTNCTITGATNGARIK  309

Query  853   TWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGT  1032
             TW  S  G+ TD+H+  ++M DV NP++IDQ YCP N+C  Q PS VKIS VS++ I+GT
Sbjct  310   TWLASKIGIATDMHFQDVQMNDVANPVLIDQGYCPFNQCQAQIPSLVKISNVSFERIRGT  369

Query  1033  SATKETVILACSSGVPCEDVEIGEIDLTFK---GGAKTICSNVKPKLTGKQCP  1182
             S+TK  V +ACS  +PCE VEI +I+L +K   G A + CSNV+P ++G Q P
Sbjct  370   SSTKVAVKIACSKRIPCEGVEIADINLVYKGPDGPATSECSNVRPLISGMQNP  422


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = +1

Query  991   VKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKG--GAKTICS-NVKPK  1161
             VKIS VS++DI+GTSAT     L C  GVPC+ +E+ +I+L + G  GA T  S N+KP 
Sbjct  429   VKISDVSFRDIRGTSATPLAEKLGCGRGVPCQKLELADINLRYNGRNGASTSQSANMKPT  488

Query  1162  LTGK  1173
             +TGK
Sbjct  489   ITGK  492



>ref|XP_002274125.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   368 bits (945),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 177/375 (47%), Positives = 251/375 (67%), Gaps = 11/375 (3%)
 Frame = +1

Query  76    ILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEG  255
             I+F +  +G        A  + D+   L+KAW ++C++  AST++IP GT+ + Q+++ G
Sbjct  26    IIFDVTKYG------ARADGHSDISQALLKAWGDSCSSPVASTVMIPNGTYALGQITIGG  79

Query  256   PCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEK  435
             PCKAP+   +   + AP D      +  W+   ++D FTLSGGG  DGQG   V+  K  
Sbjct  80    PCKAPINFVVQGTVMAPVDTSRFKAEAGWIAFQQIDQFTLSGGGVFDGQGKT-VWGRKCP  138

Query  436   GFKGDK-LPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTD  612
              +   K LP NL  NF+TNS+++DIT+ +SK FH+N+LG KNL F +  + AP  S NTD
Sbjct  139   HYAYCKQLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLAFYNVAISAPDESLNTD  198

Query  613   GIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPV  792
             GIHI R  GI + DS I TGDDC+S+GDG E + I  VTCGPGHGISVGSLG+ P E PV
Sbjct  199   GIHIGRSSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPV  258

Query  793   KGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECS  972
              GI V N     T NGVR+KT+P SH G+ +++H+  I M +V NPI+IDQEYCP+N+C+
Sbjct  259   VGISVKNCTLTNTQNGVRVKTFPASHQGIASEMHFEDIVMNNVGNPIIIDQEYCPHNQCN  318

Query  973   KQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTIC  1143
              + PS++K+S VS+++I+GT++T+  V L CS GVPC+DVE+G+I+L +   +G A + C
Sbjct  319   LKSPSRIKLSNVSFRNIRGTTSTQVAVKLLCSQGVPCQDVELGDINLKYNGKEGPAMSQC  378

Query  1144  SNVKPKLTGKQCPKV  1188
              N+KP L G Q P++
Sbjct  379   KNIKPNLLGVQLPRI  393



>ref|XP_010112811.1| hypothetical protein L484_020043 [Morus notabilis]
 gb|EXC34926.1| hypothetical protein L484_020043 [Morus notabilis]
Length=394

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 187/376 (50%), Positives = 244/376 (65%), Gaps = 7/376 (2%)
 Frame = +1

Query  76    ILFLLAHFGESAIINV---AAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVS  246
             +L L A    + + +V    AK N D    L+  WKEACA+ T S IV+PKG F +TQ  
Sbjct  12    LLVLFASHANAQVFDVTANGAKPNADSTQALLTTWKEACASATRSKIVVPKGVFKVTQAL  71

Query  247   LEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQG-NVQVYP  423
              +GPCKAP+E  +   L+APP      G   W+    VD  T+SG G  DGQG +     
Sbjct  72    FQGPCKAPIEFNLQGTLQAPPVGGGFKGGDTWIGFEHVDFLTVSGNGVFDGQGKSAWGKK  131

Query  424   SKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  603
                  + G +LP NL  +F+TNS+++D+TTL+SK FHVNVLG KN+TF +F V AP NS 
Sbjct  132   CDHTEYCGKQLPINLRFDFVTNSLVQDVTTLDSKQFHVNVLGCKNVTFHNFHVIAPENSV  191

Query  604   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  783
             NTDGIHI R   I + +S+I TGDDC+S+GDG + + +T VTCGPGHG  +GSLG+   E
Sbjct  192   NTDGIHIGRSTDIKILNSIIQTGDDCVSIGDGSKQIYLTQVTCGPGHGFGIGSLGKYLNE  251

Query  784   RPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNN  963
              PV+GIFV+      T NGVRIKTWPNS+PG  +DIH+  I ME+V NP++IDQEYCP N
Sbjct  252   LPVQGIFVTGCTLKNTLNGVRIKTWPNSYPGTASDIHFADITMENVGNPVLIDQEYCPWN  311

Query  964   ECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI-  1140
             +C+ + PSKVK+S +S+K I GTS+T   V L CSSG PC++V I +I+L + G    I 
Sbjct  312   QCNLKVPSKVKLSNISFKKIHGTSSTPLAVNLVCSSGAPCQNVVIQDINLKYSGSQGPIT  371

Query  1141  --CSNVKPKLTGKQCP  1182
               C NVKP + G Q P
Sbjct  372   SKCKNVKPTVGGVQNP  387



>ref|XP_009134996.1| PREDICTED: polygalacturonase-like [Brassica rapa]
 emb|CDX74029.1| BnaA03g30180D [Brassica napus]
Length=395

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 182/383 (48%), Positives = 255/383 (67%), Gaps = 8/383 (2%)
 Frame = +1

Query  58    YCAFTFILFLLAHFGESAI-INVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPM  234
             + AFT  +F L  F  +A+ I + +    D+   L+KA+  AC + T S +VIPKG F +
Sbjct  5     FGAFTVFIFCLLGFSANAVYITIGSSPGSDITQALLKAFTTACQSPTPSRVVIPKGEFKL  64

Query  235   TQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQ  414
              ++ + GPCKAPVE+ I   +KA  D   + GK  W++ G ++ F L+GGG  DG+GN  
Sbjct  65    GEIQMRGPCKAPVEITIQGTVKA--DGNAIQGKDTWIVFGNINGFKLNGGGAFDGEGNAA  122

Query  415   VYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAP  591
                +   + F   KLP ++  +F+ N+ IRDI+++++K FH+NVLG KN+T DH  + AP
Sbjct  123   WRVNNCHQTFNCKKLPISIRFDFVENAEIRDISSIDAKNFHINVLGAKNMTMDHINIIAP  182

Query  592   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  771
              +SPNTDGIH+ R  G+ + ++ I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR
Sbjct  183   KDSPNTDGIHLGRSDGVKILNTFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGR  242

Query  772   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQE  948
                E+ V GI V N     TDNG+RIKTWP++      +DIH+  I +++V NPI+IDQE
Sbjct  243   YGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIILKNVMNPILIDQE  302

Query  949   YCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG  1128
             YCP N+C+KQKPS +K++ +S+K I+GTS  K+ V L CS G PC++VEIG+ID+ + G 
Sbjct  303   YCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSGA  362

Query  1129  ---AKTICSNVKPKLTGKQCPKV  1188
                A   CSNV PKL G Q PK 
Sbjct  363   DGPATFQCSNVSPKLMGTQSPKA  385



>ref|XP_011097018.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=373

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 187/352 (53%), Positives = 244/352 (69%), Gaps = 10/352 (3%)
 Frame = +1

Query  157   LMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKK  336
             LM AWKEAC +T+ STIVIP+GT+ ++QV L  P KAPVEL++   L+A P+P  +  K+
Sbjct  16    LMDAWKEACNSTSPSTIVIPRGTWSLSQVKLLAPNKAPVELQVQGTLQANPNPGQLPNKE  75

Query  337   -EWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKE--KGFKGDKLPNNLSLNFLTNSVIRDI  507
              EW+ +  V++FTLSGGG  D QG  + +   +  K     KLP NLS NF+ NS+IRD+
Sbjct  76    GEWITINYVNYFTLSGGGVFDDQGQ-EAWKQNDCHKNRNCAKLPMNLSFNFVNNSIIRDV  134

Query  508   TTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCIS  687
             TT +SK FHV  +   N+TF  FTV APG+SPNTDGIH+ R   I +KDS+I TGDDC+S
Sbjct  135   TTKDSKNFHVICILSHNVTFLRFTVSAPGDSPNTDGIHLGRDTMINIKDSIIKTGDDCVS  194

Query  688   LGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS  867
             +GD  + + I  VTCGPGHGISVGS G    E+ V+ I+V+N  FIGT NGVR+KTWP S
Sbjct  195   IGDESKEIHIQNVTCGPGHGISVGSFGGYAVEKDVQEIYVTNCTFIGTQNGVRVKTWP-S  253

Query  868   HPGVVT--DIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSAT  1041
              P  +T  D+H+  + M++V +PI+IDQEYCP+N C K +PS +KIS VS K+I+GT+ T
Sbjct  254   APATLTVSDLHFEDLIMDNVSSPIIIDQEYCPHNLCKKDRPSSIKISNVSIKNIRGTTNT  313

Query  1042  KETVILACSSGVPCEDVEIGEIDLTFKGGA---KTICSNVKPKLTGKQCPKV  1188
              E V   CS   PCE+VE+G+IDLT+ G      T C+NVKPK  GKQ P V
Sbjct  314   AEAVTFICSGLKPCENVEVGDIDLTYNGNQGPITTNCANVKPKFVGKQNPPV  365



>ref|XP_004173029.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=423

 Score =   367 bits (943),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 189/365 (52%), Positives = 254/365 (70%), Gaps = 11/365 (3%)
 Frame = +1

Query  112   IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMA  291
             I    AK N D+   L  AWKEACA+TT S ++IPKG++ ++Q +L+GPCK+P+EL+I  
Sbjct  51    ITKYGAKPNADITAALTSAWKEACASTTPSKVLIPKGSYGLSQSNLKGPCKSPIELQIEG  110

Query  292   ILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD--KLPNN  465
              L+AP  P+     +  LI+   D  T+SG G LDGQG    +   +   K +  KLP N
Sbjct  111   TLQAPAHPEG----EGLLILENTDLLTVSGTGVLDGQGKAG-WEKNDCHLKKECTKLPMN  165

Query  466   LSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGIT  645
             L LNF+TNS++  IT+L+SK FH+N+LG KNLTFDH T+ APGNSPNTDGIH++    I 
Sbjct  166   LKLNFITNSIVTGITSLDSKNFHINLLGCKNLTFDHVTITAPGNSPNTDGIHVSSSEQIN  225

Query  646   VKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFI  825
             + ++ I TGDDCIS+GD  + + I+ VTCGPGHGIS+GSLG+   E+ V G+ V   K  
Sbjct  226   ILNTNIATGDDCISVGDSNKQVAISDVTCGPGHGISIGSLGKYTKEKEVVGVTVKKCKLT  285

Query  826   GTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKIS  1002
             GT NGVRIKTWP+S      TD+H+  IEM++V NPI+IDQEYCP N+C+++  SK+KIS
Sbjct  286   GTTNGVRIKTWPDSAVAFPATDMHFEDIEMDNVSNPIIIDQEYCPWNQCNRKVASKIKIS  345

Query  1003  KVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTGK  1173
              VS+K+I+GTSAT   V + CS  +PCE VEI +IDLT+   +G  K+ C+NVKP +TGK
Sbjct  346   NVSFKNIRGTSATAIAVKIVCSKSIPCEGVEIADIDLTYSGPEGPIKSQCANVKPVITGK  405

Query  1174  QCPKV  1188
             Q P +
Sbjct  406   QNPPI  410



>gb|ABN13878.1| polygalacturonase [Brassica rapa subsp. oleifera]
Length=395

 Score =   366 bits (939),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 181/383 (47%), Positives = 255/383 (67%), Gaps = 8/383 (2%)
 Frame = +1

Query  58    YCAFTFILFLLAHFGESAI-INVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPM  234
             + AFT  +F L  F  +A+ I + +    D+   L+KA+  AC + T S +VIPKG F +
Sbjct  5     FGAFTVFIFCLLGFSANAVYITIGSSPGSDITQALLKAFTTACQSPTPSRVVIPKGEFKL  64

Query  235   TQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQ  414
              ++ + GPCKAPVE+ I   +KA  D   + GK  W++ G ++ F L+GGG  DG+GN  
Sbjct  65    GEIQMRGPCKAPVEITIQGTVKA--DGNAIQGKDTWIVFGNINGFKLNGGGAFDGEGNAA  122

Query  415   VYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAP  591
                +   + F   KLP ++  +F+ N+ I+DI+++++K FH+NVLG KN+T DH  + AP
Sbjct  123   WRVNNCHQTFNCKKLPISIRFDFVENAEIKDISSIDAKNFHINVLGAKNMTMDHINIIAP  182

Query  592   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  771
              +SPNTDGIH+ R  G+ + ++ I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR
Sbjct  183   KDSPNTDGIHLGRSDGVKILNTFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGR  242

Query  772   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQE  948
                E+ V GI V N     TDNG+RIKTWP++      +DIH+  I +++V NPI+IDQE
Sbjct  243   YGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIILKNVMNPILIDQE  302

Query  949   YCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG  1128
             YCP N+C+KQKPS +K++ +S+K I+GTS  K+ V L CS G PC++VEIG+ID+ + G 
Sbjct  303   YCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSGA  362

Query  1129  ---AKTICSNVKPKLTGKQCPKV  1188
                A   CSNV PKL G Q PK 
Sbjct  363   DGPATFQCSNVSPKLMGTQSPKA  385



>ref|XP_007142511.1| hypothetical protein PHAVU_008G286900g [Phaseolus vulgaris]
 gb|ESW14505.1| hypothetical protein PHAVU_008G286900g [Phaseolus vulgaris]
Length=383

 Score =   365 bits (937),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 186/373 (50%), Positives = 248/373 (66%), Gaps = 8/373 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAA-KANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSL  249
             F+L  ++   +S +I++     N D+     KAWKEACA+T+AS I+I  G + M  V++
Sbjct  7     FLLLTISCTAQSTVIDIKKFGRNKDITQAFTKAWKEACASTSASKILISSGEYKMNAVNV  66

Query  250   EGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK  429
             +GPCKA VE+++   ++AP DP  +    EW+ +  VD FTLSG GT DG+G +    + 
Sbjct  67    KGPCKASVEIQVDGTIQAPADPYALKDAYEWIKIEYVDSFTLSGKGTFDGKGAIAWKHNN  126

Query  430   EKGFKGDKLPN-NLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPN  606
              +  +  K  + N   NFL NS++R +T+ +SK FHVNVLG  N TFD+F + AP  S N
Sbjct  127   CRTHQNCKRNSMNFGFNFLNNSIVRGVTSKDSKNFHVNVLGCNNFTFDNFHISAPETSIN  186

Query  607   TDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGER  786
             TDGIHI R   + V +S I TGDDC+SLGDG   + I  V CGPGHGISVGSLG+  GE 
Sbjct  187   TDGIHIGRSTNVKVLNSNIATGDDCVSLGDGSREVIIKNVKCGPGHGISVGSLGKYAGEE  246

Query  787   PVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNN  963
             PV+ + V N    GTDNGVRIKTWPN+     VT++H+    M +V +P++IDQEYCP N
Sbjct  247   PVENLLVKNCTMTGTDNGVRIKTWPNTAVVTTVTNMHFEDFTMVNVLHPVIIDQEYCPWN  306

Query  964   ECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AK  1134
             +CSK+ PSK+KISKV++K+IKGTS +KE V L CS  VPCE VE+ E+ LT+ G    AK
Sbjct  307   QCSKENPSKIKISKVTFKNIKGTSRSKEGVTLICSRSVPCEGVELSEVSLTYNGAPIVAK  366

Query  1135  TICSNVKPKLTGK  1173
               C NVKPK+TGK
Sbjct  367   --CVNVKPKITGK  377



>ref|XP_010112807.1| hypothetical protein L484_020039 [Morus notabilis]
 gb|EXC34922.1| hypothetical protein L484_020039 [Morus notabilis]
Length=396

 Score =   365 bits (938),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 180/360 (50%), Positives = 239/360 (66%), Gaps = 3/360 (1%)
 Frame = +1

Query  112   IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMA  291
             I    AK+N D    L +AWK ACA+   S +V+PKGTF +++ +  GPCKAP+E  I+ 
Sbjct  30    ITKYGAKSNNDANQALGQAWKAACASKVPSKVVVPKGTFRLSRAAFFGPCKAPIEFMIVG  89

Query  292   ILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLS  471
              L+AP +P        W+    +D  TL GGGT DG G         +     KLP NL 
Sbjct  90    TLQAPQNPGGFKDGDGWVTFQDIDRLTLDGGGTFDGNGQNVWGKHCTRLNYCSKLPINLR  149

Query  472   LNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVK  651
              NF+ NSVI+ +T+LNSK FH+ VLGG NL+F +  + AP +S NTDGIHI R   I++ 
Sbjct  150   FNFIKNSVIKSVTSLNSKQFHIMVLGGVNLSFRNLKIIAPEDSYNTDGIHIGRSTNISIT  209

Query  652   DSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGT  831
             DS I TGDDCIS+GDG +NL + GVTCGPGHGIS+GSLG+   E PV+GI V +  F  T
Sbjct  210   DSYIQTGDDCISVGDGTKNLTVKGVTCGPGHGISIGSLGKYRNEAPVQGITVRDCTFKNT  269

Query  832   DNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVS  1011
              NGVRIKTWPN++ G  +D+ +  + M++V +P++IDQEYCP N+C+ Q PSKVK+SK+S
Sbjct  270   QNGVRIKTWPNANEGSASDLRFENLYMQNVGSPVLIDQEYCPWNQCNTQNPSKVKLSKIS  329

Query  1012  YKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKTICSNVKPKLTGKQCP  1182
             +K+I GTS+T   V L CS G PC++VE+G IDL +KG    A ++C NV  K+TGK  P
Sbjct  330   FKNIWGTSSTPLAVNLICSRGYPCQNVEVGNIDLKYKGKDGPAHSVCKNVNVKVTGKMNP  389



>emb|CBI22050.3| unnamed protein product [Vitis vinifera]
Length=414

 Score =   366 bits (939),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 174/368 (47%), Positives = 239/368 (65%), Gaps = 9/368 (2%)
 Frame = +1

Query  76    ILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEG  255
             I+F +  +G           N D+   L+KAW +AC++  AST++IP GT+ + Q+ + G
Sbjct  26    IIFDVTKYG------ARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAG  79

Query  256   PCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEK  435
             PCKAP+   +   + AP D      +  W+   ++D FTLSG G  DGQG          
Sbjct  80    PCKAPINFVVQGTVMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKTVWGTKCLS  139

Query  436   GFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDG  615
                 ++LP NL  NF+TNS+++DIT+ +SK FH+N+LG KNLTF +  + AP  S NTDG
Sbjct  140   SSYCNQLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNVVISAPQESLNTDG  199

Query  616   IHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVK  795
             IHI R  GI + DS I TGDDC+S+GDG E + I  VTCGPGHGISVGSLG+ P E PV 
Sbjct  200   IHIGRSSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVV  259

Query  796   GIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSK  975
             GI V N     T NGVR+KTWP SH G  +++H+  I M +V NPI+IDQEYCP+N+C+ 
Sbjct  260   GISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNL  319

Query  976   QKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKTICS  1146
             + PS++KIS VS+++I+GT++T+  V L CS G PC+DVE+G+I+L + G    A + C 
Sbjct  320   KSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGEPCQDVELGDINLEYNGNEGPAMSQCK  379

Query  1147  NVKPKLTG  1170
             N+KP L G
Sbjct  380   NIKPNLLG  387



>ref|XP_008467043.1| PREDICTED: exopolygalacturonase-like, partial [Cucumis melo]
Length=365

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 186/357 (52%), Positives = 252/357 (71%), Gaps = 11/357 (3%)
 Frame = +1

Query  136   NVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDP  315
             N DV   L  AWKEACA+TT S ++IPKG++ ++Q +L+GPCK+ +EL+I   L+AP DP
Sbjct  1     NADVTAALASAWKEACASTTPSKVLIPKGSYGLSQSNLKGPCKSAIELQIEGTLQAPADP  60

Query  316   KNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTN  489
             K  DG    L++  VD  T+SG G LDGQG    +   +   K +  KLP NL LNF+TN
Sbjct  61    KG-DG---LLLLEYVDQLTVSGTGVLDGQGKAG-WEKNDCHLKKECTKLPMNLKLNFVTN  115

Query  490   SVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGT  669
             S+++DIT+L+SK +H+N+LG KNLTFDH T+ APGNSPNTDGIH++    I + ++ I T
Sbjct  116   SIVKDITSLDSKNYHINLLGCKNLTFDHVTITAPGNSPNTDGIHVSSSEQINILNTNIAT  175

Query  670   GDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRI  849
             GDDCIS+GD  + + I+ VTCGPGHGIS+GSLG+   E+ V G+ V   K   T NGVRI
Sbjct  176   GDDCISVGDTNKQVVISDVTCGPGHGISIGSLGKYSKEKEVVGVTVKKCKLTDTTNGVRI  235

Query  850   KTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIK  1026
             KTWP+S      +D+H+  IEM +V NP++IDQEYCP N+C+++ PSK+KIS VS+K+I+
Sbjct  236   KTWPDSAVAFPASDMHFEDIEMVNVSNPVIIDQEYCPWNQCNRKVPSKIKISNVSFKNIR  295

Query  1027  GTSATKETVILACSSGVPCEDVEIGEIDLTFKGGA---KTICSNVKPKLTGKQCPKV  1188
             GTSAT   V + CS   PCE VE+ +IDLT+ G     K+ C+NVKP ++GKQ P +
Sbjct  296   GTSATPVAVKIVCSQSNPCEGVEVADIDLTYSGSEGPIKSQCANVKPVISGKQNPPI  352



>ref|XP_011099769.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=402

 Score =   365 bits (937),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 180/360 (50%), Positives = 246/360 (68%), Gaps = 6/360 (2%)
 Frame = +1

Query  127   AKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAP  306
             A +  D+   L+KAWKEA  +   S I+IP+GTF ++QV LEGP KAP+EL++   LKA 
Sbjct  35    ANSGADISQALLKAWKEAIVSVVPSKILIPQGTFTVSQVKLEGPNKAPIELEVQGTLKAF  94

Query  307   PDPKNM-DGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNF  480
             PDP  + D K EW+ +  V++FTLSGGG  DGQG +    +   K     KLP NLS NF
Sbjct  95    PDPNQLPDKKAEWITINYVNYFTLSGGGVFDGQGQIAWKMNDCHKNKNCPKLPYNLSFNF  154

Query  481   LTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSV  660
             + NS+I D+TT +SK FH+N +   N+TF HFT+ AP  SPNTDGIH+ R   I + DSV
Sbjct  155   INNSIIHDVTTKDSKNFHLNCISSHNVTFRHFTISAPDESPNTDGIHLGRSTRINIIDSV  214

Query  661   IGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNG  840
             I TGDDC+S+GD  + + I  VTCGPGHGIS+GSLG    E+ V+GI+V N  FIGT NG
Sbjct  215   IRTGDDCVSIGDDTKEVHIENVTCGPGHGISIGSLGGYATEKDVEGIYVKNYTFIGTGNG  274

Query  841   VRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYK  1017
             VR+KTWP +   + +T++++  + M++V NPI+IDQEYCP+N C + +PS +KI+KV+ K
Sbjct  275   VRVKTWPTTPAQLSITNLNFEDLIMDNVSNPIIIDQEYCPHNLCKRDRPSFIKINKVNLK  334

Query  1018  DIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTGKQCPKV  1188
             +I+GT+ ++E V L CS   PCE+V +G+IDL +   +G   T C NV+P   GKQ P +
Sbjct  335   NIRGTTNSEEAVTLLCSKLKPCENVVVGDIDLKYNGNRGPVTTKCVNVQPTFVGKQNPPI  394



>gb|KFK38253.1| hypothetical protein AALP_AA3G089200 [Arabis alpina]
Length=394

 Score =   365 bits (936),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 185/383 (48%), Positives = 258/383 (67%), Gaps = 9/383 (2%)
 Frame = +1

Query  58    YCAFTFIL--FLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFP  231
             Y  F+ IL  FLL+    + +  V++ +  D+   L+KA+K AC + +AS +VIPKG F 
Sbjct  4     YIGFSTILVIFLLSLSANAEVFKVSSSSGSDITQALLKAFKSACQSPSASHVVIPKGEFK  63

Query  232   MTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV  411
             + ++ L GPCKAP+E+ +   +KA  + K+  G++ W++  R++ F L+GGG  DG+GN 
Sbjct  64    LGEIELMGPCKAPIEITLQGTVKADGNTKH--GRERWVVFSRINGFKLNGGGIFDGEGNA  121

Query  412   QVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKA  588
                 +   K F+  KLP ++  +F+T + IRDITTL+SK FH+NVLG KN+TF +  V A
Sbjct  122   AWRVNNCHKTFECKKLPISIRFDFVTEAEIRDITTLDSKNFHINVLGAKNMTFTNVKVIA  181

Query  589   PGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLG  768
             P  SPNTDGIH+ R  G+ + +S I TGDDCIS+GDG++NL + GV CGPGHGISVGSLG
Sbjct  182   PAESPNTDGIHLGRSDGVKILNSRISTGDDCISVGDGMKNLHVEGVVCGPGHGISVGSLG  241

Query  769   RTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIVIDQ  945
             R   E+ V GI V N     TDNG+RIKTWP++      + IH+  I +++V NPI+IDQ
Sbjct  242   RYGHEQDVSGITVVNCTLQETDNGLRIKTWPSAACATTASGIHFENIILKNVSNPILIDQ  301

Query  946   EYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKG  1125
             EYCP N+C+K KPS +K+  + +K+I+GTS  K+ V L CS G PC++VEIG I++ +KG
Sbjct  302   EYCPWNQCNKNKPSTIKLVDIKFKNIRGTSGNKDAVKLLCSKGHPCQNVEIGNINIAYKG  361

Query  1126  G---AKTICSNVKPKLTGKQCPK  1185
                 A   CSNVKPKL G Q PK
Sbjct  362   ADGPATFQCSNVKPKLVGTQNPK  384



>ref|NP_187441.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21194.1|AC013483_18 putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE74610.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=401

 Score =   365 bits (936),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 255/386 (66%), Gaps = 10/386 (3%)
 Frame = +1

Query  55    SYCAFTFILFLLAHFGESA---IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGT  225
             SY   + +LF+++  G SA   + NV      D+   L+KA+  AC A TAS +VI KG 
Sbjct  3     SYLGISAVLFVISLLGFSANAEVFNVGGSPGSDITQALLKAFTSACQAPTASKVVITKGE  62

Query  226   FPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQG  405
             F + ++ + GPCKAPVE+ +   LKA  D K + GK+ W++  R++ F L+GGG  DG+G
Sbjct  63    FKLGEIEMTGPCKAPVEINLQGTLKA--DGKAIQGKERWVVFLRINGFKLNGGGIFDGEG  120

Query  406   NVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTV  582
             N     +   K F+  KLP ++  +F+ N+ IRDI+++++K FH+NVLG KN+TFD+  V
Sbjct  121   NAAWRVNNCHKTFECKKLPISIRFDFVENAEIRDISSIDAKNFHINVLGAKNMTFDNVKV  180

Query  583   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  762
              AP  SPNTDGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  V CGPGHGISVGS
Sbjct  181   IAPAESPNTDGIHLGRSEGVKILNSKIATGDDCISVGDGMKNLHVENVMCGPGHGISVGS  240

Query  763   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIVI  939
             LGR   E+ V GI V N    GTDNG+RIKTWP++      + IH+  I + +V NPI+I
Sbjct  241   LGRYVHEQDVTGITVVNCTLQGTDNGLRIKTWPSAACATTASGIHFENIILNNVSNPILI  300

Query  940   DQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF  1119
             DQEYCP N+C+KQKPS +K+  +S+K+I+GTS  K+ V L CS   PC +VEIG I+L +
Sbjct  301   DQEYCPWNQCNKQKPSTIKLVDISFKNIRGTSGNKDAVKLLCSKAHPCANVEIGNINLEY  360

Query  1120  KGG---AKTICSNVKPKLTGKQCPKV  1188
             KG       +CSNV PKL G Q PK 
Sbjct  361   KGADGPPTFMCSNVSPKLVGTQNPKA  386



>sp|Q6H9K0.1|PGLR2_PLAAC RecName: Full=Exopolygalacturonase; AltName: Full=Pollen allergen 
Pla a 2; AltName: Allergen=Pla a 2; Flags: Precursor, partial 
[Platanus x acerifolia]
 emb|CAE52833.1| polygalacturonase [Platanus x acerifolia]
Length=377

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/369 (48%), Positives = 252/369 (68%), Gaps = 16/369 (4%)
 Frame = +1

Query  118   NVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCK-APVELKIMAI  294
             +  AK   D+   +MKAWK ACA+   ST++IPKG + M +V+++GPCK + +  +I  +
Sbjct  14    DYGAKGAGDISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGPCKGSKIGFQIDGV  73

Query  295   LKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPN----  462
             +KAP DP        W+   R+D  T+SG GTLDGQG  Q   +K      DK PN    
Sbjct  74    VKAPADPSKFK-SDGWVSFYRIDGLTVSGTGTLDGQG--QTAWAKNNC---DKNPNCKHA  127

Query  463   --NLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARII  636
               NL  +FL ++++RDIT+LNSK+FH+NVL  +++TF H TV APG S NTDGIH+    
Sbjct  128   AMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDGIHVGISK  187

Query  637   GITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNS  816
             G+T+ ++ I TGDDCIS+G G +N+ IT V CGPGHGIS+GSLGR   E+ V+GI V   
Sbjct  188   GVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVRGITVKGC  247

Query  817   KFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVK  996
              F GT NGVR+KTWPNS PG  TD+ +  + M +V+NP+++DQEYCP  +CS+Q PS++K
Sbjct  248   TFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCSRQAPSRIK  307

Query  997   ISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKTICSNVKPKLT  1167
             +S +++ +I+GTS  K  V++ACS G+PC +++IGEI+L+++G    A + CSNVKP  +
Sbjct  308   LSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCSNVKPTFS  367

Query  1168  GKQCPKVTC  1194
             GKQ P + C
Sbjct  368   GKQVPAIKC  376



>ref|XP_008229848.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=399

 Score =   364 bits (935),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 189/353 (54%), Positives = 235/353 (67%), Gaps = 9/353 (3%)
 Frame = +1

Query  130   KANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPP  309
             K N D+   L KAW +ACA+T+ ST+V+PKGTF     + +GPCKAP+  ++  IL+AP 
Sbjct  37    KPNSDITQALSKAWTDACASTSPSTLVVPKGTFKFLGTTFKGPCKAPIAFQLQGILQAPV  96

Query  310   DPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNLSLNF  480
             D   +  K  W+    +D  T+SGGGT DGQG +   Q    K K  K   +  NL  NF
Sbjct  97    DGNQLPKKDTWISFDHIDRLTISGGGTFDGQGAIAWKQNDCHKNKNCKSIAI--NLRFNF  154

Query  481   LTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSV  660
             +TNS I  ITT +SK FHVNVLG  N+ F HFTV AP  S NTDGIHI R  GI++ DS 
Sbjct  155   ITNSRIEYITTKDSKNFHVNVLGCTNVAFHHFTVSAPKESINTDGIHIGRSTGISIIDST  214

Query  661   IGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNG  840
             I TGDDCIS+GDG +NL +T VTCGPGHGIS+GSLGR   E PV GI + N     T NG
Sbjct  215   IKTGDDCISIGDGTKNLNVTNVTCGPGHGISIGSLGRYQKEEPVSGITIKNCTLTDTQNG  274

Query  841   VRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYK  1017
             VRIKTWP S   G  +DIH+  I M +V NPI+IDQEYCP N+C+ + PSKVKIS VS+K
Sbjct  275   VRIKTWPASPSAGTASDIHFEDIIMVNVGNPILIDQEYCPWNQCTLKVPSKVKISNVSFK  334

Query  1018  DIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI---CSNVKPKLT  1167
             +IKGTS T   + L CS G+PCE+VE+ +IDL + G    +   C+NVKPK+T
Sbjct  335   NIKGTSTTPLALKLVCSKGLPCENVELSDIDLKYTGNQGPLTSKCTNVKPKIT  387



>ref|XP_008342227.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Malus domestica]
Length=400

 Score =   364 bits (935),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 190/383 (50%), Positives = 256/383 (67%), Gaps = 12/383 (3%)
 Frame = +1

Query  70    TFILFLLAHF--GESAIINV---AAKAN--VDVGPLLMKAWKEACAATTASTIVIPKGTF  228
             TF LFL+A F   ++A I++    AKA+   D    +  AWKEAC + T ST+VI KG +
Sbjct  10    TFFLFLVALFIKAKAADIDIKKFGAKADGKTDDSQAINSAWKEACTSATPSTVVIAKGNY  69

Query  229   PMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGN  408
              +  V  +GPCKAPV L++   L+AP +P+ +  +  W+I   +D  ++SGGGT DGQG+
Sbjct  70    MVGPVKFQGPCKAPVSLRVEGTLQAPAEPEKLKSQDGWVIFQNIDALSVSGGGTFDGQGS  129

Query  409   VQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVK  585
             +    +   K  K + LP +L L  LTN+ I+DIT+ NSKLFH+N+L  KN+T  H T+K
Sbjct  130   IAWSKNDCAKTGKCNSLPISLRLTGLTNAHIQDITSTNSKLFHMNILNCKNVTLQHVTIK  189

Query  586   APGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSL  765
             APG S NTDGIHI R   I +  + I TGDDC+S+GDG + + I  VTCGPGHGIS+GSL
Sbjct  190   APGESLNTDGIHIGRSTNINITGAEIQTGDDCVSIGDGSQQINIEKVTCGPGHGISIGSL  249

Query  766   GRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDV-KNPIVID  942
             GR   E+PV+G+ V N     T NGVR+KTWP S  GV +D+H+  I ME+V  +P++ID
Sbjct  250   GRYHDEQPVRGVTVRNCTIKNTSNGVRVKTWPASPNGVASDLHFEDIIMENVTTSPVLID  309

Query  943   QEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFK  1122
             QEYCPN +C  + PS+VKIS VS+K+I+GTSA    V LACS G+PC++VEI +I+LT  
Sbjct  310   QEYCPNGQCQAKMPSRVKISNVSFKNIRGTSADPVAVKLACSKGIPCQNVEISDINLTCN  369

Query  1123  GGAKT---ICSNVKPKLTGKQCP  1182
             G   T   +CSNV P +TGK  P
Sbjct  370   GKNGTCTSVCSNVNPTVTGKVIP  392



>ref|XP_008455553.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=403

 Score =   364 bits (934),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 193/399 (48%), Positives = 258/399 (65%), Gaps = 21/399 (5%)
 Frame = +1

Query  43    MATISYCAF---TFILFLLAHFGES-----AIINVAAKANV----DVGPLLMKAWKEACA  186
             M+ I Y +    TF++ LL+   ES      I ++    N+    DV   L  AW +ACA
Sbjct  1     MSVIKYSSLLVITFLMALLSFTVESRSHVDVIFHLRKYGNIVSGADVTEALKDAWNDACA  60

Query  187   ATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDH  366
             +   S +VIPKGTF + +   +GPCK+PVE+++   L+AP  P        W+    VD 
Sbjct  61    SLRPSAVVIPKGTFKVREGEFKGPCKSPVEVRVRGTLQAPKHPHG----DSWITFAYVDR  116

Query  367   FTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNV  543
              TLSGGG  DGQG      +   K     +LP +L  NF+TNS++R IT+L+SK FHVN+
Sbjct  117   MTLSGGGVFDGQGKAGWEKNDCHKHISCARLPISLRFNFITNSIVRRITSLDSKNFHVNI  176

Query  544   LGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITG  723
             LG  NLTFD   + AP +SPNTDGIHI R IGI++  S I TGDDCISLGDG + +KIT 
Sbjct  177   LGCNNLTFDGVNIIAPEDSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRVKITN  236

Query  724   VTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYH  900
             VTCGPGHGIS+GSLG+   E PV+G+ V N   + T NGVRIKTWP S   G+ T++H+ 
Sbjct  237   VTCGPGHGISIGSLGKYTNEEPVEGVIVKNCTIMNTTNGVRIKTWPASPVAGIATNMHFL  296

Query  901   KIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVP  1080
              I M +V NPI+IDQEYCP N+C+++ PSK+KI+KVS+K+I+G+SAT   V L CSS +P
Sbjct  297   DITMVNVSNPILIDQEYCPWNQCNRKIPSKIKINKVSFKNIRGSSATPVAVKLICSSNLP  356

Query  1081  CEDVEIGEIDLTF---KGGAKTICSNVKPKLTGKQCPKV  1188
             CE+V++  IDL +   KG   + C NVKP ++G Q P +
Sbjct  357   CEEVKVANIDLVYNGIKGSLTSECMNVKPIISGTQNPPI  395



>emb|CBI28390.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   365 bits (938),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 175/371 (47%), Positives = 249/371 (67%), Gaps = 11/371 (3%)
 Frame = +1

Query  76    ILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEG  255
             I+F +  +G        A  + D+   L+KAW ++C++  AST++IP GT+ + Q+++ G
Sbjct  26    IIFDVTKYG------ARADGHSDISQALLKAWGDSCSSPVASTVMIPNGTYALGQITIGG  79

Query  256   PCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEK  435
             PCKAP+   +   + AP D      +  W+   ++D FTLSGGG  DGQG   V+  K  
Sbjct  80    PCKAPINFVVQGTVMAPVDTSRFKAEAGWIAFQQIDQFTLSGGGVFDGQGKT-VWGRKCP  138

Query  436   GFKGDK-LPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTD  612
              +   K LP NL  NF+TNS+++DIT+ +SK FH+N+LG KNL F +  + AP  S NTD
Sbjct  139   HYAYCKQLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLAFYNVAISAPDESLNTD  198

Query  613   GIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPV  792
             GIHI R  GI + DS I TGDDC+S+GDG E + I  VTCGPGHGISVGSLG+ P E PV
Sbjct  199   GIHIGRSSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPV  258

Query  793   KGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECS  972
              GI V N     T NGVR+KT+P SH G+ +++H+  I M +V NPI+IDQEYCP+N+C+
Sbjct  259   VGISVKNCTLTNTQNGVRVKTFPASHQGIASEMHFEDIVMNNVGNPIIIDQEYCPHNQCN  318

Query  973   KQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTIC  1143
              + PS++K+S VS+++I+GT++T+  V L CS GVPC+DVE+G+I+L +   +G A + C
Sbjct  319   LKSPSRIKLSNVSFRNIRGTTSTQVAVKLLCSQGVPCQDVELGDINLKYNGKEGPAMSQC  378

Query  1144  SNVKPKLTGKQ  1176
              N+KP L G++
Sbjct  379   KNIKPNLLGQE  389



>ref|XP_008459709.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=428

 Score =   364 bits (935),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 185/363 (51%), Positives = 243/363 (67%), Gaps = 11/363 (3%)
 Frame = +1

Query  112   IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMA  291
             +    AK N D+   L  AWKEACA+T+   IVIP GT+ +  + L+G CK+P+E+++  
Sbjct  57    VTKYGAKPNADITQALADAWKEACASTSPCKIVIPTGTYKLGTIELKGECKSPIEIQVQG  116

Query  292   ILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKE--KGFKGDKLPNN  465
              L+APPD    D    W+    +D+ +++ GG  DGQG  Q + S +  K  K  ++P N
Sbjct  117   TLQAPPDLTGED----WVHFKYIDYLSVTSGGVFDGQGK-QAWESNDCDKNPKCARIPMN  171

Query  466   LSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGIT  645
             L  +F+ N+++ DIT+ +SK FH+ VLG  NLTF H  V AP  S NTDGIHI R +GI 
Sbjct  172   LKFSFIKNAIVSDITSKDSKNFHIQVLGCNNLTFQHVNVNAPETSINTDGIHIGRSLGIN  231

Query  646   VKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFI  825
             + ++ IGTGDDCISLGDG + + IT VTCGPGHGISVGSLGR   E PV+G+ V N    
Sbjct  232   ILNTNIGTGDDCISLGDGSKQVTITNVTCGPGHGISVGSLGRYNLEEPVEGLQVKNCTLT  291

Query  826   GTDNGVRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKIS  1002
             GT NG+RIKTWP S   GV +D+HY  + M +V NPI+IDQEYCP N+C+KQ PSKVKIS
Sbjct  292   GTTNGLRIKTWPASPAAGVASDMHYEDVVMNNVMNPILIDQEYCPYNQCNKQVPSKVKIS  351

Query  1003  KVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI---CSNVKPKLTGK  1173
             KVS+K+I+GTS     V L CSS  PC+ VE+ +IDLT+ G    I   C+NVKP ++GK
Sbjct  352   KVSFKNIRGTSGNAAAVTLVCSSSNPCDGVELADIDLTYSGSEGPITSRCANVKPTVSGK  411

Query  1174  QCP  1182
             Q P
Sbjct  412   QNP  414



>gb|ABL63521.1| pollen-specific protein MF9l [Brassica oleracea var. alboglabra]
Length=395

 Score =   363 bits (932),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 181/383 (47%), Positives = 254/383 (66%), Gaps = 8/383 (2%)
 Frame = +1

Query  58    YCAFTFILFLLAHFGESAIINVAAKANV-DVGPLLMKAWKEACAATTASTIVIPKGTFPM  234
             + AFT  +F L  F  +A+      ++  D+   L+KA+  AC + T S +VIPKG F +
Sbjct  5     FGAFTVFIFCLLGFSANAVYISIGSSSGSDITQALLKAFTTACQSPTPSRVVIPKGEFKL  64

Query  235   TQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQ  414
              ++ + GPCKAPVE+ I   +KA  D   + GK  W++ G ++ F L+GGG  DG+GN  
Sbjct  65    GEIQMRGPCKAPVEITIQGTVKA--DGNAIQGKDTWIVFGNINGFKLNGGGAFDGEGNAA  122

Query  415   VYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAP  591
                +   + F   KLP ++  +F+ N+ IRDI+++++K FH+NVLG KN+T DH  + AP
Sbjct  123   WRVNNCHQTFNCKKLPISIRFDFVENAEIRDISSIDAKNFHINVLGAKNMTMDHINIIAP  182

Query  592   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  771
              +SPNTDGIH+ R  G+ + ++ I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR
Sbjct  183   KDSPNTDGIHLGRSDGVKILNTFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGR  242

Query  772   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQE  948
                E+ V GI V N     TDNG+RIKTWP++      +DIH+  I +++V NPI+IDQE
Sbjct  243   YGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIIVKNVMNPILIDQE  302

Query  949   YCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG  1128
             YCP N+C+KQKPS +K++ +S+K I+GTS  K+ V L CS G PC++VEIG+ID+ + G 
Sbjct  303   YCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYNGA  362

Query  1129  ---AKTICSNVKPKLTGKQCPKV  1188
                A   CSNV PKL G Q PK 
Sbjct  363   DGPATFQCSNVSPKLMGTQSPKA  385



>gb|ADP09681.1| polygalacturonase [Cucurbita pepo]
Length=416

 Score =   363 bits (933),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 186/368 (51%), Positives = 247/368 (67%), Gaps = 10/368 (3%)
 Frame = +1

Query  112   IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMA  291
             I    AK N D    L  AWKEACA+ T S +++PKGT+ + +  L+GPCK+P+EL +  
Sbjct  42    ITTFGAKPNADATQALADAWKEACASATPSKVLVPKGTYQLGESRLKGPCKSPIELLVEG  101

Query  292   ILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD--KLPNN  465
              L+A P     DG    L++  +DH TLSG G  DGQG    +   +   K +  KLP N
Sbjct  102   TLQASPTDTEGDG---LLVMEYIDHLTLSGTGVFDGQGKAG-WEKNDCHLKKECKKLPMN  157

Query  466   LSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGIT  645
             L  NF+TNS+++DIT+L+SK FH+NVL GKNLTFDH  + AP NSPNTDGIH+     + 
Sbjct  158   LKFNFITNSIVKDITSLDSKNFHINVLAGKNLTFDHLKITAPHNSPNTDGIHLGDSEDVY  217

Query  646   VKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFI  825
             + ++ I TGDDCIS+G     + I+ VTCGPGHGIS+GSLG+   E+ V G+ V   K I
Sbjct  218   ILNTAIATGDDCISVGYTNRKITISDVTCGPGHGISIGSLGKYKTEKEVVGVTVKKCKLI  277

Query  826   GTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKIS  1002
             GT NGVRIK+WP+S      +D+H+  IEME+V NPI+IDQEYCP N+C+++ PS +KIS
Sbjct  278   GTTNGVRIKSWPDSAVSYPASDMHFEDIEMENVANPIIIDQEYCPWNQCNRKVPSAIKIS  337

Query  1003  KVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTGK  1173
             KVS+K+I+GTS+T   V L CS   PCE VEI +IDLT+   +G A + CSNVKP ++GK
Sbjct  338   KVSFKNIRGTSSTPVAVKLVCSKSNPCEGVEIADIDLTYSGKEGPAVSECSNVKPTISGK  397

Query  1174  QCPKVTCK  1197
             Q P +  K
Sbjct  398   QNPPICAK  405



>emb|CDY07974.1| BnaC03g35490D [Brassica napus]
Length=395

 Score =   363 bits (931),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 181/383 (47%), Positives = 254/383 (66%), Gaps = 8/383 (2%)
 Frame = +1

Query  58    YCAFTFILFLLAHFGESAIINVAAKANV-DVGPLLMKAWKEACAATTASTIVIPKGTFPM  234
             + AFT  +F L  F  +A+      ++  D+   L+KA+  AC + T S +VIPKG F +
Sbjct  5     FGAFTVFIFCLLGFSANAVYISIGSSSGSDITQALVKAFTTACQSPTPSRVVIPKGEFKL  64

Query  235   TQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQ  414
              ++ + GPCKAPVE+ I   +KA  D   + GK  W++ G ++ F L+GGG  DG+GN  
Sbjct  65    GEIQMRGPCKAPVEITIQGTVKA--DGNAIQGKDTWIVFGNINGFKLNGGGAFDGEGNAA  122

Query  415   VYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAP  591
                +   + F   KLP ++  +F+ N+ IRDI+++++K FH+NVLG KN+T DH  + AP
Sbjct  123   WRVNNCHQTFNCKKLPISIRFDFVENAEIRDISSIDAKNFHINVLGAKNMTMDHINIIAP  182

Query  592   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  771
              +SPNTDGIH+ R  G+ + ++ I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR
Sbjct  183   KDSPNTDGIHLGRSDGVKILNTFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGR  242

Query  772   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQE  948
                E+ V GI V N     TDNG+RIKTWP++      +DIH+  I +++V NPI+IDQE
Sbjct  243   YGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIIVKNVMNPILIDQE  302

Query  949   YCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG  1128
             YCP N+C+KQKPS +K++ +S+K I+GTS  K+ V L CS G PC++VEIG+ID+ + G 
Sbjct  303   YCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYNGA  362

Query  1129  ---AKTICSNVKPKLTGKQCPKV  1188
                A   CSNV PKL G Q PK 
Sbjct  363   DGPATFQCSNVSPKLMGTQSPKA  385



>gb|ABG38468.1| pollen-expressed protein MF9c [Brassica oleracea]
Length=395

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 181/383 (47%), Positives = 254/383 (66%), Gaps = 8/383 (2%)
 Frame = +1

Query  58    YCAFTFILFLLAHFGESAIINVAAKANV-DVGPLLMKAWKEACAATTASTIVIPKGTFPM  234
             + AFT  +F L  F  +A+      ++  D+   L+KA+  AC + T S +VIPKG F +
Sbjct  5     FGAFTVFIFCLLGFSANAVYISIGSSSGSDITQALVKAFTTACQSPTPSRVVIPKGEFKL  64

Query  235   TQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQ  414
              ++ + GPCKAPVE+ I   +KA  D   + GK  W++ G ++ F L+GGG  DG+GN  
Sbjct  65    GEIQMRGPCKAPVEITIQGTVKA--DGNAIQGKDTWIVFGNINGFKLNGGGAFDGEGNAA  122

Query  415   VYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAP  591
                +   + F   KLP ++  +F+ N+ IRDI+++++K FH+NVLG KN+T DH  + AP
Sbjct  123   WRVNNCHQTFNCKKLPISVRFDFVENAEIRDISSIDAKNFHINVLGAKNMTMDHINIIAP  182

Query  592   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  771
              +SPNTDGIH+ R  G+ + ++ I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR
Sbjct  183   KDSPNTDGIHLGRSDGVKILNTFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGR  242

Query  772   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQE  948
                E+ V GI V N     TDNG+RIKTWP++      +DIH+  I +++V NPI+IDQE
Sbjct  243   YGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIIVKNVMNPILIDQE  302

Query  949   YCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG  1128
             YCP N+C+KQKPS +K++ +S+K I+GTS  K+ V L CS G PC++VEIG+ID+ + G 
Sbjct  303   YCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSGA  362

Query  1129  ---AKTICSNVKPKLTGKQCPKV  1188
                A   CSNV PKL G Q PK 
Sbjct  363   DGPATFQCSNVSPKLMGTQSPKA  385



>ref|XP_011097019.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=399

 Score =   362 bits (929),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 193/393 (49%), Positives = 258/393 (66%), Gaps = 18/393 (5%)
 Frame = +1

Query  52    ISYCAFTFILFLLAHFGESA------IINVAAKANVDVGPLLMKAWKEACAATTASTIVI  213
             I++    F L LLA    +       I    AK+  D+   LM AWKEAC +T+ STIVI
Sbjct  3     INFITIMFFLPLLAINVNAQGPVTYDITKYGAKSGGDISQALMDAWKEACNSTSPSTIVI  62

Query  214   PKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKK-EWLIVGRVDHFTLSGGGT  390
             P GT+ ++QV L GP KAP+EL++   L+A  +P  +  K+ EW+ +  V++FTLSGGG 
Sbjct  63    PGGTWSLSQVKLLGPNKAPIELQVQGTLQA--NPGQLPNKEGEWITINYVNYFTLSGGGV  120

Query  391   LDGQGNVQVYPSKE--KGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLT  564
              DG+G  + +   +  K     KLP NLS NF+ NS+IRD+TT +SK FHVN +   N+T
Sbjct  121   FDGRGQ-EAWKQNDCHKNKNCAKLPMNLSFNFVNNSIIRDVTTKDSKNFHVNCISSHNVT  179

Query  565   FDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGH  744
             F  FTV APG+SPNTDGIH+ R   I +KDS+I TGDDC+S+GD  + + I  VTCGPGH
Sbjct  180   FLRFTVSAPGDSPNTDGIHLGRDTMINIKDSIIKTGDDCVSIGDESKEIHIQNVTCGPGH  239

Query  745   GISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--DIHYHKIEMED  918
             GISVGSLG    E+ V+GI+V+N  FIGT NGVR+KTWP S P  +T  D+H+  + M++
Sbjct  240   GISVGSLGGYAEEKDVQGIYVTNCTFIGTTNGVRVKTWP-SAPATLTVSDLHFEDLIMDN  298

Query  919   VKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEI  1098
             V +PI+IDQEYCP+N C K +PS +KI+ V  ++++GT+ T E V   CS   PCE   +
Sbjct  299   VSSPIIIDQEYCPHNLCKKDRPSSIKITNVRERNVRGTTNTAEAVTFICSGLKPCERGGV  358

Query  1099  GEIDLTFKGGA---KTICSNVKPKLTGKQCPKV  1188
             G+IDLT+ G      T C+NVKPK  GKQ P V
Sbjct  359   GDIDLTYNGNQGPITTKCANVKPKFVGKQNPPV  391



>ref|XP_010038563.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=395

 Score =   361 bits (927),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 189/384 (49%), Positives = 252/384 (66%), Gaps = 14/384 (4%)
 Frame = +1

Query  70    TFILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSL  249
             +F   ++A   +    NV      D+   L+ AWK+ACA+TT   ++IP GTF +++V L
Sbjct  15    SFSSTIIAQVFQIENYNVTGGGIPDITQSLLDAWKKACASTTRPKVLIPGGTFTLSEVVL  74

Query  250   EGPCKAPVELKIMAILKAPPDPKNM--DGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYP  423
             EGPCKA VE ++ A L APP+      DG   W++   +D  T+ GG T DGQG +    
Sbjct  75    EGPCKAHVEFEVHARLLAPPELSRFKTDG---WVVFHNIDGLTMLGG-TFDGQGKMAWAQ  130

Query  424   S---KEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPG  594
             +   K K  +   LP NL  N ++N++I D+T+++SK FHV VLG KN+TF HF V APG
Sbjct  131   NDCIKNKNCR--MLPMNLRFNVVSNAIIHDVTSVDSKYFHVTVLGCKNVTFQHFHVNAPG  188

Query  595   NSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRT  774
             NS NTDGIHI R +G+ + D+ I TGDDC+SLGDG   + + G+TCGPGHGISVGSLG+ 
Sbjct  189   NSVNTDGIHIGRSLGVNILDTDIKTGDDCVSLGDGSRQVTVKGLTCGPGHGISVGSLGKY  248

Query  775   PGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYC  954
               E PV G+FV+N    G  NGVRIKTWP S  G+ TD+H+  I+M +V NP++IDQ YC
Sbjct  249   DNEEPVSGVFVTNCTINGATNGVRIKTWPASKIGIATDMHFEDIQMNNVFNPVLIDQGYC  308

Query  955   PNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFK---G  1125
             P N+C  Q PS VKIS VS+K I+GTSATK  V +ACS  +PCE VEI +I+L +K   G
Sbjct  309   PWNQCQAQIPSLVKISNVSFKRIRGTSATKVAVKIACSKRIPCEGVEIADINLVYKGPDG  368

Query  1126  GAKTICSNVKPKLTGKQCPKVTCK  1197
              A + CSNV+P ++G Q P+   K
Sbjct  369   PATSECSNVRPLISGMQNPRACAK  392



>ref|XP_008441641.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=404

 Score =   362 bits (928),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 188/371 (51%), Positives = 257/371 (69%), Gaps = 23/371 (6%)
 Frame = +1

Query  112   IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMA  291
             + +  AK + D+   L+ AWKE CA+ T S ++IPKG++ ++Q +L+GPCK+ +EL+I  
Sbjct  32    VTSFGAKPDADITGALVSAWKEGCASITPSKVLIPKGSYGLSQSNLKGPCKSSIELQIEG  91

Query  292   ILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD-------  450
              L+AP DPK  DG    LI+  VD  T+SG G LDGQG       KE   K D       
Sbjct  92    TLQAPSDPKG-DG---LLILEYVDRLTVSGMGVLDGQG-------KEGWEKNDCHLKKIC  140

Query  451   -KLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIA  627
              KLP NL LNF+TNS+++DIT+L+SK +H+N+LG KNLTFDH T+ APG+SPNTDGIH++
Sbjct  141   TKLPMNLKLNFITNSIVKDITSLDSKNYHINLLGCKNLTFDHVTITAPGDSPNTDGIHVS  200

Query  628   RIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFV  807
                 I + ++ I TGDDCIS+GD  + + I+ VTCGPGHGIS+GSLG+   E+ V G+ V
Sbjct  201   SSEEINILNTNIATGDDCISVGDTNKQIVISDVTCGPGHGISIGSLGKYSKEKEVVGVTV  260

Query  808   SNSKFIGTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKP  984
                K   T NGVRIKTWP+S      +D+H+  IEM +V NP++IDQEYCP N+C+++ P
Sbjct  261   KKCKLTSTTNGVRIKTWPDSVGTFPASDMHFEDIEMVNVSNPVIIDQEYCPWNQCNRKVP  320

Query  985   SKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGA---KTICSNVK  1155
             SK+KISKVS+K+I+GTSAT   V + CS   PCE+VE+ +IDLT+ G     K+ C+NVK
Sbjct  321   SKIKISKVSFKNIRGTSATPVAVKIVCSKSNPCEEVEVADIDLTYSGSEGPIKSQCANVK  380

Query  1156  PKLTGKQCPKV  1188
             P ++GKQ P +
Sbjct  381   PVISGKQNPPI  391



>emb|CAA05892.1| polygalacturonase [Arabidopsis thaliana]
 emb|CAA06610.1| polygalacturonase [Arabidopsis thaliana]
Length=391

 Score =   361 bits (926),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 177/377 (47%), Positives = 254/377 (67%), Gaps = 7/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
             FI+ LL     + +  + + +  D+   L+KA+  AC +++ S +VIPKG F + ++ + 
Sbjct  11    FIICLLGISANAEVFTIGSSSGSDITQALLKAFTSACQSSSPSKVVIPKGEFKLGEIEMR  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCKAP+E+ +   +KA  D   + GK++W++ G +D F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIEVTLQGTVKA--DGNAIQGKEKWVVFGNIDGFKLNGGGAFDGEGNAAWRVNNC  128

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F+  KLP ++  +F+ NS IRDI+++++K FH+NVLG KN+T ++  + AP +SPNT
Sbjct  129   HKTFECKKLPISIRFDFILNSEIRDISSIDAKNFHINVLGAKNMTMNNIKIVAPEDSPNT  188

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  GI + +S I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRSDGIKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGHEQD  248

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V GI V N     TDNG+RIKTWP++      +DIH+  I ++DV NPI+IDQEYCP N+
Sbjct  249   VSGIKVINCTLQETDNGLRIKTWPSAACSTTASDIHFEDIILKDVSNPILIDQEYCPWNQ  308

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKT  1137
             C+KQK S +K+  +S+K+I+GTS  K+ V L CS G PC++VEIG+ID+ + G    A  
Sbjct  309   CNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIKYNGADGPATF  368

Query  1138  ICSNVKPKLTGKQCPKV  1188
              CSNV PK+ G Q PK 
Sbjct  369   HCSNVSPKILGSQSPKA  385



>ref|XP_008460220.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=393

 Score =   361 bits (926),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 184/364 (51%), Positives = 253/364 (70%), Gaps = 9/364 (2%)
 Frame = +1

Query  112   IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMA  291
             +    AK N D+   L+ AWK ACA+T+ S ++IPKG + ++Q +L+GPCK+ +E+++  
Sbjct  32    VTRYGAKPNTDITHALLNAWKGACASTSRSKVLIPKGVYLLSQSNLKGPCKSSIEIQVDG  91

Query  292   ILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNL  468
              L+APPDPK  DG    +I+  +D  TLSG G  DGQG V    +   K     KLP  L
Sbjct  92    TLQAPPDPKG-DG---LVILEYIDKLTLSGTGVFDGQGKVGWEKNDCHKKKICTKLPMTL  147

Query  469   SLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITV  648
               NF+TNS++RDIT+L+SK FH+N+LG KNLTF H T+ AP +SPNTDGIHI+    IT+
Sbjct  148   KFNFVTNSIVRDITSLDSKNFHINILGCKNLTFQHVTISAPEDSPNTDGIHISSSEQITI  207

Query  649   KDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIG  828
              ++ I TGDDC+S+GD  + + I  VTCGPGHGIS+GSLG+   E+ V+G++V+  K   
Sbjct  208   LNTKISTGDDCVSVGDSNKQITIRDVTCGPGHGISIGSLGKYSKEKAVEGVWVTKCKLTS  267

Query  829   TDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISK  1005
             T NGVRIKTWP+S      +D+H+  IEM +V NPI+IDQEYCP N+C+ + PS +KISK
Sbjct  268   TTNGVRIKTWPDSAGEYSASDMHFEDIEMNNVSNPIIIDQEYCPWNQCNPKIPSSIKISK  327

Query  1006  VSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTGKQ  1176
             VS+K+I+GTSAT   V L CS  +PCE VE+ +IDL +   KG  K+ C+NVKP ++GKQ
Sbjct  328   VSFKNIRGTSATPVAVKLVCSKKIPCEAVEVVDIDLKYNGNKGPIKSQCANVKPIISGKQ  387

Query  1177  CPKV  1188
              P++
Sbjct  388   NPRI  391



>ref|XP_008245681.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Prunus mume]
Length=402

 Score =   361 bits (927),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 188/388 (48%), Positives = 253/388 (65%), Gaps = 12/388 (3%)
 Frame = +1

Query  70    TFILFLL-----AHFGESAIINVAAKAN--VDVGPLLMKAWKEACAATTASTIVIPKGTF  228
             TF LFL+     A   +  I    AKA+   D    + +AWKEACA+TT ST++I KG +
Sbjct  10    TFFLFLISFSIKARAADFDIKKYGAKADGKTDDSQAINRAWKEACASTTPSTVLIAKGNY  69

Query  229   PMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGN  408
                 V  +GPCKAPV +++   L+AP +P+ +  +  W++   +D  T+SGGGT DGQG+
Sbjct  70    MAGPVKFQGPCKAPVSIRVEGTLQAPAEPEKLKSQDGWVVFRNIDGLTVSGGGTFDGQGS  129

Query  409   VQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVK  585
             +    +   K  K + LP N+  + LTNS I++IT+ NSKLFH+NVL  KN+T  H  + 
Sbjct  130   IAWSKNDCAKTGKCNSLPINIRFSGLTNSHIQNITSSNSKLFHINVLNCKNVTLQHVIIT  189

Query  586   APGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSL  765
             APG S NTDGIHI R   I +  + I TGDDCISLGDG + + I  V CGPGHGIS+GSL
Sbjct  190   APGESLNTDGIHIGRSSNINITGAEIKTGDDCISLGDGSQQINIEKVKCGPGHGISIGSL  249

Query  766   GRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVK-NPIVID  942
             GR   E+PV G+ V N     T NGVR+KTWP S  GV +D+H+  I ME+VK +P++ID
Sbjct  250   GRYHDEQPVTGVTVRNCTISNTSNGVRVKTWPASPNGVASDLHFEDIIMENVKTSPVLID  309

Query  943   QEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF-  1119
             QEYCPN +C  + PSKVKIS VS+K+I+GTSA    V LACS G+PC++V+I +I LT+ 
Sbjct  310   QEYCPNGQCQAKIPSKVKISNVSFKNIRGTSADPVVVKLACSKGIPCQNVQISDIHLTYN  369

Query  1120  --KGGAKTICSNVKPKLTGKQCPKVTCK  1197
                G A ++C+NVKP +TG+  P    K
Sbjct  370   GKNGAATSVCTNVKPTMTGQIFPPACAK  397



>ref|NP_187439.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21192.1|AC013483_16 polygalacturonase (PGA3) [Arabidopsis thaliana]
 gb|AAL38715.1| putative polygalacturonase(PGA3 [Arabidopsis thaliana]
 gb|AAM20184.1| putative polygalacturonase (PGA3) [Arabidopsis thaliana]
 gb|AAM65120.1| polygalacturonase PGA3 [Arabidopsis thaliana]
 gb|AEE74608.1| polygalacturonase [Arabidopsis thaliana]
Length=391

 Score =   360 bits (925),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 176/377 (47%), Positives = 254/377 (67%), Gaps = 7/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
             FI+ LL     + +  + + +  D+   L+KA+  AC +++ S +VIPKG F + ++ + 
Sbjct  11    FIICLLGISANAEVFTIGSSSGSDITQALLKAFTSACQSSSPSKVVIPKGEFKLGEIEMR  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCKAP+E+ +   +KA  D   + GK++W++ G +D F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIEVTLQGTVKA--DGNAIQGKEKWVVFGNIDGFKLNGGGAFDGEGNAAWRVNNC  128

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F+  KLP ++  +F+ NS IRDI+++++K FH+NVLG KN+T ++  + AP +SPNT
Sbjct  129   HKTFECKKLPISIRFDFILNSEIRDISSIDAKNFHINVLGAKNMTMNNIKIVAPEDSPNT  188

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGHEQD  248

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V GI V N     TDNG+RIKTWP++      +DIH+  I ++DV NPI+IDQEYCP N+
Sbjct  249   VSGIKVINCTLQETDNGLRIKTWPSAACSTTASDIHFEDIILKDVSNPILIDQEYCPWNQ  308

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKT  1137
             C+KQK S +K+  +S+K+I+GTS  K+ V L CS G PC++VEIG+ID+ + G    A  
Sbjct  309   CNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIKYNGADGPATF  368

Query  1138  ICSNVKPKLTGKQCPKV  1188
              CSNV PK+ G Q PK 
Sbjct  369   HCSNVSPKILGSQSPKA  385



>ref|XP_004140444.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
 ref|XP_004157869.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=401

 Score =   361 bits (926),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 180/364 (49%), Positives = 253/364 (70%), Gaps = 9/364 (2%)
 Frame = +1

Query  112   IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMA  291
             +    AK N D+   L+ AWK ACA+T+ S ++IPKG + ++Q +L+GPCK+ +E+++  
Sbjct  29    VTRYGAKPNTDITHALLNAWKGACASTSRSKVLIPKGIYLLSQSNLKGPCKSSIEIQVQG  88

Query  292   ILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNL  468
              L+APPDPK  DG    +I+  +D  TLSG G  DGQG      +   K     KLP  L
Sbjct  89    TLQAPPDPKG-DG---LVILEYIDQLTLSGTGVFDGQGKAGWEKNDCHKKKICTKLPMTL  144

Query  469   SLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITV  648
               NF+TNS+++DIT+L+SK FH+N+LG KN+TF+H T+ AP NSPNTDGIHI+    I +
Sbjct  145   KFNFVTNSIVKDITSLDSKNFHINLLGCKNITFEHVTISAPENSPNTDGIHISSSEQIRI  204

Query  649   KDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIG  828
              ++ I TGDDC+S+GD  +++ I  VTCGPGHGIS+GSLG+   E+ V+G++V+  K I 
Sbjct  205   LNTKISTGDDCVSVGDSNKDITIRDVTCGPGHGISIGSLGKYTKEKAVEGVWVTKCKLIK  264

Query  829   TDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISK  1005
             T NGVRIKTWP+S      +D+H+  IEM DV NPI+IDQEYCP N+C+++ PS +KISK
Sbjct  265   TTNGVRIKTWPDSAVKYSASDMHFEDIEMIDVSNPILIDQEYCPWNQCNRKIPSSIKISK  324

Query  1006  VSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI---CSNVKPKLTGKQ  1176
             VS+K+I+GT+ T   V L CS  +PCE VE+ +IDL + G   +I   C+NVKP ++GKQ
Sbjct  325   VSFKNIRGTTVTPVAVKLVCSKSIPCEAVEVADIDLKYNGNKGSITSQCANVKPIISGKQ  384

Query  1177  CPKV  1188
              P++
Sbjct  385   NPRI  388



>ref|XP_006407791.1| hypothetical protein EUTSA_v10020866mg [Eutrema salsugineum]
 gb|ESQ49244.1| hypothetical protein EUTSA_v10020866mg [Eutrema salsugineum]
Length=398

 Score =   360 bits (925),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 177/377 (47%), Positives = 252/377 (67%), Gaps = 8/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
              +L LL +   + +  V      D+   L+KA+  AC A   S ++IPKG + + ++++ 
Sbjct  11    LVLCLLGYSANAEVFRVPGAPGSDITQALLKAFTSACQAPAPSQVLIPKGEYKLGEIAMT  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCK+PVE+ +   +KA     NM GK+ W++  +++ F L+GGG  DG+GN     +  
Sbjct  71    GPCKSPVEITLQGTVKAD---GNMQGKERWVVFEKINGFKLNGGGIFDGEGNAAWRTNNC  127

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F+  KLP +L  +F+ N+ IRDIT+++SK FH+NV+ GKN+TFD+  + AP  SPNT
Sbjct  128   HKTFECKKLPISLRFDFVDNADIRDITSMDSKNFHINVISGKNMTFDNIKISAPAESPNT  187

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  V CGPGHGISVGSLGR   E  
Sbjct  188   DGIHLGRCDGVKILNSKIATGDDCISVGDGMKNLLVEKVVCGPGHGISVGSLGRYGFEED  247

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V G+ V N   +GTDNG+RIKTWP++      + IH+  I +++V NPI+IDQEYCP N+
Sbjct  248   VAGVRVVNCTLVGTDNGLRIKTWPSAKCTTTASGIHFEDIILQNVSNPILIDQEYCPWNQ  307

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKG--GAKTI  1140
             C+KQKPS +K+  +S++ I+GTS  K+ V L CS G+PCE+VEIG+I++ +KG  G  T 
Sbjct  308   CNKQKPSTIKLVDISFRKIRGTSGNKDAVKLLCSKGIPCENVEIGDINIEYKGADGPPTF  367

Query  1141  -CSNVKPKLTGKQCPKV  1188
              CSNV PKL G Q PK 
Sbjct  368   QCSNVNPKLVGTQVPKA  384



>gb|KCW46859.1| hypothetical protein EUGRSUZ_K00664 [Eucalyptus grandis]
Length=392

 Score =   360 bits (925),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 188/380 (49%), Positives = 251/380 (66%), Gaps = 14/380 (4%)
 Frame = +1

Query  70    TFILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSL  249
             +F   ++A   +    NV      D+   L+ AWK+ACA+TT   ++IP GTF +++V L
Sbjct  15    SFSSTIIAQVFQIENYNVTGGGIPDITQSLLDAWKKACASTTRPKVLIPGGTFTLSEVVL  74

Query  250   EGPCKAPVELKIMAILKAPPDPKNM--DGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYP  423
             EGPCKA VE ++ A L APP+      DG   W++   +D  T+ GG T DGQG +    
Sbjct  75    EGPCKAHVEFEVHARLLAPPELSRFKTDG---WVVFHNIDGLTMLGG-TFDGQGKMAWAQ  130

Query  424   S---KEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPG  594
             +   K K  +   LP NL  N ++N++I D+T+++SK FHV VLG KN+TF HF V APG
Sbjct  131   NDCIKNKNCR--MLPMNLRFNVVSNAIIHDVTSVDSKYFHVTVLGCKNVTFQHFHVNAPG  188

Query  595   NSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRT  774
             NS NTDGIHI R +G+ + D+ I TGDDC+SLGDG   + + G+TCGPGHGISVGSLG+ 
Sbjct  189   NSVNTDGIHIGRSLGVNILDTDIKTGDDCVSLGDGSRQVTVKGLTCGPGHGISVGSLGKY  248

Query  775   PGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYC  954
               E PV G+FV+N    G  NGVRIKTWP S  G+ TD+H+  I+M +V NP++IDQ YC
Sbjct  249   DNEEPVSGVFVTNCTINGATNGVRIKTWPASKIGIATDMHFEDIQMNNVFNPVLIDQGYC  308

Query  955   PNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFK---G  1125
             P N+C  Q PS VKIS VS+K I+GTSATK  V +ACS  +PCE VEI +I+L +K   G
Sbjct  309   PWNQCQAQIPSLVKISNVSFKRIRGTSATKVAVKIACSKRIPCEGVEIADINLVYKGPDG  368

Query  1126  GAKTICSNVKPKLTGKQCPK  1185
              A + CSNV+P ++G Q P+
Sbjct  369   PATSECSNVRPLISGMQNPR  388



>sp|P24548.1|PGLR_OENOR RecName: Full=Exopolygalacturonase; Short=ExoPG; AltName: Full=Galacturan 
1,4-alpha-galacturonidase; AltName: Full=Pectinase, 
partial [Oenothera organensis]
 gb|AAB23476.1| polygalacturonase homolog {clone P22} [Oenothera organensis]
Length=362

 Score =   359 bits (921),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 181/354 (51%), Positives = 237/354 (67%), Gaps = 6/354 (2%)
 Frame = +1

Query  142   DVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKN  321
             D    L  AWKEACA+ + STI++PKG F +  ++LEGPCK+ + L++   LKAP DP  
Sbjct  1     DSTQALTTAWKEACASASPSTILVPKGNFAVGLITLEGPCKSSIGLQLQGTLKAPADPSK  60

Query  322   MDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPS--KEKGFKGDKLPNNLSLNFLTNSV  495
             + G   W+ + ++D  T+ GGG  DGQG      +   + G     L  NL L  +TNS+
Sbjct  61    IKGLG-WINLNKIDLLTIFGGGVFDGQGKSAWVQNDCHKNGPICKTLSMNLRLYAVTNSI  119

Query  496   IRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGD  675
             +RD+TTL+SK FHVNV+G KNLTF+ F + A   S NTDGIHI R  G+ + ++ I TGD
Sbjct  120   LRDVTTLDSKNFHVNVIGCKNLTFERFKISAAETSINTDGIHIGRSDGVNIINTEIKTGD  179

Query  676   DCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKT  855
             DCISLGDG +N+ IT +TCGPGHGISVGSLGR   E  V GI+V N    G+ NGVRIKT
Sbjct  180   DCISLGDGSKNINITNITCGPGHGISVGSLGRYKNEESVVGIYVKNCTITGSQNGVRIKT  239

Query  856   WPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTS  1035
             WP S PG  +++H+  I M  V  PI+IDQ YCP N+C+ + PS VK+SK+S+K+IKGTS
Sbjct  240   WPKSEPGEASEMHFQDITMNSVGTPILIDQGYCPYNQCTAEVPSSVKLSKISFKNIKGTS  299

Query  1036  ATKETVILACSSGVPCEDVEIGEIDLTF--KGG-AKTICSNVKPKLTGKQCPKV  1188
              TKE V L CS   PC  VE+ +IDLT+  KGG A ++C N+KP + GKQ P +
Sbjct  300   TTKEAVKLVCSKSFPCNGVELADIDLTYSGKGGPATSVCENIKPTIKGKQIPAI  353



>ref|XP_010112809.1| hypothetical protein L484_020041 [Morus notabilis]
 gb|EXC34924.1| hypothetical protein L484_020041 [Morus notabilis]
Length=399

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 180/354 (51%), Positives = 236/354 (67%), Gaps = 11/354 (3%)
 Frame = +1

Query  142   DVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKN  321
             D+   L+KAW  ACA+T  S +V+PKG F ++  +LEGPC AP+E  +  IL+APP+  N
Sbjct  42    DITDALLKAWNNACASTIPSKVVVPKGIFKLSGATLEGPCNAPIEFDLQGILQAPPEDGN  101

Query  322   MDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDK----LPNNLSLNFLTN  489
               G   W+    VD  T+SGGG  DGQG     P+  K    D+    LP N+  N++TN
Sbjct  102   FTGGDTWVAFEYVDLLTISGGGIFDGQGK----PTWGKDCANDEYCGDLPINIRFNYVTN  157

Query  490   SVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGT  669
             S+I++IT+L+SK FH+NVLG +N+TF H  + A  NSP+TDGIHI R   I V DS I T
Sbjct  158   SIIQEITSLDSKQFHINVLGCQNVTFQHVKIIAAENSPHTDGIHIGRSTDIKVLDSNIQT  217

Query  670   GDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRI  849
             GDDCISLGDG + + I  VTCGPGHGIS+GSLG+   E  VKG+ V +     T NGVRI
Sbjct  218   GDDCISLGDGSKQITIAKVTCGPGHGISIGSLGKYLNEEAVKGVDVKSCTLKNTQNGVRI  277

Query  850   KTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKG  1029
             KTWP+S  G  +D+H+  I ME+V NP++IDQEYCP N+C  Q PS+V+IS V +K+I+G
Sbjct  278   KTWPDSQEGKASDLHFEDIIMENVGNPVMIDQEYCPWNQCVSQLPSRVQISGVRFKNIRG  337

Query  1030  TSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI---CSNVKPKLTGKQCP  1182
             TS+T   V L CS G+PC+DVE+ +IDL + G    I   C NVKP ++G Q P
Sbjct  338   TSSTALAVKLVCSGGLPCQDVEMTDIDLKYSGDEGQITSECKNVKPTVSGIQNP  391



>ref|XP_009334235.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=399

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 186/378 (49%), Positives = 244/378 (65%), Gaps = 10/378 (3%)
 Frame = +1

Query  64    AFTFILFLLAHFGESAIINVA-----AKANVDVGPLLMKAWKEACAATTASTIVIPKGTF  228
             AF F+L       E  + +V      AK   D+   L KAW +ACA+ T S +V+P GT+
Sbjct  10    AFLFLLSASKTQAEPGVFDVTSATYGAKPGSDITQALAKAWTDACASPTPSKVVVPSGTY  69

Query  229   PMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGN  408
              +T+ S +GPCKAP+E+++   L AP D   +     W+    V+  T+SGGGT DGQG 
Sbjct  70    MLTEASFKGPCKAPIEIQVQGKLTAPADGGKLTKPDTWVCFEHVNKLTVSGGGTFDGQGA  129

Query  409   VQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVK  585
             +    +   K      +  N+  +F+TNS I+DIT+L+SK FHVNVLG  N+TF    V 
Sbjct  130   LAWKKNDCNKNKDCKSMAINMRFDFVTNSTIQDITSLDSKNFHVNVLGCHNVTFQRVNVT  189

Query  586   APGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSL  765
             APG S NTDGIHI R  GI + D+ IGTGDDC+S+GDG + + +T VTCGPGHGISVGSL
Sbjct  190   APGESINTDGIHIGRSTGINITDAHIGTGDDCVSIGDGNKEITVTRVTCGPGHGISVGSL  249

Query  766   GRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVID  942
             GR P E PV GI V N     T NGVRIKTWP S   G+ +D+H+  I M +V NP++ID
Sbjct  250   GRYPNEEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVLID  309

Query  943   QEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF-  1119
             Q+YCP N+C +  PSK+KIS VS+K+IKG+SAT   V + CSSG+ CE VE+ +IDLT+ 
Sbjct  310   QQYCPWNQCKQNVPSKIKISNVSFKNIKGSSATPLAVQIVCSSGIACEKVELDDIDLTYN  369

Query  1120  --KGGAKTICSNVKPKLT  1167
               KG   + CSNVKP +T
Sbjct  370   GNKGPLTSQCSNVKPTIT  387



>ref|XP_009365183.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=401

 Score =   359 bits (922),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 186/379 (49%), Positives = 242/379 (64%), Gaps = 15/379 (4%)
 Frame = +1

Query  67    FTFILFLLAHFGESAII-----NVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFP  231
             F ++L       +S +      N   KAN D+   L KAW +ACA+T+AS IV+P GT+ 
Sbjct  12    FVYLLLASTSNAQSGVYDVTGANYGGKANSDITQALSKAWTDACASTSASKIVVPSGTYK  71

Query  232   MTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV  411
                 + +GPCKAP+E ++   ++AP   K +  +  W+   R+D  TLSGGG  DGQG  
Sbjct  72    FVGATFKGPCKAPIEFQLQGTVQAPEHIKELPKEDTWVAFERIDGLTLSGGGIFDGQGTT  131

Query  412   ---QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTV  582
                Q    K K  K   +  NL  NF+TNS++R+ITT +SK FHVN+LG  NL F HFTV
Sbjct  132   AWKQNDCHKNKNCKSKAV--NLRFNFVTNSIVREITTKDSKNFHVNLLGCNNLAFQHFTV  189

Query  583   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  762
              AP  S NTDGIH+ R   I + D+ IGTGDDCIS+G G + L +T VTCGPGHGIS+GS
Sbjct  190   SAPKESVNTDGIHMGRSTEINITDTTIGTGDDCISIGHGTKQLHVTNVTCGPGHGISIGS  249

Query  763   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS--HPGVVTDIHYHKIEMEDVKNPIV  936
             LGRT  E PV GIF+ N     TDNGVRIKTWP S      V+D+H+  I M++VKNP+V
Sbjct  250   LGRTEDEEPVSGIFIKNCTISNTDNGVRIKTWPASPAKGTAVSDVHFEDIIMDNVKNPVV  309

Query  937   IDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLT  1116
             IDQEYCP+  C+ +  SKVKIS VS+K+IKG+S+    V L CS  +PCE+VE+  IDLT
Sbjct  310   IDQEYCPHKLCTPEVSSKVKISNVSFKNIKGSSSGPVGVKLLCSGKLPCENVELSNIDLT  369

Query  1117  F---KGGAKTICSNVKPKL  1164
             +   KG   + C +VKP +
Sbjct  370   YTGDKGSLTSECKHVKPTI  388



>ref|XP_008349086.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score =   358 bits (919),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 188/380 (49%), Positives = 245/380 (64%), Gaps = 14/380 (4%)
 Frame = +1

Query  64    AFTFILFLLAHFGESAIINV-----AAKANVDVGPLLMKAWKEACAATTASTIVIPKGTF  228
             AF F+L       E  + +V      AK   D+   L KAW +ACA+   S +V+P GT+
Sbjct  10    AFLFLLSASKTQAEPGVFDVTSATYGAKPGSDITHALAKAWIDACASPAPSKVVVPSGTY  69

Query  229   PMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGN  408
              +T+ S +GPCKAP+E+++   L AP D   +     W+    V+  T+SGGG  DGQG 
Sbjct  70    MLTEASFKGPCKAPIEIQVQGKLTAPADGGKLTRPDTWVGFDHVNKLTVSGGGXFDGQGA  129

Query  409   VQVYPS---KEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFT  579
             +    +   K K  K   +  N+  NF+TNS I+DIT+L+SK FHVNVLG  N+TF    
Sbjct  130   LAWKKNDCNKNKDCKSIAI--NMRFNFVTNSTIQDITSLDSKNFHVNVLGCHNVTFQRVN  187

Query  580   VKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVG  759
             V APG S NTDGIHI R  GI + D+ IGTGDDC+S+GDG + + +T VTCGPGHGISVG
Sbjct  188   VTAPGESINTDGIHIGRSTGINITDAHIGTGDDCVSIGDGNKEITVTRVTCGPGHGISVG  247

Query  760   SLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIV  936
             SLGR P E PV GI V N     T NGVRIKTWP S   G+ +D+H+  I M +V NP++
Sbjct  248   SLGRYPNEEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVL  307

Query  937   IDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLT  1116
             IDQ+YCP N+C +  PSKVKIS VS+K+IKG+SAT   V + CS G+PCE+VE+ +IDLT
Sbjct  308   IDQQYCPWNQCKQNVPSKVKISNVSFKNIKGSSATPLAVQIVCSGGIPCENVELADIDLT  367

Query  1117  F---KGGAKTICSNVKPKLT  1167
             +   KG   + CSNVKP +T
Sbjct  368   YNGNKGPLTSQCSNVKPTIT  387



>ref|XP_003633345.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28394.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   358 bits (918),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 176/359 (49%), Positives = 233/359 (65%), Gaps = 4/359 (1%)
 Frame = +1

Query  127   AKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAP  306
             A    D+   L+ AW+ ACA+  AS +VIP G + + QV++EGPCKAP+ L +   ++AP
Sbjct  35    ADGKTDISQALLTAWEAACASPIASRVVIPAGIYALGQVTIEGPCKAPINLIVKGTVRAP  94

Query  307   PDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLT  486
              D      +  W+    +D FTLSG G  DGQG         +     +LP NL  NFLT
Sbjct  95    VDTSRFKPQAGWVAFQHLDQFTLSGYGVFDGQGQSVWRQKCSRTKYCHQLPINLRFNFLT  154

Query  487   NSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIG  666
             NS+I+DIT+ +SK FH+NVL  +N+TF    + AP +S NTDGIHI R  G+ +  S I 
Sbjct  155   NSIIKDITSKDSKQFHINVLRCRNITFFQVAITAPEDSQNTDGIHIGRSRGVNITHSTIQ  214

Query  667   TGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVR  846
             TGDDC+S+GDG E + IT V CGPGHGISVGSLG    E PV GI V N     T NGVR
Sbjct  215   TGDDCVSIGDGSEQIDITKVNCGPGHGISVGSLGLYKNEAPVIGIRVKNCTLSDTTNGVR  274

Query  847   IKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIK  1026
             +KTWP+S  G  T++H+H I M +V NPI+IDQEYCP+N+C+ Q PS+VK+S +S+K+I+
Sbjct  275   VKTWPSSPQGTATEMHFHDIVMNNVSNPIIIDQEYCPHNQCNLQIPSRVKLSNISFKNIR  334

Query  1027  GTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTGKQCPKVTC  1194
             GT++T+  V L CS G PC+ VE+G IDL +   +G A + C NV+  L G Q PK TC
Sbjct  335   GTTSTELAVNLVCSKGAPCQKVELGNIDLKYTGPEGTASSQCKNVEATLWGTQQPK-TC  392



>gb|EYU42735.1| hypothetical protein MIMGU_mgv1a007533mg [Erythranthe guttata]
Length=404

 Score =   358 bits (918),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 179/391 (46%), Positives = 256/391 (65%), Gaps = 13/391 (3%)
 Frame = +1

Query  52    ISYCAFTFILFLLAHFGESAIINV----AAKANVDVGPLLMKAWKEACAATTASTIVIPK  219
              S     F+ FL  H     + ++    A     D+ P+L K WKEAC AT AS ++IPK
Sbjct  7     FSAVLLVFLPFLAYHAESVTVFDISKYGAKPGGEDISPVLAKVWKEACEATNASKVLIPK  66

Query  220   GTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKK-EWLIVGRVDHFTLSGGGTLD  396
             GT+ ++Q+ L GP KAP+EL++   ++A PD   +  K  +W+ +  +D FT+SGGG  D
Sbjct  67    GTWYLSQIRLVGPNKAPLELEVQGTVEANPDYTKLPQKDGQWITINYLDGFTISGGGVFD  126

Query  397   GQGNVQVYPSKE--KGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFD  570
             G+G  Q + + +  K     KLP NLSLNF+ N++I+D+TT +SK FH N +  +N+TF 
Sbjct  127   GKGE-QAWKANDCHKNPNCPKLPINLSLNFIKNAIIKDVTTKDSKNFHCNCISSQNVTFQ  185

Query  571   HFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGI  750
              FT+ APG S NTDGIHIAR+  + V DS IGTGDDCIS+GD   +L I  V CGPGHGI
Sbjct  186   RFTISAPGESINTDGIHIARVSNVKVLDSNIGTGDDCISIGDETTDLHIENVKCGPGHGI  245

Query  751   SVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVKN  927
             SVGS+G+ P E+ V GI V    F GT NGVR+KTWPN+   + ++++H+  + M +V  
Sbjct  246   SVGSMGKNPAEKDVTGITVKKCTFTGTSNGVRVKTWPNAPATLKISNLHFEDLTMNNVSY  305

Query  928   PIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEI  1107
             P+VIDQ+YCP N C+K KPS ++IS ++ K+++GT+ TKE ++ +CSS  PC++V+I +I
Sbjct  306   PVVIDQQYCPWNLCTKDKPSLIQISGLTVKNVRGTANTKEALLFSCSSSKPCQNVQISDI  365

Query  1108  DLTF----KGGAKTICSNVKPKLTGKQCPKV  1188
             DL +         T+C NVKP ++GKQ P +
Sbjct  366   DLKYVNSIPANFTTVCENVKPTVSGKQIPPI  396



>gb|EYU42739.1| hypothetical protein MIMGU_mgv1a007536mg [Erythranthe guttata]
Length=404

 Score =   358 bits (918),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 180/391 (46%), Positives = 256/391 (65%), Gaps = 13/391 (3%)
 Frame = +1

Query  52    ISYCAFTFILFLLAHFGESAIINV----AAKANVDVGPLLMKAWKEACAATTASTIVIPK  219
              S     F+ FL  H     I ++    A     D+ P+L K WKEAC AT AS ++IPK
Sbjct  7     FSAVLLVFLPFLAYHAESVTIFDISKYGAKPGGEDISPVLAKVWKEACEATNASKVLIPK  66

Query  220   GTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKK-EWLIVGRVDHFTLSGGGTLD  396
             GT+ ++Q+ L GP KAP+EL++   ++A PD   +  K  +W+ +  +D FT+SGGG  D
Sbjct  67    GTWYLSQIRLVGPNKAPLELEVQGTVEANPDYTKLPQKDGQWITINYLDGFTISGGGVFD  126

Query  397   GQGNVQVYPSKE--KGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFD  570
             G+G  Q + + +  K     KLP NLSLNF+ N++I+D+TT +SK FH N +  +N+TF 
Sbjct  127   GKGE-QAWKANDCHKNPNCPKLPINLSLNFIKNAIIKDVTTKDSKNFHCNCISSQNVTFQ  185

Query  571   HFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGI  750
              FT+ APG S NTDGIHIAR+  + V DS IGTGDDCIS+GD   +L I  V CGPGHGI
Sbjct  186   RFTISAPGESINTDGIHIARVSNVKVLDSNIGTGDDCISIGDETTDLHIENVKCGPGHGI  245

Query  751   SVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVKN  927
             SVGS+G+ P E+ V GI V    F GT NGVR+KTWPN+   + ++++H+  + M +V  
Sbjct  246   SVGSMGKNPAEKDVTGITVKKCTFTGTSNGVRVKTWPNAPATLKISNLHFEDLTMNNVSY  305

Query  928   PIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEI  1107
             P+VIDQ+YCP N C+K KPS ++IS ++ K+++GT+ TKE ++ +CSS  PC++V+I +I
Sbjct  306   PVVIDQQYCPWNLCTKDKPSLIQISGLTVKNVRGTANTKEALLFSCSSSKPCQNVQISDI  365

Query  1108  DLTF----KGGAKTICSNVKPKLTGKQCPKV  1188
             DL +         T+C NVKP ++GKQ P +
Sbjct  366   DLKYVNSIPANFTTVCENVKPTVSGKQNPPI  396



>ref|XP_004162875.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=397

 Score =   357 bits (917),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 187/379 (49%), Positives = 254/379 (67%), Gaps = 18/379 (5%)
 Frame = +1

Query  79    LFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGP  258
             LF +  +G        AK N D+   L  AWKEAC +TT S ++IPKG + ++Q  L+GP
Sbjct  21    LFDVTRYG--------AKPNTDITQALANAWKEACMSTTPSKLLIPKGVYQLSQSYLKGP  72

Query  259   CKA-PVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-E  432
             CK+ P+++++   LKAP  P N DG    ++   +D   LSG G  DGQG      +   
Sbjct  73    CKSVPIQVQVDGTLKAPLHP-NGDG---LVLFAYIDQLMLSGTGVFDGQGKAGWDKNDCH  128

Query  433   KGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTD  612
             K     KLP NL  +F+TNS+++DIT+L+SK FH+N+LG KN+TF H T+ AP NSPNTD
Sbjct  129   KKKICTKLPMNLKFSFITNSIVKDITSLDSKNFHINLLGCKNVTFQHVTISAPENSPNTD  188

Query  613   GIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPV  792
             GIHI+    I + DS I TGDDC+S+GD  + + IT VTCGPGHGISVGSLG+   E+ V
Sbjct  189   GIHISSSEQINILDSKISTGDDCVSVGDSNKQVTITNVTCGPGHGISVGSLGKYTKEKDV  248

Query  793   KGIFVSNSKFIGTDNGVRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIVIDQEYCPNNEC  969
              G+ V   K I T NGVRIKTWP+S    + +D+H+  IEM++V NP++IDQEYCP N+C
Sbjct  249   VGVTVKTCKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVIIDQEYCPWNQC  308

Query  970   SKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI---  1140
             +++ PSK+KISKVS+K+I+GTSAT   V L CS  +PCE VE+ +I+LT+ G    I   
Sbjct  309   NRKVPSKIKISKVSFKNIRGTSATPIAVKLVCSKSIPCEGVEVADINLTYSGIRGPILSE  368

Query  1141  CSNVKPKLTGKQCPKVTCK  1197
             C+NV+P +TGKQ P++  K
Sbjct  369   CANVQPLITGKQSPQICAK  387



>gb|EYU42734.1| hypothetical protein MIMGU_mgv1a007528mg [Erythranthe guttata]
Length=404

 Score =   357 bits (917),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 180/391 (46%), Positives = 256/391 (65%), Gaps = 13/391 (3%)
 Frame = +1

Query  52    ISYCAFTFILFLLAHFGESAIINV----AAKANVDVGPLLMKAWKEACAATTASTIVIPK  219
              S     F+ FL  H     I ++    A     D+ P+L K WKEAC AT AS ++IPK
Sbjct  7     FSAVLLVFLPFLAYHAESVTIFDISKYGAKPGGDDISPVLAKVWKEACEATNASKVLIPK  66

Query  220   GTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKK-EWLIVGRVDHFTLSGGGTLD  396
             GT+ ++Q+ L GP KAP+EL++   ++A PD   +  K  +W+ +  +D FT+SGGG  D
Sbjct  67    GTWYLSQIRLVGPNKAPLELEVQGTVEANPDYTKLPQKDGQWITINYLDGFTISGGGVFD  126

Query  397   GQGNVQVYPSKE--KGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFD  570
             G+G  Q + + +  K     KLP NLSLNF+ N++I+D+TT +SK FH N +  +N+TF 
Sbjct  127   GKGE-QAWKANDCHKNPNCPKLPINLSLNFIKNAIIKDVTTKDSKNFHCNCISSQNVTFQ  185

Query  571   HFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGI  750
              FT+ APG S NTDGIHIAR+  + V DS IGTGDDCIS+GD   +L I  V CGPGHGI
Sbjct  186   RFTISAPGESINTDGIHIARVSNVKVLDSDIGTGDDCISIGDETTDLHIENVKCGPGHGI  245

Query  751   SVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVKN  927
             SVGS+G+ P E+ V GI V    F GT NGVR+KTWPN+   + ++++H+  + M +V  
Sbjct  246   SVGSMGKNPAEKDVTGITVKKCTFTGTSNGVRVKTWPNAPATLKISNLHFEDLTMNNVSY  305

Query  928   PIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEI  1107
             P+VIDQ+YCP N C+K KPS ++IS ++ K+++GT+ TKE ++ +CSS  PC++V+I +I
Sbjct  306   PVVIDQQYCPWNLCTKDKPSLIQISGLTVKNVRGTANTKEALLFSCSSSKPCQNVQISDI  365

Query  1108  DLTF----KGGAKTICSNVKPKLTGKQCPKV  1188
             DL +         T+C NVKP ++GKQ P +
Sbjct  366   DLKYVNSIPANFTTVCENVKPTVSGKQNPPI  396



>ref|XP_004153076.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
 ref|XP_004172630.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=397

 Score =   357 bits (916),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 187/379 (49%), Positives = 254/379 (67%), Gaps = 18/379 (5%)
 Frame = +1

Query  79    LFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGP  258
             LF +  +G        AK N D+   L  AWKEAC +TT S ++IPKG + ++Q  L+GP
Sbjct  21    LFDVTRYG--------AKPNTDITQALANAWKEACMSTTPSKLLIPKGVYQLSQSYLKGP  72

Query  259   CKA-PVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-E  432
             CK+ P+++++   LKAP  P N DG    ++   +D   LSG G  DGQG      +   
Sbjct  73    CKSVPIQVQVDGTLKAPLHP-NGDG---LVLFAYIDQLMLSGTGVFDGQGKAGWDKNDCH  128

Query  433   KGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTD  612
             K     KLP NL  +F+TNS+++DIT+L+SK FH+N+LG KN+TF H T+ AP NSPNTD
Sbjct  129   KKKICTKLPMNLKFSFITNSIVKDITSLDSKNFHINLLGCKNVTFQHVTISAPENSPNTD  188

Query  613   GIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPV  792
             GIHI+    I + DS I TGDDC+S+GD  + + IT VTCGPGHGISVGSLG+   E+ V
Sbjct  189   GIHISSSEQINILDSKISTGDDCVSVGDSNKQVTITNVTCGPGHGISVGSLGKYTKEKDV  248

Query  793   KGIFVSNSKFIGTDNGVRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIVIDQEYCPNNEC  969
              G+ V   K I T NGVRIKTWP+S    + +D+H+  IEM++V NP++IDQEYCP N+C
Sbjct  249   VGVTVKACKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVIIDQEYCPWNQC  308

Query  970   SKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI---  1140
             +++ PSK+KISKVS+K+I+GTSAT   V L CS  +PCE VE+ +I+LT+ G    I   
Sbjct  309   NRKVPSKIKISKVSFKNIRGTSATPIAVKLVCSKSIPCEGVEVADINLTYSGIRGPILSE  368

Query  1141  CSNVKPKLTGKQCPKVTCK  1197
             C+NV+P +TGKQ P++  K
Sbjct  369   CANVQPLITGKQSPQICAK  387



>ref|XP_002884668.1| polygalacturonase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60927.1| polygalacturonase 3 [Arabidopsis lyrata subsp. lyrata]
Length=391

 Score =   357 bits (915),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/377 (46%), Positives = 251/377 (67%), Gaps = 7/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
              I+ LL     + +  + + +  D+   L+KA+  AC +++ S +VIPKG F + ++ + 
Sbjct  11    LIICLLGISANAEVFTIGSSSGSDITQALLKAFTSACQSSSPSKVVIPKGEFKLGEIEMR  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCKAP+E+ +   +KA  D   + GK++W++ G +D F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIEVTLQGTVKA--DGNAIQGKEKWVVFGNIDGFKLNGGGAFDGEGNSAWRVNNC  128

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F   KLP ++  +F+ NS IRDI+++++K FH+NVLG KN+T D+  + AP  SPNT
Sbjct  129   HKTFNCKKLPISIRFDFVLNSEIRDISSIDAKNFHINVLGAKNMTMDNIKIIAPEESPNT  188

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGHEQD  248

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V GI + N     TDNG+RIKTWP++      +DIH+  I +++V NPI+IDQEYCP N+
Sbjct  249   VSGIKIINCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVSNPILIDQEYCPWNQ  308

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKT  1137
             C+KQK S +K+  +S+K+I+GTS  K+ V L CS G PC++VEIG+ID+ + G    A  
Sbjct  309   CNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIKYNGADGPATF  368

Query  1138  ICSNVKPKLTGKQCPKV  1188
              CSNV PKL G Q PK 
Sbjct  369   QCSNVSPKLLGSQSPKA  385



>ref|XP_008381794.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=401

 Score =   357 bits (916),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 188/392 (48%), Positives = 247/392 (63%), Gaps = 20/392 (5%)
 Frame = +1

Query  34    NLKMATISYCAFTFILFLLAHFGESAII-----NVAAKANVDVGPLLMKAWKEACAATTA  198
             +LK+  I    F F+L + +   +S +      N   KAN D+   L KAW +ACA+T+A
Sbjct  2     DLKLKNI-LSMFVFLLLVSSSNAQSGVYDVTGANYGGKANSDITQALSKAWTDACASTSA  60

Query  199   STIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLS  378
             S IV+P GT+     + +GPCK P+E ++   L+AP   K +  +  W+   R+D  TLS
Sbjct  61    SKIVVPSGTYKFVGATFKGPCKGPIEFQLQGTLQAPEHIKELPKEDTWVAFERIDGLTLS  120

Query  379   GGGTLDGQGNV-----QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNV  543
             GGGT DGQG         + +K+  FK      NL  NF+TNS++R ITT +SK FHVN+
Sbjct  121   GGGTFDGQGATAWKQNDCHKNKDCKFKAV----NLRFNFITNSIVRGITTKDSKNFHVNL  176

Query  544   LGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITG  723
             LG   L F  FTV AP  S NTDGIH+ R   I + D+ IGTGDDCIS+G G + L +T 
Sbjct  177   LGCNKLAFQDFTVSAPKESVNTDGIHMGRSTEINITDTTIGTGDDCISIGHGTKQLHVTN  236

Query  724   VTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS--HPGVVTDIHY  897
             VTCGPGHGIS+GSLGRT  E PV GIF+ N     TDNGVRIKTWP S      V+D+H+
Sbjct  237   VTCGPGHGISIGSLGRTEDEEPVSGIFIKNCTITNTDNGVRIKTWPASPAKGTAVSDVHF  296

Query  898   HKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGV  1077
               I M++VKNP+VIDQEYCP+  C+ +  SKVKIS VS+K+IKG+S+    V L CS  +
Sbjct  297   ZDIIMDNVKNPVVIDQEYCPHKLCTPEVSSKVKISNVSFKNIKGSSSGPVGVKLLCSGKL  356

Query  1078  PCEDVEIGEIDLTFKGGAKTI---CSNVKPKL  1164
             PCE+VE+  IDLT+ G   +I   C +VKP +
Sbjct  357   PCENVELSNIDLTYTGDKGSITSECKHVKPTI  388



>ref|XP_006299274.1| hypothetical protein CARUB_v10015428mg [Capsella rubella]
 gb|EOA32172.1| hypothetical protein CARUB_v10015428mg [Capsella rubella]
Length=396

 Score =   357 bits (915),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 176/380 (46%), Positives = 250/380 (66%), Gaps = 7/380 (2%)
 Frame = +1

Query  64    AFTFILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQV  243
             +  FI+ L      + +  + + +  D+   L+KA+  AC + + S +VIPKG F + ++
Sbjct  8     SIIFIICLSGFSANAEVFTIRSSSGSDITQALLKAFTSACQSPSPSKVVIPKGEFKLREI  67

Query  244   SLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYP  423
              + GPCKAP+E+ I   +KA  D   + GK +W++ G ++ F L+GGG  DG+GN     
Sbjct  68    EMRGPCKAPIEITIQGTVKA--DGNAIQGKDKWVVFGNINGFKLNGGGAFDGEGNASWRV  125

Query  424   SK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNS  600
             +   K F+  KLP ++  +F+ NS IRDI++++SK FH+NVLG KN+T D+  + AP  S
Sbjct  126   NNCHKTFQCKKLPISIRFDFVLNSEIRDISSIDSKNFHINVLGAKNMTMDNIKIIAPEES  185

Query  601   PNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPG  780
             PNTDGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR   
Sbjct  186   PNTDGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGH  245

Query  781   ERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT-DIHYHKIEMEDVKNPIVIDQEYCP  957
             E+ V GI + N     TDNG+RIKTWP++       DIH+  I +++V NPI+IDQEYCP
Sbjct  246   EQDVSGIRIINCTLQQTDNGLRIKTWPSAACSTTAFDIHFEDIIVKNVSNPILIDQEYCP  305

Query  958   NNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---  1128
              N+C+KQKPS +K+   S+K+I+GTS  K+ V L CS G PC++VEIG++D+ + G    
Sbjct  306   WNQCNKQKPSTIKLVNTSFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGDVDIKYNGADGP  365

Query  1129  AKTICSNVKPKLTGKQCPKV  1188
             A   CSNV PKL G Q PK 
Sbjct  366   ATFQCSNVSPKLLGTQNPKA  385



>ref|XP_004308599.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=392

 Score =   357 bits (915),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/353 (49%), Positives = 238/353 (67%), Gaps = 7/353 (2%)
 Frame = +1

Query  127   AKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAP  306
             AK N D+   +  AWK+ACA+T  S +++PKG + + + +  GPCKAP+EL++   L+A 
Sbjct  29    AKPNSDITQAIANAWKDACASTMPSKVIVPKGIYKLKEANFNGPCKAPIELQVCGTLQAS  88

Query  307   PDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKE--KGFKGDKLPNNLSLNF  480
             PD   +     W++   +D FTLSG G  DGQG  Q + + +  K  K   +  N+  + 
Sbjct  89    PDGAQLSKPDTWIMFSYLDRFTLSGTGIFDGQGQ-QAWKANDCHKNPKCSSIAINMRFHS  147

Query  481   LTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSV  660
             + NS++RD+++LNSK FHVNVLG + LTF HFTV AP  S NTDGIHI R  GI + DS 
Sbjct  148   VKNSLVRDVSSLNSKNFHVNVLGCERLTFQHFTVTAPETSVNTDGIHIGRSTGINITDSN  207

Query  661   IGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNG  840
             I TGDDCIS+GDG + L IT VTCGPGHGIS+GSLGR P E PV GI++ +     T NG
Sbjct  208   ISTGDDCISIGDGTKQLTITKVTCGPGHGISIGSLGRYPKEEPVTGIYIKSCTLSNTMNG  267

Query  841   VRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYK  1017
             +RIKTWPNS    + +DIH+  I M +V NPI+IDQEYCP N C+KQ  SKVKIS VS++
Sbjct  268   IRIKTWPNSPAASIASDIHFEDIIMNNVGNPILIDQEYCPWNLCNKQVASKVKISNVSFR  327

Query  1018  DIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI---CSNVKPKLT  1167
             +I+GTS+T   + + C+ G+PC+ VE+ +I+L + G   ++   CSNV+P +T
Sbjct  328   NIRGTSSTPLALKILCAKGLPCDKVEMTDINLKYNGKQGSLTSQCSNVRPTIT  380



>ref|XP_008391258.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score =   357 bits (915),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 188/380 (49%), Positives = 245/380 (64%), Gaps = 14/380 (4%)
 Frame = +1

Query  64    AFTFILFLLAHFGESAIINV-----AAKANVDVGPLLMKAWKEACAATTASTIVIPKGTF  228
             AF F+L       E  + +V      AK   D+   L KAW +ACA+   S +V+P GT+
Sbjct  10    AFLFLLSASKTQAEPGVFDVTSATYGAKPGSDITHALAKAWIDACASPAPSKVVVPSGTY  69

Query  229   PMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGN  408
              +T+ S +GPCKAP+E+++   L AP D   +     W+    V+  T+SGGGT DGQG 
Sbjct  70    MLTEASFKGPCKAPIEIQVQGKLTAPADGGKLTRPDTWVGFDHVNKLTVSGGGTFDGQGA  129

Query  409   VQVYPS---KEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFT  579
             +    +   K K  K   +  N+  NF+TNS I+DIT+L+SK FHVNVLG  N+TF    
Sbjct  130   LAWKKNDCNKNKDCKSIAI--NMRFNFVTNSTIQDITSLDSKNFHVNVLGCHNVTFXRVN  187

Query  580   VKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVG  759
             V AP  S NTDGIHI R  GI + D+ IGTGDDC+S+GDG + + +T VTCGPGHGISVG
Sbjct  188   VTAPXESINTDGIHIGRSTGINITDAHIGTGDDCVSIGDGNKEITVTRVTCGPGHGISVG  247

Query  760   SLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIV  936
             SLGR P E PV GI V N     T NGVRIKTWP S   G+ +D+H+  I M +V NP++
Sbjct  248   SLGRYPNEEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVL  307

Query  937   IDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLT  1116
             IDQ+YCP N+C +  PSKVKIS VS+K+IKG+SAT   V + CS G+PCE+VE+ +IDLT
Sbjct  308   IDQQYCPWNQCKQNVPSKVKISNVSFKNIKGSSATPLAVQIVCSGGIPCENVELADIDLT  367

Query  1117  F---KGGAKTICSNVKPKLT  1167
             +   KG   + CSNVKP +T
Sbjct  368   YNGNKGPLTSQCSNVKPTIT  387



>ref|XP_003595656.1| Polygalactorunase PG11 [Medicago truncatula]
 gb|AES65907.1| polygalacturonase 11c, putative [Medicago truncatula]
Length=407

 Score =   357 bits (915),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 190/394 (48%), Positives = 252/394 (64%), Gaps = 19/394 (5%)
 Frame = +1

Query  13    NTKI*VTNLKMATISYCAFTFILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAAT  192
             +T I V+ L +A   +CA   ++  ++ FG           N D+   L  AWKEACA+T
Sbjct  4     STAIIVSFLFLA--EFCAVQSLVLDISKFG--------GAPNSDITLALGNAWKEACAST  53

Query  193   TASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFT  372
             TAS IVIP GT+ M  + L+GPCKAP+E+++   ++AP DP  +    +W+    ++H T
Sbjct  54    TASKIVIPGGTYKMGGIELKGPCKAPIEVQVDGTIQAPADPSQIKAADQWVKFLYMEHLT  113

Query  373   LSGGGTLDGQGNV---QVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDITTLNSKLFHV  537
             LSG G  DGQG     Q  P+     K    K+  NL   F+ NS++  +T+ +SK FHV
Sbjct  114   LSGKGVFDGQGATAYKQAQPAAAWSGKKSNVKILMNLGFMFVNNSMVTGVTSKDSKNFHV  173

Query  538   NVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKI  717
              VLG  N TFD FTV AP +SPNTDGIH+ R   + + ++ IGTGDDC+SLGDG   + +
Sbjct  174   MVLGCNNFTFDGFTVTAPSDSPNTDGIHMGRSTDVKILNTNIGTGDDCVSLGDGSRKITV  233

Query  718   TGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--DI  891
              GV CGPGHGISVGSLGR   E  V+G+ V N     T NGVRIKTWP++ PG +T  DI
Sbjct  234   QGVKCGPGHGISVGSLGRYTTEDNVEGVTVKNCTLTATQNGVRIKTWPDA-PGTITVSDI  292

Query  892   HYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSS  1071
             H+  I M +V NPI+IDQEYCP N C+K+ PSKVK+SK+S+K+I+GTS   E V+L CSS
Sbjct  293   HFEDITMNNVTNPIIIDQEYCPWNACNKKVPSKVKLSKISFKNIQGTSGAPEGVVLVCSS  352

Query  1072  GVPCEDVEIGEIDLTFKGG-AKTICSNVKPKLTG  1170
              VPC+ VE+  +D+ F G  A   CSNVKP +TG
Sbjct  353   AVPCDGVELNNVDVKFNGKPAIAKCSNVKPTVTG  386



>gb|AAO62938.1| polygalactorunase PG11 precursor [Medicago sativa]
Length=407

 Score =   356 bits (914),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 191/395 (48%), Positives = 255/395 (65%), Gaps = 21/395 (5%)
 Frame = +1

Query  13    NTKI*VTNLKMATISYCAFTFILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAAT  192
             +T I V+ L +A  ++CA   ++  ++ FG           N D+   +  AWKEAC +T
Sbjct  4     STAIIVSFLFLA--NFCAVQSVVLDISKFG--------GAPNSDITQAIGNAWKEACLST  53

Query  193   TASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFT  372
             TA+ I+IP GT+ M  V L+GPCKAP+E+++   ++AP DP  M    +W+    ++H T
Sbjct  54    TAAKIMIPGGTYRMNGVELKGPCKAPIEVQVDGTIQAPADPSQMKAADQWIKFLYMEHLT  113

Query  373   LSGGGTLDGQGNVQVY----PSKEKGFKGD--KLPNNLSLNFLTNSVIRDITTLNSKLFH  534
             LSG G  DGQG   VY    P+     K    K+  NL   F+ NS++  +T+ +SK FH
Sbjct  114   LSGKGVFDGQG-ATVYKKAAPAAAWSGKNSNVKIFMNLGFMFVNNSMVHGLTSKDSKNFH  172

Query  535   VNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLK  714
             V VLG  N TFD FTV APG+SPNTDGIH+ R   I + ++ I TGDDCISLGDG   + 
Sbjct  173   VMVLGCNNFTFDGFTVTAPGDSPNTDGIHMGRSTDIKILNTNIATGDDCISLGDGSRKIT  232

Query  715   ITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--D  888
             +  V CGPGHGISVGSLG+   E  V+G+ V N     T NGVRIKTWP++ PG +T  D
Sbjct  233   VQNVKCGPGHGISVGSLGKYTTEDNVEGVIVKNCTLTATQNGVRIKTWPDA-PGTITVSD  291

Query  889   IHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACS  1068
             IH+  I M +V NP++IDQEYCP N+CSK+ PSK+K+SK+S+K+I+GTS T E V+L CS
Sbjct  292   IHFEDIIMNNVMNPVIIDQEYCPWNQCSKKNPSKIKLSKISFKNIQGTSGTPEGVVLICS  351

Query  1069  SGVPCEDVEIGEIDLTFKGG-AKTICSNVKPKLTG  1170
             SGVPC+ VE+  + LTF G  A   CSNVKP +TG
Sbjct  352   SGVPCDGVELNNVGLTFNGKPAIAKCSNVKPLVTG  386



>emb|CBI22052.3| unnamed protein product [Vitis vinifera]
Length=1080

 Score =   375 bits (963),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 174/355 (49%), Positives = 239/355 (67%), Gaps = 3/355 (1%)
 Frame = +1

Query  136   NVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDP  315
             N D+   L+KAW +AC++  AST++IP GT+ + Q+ + GPCKAP+   +   + AP D 
Sbjct  40    NSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAGPCKAPINFVVQGTVMAPVDT  99

Query  316   KNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSV  495
                  +  W+   ++D FTLSG G  DGQG +            ++LP NL  NF+TNS+
Sbjct  100   SRFRAEAGWITFQQIDQFTLSGDGVFDGQGKIVWGTKCLSSAYCNQLPINLRFNFITNSM  159

Query  496   IRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGD  675
             ++DIT+ +SK FH+N+LG KNLTF +  + AP  S NTDGIHI R  GI + DS I TGD
Sbjct  160   VKDITSRDSKQFHINLLGCKNLTFYNIVISAPQESLNTDGIHIGRSSGINITDSTIETGD  219

Query  676   DCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKT  855
             DC+S+GDG E + I  VTCGPGHGISVGSLG+ P E PV GI V N     T NGVR+KT
Sbjct  220   DCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGISVKNCTLTNTQNGVRVKT  279

Query  856   WPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTS  1035
             WP SH G  +++H+  I M +V NPI+IDQEYCP+N+C+ + PS++KIS VS+++I+GT+
Sbjct  280   WPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSPSRIKISNVSFRNIRGTT  339

Query  1036  ATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKTICSNVKPKLTGKQCPKVT  1191
             +T+  V L CS GVPC DVE+G+I+L + G    A + C N+KP L G Q P+++
Sbjct  340   STQVAVKLICSQGVPCHDVELGDINLEYNGNEGPAMSQCKNIKPNLLGVQLPRIS  394



>ref|XP_008449697.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=403

 Score =   356 bits (914),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 192/395 (49%), Positives = 263/395 (67%), Gaps = 18/395 (5%)
 Frame = +1

Query  43    MATIS-YCAFTFILFLLAHF-GESA-----IINVAAKANVDVGPLLMKAWKEACAATTAS  201
             M  IS + A   +L L+++   +SA     I    AK N D+   L  AWKEACA+TT S
Sbjct  1     MGLISNFVALLPMLLLVSNSKAQSAAGVFDITKYGAKPNADITAALASAWKEACASTTPS  60

Query  202   TIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSG  381
              ++IPKGT+ +TQ +L+GPCK+ +EL++   ++A  D K  DG    L++  VD  T+SG
Sbjct  61    KVLIPKGTYGLTQSNLKGPCKSSIELQLEGTVQASSDVKG-DG---LLLLEYVDQLTVSG  116

Query  382   GGTLDGQGNVQVYPSKEKGFKG--DKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGK  555
              G +DGQG    +   +   K    KLP NL  NF+TNS+++DIT+L+SK +H N+L  K
Sbjct  117   TGVVDGQGKT-AWGKNDCHLKKICTKLPMNLKFNFVTNSIVKDITSLDSKNYHFNLLACK  175

Query  556   NLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCG  735
             NLTFDH T+ APGNSPNTDGIH+     I + ++ I TGDDCIS+G   + + I+ VTCG
Sbjct  176   NLTFDHVTITAPGNSPNTDGIHVGDSEQINILNTNIATGDDCISVGSSNKQIVISDVTCG  235

Query  736   PGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHYHKIEM  912
             PGHGIS+GSLG+   E+ + G+ V   K  GT NGVRIKTWP+S      +D+H+  IEM
Sbjct  236   PGHGISIGSLGKYTNEKELVGVTVKKCKLTGTTNGVRIKTWPDSAVAFPASDMHFEDIEM  295

Query  913   EDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDV  1092
              +V NP++IDQEYCP N+C+++ PSK+KISKVS+K+I+GTSAT   V L CS   PCE V
Sbjct  296   VNVSNPVLIDQEYCPWNQCNRKVPSKIKISKVSFKNIRGTSATPVAVKLVCSQSNPCEGV  355

Query  1093  EIGEIDLTFKGGA---KTICSNVKPKLTGKQCPKV  1188
             E+ +IDLT+ G     K+ C+NVKP ++GKQ P +
Sbjct  356   EVADIDLTYSGSEGPIKSQCANVKPVISGKQNPPI  390



>gb|EYU42736.1| hypothetical protein MIMGU_mgv1a007545mg [Erythranthe guttata]
Length=404

 Score =   356 bits (913),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 178/391 (46%), Positives = 256/391 (65%), Gaps = 13/391 (3%)
 Frame = +1

Query  52    ISYCAFTFILFLLAHFGESAIINV----AAKANVDVGPLLMKAWKEACAATTASTIVIPK  219
              S     F+ FL  H     + ++    A     D+ P+L K WKEAC AT AS ++IPK
Sbjct  7     FSAVLLVFLPFLAYHAESVTVFDISKYGAKPGGEDISPVLAKVWKEACEATNASKVLIPK  66

Query  220   GTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKK-EWLIVGRVDHFTLSGGGTLD  396
             GT+ ++Q+ L GP KAP+EL++   ++A PD   +  K  +W+ +  +D FT+SGGG  D
Sbjct  67    GTWYLSQIRLVGPNKAPLELEVQGTVEANPDYTKLPQKDGQWITINYLDGFTISGGGVFD  126

Query  397   GQGNVQVYPSKE--KGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFD  570
             G+G  Q + + +  K     KLP NLSLNF+ N++I+D+TT +SK FH N +  +N+TF 
Sbjct  127   GKGE-QAWKANDCHKNPNCPKLPINLSLNFIKNAIIKDVTTKDSKNFHCNCISSQNVTFQ  185

Query  571   HFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGI  750
              FT+ APG S NTDGIHIAR+  + V DS IGTGDDCIS+GD   +L I  V CGPGHGI
Sbjct  186   RFTISAPGESINTDGIHIARVSNVKVLDSNIGTGDDCISIGDETTDLHIENVKCGPGHGI  245

Query  751   SVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVKN  927
             SVGS+G+ P E+ V GI V    F GT NGVR+KTWP++   + ++++H+  + M +V  
Sbjct  246   SVGSMGKNPAEKDVTGITVKKCTFTGTSNGVRVKTWPSAPATLKISNLHFEDLTMNNVSY  305

Query  928   PIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEI  1107
             P+VIDQ+YCP N C+K KPS ++IS ++ K+++GT+ TKE ++ +CSS  PC++V+I +I
Sbjct  306   PVVIDQQYCPWNLCTKDKPSLIQISGLTVKNVRGTANTKEALLFSCSSSKPCQNVQISDI  365

Query  1108  DLTF----KGGAKTICSNVKPKLTGKQCPKV  1188
             DL +         T+C NVKP ++GKQ P +
Sbjct  366   DLKYVNSIPANFTTVCENVKPTVSGKQIPPI  396



>ref|XP_004491599.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=393

 Score =   355 bits (912),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 185/372 (50%), Positives = 238/372 (64%), Gaps = 9/372 (2%)
 Frame = +1

Query  82    FLLAHFG--ESAIINVA--AKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSL  249
             FLL  FG  +SA+ ++      + D+       WK AC +T AS + IP G++ M  + +
Sbjct  13    FLLTTFGIAQSAVFDIRKYGAPSGDITTAFGDVWKAACNSTGASKVWIPSGSYKMGAIVV  72

Query  250   EGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK  429
             +GPC  P+E+++   + AP +P  +    EW+    VD FTLSG G  DGQG +    + 
Sbjct  73    KGPCNGPIEVQVDGTIIAPANPAALHDAYEWIKFEYVDFFTLSGKGVFDGQGAIAWNQND  132

Query  430   -EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPN  606
               K    D    N   NFL ++ +RDIT+ +SK FHVNVLG  N TFDHFTV AP  S N
Sbjct  133   CGKNKNCDMASMNFGFNFLKHATVRDITSKDSKNFHVNVLGCTNFTFDHFTVTAPATSLN  192

Query  607   TDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGER  786
             TDGIHI R   + + ++ IGTGDDC+SLGDG + + +  V CGPGHGISVGSLG+ P E 
Sbjct  193   TDGIHIGRSTDVKILNTNIGTGDDCVSLGDGCKQITVQNVNCGPGHGISVGSLGKYPKEE  252

Query  787   PVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHYHKIEMEDVKNPIVIDQEYCPN  960
             PV+ + V N     TDNGVRIKTWP S PG   +TD+H+  I M DV NP++IDQEYCP 
Sbjct  253   PVEQLLVKNCTLTNTDNGVRIKTWP-STPGTNPITDMHFEDITMVDVLNPVIIDQEYCPW  311

Query  961   NECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG-AKT  1137
             N+CSKQ PSK+KISKV++K+IKGTS TK+ VIL CS  VPCE VE+  + LTF G     
Sbjct  312   NQCSKQSPSKIKISKVTFKNIKGTSKTKDGVILICSKSVPCEGVELNNVALTFNGTEVDA  371

Query  1138  ICSNVKPKLTGK  1173
              C NVKP +TGK
Sbjct  372   KCVNVKPIVTGK  383



>ref|XP_010458152.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   355 bits (911),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 174/377 (46%), Positives = 253/377 (67%), Gaps = 7/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
             FI+ LL     + +  + + +  D+   L+KA+  AC + + S +VIPKG F + ++ ++
Sbjct  11    FIICLLGISANAEVFTIGSSSGSDITQALLKAFTAACQSPSPSKVVIPKGEFKLGEIEMK  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCKAP+E+ I   +KA  D   + GK +W++ G ++ F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIEVTIQGTVKA--DGNAIQGKDKWVVFGNINGFKLNGGGAFDGEGNASWRVNNC  128

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F+  KLP ++  +F+ NS I+DI+++++K FH+NVLG KN+T ++  + AP +SPNT
Sbjct  129   HKTFQCKKLPISIRFDFVLNSEIKDISSIDAKNFHINVLGAKNMTMNNIKIIAPEDSPNT  188

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGHEQD  248

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V GI + N     TDNG+RIKTWP++      +DIH+  I +++V NPI+IDQEYCP N+
Sbjct  249   VSGIRIINCTLQQTDNGLRIKTWPSAACSTTASDIHFQDIIVKNVSNPILIDQEYCPWNQ  308

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKT  1137
             C+KQKPS +K+  +S+K+I+GTS  K+ V L CS G PC++VEIG +D+ + G    A  
Sbjct  309   CNKQKPSTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGNVDIKYTGADGPATF  368

Query  1138  ICSNVKPKLTGKQCPKV  1188
              CSNV PKL G Q PK 
Sbjct  369   QCSNVSPKLLGTQNPKA  385



>gb|EYU42733.1| hypothetical protein MIMGU_mgv1a007538mg [Erythranthe guttata]
Length=404

 Score =   355 bits (911),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 178/391 (46%), Positives = 256/391 (65%), Gaps = 13/391 (3%)
 Frame = +1

Query  52    ISYCAFTFILFLLAHFGESAIINV----AAKANVDVGPLLMKAWKEACAATTASTIVIPK  219
              S     F+ FL  H     + ++    A     D+ P+L K WKEAC AT AS ++IPK
Sbjct  7     FSAVLLVFLPFLAYHAQAVTVFDISKYGAKPGGEDISPVLAKVWKEACEATNASKVLIPK  66

Query  220   GTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKK-EWLIVGRVDHFTLSGGGTLD  396
             GT+ ++Q+ L GP KAP+EL++   ++A PD   +  K  +W+ +  +D FT+SGGG  D
Sbjct  67    GTWYLSQIRLVGPNKAPLELEVQGTVEANPDYTKLPQKDGQWITINYLDGFTISGGGVFD  126

Query  397   GQGNVQVYPSKE--KGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFD  570
             G+G  Q + + +  K     KLP NLSLNF+ N++I+D+TT +SK FH N +  +N+TF 
Sbjct  127   GKGE-QAWKANDCHKNPNCPKLPINLSLNFIKNAIIKDVTTKDSKNFHCNCISSQNVTFQ  185

Query  571   HFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGI  750
              FT+ APG S NTDGIHIAR+  + V DS IGTGDDCIS+GD   +L I  V CGPGHGI
Sbjct  186   RFTISAPGESINTDGIHIARVSNVKVLDSNIGTGDDCISIGDETTDLHIENVKCGPGHGI  245

Query  751   SVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVKN  927
             SVGS+G+ P E+ V GI V    F GT NGVR+KTWP++   + ++++H+  + M +V  
Sbjct  246   SVGSMGKNPAEKDVTGITVKKCTFTGTSNGVRVKTWPSAPATLKISNLHFEDLTMNNVSY  305

Query  928   PIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEI  1107
             P+VIDQ+YCP N C+K KPS ++IS ++ K+++GT+ TKE ++ +CSS  PC++V+I +I
Sbjct  306   PVVIDQQYCPWNLCTKDKPSLIQISGLTVKNVRGTANTKEALLFSCSSSKPCQNVQISDI  365

Query  1108  DLTF----KGGAKTICSNVKPKLTGKQCPKV  1188
             DL +         T+C NVKP ++GKQ P +
Sbjct  366   DLKYVNSIPANFTTVCENVKPTVSGKQNPPI  396



>ref|XP_004490643.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=394

 Score =   354 bits (909),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 175/350 (50%), Positives = 236/350 (67%), Gaps = 5/350 (1%)
 Frame = +1

Query  136   NVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDP  315
             N D+   L  AWKEAC + + S +V+P G + + Q+ LEGPCKAP+E+K+  I++AP +P
Sbjct  37    NGDITNALKNAWKEACESRSRSKVVVPSGRYKLQQIDLEGPCKAPIEVKVNGIIQAPKNP  96

Query  316   KNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTN  489
              +++G+ +W+    ++ FTLSG GT DGQG +  +   + G   +  +L  N    FL N
Sbjct  97    FHLNGQDQWIRFQYINFFTLSGKGTFDGQGEM-AWKQNDCGRNTNCKRLAMNFGFAFLNN  155

Query  490   SVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGT  669
             SVI+DI + +SK FH NV G  N+TF +F + AP +SPNTDGIHI +   + + +S IG+
Sbjct  156   SVIKDINSKDSKYFHANVFGCNNVTFTNFNINAPESSPNTDGIHIGKSSRVKISNSKIGS  215

Query  670   GDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRI  849
             GDDCISLGDG   + I  VTCGPGHGISVGSLG+ P E PV  + V N     TDNGVRI
Sbjct  216   GDDCISLGDGSTQITIQNVTCGPGHGISVGSLGKYPNEDPVVDLIVKNCTLNNTDNGVRI  275

Query  850   KTWP-NSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIK  1026
             KTWP  S   + + +H+  I M +V NPI+IDQ+YCP N+CSKQ PSK+KI KV +K+I+
Sbjct  276   KTWPGTSVISIASHLHFEDIVMVNVSNPIIIDQQYCPWNQCSKQSPSKIKIRKVIFKNIR  335

Query  1027  GTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI-CSNVKPKLTGK  1173
             GTSAT+E V L CS GVPCE V + +I+L+F G   T  C+NV PK+  K
Sbjct  336   GTSATQEGVSLICSRGVPCEAVVLSDINLSFNGSEVTAKCANVNPKIRRK  385



>ref|XP_002884669.1| hypothetical protein ARALYDRAFT_478121 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60928.1| hypothetical protein ARALYDRAFT_478121 [Arabidopsis lyrata subsp. 
lyrata]
Length=397

 Score =   354 bits (909),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/377 (45%), Positives = 256/377 (68%), Gaps = 8/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
             F++ LL     + +  + +    D+   L++A+  AC A T S +VIPKG F + ++ + 
Sbjct  11    FVICLLGFSANAEVFRIGSPPGSDITQALLRAFTSACQAPTPSKVVIPKGQFRLGEIMMS  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCK+PVE+ ++  + A  D  ++ GK++W++  R+D F L+GGGT DG+GN     +  
Sbjct  71    GPCKSPVEITLLGTVLA--DGNSIHGKEKWVVFQRMDGFRLNGGGTFDGEGNAAWRVNNC  128

Query  430   EKGFKGDKLP-NNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPN  606
              K F+  KLP  ++  +F+TN+ IRDI+++++K FH+NV+G KN+TF++  + AP  SPN
Sbjct  129   HKTFECKKLPIVSIRFDFVTNAEIRDISSIDAKNFHINVIGAKNMTFNNVKIMAPAESPN  188

Query  607   TDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGER  786
             TDGIH+ R +G+++ +S I TGDDC+S+GDG+ NL +  V CGPGHGISVGSLGR   E+
Sbjct  189   TDGIHLGRSVGVSIINSRIATGDDCVSVGDGMVNLLVKNVVCGPGHGISVGSLGRYGHEQ  248

Query  787   PVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNN  963
              V GI V N     TDNG+RIKTWP++      ++IH+  I + +V NPI+IDQEYCP N
Sbjct  249   DVSGIRVINCTLQETDNGLRIKTWPSAACSTTASNIHFENIILRNVSNPILIDQEYCPWN  308

Query  964   ECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AK  1134
             +C+KQK S +K++ +S+K I+GTS  K+ V L CS G PCE+V++G+I++ + G    A 
Sbjct  309   QCNKQKSSSIKLANISFKRIRGTSGNKDAVKLLCSKGYPCENVQVGDINIQYTGADGPAT  368

Query  1135  TICSNVKPKLTGKQCPK  1185
              +CSNV+PKL G Q PK
Sbjct  369   FMCSNVRPKLVGTQFPK  385



>gb|KHN43962.1| Polygalacturonase [Glycine soja]
Length=389

 Score =   354 bits (908),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 231/352 (66%), Gaps = 3/352 (1%)
 Frame = +1

Query  136   NVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDP  315
             + D+      AWK ACA+T+AS I+IP GT+ M  V ++GPC AP+E++I   ++AP DP
Sbjct  35    DADITQAFTDAWKVACASTSASKILIPNGTYKMKAVDVKGPCMAPIEIQIDGTIQAPADP  94

Query  316   KNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPN-NLSLNFLTNS  492
               +DG K+W+ +G  +  TLSG G  DGQG +    +  +     K+P+ N   NF+ +S
Sbjct  95    NALDGAKQWVKIGYANFITLSGKGIFDGQGAIAWKQNDCRTNTNCKIPSMNFGFNFVNHS  154

Query  493   VIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  672
             ++R IT+ +SK FHV + G  N TFD F + AP  S NTDGIHI +   + + ++ I TG
Sbjct  155   MVRGITSKDSKSFHVILFGCYNFTFDGFHISAPETSINTDGIHIGKSTDVKILNTNIATG  214

Query  673   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  852
             DDC+SLGDG  ++ +  V CGPGHGISVGSLG+   E PVK + V N     T+NGVRIK
Sbjct  215   DDCVSLGDGSIHVTVQNVNCGPGHGISVGSLGKYTNEEPVKDLLVKNCTLTNTENGVRIK  274

Query  853   TWPN-SHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKG  1029
             TWPN S   +VTD+H+  I M DV NP++IDQEYCP N C KQ PSK+KI KVS+ DIKG
Sbjct  275   TWPNSSQTYLVTDMHFEDITMVDVLNPVIIDQEYCPWNHCPKQSPSKIKIRKVSFSDIKG  334

Query  1030  TSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI-CSNVKPKLTGKQCP  1182
             TS +KE VI  CS  VPCEDVE+  + LTFKG      C+NV+PK  GK  P
Sbjct  335   TSKSKEGVIFICSKAVPCEDVELNNVALTFKGDPIVAKCANVRPKFAGKAPP  386



>ref|XP_003518573.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=391

 Score =   353 bits (907),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 231/352 (66%), Gaps = 3/352 (1%)
 Frame = +1

Query  136   NVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDP  315
             + D+      AWK ACA+T+AS I+IP GT+ M  V ++GPC AP+E++I   ++AP DP
Sbjct  37    DADITQAFTDAWKVACASTSASKILIPNGTYKMKAVDVKGPCMAPIEIQIDGTIQAPADP  96

Query  316   KNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPN-NLSLNFLTNS  492
               +DG K+W+ +G  +  TLSG G  DGQG +    +  +     K+P+ N   NF+ +S
Sbjct  97    NALDGAKQWVKIGYANFITLSGKGIFDGQGAIAWKQNDCRTNTNCKIPSMNFGFNFVNHS  156

Query  493   VIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  672
             ++R IT+ +SK FHV + G  N TFD F + AP  S NTDGIHI +   + + ++ I TG
Sbjct  157   MVRGITSKDSKSFHVILFGCYNFTFDGFHISAPETSINTDGIHIGKSTDVKILNTNIATG  216

Query  673   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  852
             DDC+SLGDG  ++ +  V CGPGHGISVGSLG+   E PVK + V N     T+NGVRIK
Sbjct  217   DDCVSLGDGSIHVTVQNVNCGPGHGISVGSLGKYTNEEPVKDLLVKNCTLTNTENGVRIK  276

Query  853   TWPN-SHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKG  1029
             TWPN S   +VTD+H+  I M DV NP++IDQEYCP N C KQ PSK+KI KVS+ DIKG
Sbjct  277   TWPNSSQTYLVTDMHFEDITMVDVLNPVIIDQEYCPWNHCPKQSPSKIKIRKVSFSDIKG  336

Query  1030  TSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI-CSNVKPKLTGKQCP  1182
             TS +KE VI  CS  VPCEDVE+  + LTFKG      C+NV+PK  GK  P
Sbjct  337   TSKSKEGVIFICSKAVPCEDVELNNVALTFKGDPIVAKCANVRPKFAGKAPP  388



>ref|XP_008449696.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Cucumis 
melo]
Length=404

 Score =   354 bits (908),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 184/365 (50%), Positives = 249/365 (68%), Gaps = 11/365 (3%)
 Frame = +1

Query  112   IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMA  291
             I    AK N D+   L  AWKEACA+TT S ++IPKGT+ +TQ +L+GPCK+ +EL++  
Sbjct  32    ITKYGAKPNADITAALASAWKEACASTTPSKVLIPKGTYGLTQSNLKGPCKSSIELQLEG  91

Query  292   ILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKG--DKLPNN  465
              ++A  D K  DG    L++  VD  T+SG G +DGQG    +   +   K    KLP N
Sbjct  92    TVQASVDVKG-DG---LLLLEYVDQLTVSGTGVVDGQGKT-AWGKNDCHLKKICTKLPMN  146

Query  466   LSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGIT  645
             L  NF+TNS+++DIT+L+SK +H N+L  KNLTFDH T+ APGNSPNTDGIH+     I 
Sbjct  147   LKFNFVTNSIVKDITSLDSKNYHFNLLACKNLTFDHVTITAPGNSPNTDGIHVGDSEQIN  206

Query  646   VKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFI  825
             + ++ I TGDDCIS+G   + + I+ VTCGPGHGIS+GSLG+   E+ + G+ V   K  
Sbjct  207   ILNTNIATGDDCISVGISNKQIVISDVTCGPGHGISIGSLGKYTNEKELVGVTVKKCKLT  266

Query  826   GTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKIS  1002
             GT NGVRIKTWP+S      +D+H+  IEM +V NP++IDQEYCP N+C+++ PSK+KIS
Sbjct  267   GTTNGVRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVLIDQEYCPWNQCNRKVPSKIKIS  326

Query  1003  KVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGA---KTICSNVKPKLTGK  1173
             KVS+K+I+GTSAT   V L CS   PCE VE+ +IDLT+ G     K+ C+NVKP ++GK
Sbjct  327   KVSFKNIRGTSATPVAVKLVCSQSNPCEGVEVADIDLTYSGSEGPIKSQCANVKPVISGK  386

Query  1174  QCPKV  1188
             Q P +
Sbjct  387   QNPPI  391



>ref|NP_187440.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21193.1|AC013483_17 putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE74609.1| polygalacturonase-like protein [Arabidopsis thaliana]
Length=397

 Score =   353 bits (907),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 170/378 (45%), Positives = 257/378 (68%), Gaps = 11/378 (3%)
 Frame = +1

Query  79    LFLLAHFGESA----IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVS  246
             +F++   G SA    ++ + +    D+   L++A+  AC + T   +VIPKG F + ++ 
Sbjct  10    IFVICLLGFSANAHEVLRLTSSPGSDITQALLRAFTTACQSPTPRKVVIPKGQFKLGEIM  69

Query  247   LEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPS  426
             + GPCK+PVE+ ++  + A  D  ++ GK++W++  R+D F L+GGGT DG+GN     +
Sbjct  70    MSGPCKSPVEITLLGTVLA--DGNSIHGKEKWVVFQRMDGFRLNGGGTFDGEGNAAWRVN  127

Query  427   K-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  603
                K F+  KLP ++  +F+TN+ IRDI+++++K FH+NV+G KN+TFD+  + AP  SP
Sbjct  128   NCHKTFECKKLPISIRFDFVTNAEIRDISSIDAKNFHINVIGAKNMTFDNVKIMAPAESP  187

Query  604   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  783
             NTDGIH+ R +G+++ +S I TGDDC+S+GDG+ NL +  V CGPGHGISVGSLGR   E
Sbjct  188   NTDGIHLGRSVGVSIINSRISTGDDCVSVGDGMVNLLVKNVVCGPGHGISVGSLGRYGHE  247

Query  784   RPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPN  960
             + V GI V N     TDNG+RIKTWP++      ++IH+  I + +V NPI+IDQEYCP 
Sbjct  248   QDVSGIRVINCTLQETDNGLRIKTWPSAACSTTASNIHFENIILRNVSNPILIDQEYCPW  307

Query  961   NECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---A  1131
             N+C+KQK S +K++ +S++ I+GTS  K+ V L CS G PCE+V++G+I++ + G    A
Sbjct  308   NQCNKQKSSSIKLANISFRRIRGTSGNKDAVKLLCSKGYPCENVQVGDINIQYTGADGPA  367

Query  1132  KTICSNVKPKLTGKQCPK  1185
               +CSNV+PKL G Q PK
Sbjct  368   TFMCSNVRPKLVGTQFPK  385



>ref|XP_010464425.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   353 bits (906),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 175/377 (46%), Positives = 251/377 (67%), Gaps = 7/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
              I+ LL     +A+  + + +  D+   L+KA+  AC   + S +VIPKG F + ++ + 
Sbjct  11    LIICLLGISANAAVFPIGSPSGSDITQALLKAFTAACQCPSPSKVVIPKGEFKLGEIEMR  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCKAP+E+ I   +KA  D   + GK +W++ G ++ F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIEITIQGTVKA--DGNAIQGKDKWVVFGNINGFKLNGGGAFDGEGNASWRVNNC  128

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F   KLP ++  +F+ NS IRDI+++++K FH+NVLG KN+T ++  + AP +SPNT
Sbjct  129   HKTFLCKKLPISIRFDFVLNSEIRDISSIDAKNFHINVLGAKNMTMNNIKIIAPEDSPNT  188

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGHEQD  248

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V GI + N     TDNG+RIKTWP++      +DIH+  I +++V NPI+IDQEYCP N+
Sbjct  249   VSGIRIINCTLQQTDNGLRIKTWPSAACSTTASDIHFQDIILKNVNNPILIDQEYCPWNQ  308

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKT  1137
             C+KQKPS +K+  +S+K+I+GTS  K+ V L CS G PC++VEIG +D+ + G    A  
Sbjct  309   CNKQKPSTIKLVNISFKNIRGTSGNKDAVKLLCSRGYPCQNVEIGNVDIKYTGADGPATF  368

Query  1138  ICSNVKPKLTGKQCPKV  1188
              CSNV PKL+G Q PK 
Sbjct  369   QCSNVSPKLSGIQNPKA  385



>gb|KFK38252.1| hypothetical protein AALP_AA3G089100 [Arabis alpina]
Length=394

 Score =   353 bits (905),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 173/377 (46%), Positives = 247/377 (66%), Gaps = 7/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
             F+  LL     +    + + +  D+   L+KA+  AC + + S +VIPKG F + ++ L 
Sbjct  11    FVFCLLGFSANAEEFTIGSSSGSDITQELLKAFTSACQSPSRSRVVIPKGEFKLGEIELR  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCKAP+++ +   +KA  D     GK +W++ G ++ F L GGG  DG+GN     +  
Sbjct  71    GPCKAPIDIVLRGTVKA--DGNTAYGKDKWVVFGNINGFKLHGGGAFDGEGNAAWRVNNC  128

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F+  KLP ++  +F+ N++I+DI+++++K FH+NVLG KN+T  +  + AP +SPNT
Sbjct  129   HKTFECKKLPISIRFDFIENAIIKDISSIDAKNFHINVLGAKNMTMSNIKIIAPEDSPNT  188

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  G+ + +S I TGDDCIS+GDG++NL + GV CGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEGVVCGPGHGISVGSLGRYGMEQD  248

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V GI V N     TDNG+RIKTWP+S      +DIH+  I ++DV NPI+IDQEYCP N+
Sbjct  249   VSGITVKNCTLQSTDNGLRIKTWPSSACSTTASDIHFEDIILKDVSNPILIDQEYCPWNQ  308

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKT  1137
             C+KQK S +K+  +S+K I+GTS  K+ V L CS G PC++VEIG+ID+ + G    A  
Sbjct  309   CNKQKSSTIKLVNISFKKIRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIRYNGADGPATF  368

Query  1138  ICSNVKPKLTGKQCPKV  1188
              CSNV PK+ G Q PK 
Sbjct  369   QCSNVSPKIMGTQIPKA  385



>ref|XP_004295347.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=412

 Score =   353 bits (907),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 174/351 (50%), Positives = 235/351 (67%), Gaps = 7/351 (2%)
 Frame = +1

Query  130   KANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPP  309
             KA  D+   L  AWK+ACA+T+ S I+IPKGT+P+ +    GPCKAP+E+++   L+AP 
Sbjct  41    KAGSDISQALTNAWKDACASTSPSKIIIPKGTYPLKEAEFSGPCKAPIEMQLQGTLQAPE  100

Query  310   DPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNF--L  483
             D   +     W+    +  FTLSGGG  DGQG  + + + +   K  K  + +++ F  +
Sbjct  101   DSTQLTKPDTWIGFLYISDFTLSGGGVFDGQG-AKAWKANDCQ-KNPKCSSTINIRFHQM  158

Query  484   TNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVI  663
               S+++DIT+LNSK FH N++G + LTFDH TV APG+SPNTDGIHI R  G+ + + VI
Sbjct  159   KKSLVKDITSLNSKNFHFNIIGAEQLTFDHVTVTAPGDSPNTDGIHIGRSNGVNITNCVI  218

Query  664   GTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGV  843
             GTGDDCIS+GDG + L I  VTCGPGHGISVGSLG+   E PV GIFV N     T NGV
Sbjct  219   GTGDDCISIGDGTKQLTIEKVTCGPGHGISVGSLGKYDNEEPVAGIFVKNCTISKTQNGV  278

Query  844   RIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKD  1020
             R+KTWPN    +  +DIH+  I M++V+NPIV+DQEYCP ++C K   SK+KIS VS+K+
Sbjct  279   RVKTWPNGPSAITASDIHFEDIIMDNVQNPIVLDQEYCPYDQCDKSASSKIKISNVSFKN  338

Query  1021  IKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAK--TICSNVKPKLT  1167
             I+GTSAT   V +ACS   PC+ V + +IDL   G  +  + C+N KP +T
Sbjct  339   IRGTSATALGVKVACSKSNPCDQVVMSDIDLKLSGAGELTSQCTNTKPTIT  389



>ref|XP_010657416.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   353 bits (905),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 174/386 (45%), Positives = 241/386 (62%), Gaps = 12/386 (3%)
 Frame = +1

Query  70    TFILFLLAHFGE---SAIINVA-----AKANVDVGPLLMKAWKEACAATTASTIVIPKGT  225
             T ++ LLA   E     I +V      A  N D+   L+KAW +AC++  AST++ P G 
Sbjct  10    TSLMLLLASAAEVSCDTIFDVTKYGARADGNTDISQALLKAWGDACSSPVASTVMTPDGX  69

Query  226   FPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQG  405
               + Q+++ GPCK P+   +   +KA  D         W+   ++D FTLSGGG  DGQG
Sbjct  70    HALGQITIGGPCKDPINFIVQGSVKALMDTSRFKAXAGWIAFRQIDQFTLSGGGVFDGQG  129

Query  406   NVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVK  585
                           ++LP NL  NF+TNS++++IT+ +S  FH+N+LG KNLTF +  + 
Sbjct  130   KTVWGTKCPSSAYCNQLPINLRFNFITNSMVKNITSRDSNQFHINLLGCKNLTFYNVAIS  189

Query  586   APGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSL  765
             AP    NTDGIHI R +GI +  S I TGDDC+S+GDG E + +  VTCGPGHG SVGSL
Sbjct  190   APEERLNTDGIHIGRSLGINITYSTIETGDDCVSIGDGSEQINMQRVTCGPGHGTSVGSL  249

Query  766   GRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQ  945
             G+ P E PV GI V N     T NGVR+KTWP SH G  + +H+  I M +V NPI+IDQ
Sbjct  250   GKYPNEEPVVGISVKNCTRTNTQNGVRVKTWPASHQGTASXMHFEDIVMNNVGNPIIIDQ  309

Query  946   EYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFK-  1122
             EYCP+N+C+ + PS++ +S VS+++I+GT++T+  V L CS GVPCED E+G+I+L +  
Sbjct  310   EYCPHNQCNLKIPSRIMLSNVSFRNIRGTTSTQVAVKLVCSQGVPCEDAELGDINLKYNG  369

Query  1123  --GGAKTICSNVKPKLTGKQCPKVTC  1194
               G A + C N+KP L G Q P+ TC
Sbjct  370   KVGHAMSQCKNIKPNLLGTQLPR-TC  394



>ref|XP_010486355.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   353 bits (905),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 173/377 (46%), Positives = 252/377 (67%), Gaps = 7/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
             FI+ LL     + +  + + +  D+   L+KA+  AC + + S +VIPKG F + ++ + 
Sbjct  11    FIICLLRISANAEVFTIGSSSGSDITQALLKAFTAACQSPSPSKVVIPKGEFKLGEIEMR  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCKAP+E+ I   +KA  +   + GK +W++ G ++ F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIEVTIQGTVKA--NGNAIQGKDKWVVFGNINGFKLNGGGAFDGEGNASWRVNNC  128

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F+  KLP ++  +F+ NS I+DI+++++K FH+NVLG KN+T ++  + AP +SPNT
Sbjct  129   HKTFQCKKLPISIRFDFVLNSEIKDISSIDAKNFHINVLGAKNMTMNNIKIIAPEDSPNT  188

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGHEQD  248

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V GI + N     TDNG+RIKTWP++      +DIH+  I +++V NPI+IDQEYCP N+
Sbjct  249   VSGIRIINCTLQQTDNGLRIKTWPSAACSTTASDIHFQDIIVKNVSNPILIDQEYCPWNQ  308

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKT  1137
             C+KQKPS +K+  +S+K+I+GTS  K+ V L CS G PC++VEIG +D+ + G    A  
Sbjct  309   CNKQKPSTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGNVDIKYTGADGPATF  368

Query  1138  ICSNVKPKLTGKQCPKV  1188
              CSNV PKL G Q PK 
Sbjct  369   QCSNVSPKLLGTQNPKA  385



>ref|XP_010547226.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   353 bits (905),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 180/390 (46%), Positives = 258/390 (66%), Gaps = 11/390 (3%)
 Frame = +1

Query  43    MATISYCAFTFILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEA----CAATTASTIV  210
             M   +  +  F L+LL+    + + ++    +V VG  + +A+++A    C +   S++V
Sbjct  1     MVAKTLASVLFALYLLSFSANAEVFDIRKFGHVSVGSDITQAFRQAFQAACQSPRPSSVV  60

Query  211   IPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGT  390
             IPKGT+ + ++++ GPCKAPVE+ +   L+A  +   + G ++W++   ++ F L+GGG 
Sbjct  61    IPKGTYKLGEINMIGPCKAPVEVTVNGHLQA--NGNALAGHEKWVVFRYINGFKLNGGGI  118

Query  391   LDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTF  567
              DGQGN     +   K     KLP ++  +F+ N  +RDIT+L++K FHVNVLG KN TF
Sbjct  119   FDGQGNAAWKSNDCHKNNNCKKLPISIRFDFVLNGEVRDITSLDAKNFHVNVLGCKNFTF  178

Query  568   DHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHG  747
             D+  +KAP  SPNTDGIH+ R  G+ +  S I TGDDCIS+GDG++NL +  VTCGPGHG
Sbjct  179   DNVKIKAPAESPNTDGIHLGRSDGVNILRSFISTGDDCISIGDGMKNLHVERVTCGPGHG  238

Query  748   ISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVK  924
             IS+GSLGR   E PV GI++ N     TDNG+RIKT+P+S   + V+DIH+  I +++V 
Sbjct  239   ISIGSLGRYTIEEPVAGIWIKNCTLQETDNGLRIKTYPSSASSITVSDIHFEDIIVKNVS  298

Query  925   NPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGE  1104
             NPI+IDQEYCP N+C+K KPS VK+  +S+K I+GTS  K+ V L CS GVPC +VE+G+
Sbjct  299   NPILIDQEYCPWNKCNKAKPSTVKLVNISFKRIRGTSGNKDAVRLLCSKGVPCTNVEVGD  358

Query  1105  IDLTFKGG---AKTICSNVKPKLTGKQCPK  1185
             IDL + G    A   CSNV PKL+G Q PK
Sbjct  359   IDLRYGGADGPATFECSNVTPKLSGTQFPK  388



>gb|AFK35534.1| unknown [Medicago truncatula]
Length=407

 Score =   353 bits (905),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 189/394 (48%), Positives = 251/394 (64%), Gaps = 19/394 (5%)
 Frame = +1

Query  13    NTKI*VTNLKMATISYCAFTFILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAAT  192
             +T I V+ L +A   +CA   ++  ++ FG           N D+   L  AWKEACA+T
Sbjct  4     STAIIVSFLFLA--EFCAVQSLVLDISKFG--------GAPNSDITLALGNAWKEACAST  53

Query  193   TASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFT  372
             TAS IVIP GT+ M  + L+GPCKAP+E+++   ++AP DP  +    +W+    ++H T
Sbjct  54    TASKIVIPGGTYKMGGIELKGPCKAPIEVQVDGTIQAPADPSQIKAADQWVKFLYMEHLT  113

Query  373   LSGGGTLDGQGNV---QVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDITTLNSKLFHV  537
             LSG G  DGQG     Q  P+     K    K+  NL   F+ NS++  +T+ +SK FHV
Sbjct  114   LSGKGVFDGQGATAYKQAQPAAAWSGKKSNVKILMNLGFMFVNNSMVTGVTSKDSKNFHV  173

Query  538   NVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKI  717
              VLG  N TFD FTV AP +SPNTDGIH+ R   + + ++ IGTGDDC+SLGDG   + +
Sbjct  174   MVLGCNNFTFDGFTVTAPSDSPNTDGIHMGRSTDVKILNTNIGTGDDCVSLGDGSRKITV  233

Query  718   TGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--DI  891
              GV CGPGHGISVGSLGR   E  V+G+ V +     T NGVRIKTWP++ PG +T  DI
Sbjct  234   QGVKCGPGHGISVGSLGRYTTEDNVEGVTVKSCTLTATQNGVRIKTWPDA-PGTITVSDI  292

Query  892   HYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSS  1071
             H+  I M +V NPI+IDQEYCP N C+K+ PSKVK+SK S+K+I+GTS   E V+L CSS
Sbjct  293   HFEDITMNNVTNPIIIDQEYCPWNACNKKVPSKVKLSKTSFKNIQGTSGAPEGVVLVCSS  352

Query  1072  GVPCEDVEIGEIDLTFKGG-AKTICSNVKPKLTG  1170
              VPC+ VE+  +D+ F G  A   CSNVKP +TG
Sbjct  353   TVPCDGVELNNVDVKFNGKPAIAKCSNVKPTVTG  386



>ref|XP_006407793.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
 gb|ESQ49246.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
Length=396

 Score =   352 bits (903),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/377 (46%), Positives = 248/377 (66%), Gaps = 7/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
              +L LL     + +  + + +  D+   L+KA+  AC +T+ S +VIPKG F + ++ + 
Sbjct  11    LVLCLLGISANAEVFTIGSSSGSDITQALLKAFTSACQSTSPSKVVIPKGEFKLGEIEMR  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCKAPVE+ +   +KA  D     GK +W++ G ++ F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPVEITLQGTVKA--DGNTNHGKDKWVVFGNINGFKLNGGGAFDGEGNAAWRVNNC  128

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F+  KLP ++  +F+ N+ I+DI+++++K FH+NVLG KN+T D+  + AP +SPNT
Sbjct  129   HKTFECKKLPISVRFDFVENAEIKDISSIDAKNFHINVLGAKNMTMDNIKITAPEDSPNT  188

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  V CGPGHGISVGSLGR   E  
Sbjct  189   DGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVVCGPGHGISVGSLGRYGHEED  248

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V GI V N     TDNG+RIKTWP++      +DIH+  I +++V NPI+IDQEYCP N+
Sbjct  249   VSGIRVVNCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVSNPILIDQEYCPWNQ  308

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKT  1137
             C+KQK S +K+  +S+K+I+GTS  K+ V L CS G PC+ VEIG+ID+ + G    A  
Sbjct  309   CNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQKVEIGDIDIAYSGADGPATF  368

Query  1138  ICSNVKPKLTGKQCPKV  1188
              CSNV P+L G Q PK 
Sbjct  369   QCSNVSPQLLGSQSPKA  385



>ref|XP_003544285.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=386

 Score =   351 bits (901),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 176/355 (50%), Positives = 239/355 (67%), Gaps = 9/355 (3%)
 Frame = +1

Query  136   NVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDP  315
             N D+   L KAW++AC +TT S +VIP   + + Q+   GPCKAP+E+ +  I+KAP +P
Sbjct  31    NGDITMALQKAWRDACVSTTPSKVVIPSNKYKLRQIDFMGPCKAPIEILVNGIIKAPKNP  90

Query  316   KNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNLSLNFLT  486
              ++ G+ +W+  G ++  TLSG GT  G+G +   Q   S  K  K  KL  N    F+ 
Sbjct  91    FDVSGQNQWVRFGYINFLTLSGNGTFHGRGKMAWKQNNCSTNKNCK--KLAMNFGFGFVN  148

Query  487   NSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIG  666
             NSVI DIT+ +SK FHVNV G KN++F +F V +P  SPNTDGIHI +   + + +S I 
Sbjct  149   NSVIHDITSKDSKYFHVNVFGCKNISFTNFRVSSPAYSPNTDGIHIGKSTQVKITNSKID  208

Query  667   TGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVR  846
             TGDDCISLGDG + + I  VTCGPGHGISVGSLG+   E  V+ + V N     T+NG+R
Sbjct  209   TGDDCISLGDGSKEVTILNVTCGPGHGISVGSLGKYSNEDSVEDVIVKNCTLKNTNNGLR  268

Query  847   IKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDI  1023
             IKTWP +    + +D+H+  I M +V NPI+IDQEYCP N+CSKQ PSK+KISKV++K+I
Sbjct  269   IKTWPGTAIISLASDLHFEDITMINVSNPIIIDQEYCPWNQCSKQSPSKIKISKVTFKNI  328

Query  1024  KGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI--CSNVKPKLTGKQCP  1182
             +GTSAT+E + L CSSG+PCE VE+ +I+L F G       C+NVKPK+ G++ P
Sbjct  329   RGTSATQEGITLVCSSGIPCETVELSDINLRFNGTTLVTAKCANVKPKI-GRKAP  382



>sp|Q39786.1|PGLR_GOSHI RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium hirsutum]
 gb|AAA82167.1| polygalacturonase [Gossypium hirsutum]
Length=407

 Score =   352 bits (902),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/380 (46%), Positives = 249/380 (66%), Gaps = 12/380 (3%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAK------ANVDVGPLLMKAWKEACAATTASTIVIPKGTFPM  234
              +LF+ A   +S   +V AK         D+    + AWKEACA+ T ST+VIPKGT+ +
Sbjct  15    LLLFISASKVQSDAFDVVAKFGAKADGKTDLSKPFLDAWKEACASVTPSTVVIPKGTYLL  74

Query  235   TQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQ  414
             ++V+LEGPCKAP+E+ +   ++AP DP        W+    V++F + GGG  DGQG++ 
Sbjct  75    SKVNLEGPCKAPIEINVQGTIQAPADPSAFK-DPNWVRFYSVENFKMFGGGIFDGQGSIA  133

Query  415   VYPS--KEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKA  588
                +  + + F+  KLP N+  +FLTN++I+DIT+ +SKLFH+NV   KN+T +   ++A
Sbjct  134   YEKNTCENREFRS-KLPVNIRFDFLTNALIQDITSKDSKLFHINVFACKNITLERLKIEA  192

Query  589   PGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLG  768
             P  SPNTDGIH+ +  G+ +  S I TGDDCIS+GDG +N+ I  +TCGPGHGIS+GSLG
Sbjct  193   PDESPNTDGIHMGKSEGVNIIASDIKTGDDCISIGDGTKNMVIKEITCGPGHGISIGSLG  252

Query  769   RTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQE  948
             +   E PV+GI +SN     T NG RIKTWP  H G V++IH+  I M +V +PI+IDQ+
Sbjct  253   KFQNEEPVEGIKISNCTITNTSNGARIKTWPGEHGGAVSEIHFEDITMNNVSSPILIDQQ  312

Query  949   YCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG  1128
             YCP N+C K + SKVK+S +S+K+I+GTSA  E +   CS   PC++VE+ +ID+   G 
Sbjct  313   YCPWNKCKKNEESKVKLSNISFKNIRGTSALPEAIKFICSGSSPCQNVELADIDIKHNGA  372

Query  1129  --AKTICSNVKPKLTGKQCP  1182
               A + C NVKP  +GK  P
Sbjct  373   EPATSQCLNVKPITSGKLNP  392



>ref|XP_010418169.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=410

 Score =   352 bits (902),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 181/378 (48%), Positives = 253/378 (67%), Gaps = 11/378 (3%)
 Frame = +1

Query  79    LFLLAHFGESA----IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVS  246
             +F+L   G SA    + N+ +    D+   L+KA+  AC  TT S +VIPKG F + ++ 
Sbjct  23    IFVLCLVGFSANAHEVFNINSPPGSDITQALLKAFTAACQCTTPSRVVIPKGEFKLCEII  82

Query  247   LEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPS  426
             + GPCKAPVE+ ++  L A  D  N+ GK +W++  +++ F L+GGGT DG+G+     +
Sbjct  83    MTGPCKAPVEITLLGTLLA--DGSNIHGKDKWVVFRKINGFKLNGGGTFDGEGSAAWRVN  140

Query  427   K-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  603
                K     KLP +L  +F+TN+ IRDI++++SK FHVNV+G  N+TFD+  + AP  SP
Sbjct  141   NCHKTSNCKKLPISLRFDFVTNAEIRDISSVDSKNFHVNVIGAMNMTFDNVKILAPAESP  200

Query  604   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  783
             NTDGIH+ R  G+++ +S I TGDDCIS+GDG+ NL +  V CGPGHGIS+GSLGR P E
Sbjct  201   NTDGIHLGRSDGVSIINSRISTGDDCISVGDGMVNLLVKNVVCGPGHGISIGSLGRYPHE  260

Query  784   RPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTD-IHYHKIEMEDVKNPIVIDQEYCPN  960
             + V+GI V N     TDNG+RIKTWP +   +V   IH+  I +++V NPI+IDQEYCP 
Sbjct  261   QNVRGIRVINCTVQETDNGLRIKTWPTAACSIVASGIHFEDIILKNVSNPILIDQEYCPW  320

Query  961   NECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---A  1131
             N+C+KQK S +K+  VS+ +I+GTSA K+ V L CS G PCE+V +G I++ + G    A
Sbjct  321   NQCNKQKSSSIKLVDVSFTNIRGTSANKDAVKLLCSKGYPCENVVVGNINIEYTGRDGPA  380

Query  1132  KTICSNVKPKLTGKQCPK  1185
               +CSNVKPKL G Q PK
Sbjct  381   TFMCSNVKPKLVGIQNPK  398



>gb|ABY21306.1| pollen allergen Pla o 2 [Platanus orientalis]
Length=378

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 167/364 (46%), Positives = 244/364 (67%), Gaps = 6/364 (2%)
 Frame = +1

Query  118   NVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCK-APVELKIMAI  294
             +  AK + D+   +MKAW+ ACA+   ST++IP G + M +V LEGPCK + +  ++  +
Sbjct  15    DYGAKGSGDISQAVMKAWEAACASPGPSTVLIPTGNYIMGEVLLEGPCKGSKIGFQLDGV  74

Query  295   LKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLS  471
             +KAP D       + W++   VD  T+SG GT DGQG      +  +K    ++ P N+ 
Sbjct  75    VKAPADVSAFK-SEGWVVFNHVDGLTVSGKGTFDGQGQKAWAANNCDKDENCNRPPMNIR  133

Query  472   LNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVK  651
              NFL N+V+RDIT++NSK+FH+NVL   N++F H T+ APG S NTDGIHI    G+T+ 
Sbjct  134   FNFLKNAVVRDITSMNSKMFHINVLECDNISFQHVTISAPGTSINTDGIHIGLSRGVTIT  193

Query  652   DSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGT  831
             D+ I TGDDC+S+G G +N+ +T V CGPGHGISVGSLG+   E+ V+GI V+   F GT
Sbjct  194   DTNIATGDDCVSIGPGSQNVTVTKVNCGPGHGISVGSLGKYKDEKDVRGITVTGCTFTGT  253

Query  832   DNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVS  1011
              NGVR+KTWP+S PGV TD+ +  + M++V+NP+++DQEYCP  +CS + PS+VK+S + 
Sbjct  254   SNGVRVKTWPDSPPGVATDMAFEDLTMKNVQNPVILDQEYCPYGQCSLKAPSRVKLSNIK  313

Query  1012  YKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKTICSNVKPKLTGKQCP  1182
             + +I+GTS+  + +++ACS G PC ++EIGEI+L        A + C+N KP  +GKQ P
Sbjct  314   FNNIRGTSSGPDAIVIACSHGFPCSNLEIGEINLALHAAGAPANSTCTNAKPIFSGKQVP  373

Query  1183  KVTC  1194
              + C
Sbjct  374   AIKC  377



>ref|XP_004170151.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=404

 Score =   351 bits (901),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 184/386 (48%), Positives = 248/386 (64%), Gaps = 17/386 (4%)
 Frame = +1

Query  70    TFILFLLAHFGESA----IINVAAKANV----DVGPLLMKAWKEACAATTASTIVIPKGT  225
             TF++ LL+   E+     I ++    N+    DV   L  AW +ACA+   S +VIPKGT
Sbjct  13    TFLMSLLSFTIEARSHVDIFSLRKYGNIVSGADVTEALKDAWNDACASDRPSAVVIPKGT  72

Query  226   FPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQG  405
             F + +   +GPCK+P+E ++   L+AP  P        W+    VD   LSGGG  DGQG
Sbjct  73    FKVREGEFKGPCKSPIEFRVHGTLQAPKHPHG----DSWITFAYVDRLRLSGGGVFDGQG  128

Query  406   NVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTV  582
                   +   K     KLP +L  +F+TNS++R IT+L+SK FHVN+LG  NLTF    +
Sbjct  129   KAGWEKNDCHKRIDCAKLPISLRFDFITNSIVRRITSLDSKNFHVNILGCNNLTFQGVNI  188

Query  583   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  762
              AP NSPNTDGIHI R IGI++  S I TGDDCISLGDG + +K+  V CGPGHGIS+GS
Sbjct  189   IAPENSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRIKVNNVICGPGHGISIGS  248

Query  763   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVI  939
             LG+   E PV+G+ V+N   I T NGVRIKTWP S   G+ T++H+  I M +V NPI+I
Sbjct  249   LGKYNNEEPVEGVIVNNCTIINTTNGVRIKTWPASPVAGIATNMHFSDITMVNVSNPILI  308

Query  940   DQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF  1119
             DQEYCP N+C+++ PS +KI+KVS+K+I+G+SAT   V L CSS +PCE+V++  IDL +
Sbjct  309   DQEYCPWNQCNREIPSNIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEVKVANIDLVY  368

Query  1120  ---KGGAKTICSNVKPKLTGKQCPKV  1188
                KG   + C NVKP ++G Q P +
Sbjct  369   NGIKGSITSECMNVKPIISGIQNPPI  394



>gb|KGN43464.1| hypothetical protein Csa_7G037910 [Cucumis sativus]
Length=404

 Score =   351 bits (901),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 184/386 (48%), Positives = 248/386 (64%), Gaps = 17/386 (4%)
 Frame = +1

Query  70    TFILFLLAHFGESA----IINVAAKANV----DVGPLLMKAWKEACAATTASTIVIPKGT  225
             TF++ LL+   E+     I ++    N+    DV   L  AW +ACA+   S +VIPKGT
Sbjct  13    TFLMSLLSFTIEARSHVDIFSLRKYGNIVSGADVTEALKDAWNDACASDRPSAVVIPKGT  72

Query  226   FPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQG  405
             F + +   +GPCK+P+E ++   L+AP  P        W+    VD   LSGGG  DGQG
Sbjct  73    FKVREGEFKGPCKSPIEFRVHGTLQAPKHPHG----DSWITFAYVDRMRLSGGGVFDGQG  128

Query  406   NVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTV  582
                   +   K     KLP +L  +F+TNS++R IT+L+SK FHVN+LG  NLTF    +
Sbjct  129   KAGWEKNDCHKRIDCAKLPISLRFDFITNSIVRRITSLDSKNFHVNILGCNNLTFQGVNI  188

Query  583   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  762
              AP NSPNTDGIHI R IGI++  S I TGDDCISLGDG + +K+  V CGPGHGIS+GS
Sbjct  189   IAPENSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRIKVNNVICGPGHGISIGS  248

Query  763   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVI  939
             LG+   E PV+G+ V+N   I T NGVRIKTWP S   G+ T++H+  I M +V NPI+I
Sbjct  249   LGKYNNEEPVEGVIVNNCTIINTTNGVRIKTWPASPVAGIATNMHFSDITMVNVSNPILI  308

Query  940   DQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF  1119
             DQEYCP N+C+++ PS +KI+KVS+K+I+G+SAT   V L CSS +PCE+V++  IDL +
Sbjct  309   DQEYCPWNQCNREIPSNIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEVKVANIDLVY  368

Query  1120  ---KGGAKTICSNVKPKLTGKQCPKV  1188
                KG   + C NVKP ++G Q P +
Sbjct  369   NGIKGSITSECMNVKPIISGIQNPPI  394



>ref|XP_009334234.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=406

 Score =   351 bits (901),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 182/381 (48%), Positives = 244/381 (64%), Gaps = 18/381 (5%)
 Frame = +1

Query  73    FILFLLAHFG---ESAIINVA-----AKANVDVGPLLMKAWKEACAATTASTIVIPKGTF  228
             F+  LLA      ES++ +V      AK   D+   L KAW ++CA+ +AS +V+P GT+
Sbjct  11    FVFLLLASATKAHESSVFDVTSAEYGAKPGSDITFALAKAWNDSCASPSASKVVVPSGTY  70

Query  229   PMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGN  408
              ++  S  GPCKAP+EL++   L+AP    ++  +  W+    VD  T+SGGGT DGQG 
Sbjct  71    KLSGASFRGPCKAPIELQVQGTLQAPEKDSDLTMEGTWVGFQHVDMITVSGGGTFDGQGA  130

Query  409   V---QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFT  579
                 Q   SK K   G     NL  +F+TNS+I+D+T+LNSK FHV+V G  N+TF H  
Sbjct  131   FVWSQNNSSKSKHCSGSV---NLRFDFVTNSIIQDVTSLNSKNFHVHVYGCNNVTFQHVH  187

Query  580   VKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVG  759
             + APG+S NTDGIHI +  GI +  + IGTGDDC+S+GDG   + +T V+CGPGHGIS+G
Sbjct  188   ITAPGDSKNTDGIHIGKSTGINITHTFIGTGDDCVSIGDGNNQIAVTNVSCGPGHGISIG  247

Query  760   SLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIV  936
             SLGR   E  + GI V N     T NGVRIKTWPNS      +DIH+  I M +V NPIV
Sbjct  248   SLGRYDNEESLAGIIVKNCTLTNTQNGVRIKTWPNSPVATAASDIHFEDIIMVNVSNPIV  307

Query  937   IDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLT  1116
             IDQ YCP  +C    PSKVKIS VS+K+I+G+SAT  ++ + CSSG PCE++E+ +IDLT
Sbjct  308   IDQLYCPYKKCDNLPPSKVKISDVSFKNIQGSSATALSLKIVCSSGSPCENMELADIDLT  367

Query  1117  FKGGAKTI---CSNVKPKLTG  1170
             + G   T+   C NVKP ++G
Sbjct  368   YSGAKGTLTSQCLNVKPTISG  388



>ref|XP_011039263.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=391

 Score =   350 bits (898),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 181/378 (48%), Positives = 241/378 (64%), Gaps = 8/378 (2%)
 Frame = +1

Query  73    FILFLLAHF---GESAIINVAAKANV-DVGPLLMKAWKEACAATTASTIVIPKGTFPMTQ  240
             F+L  L+      E+ + +V    +  D+      AW++ACA+T+ S ++IP+GT+ +  
Sbjct  11    FLLLFLSSTDVKAENVVFDVTKYGDEEDISKAFKSAWEDACASTSPSKVLIPRGTYLLGP  70

Query  241   VSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVY  420
             V + GPCKA +EL++   L+AP D +  +G   W+ +  VD FTL+GGGT DGQG     
Sbjct  71    VIISGPCKAAIELQVKGKLQAPVDMREFEGFSSWITLNYVDQFTLTGGGTFDGQGKSASN  130

Query  421   PSKEKGFKGDKLPN-NLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGN  597
              +     K  KLP  +L  NF+TN ++ DIT+ +SK FH ++LG KNLTF HFT+ A   
Sbjct  131   QNNCGKDKHCKLPPVSLKFNFITNGIVHDITSTDSKYFHAHLLGCKNLTFQHFTITAHDE  190

Query  598   SPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTP  777
             S NTDGIHI R   I + DS IGTGDDCISLG G   + I GVTC PGHGIS+GSLG++ 
Sbjct  191   SLNTDGIHIGRSKDIKIIDSDIGTGDDCISLGHGSRQITIEGVTCAPGHGISIGSLGKSQ  250

Query  778   GERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCP  957
              E  V GIFV N     T NGVRIK+WP    G  +DIH+  I M++V NPIVIDQ YCP
Sbjct  251   NEESVSGIFVKNCTISNTQNGVRIKSWPALFGGSASDIHFEDIIMKNVSNPIVIDQVYCP  310

Query  958   NNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---  1128
              NEC+++  SKV I  VS+K+I+GTS T   V L+CS  +PC++VE+ +IDL + G    
Sbjct  311   WNECNRKSASKVSIKNVSFKNIRGTSRTPVAVQLSCSKDIPCDEVEVADIDLKYTGSEGP  370

Query  1129  AKTICSNVKPKLTGKQCP  1182
             AK  CSNV+PK  GK  P
Sbjct  371   AKFQCSNVQPKFHGKINP  388



>ref|XP_010248093.1| PREDICTED: exopolygalacturonase-like, partial [Nelumbo nucifera]
Length=370

 Score =   349 bits (896),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 186/370 (50%), Positives = 245/370 (66%), Gaps = 7/370 (2%)
 Frame = +1

Query  91    AHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCK-A  267
             A  G   I     K   D+   +M AWK ACAAT A+T++IPKGT+ M  V+L GPCK A
Sbjct  4     AQNGVFDITAYGGKDGGDITQAVMDAWKAACAATGAATVLIPKGTYTMNLVNLAGPCKQA  63

Query  268   PVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKE--KGF  441
              +  ++  I++AP DP  MD  + WL+   VD  T+ GGGTLDGQG  + + S E  K  
Sbjct  64    QMNFQLEGIVQAPADPAAMD-SESWLLFDHVDDLTVFGGGTLDGQGQ-KAWESNECSKNS  121

Query  442   KGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIH  621
             K  ++P NL LNF+ N V+ DIT+LNSK+ H+ +L   NLT  H T+ AP  S NTDGIH
Sbjct  122   KCPQMPANLRLNFVNNGVVHDITSLNSKMIHIMILSANNLTIQHVTITAPSTSINTDGIH  181

Query  622   IARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGI  801
             I R  G+ + D+ IGTGDDC+S+ DG +++ ++ VTCGPGHG+S+GSLG+   E PV G+
Sbjct  182   IGRSTGVKILDTTIGTGDDCVSVSDGNKDITVSKVTCGPGHGLSIGSLGKYDNEGPVVGV  241

Query  802   FVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQK  981
              +S+     TDNGVRIK+WP+S PG  +DI +  I M DV NP++IDQ YCP   CS Q 
Sbjct  242   HISDCTLTKTDNGVRIKSWPDSKPGSASDISFENIVMNDVGNPVIIDQAYCPYGGCS-QA  300

Query  982   PSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKT-ICSNVKP  1158
             PS+VK+S +    IKGTS+T+E V + CS  +PCE+VEIG+I+L F GGA T  C+N KP
Sbjct  301   PSRVKLSNIKIAGIKGTSSTQEAVKIFCSPALPCENVEIGDINLAFSGGAATCTCANTKP  360

Query  1159  KLTGKQCPKV  1188
              LTG Q P V
Sbjct  361   TLTGTQVPPV  370



>ref|XP_002865611.1| hypothetical protein ARALYDRAFT_494865 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41870.1| hypothetical protein ARALYDRAFT_494865 [Arabidopsis lyrata subsp. 
lyrata]
Length=395

 Score =   350 bits (899),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 175/388 (45%), Positives = 252/388 (65%), Gaps = 9/388 (2%)
 Frame = +1

Query  43    MATISYCAFTFILFLLAHFGESA-IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPK  219
             M  + +    F +F L     +A + N+ +    D+   L+KA+ EAC   T ST++IPK
Sbjct  1     MGRVHFGVSAFFVFCLLGLSANAKVFNIGSPPGSDITNALLKAFNEACQFPTKSTVLIPK  60

Query  220   GTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDG  399
             G + + ++ + GPCKAP+ + +   +KA     N +GK++W+    +D F L+GGG  DG
Sbjct  61    GEYKLGEIVMMGPCKAPIRIALQGTVKAD---GNANGKEKWVAFRNIDGFKLNGGGVFDG  117

Query  400   QGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHF  576
             +GN     +   K F   KLP ++  +F+TN+ IR IT+L++K FH+NV+G KN+TF+  
Sbjct  118   EGNAAWRVNNCHKTFNCKKLPISIRFDFVTNAKIRGITSLDAKNFHINVIGAKNMTFEDV  177

Query  577   TVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISV  756
              + AP  SPNTDGIH+ R  GI + +S I TGDDC+S+GDG++NL +  VTCGPGHGIS+
Sbjct  178   KIIAPAESPNTDGIHVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISI  237

Query  757   GSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPI  933
             GSLGR   E  V GI + N     TDNG+RIKTWP++      +DIH+  I +++V NPI
Sbjct  238   GSLGRYSHEENVSGIKIINCTLQETDNGLRIKTWPSAACTTTASDIHFENILLKNVSNPI  297

Query  934   VIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDL  1113
             +IDQEYCP N+C+KQKPS +K++ +S+K I+GTS  K+ V L CS G PC++VE+G+I++
Sbjct  298   LIDQEYCPWNQCNKQKPSTIKLANISFKKIRGTSGNKDAVKLLCSKGHPCQNVEVGDINI  357

Query  1114  TFKGG---AKTICSNVKPKLTGKQCPKV  1188
              + G    A   CSNV PKL G Q PK 
Sbjct  358   KYTGADGPATFQCSNVSPKLVGTQIPKA  385



>ref|XP_010548798.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   350 bits (899),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 178/390 (46%), Positives = 254/390 (65%), Gaps = 11/390 (3%)
 Frame = +1

Query  43    MATISYCAFTFILFLLAHFGESAIINV----AAKANVDVGPLLMKAWKEACAATTASTIV  210
             MA  +  +  F L+L + +  + + ++     A    D+   L +A++ AC     S++V
Sbjct  1     MAAKTLASVLFALYLFSFWANAEVFDIRKFGTASVGSDITQALRQAFQAACQNPRPSSVV  60

Query  211   IPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGT  390
             IPKGT+ + ++ + GPCKAPVE+ +   L+A  +   + G+++W++   ++ F L+G G 
Sbjct  61    IPKGTYKLGEIDMVGPCKAPVEVTVNGHLQA--NGNALVGREKWVVFRYINGFKLNGAGI  118

Query  391   LDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTF  567
              DGQGN     +   K     KLP ++  +F+ N  +RDIT+L++K FHVNVLG KN TF
Sbjct  119   FDGQGNAAWKSNDCHKNNNCKKLPISIRFDFVLNGEVRDITSLDAKNFHVNVLGCKNFTF  178

Query  568   DHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHG  747
             D+  +KAP  SPNTDGIH+ R  G+ +  S I TGDDCIS+GDG++NL +  VTCGPGHG
Sbjct  179   DNVKIKAPAESPNTDGIHLGRSDGVNILRSFISTGDDCISVGDGMKNLHVERVTCGPGHG  238

Query  748   ISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVK  924
             IS+GSLGR   E PV GI++ N     TDNG+RIKT+P+S   + V+DIH+  I +++V 
Sbjct  239   ISIGSLGRYTNEGPVAGIWIKNCTLQETDNGLRIKTYPSSASSITVSDIHFEDIIVKNVF  298

Query  925   NPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGE  1104
             NPI+IDQEYCP N+C+K KPS VK+  +S+K I+GTS  K+ V L CS  VPC +VE+G+
Sbjct  299   NPILIDQEYCPWNKCNKAKPSTVKLVNISFKRIRGTSGNKDAVRLLCSKAVPCTNVEVGD  358

Query  1105  IDLTFKGG---AKTICSNVKPKLTGKQCPK  1185
             IDL + G    A   CSNV PKL+G Q PK
Sbjct  359   IDLRYGGADGPATFQCSNVTPKLSGTQFPK  388



>ref|XP_004167279.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=404

 Score =   350 bits (899),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 184/396 (46%), Positives = 252/396 (64%), Gaps = 20/396 (5%)
 Frame = +1

Query  28    VTNLKMATISYC----AFTFILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATT  195
             VT   M+ +S+     +   ++F L  +G     N+ + A  DV   L  AW +ACA+  
Sbjct  11    VTTFLMSLLSFTIESRSHIDVIFPLEKYG-----NIVSGA--DVTEALKNAWNDACASVH  63

Query  196   ASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTL  375
              S +VIPKG F + +   +GPCK+P+E+++   L+AP  P        W+    VD  TL
Sbjct  64    PSAVVIPKGIFKVREGKFKGPCKSPIEIRVRGTLQAPKHPYG----DSWITFAYVDRMTL  119

Query  376   SGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGG  552
             SGGG  DGQG      +   K      LP +L  +F+TNS++R IT+LNSK FHVN+LG 
Sbjct  120   SGGGVFDGQGKTGWEKNDCHKRIDCANLPISLRFDFITNSIVRRITSLNSKNFHVNILGC  179

Query  553   KNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTC  732
              NLTF    + AP +SPNTDGIHI R IGI++  S I TGDDCISLGDG + +K+  VTC
Sbjct  180   NNLTFQGVNIIAPEDSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKQVKVANVTC  239

Query  733   GPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHYHKIE  909
             GPGHGIS+GSLG+   E PV+G+ V N   I T NGVRIKTWP S   G+ T++H+  I 
Sbjct  240   GPGHGISIGSLGKYTNEEPVEGVIVKNCTIINTTNGVRIKTWPTSPAAGIATNMHFSDIT  299

Query  910   MEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCED  1089
             M +V NPI+IDQEYCP N+C+++ PS +KI+KVS+++I+G+SAT   V L CSS +PC++
Sbjct  300   MVNVSNPILIDQEYCPWNQCNREIPSNIKINKVSFENIRGSSATPVAVKLICSSNLPCDE  359

Query  1090  VEIGEIDLTFKGGAKTI---CSNVKPKLTGKQCPKV  1188
             V++  IDL + G   +I   C NVKP ++G Q P +
Sbjct  360   VKVANIDLIYNGINGSITSQCMNVKPIISGIQNPSI  395



>ref|XP_010548800.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   350 bits (898),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 179/390 (46%), Positives = 254/390 (65%), Gaps = 11/390 (3%)
 Frame = +1

Query  43    MATISYCAFTFILFLLAHFGESAIINV----AAKANVDVGPLLMKAWKEACAATTASTIV  210
             MA  +  +  F L+LL+    + + ++     A    D+   L +A++ AC     S++V
Sbjct  1     MAAKTLASVLFALYLLSFSANAEVFDIRKFGTASVGSDITQALRQAFQAACQNPRPSSVV  60

Query  211   IPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGT  390
             IPKGT+ + ++ + GPCKAPVE+ +   L+A  +   + G+++W++   ++ F L+G G 
Sbjct  61    IPKGTYKLGEIDMVGPCKAPVEVTVNGHLQA--NGNALVGREKWVVFRYINGFKLNGAGI  118

Query  391   LDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTF  567
              DGQGN     +   K     KLP ++  +F+ N  +RDIT+L++K FHVNVLG KN TF
Sbjct  119   FDGQGNAAWKSNDCHKNNNCKKLPISIRFDFVLNGEVRDITSLDAKNFHVNVLGCKNFTF  178

Query  568   DHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHG  747
             D+  +KAP  SPNTDGIH+ R  G+ +  S I TGDDCIS+GDG++NL +  VTCGPGHG
Sbjct  179   DNVKIKAPAESPNTDGIHLGRSDGVNILRSFISTGDDCISVGDGMKNLHVERVTCGPGHG  238

Query  748   ISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVK  924
             IS+GSLGR   E PV GI++ N     TDNG+RIKT+P+S   + V+DIH+  I +++V 
Sbjct  239   ISIGSLGRYTNEGPVAGIWIKNCTLQETDNGLRIKTYPSSASSITVSDIHFEDIIVKNVF  298

Query  925   NPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGE  1104
             NPI+IDQEYCP N+C+K KPS VK+  +S+K I+GTS  K+ V L CS  VPC +VE+G+
Sbjct  299   NPILIDQEYCPWNKCNKAKPSTVKLVNISFKRIRGTSGNKDAVRLLCSKAVPCTNVEVGD  358

Query  1105  IDLTFKGG---AKTICSNVKPKLTGKQCPK  1185
             IDL + G    A   CSNV PKL+G Q PK
Sbjct  359   IDLRYGGADGPATFQCSNVTPKLSGTQFPK  388



>ref|XP_002310765.1| hypothetical protein POPTR_0007s11860g [Populus trichocarpa]
 gb|EEE91215.1| hypothetical protein POPTR_0007s11860g [Populus trichocarpa]
Length=391

 Score =   350 bits (897),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 182/384 (47%), Positives = 244/384 (64%), Gaps = 7/384 (2%)
 Frame = +1

Query  52    ISYCAFTFILFLLAH--FGESAIINVAAKANV-DVGPLLMKAWKEACAATTASTIVIPKG  222
             ++  A   +LFL +     E+ + +V    +  D+      AW++ACA+T+ S ++IP+G
Sbjct  5     VNVSAIFLLLFLTSTDVKAENVVFDVTKYGDEEDISKAFKSAWEDACASTSPSKVLIPRG  64

Query  223   TFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQ  402
             T+ +  V + GPCKA +EL++   L+AP D +  +G   W+ +  VD FTL+GGGT DGQ
Sbjct  65    TYLLGPVIISGPCKAAIELQVKGKLQAPVDMREFEGFSSWITLNYVDQFTLTGGGTFDGQ  124

Query  403   GNVQVYPSKEKGFKGDKLPN-NLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFT  579
             G      +     K  KLP  +L  NF+TN ++ DIT+ +SK FH ++LG KNLTF HFT
Sbjct  125   GKSASNQNNCGKDKHCKLPPVSLKFNFITNGIVHDITSTDSKYFHAHLLGCKNLTFQHFT  184

Query  580   VKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVG  759
             + A   S NTDGIHI R   I + DS IGTGDDCISLG G   + I GVTC PGHGIS+G
Sbjct  185   ITAHDESLNTDGIHIGRSKDIKIIDSDIGTGDDCISLGHGSRQITIEGVTCAPGHGISIG  244

Query  760   SLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVI  939
             SLG++  E  V GIFV N     T NGVRIK+WP    G  +DIH+  I M++V NPIVI
Sbjct  245   SLGKSQNEESVSGIFVKNCTISNTQNGVRIKSWPALFGGSASDIHFEDIIMKNVSNPIVI  304

Query  940   DQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF  1119
             DQ YCP NEC+++  SKV I  VS+K+I+GTS T   V L+CS  +PC++VE+ +IDL +
Sbjct  305   DQVYCPWNECNRKSASKVSIKNVSFKNIRGTSRTPVAVQLSCSKDIPCDEVEVADIDLKY  364

Query  1120  KGG---AKTICSNVKPKLTGKQCP  1182
              G    AK  CSNV+PK  GK  P
Sbjct  365   TGSEGPAKFQCSNVQPKFHGKINP  388



>gb|KHN40047.1| Polygalacturonase [Glycine soja]
Length=392

 Score =   349 bits (895),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 175/355 (49%), Positives = 238/355 (67%), Gaps = 9/355 (3%)
 Frame = +1

Query  136   NVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDP  315
             N D+   L KAW++AC +TT S +VIP   + + Q+    PCKAP+E+ +  I+KAP +P
Sbjct  37    NGDITMALQKAWRDACVSTTPSKVVIPSNKYKLRQIDFMRPCKAPIEILVNGIIKAPKNP  96

Query  316   KNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNLSLNFLT  486
              ++ G+ +W+  G ++  TLSG GT  G+G +   Q   S  K  K  KL  N    F+ 
Sbjct  97    FDVSGQNQWVRFGYINFLTLSGNGTFHGRGKMAWKQNNCSTNKNCK--KLAMNFGFGFVN  154

Query  487   NSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIG  666
             NSVI DIT+ +SK FHVNV G KN++F +F V +P  SPNTDGIHI +   + + +S IG
Sbjct  155   NSVIHDITSKDSKYFHVNVFGCKNISFTNFRVSSPAYSPNTDGIHIGKSTQVKITNSKIG  214

Query  667   TGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVR  846
             TGDDCISLGDG + + I  VTCGP HGISVGSLG+   E  V+ + V N     T+NG+R
Sbjct  215   TGDDCISLGDGSKEVTILNVTCGPEHGISVGSLGKYSNEDSVEDVIVKNCTLKNTNNGLR  274

Query  847   IKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDI  1023
             IKTWP +    + +D+H+  I M +V NPI+IDQEYCP N+CSKQ PSK+KISKV++K+I
Sbjct  275   IKTWPGTAIISLASDLHFEDITMINVSNPIIIDQEYCPWNQCSKQSPSKIKISKVTFKNI  334

Query  1024  KGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI--CSNVKPKLTGKQCP  1182
             +GTSAT+E + L CSSG+PCE VE+ +I+L F G       C+NVKPK+ G++ P
Sbjct  335   RGTSATQEGITLVCSSGIPCETVELSDINLRFNGTTLVTAKCANVKPKI-GRKAP  388



>emb|CAN65676.1| hypothetical protein VITISV_002011 [Vitis vinifera]
Length=587

 Score =   355 bits (912),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 175/359 (49%), Positives = 234/359 (65%), Gaps = 4/359 (1%)
 Frame = +1

Query  127   AKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAP  306
             A    D+   L+ AW+ ACA+   S +VIP G + + QV++EGPCKAP+ L +   ++AP
Sbjct  226   ADGKTDISQALLTAWEAACASPIVSRVVIPAGIYALGQVTIEGPCKAPINLIVKGTVRAP  285

Query  307   PDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLT  486
              D      +  W+    +D FTLSG G  DGQG         +    ++LP NL  NFLT
Sbjct  286   VDTSRFKPQAGWVAFQHLDQFTLSGYGVFDGQGQSVWGQKCSRTKYCNQLPINLRFNFLT  345

Query  487   NSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIG  666
             NS+I+DIT+ +SK FH+NVLG +N+TF    + AP +S NTDGIHI R  G+ +  S I 
Sbjct  346   NSIIKDITSKDSKQFHINVLGCRNITFFQVAITAPEDSQNTDGIHIGRSRGVNITHSTIQ  405

Query  667   TGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVR  846
             TGDDC+S+GDG E + IT V CGPGHGISVGSLG    E PV GI V N     T NGVR
Sbjct  406   TGDDCVSIGDGSEQIDITKVNCGPGHGISVGSLGLYKNEAPVIGIRVKNCTLSDTTNGVR  465

Query  847   IKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIK  1026
             +KT+P+S  G  T++H+H I M +V NPI+IDQEYCP+N+C+ Q PS+VK+S +S+K+I+
Sbjct  466   VKTYPSSPQGTATEMHFHDIVMNNVSNPIIIDQEYCPHNQCNLQVPSRVKLSNISFKNIR  525

Query  1027  GTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTGKQCPKVTC  1194
             GT++T+  V L CS G PC+ VE+G IDL +   +G A + C NV+  L G Q PK TC
Sbjct  526   GTTSTELAVNLVCSKGAPCQKVELGNIDLKYTGPEGTASSQCKNVEATLWGTQQPK-TC  583


 Score =   175 bits (444),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 113/162 (70%), Gaps = 0/162 (0%)
 Frame = +1

Query  559   LTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGP  738
             +T  + T+ A  +S NTDGIH+ R  G+ + D++I TGDD +S+GDG +++ +  VTCGP
Sbjct  1     MTLQYVTINATRDSLNTDGIHMGRSTGVNISDAIIKTGDDSLSIGDGSQHINVEKVTCGP  60

Query  739   GHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMED  918
             GHGISVGSLG+   E PV G+ V N   I T NG+R+KTWP+S   V TD+H+  I M +
Sbjct  61    GHGISVGSLGKYHNEEPVVGVTVKNCTLINTMNGIRVKTWPDSPASVATDLHFEDIIMNN  120

Query  919   VKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATK  1044
             V NPI+I+QEYCP ++C  + PS+VKIS VS++ I   S T+
Sbjct  121   VGNPILINQEYCPYDQCQAKVPSQVKISDVSFQGICSMSGTQ  162



>ref|XP_004165943.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=405

 Score =   349 bits (896),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 187/399 (47%), Positives = 249/399 (62%), Gaps = 21/399 (5%)
 Frame = +1

Query  43    MATISYCAF---TFILFLLAHFGES-----AIINVAAKANV----DVGPLLMKAWKEACA  186
             M  I Y      TF++ LL+   ES      I  +    N+    DV   L  AW +ACA
Sbjct  1     MGVIKYSNLLVTTFLMSLLSFIIESRSHVDVIFPLRKYGNIVSGADVTEALKDAWNDACA  60

Query  187   ATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDH  366
             +   S +VIPKG F + +   +GPCK+P+E+++   L+AP  P        W+    VD 
Sbjct  61    SVRPSAVVIPKGIFKVREGEFKGPCKSPIEIRVRGTLQAPKHPHG----DSWITFAYVDR  116

Query  367   FTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNV  543
              TLSGGG  DGQG      +   K      LP +L  +F+TNS+++ IT+L+SK FHVN+
Sbjct  117   MTLSGGGVFDGQGKAGWEKNDCHKRIDCANLPISLRFDFITNSIVKRITSLDSKNFHVNI  176

Query  544   LGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITG  723
             LG  NLTF    + AP +SPNTDGIHI R IGI++  S I TGDDCISLGDG + +KIT 
Sbjct  177   LGCNNLTFKGVNIIAPEDSPNTDGIHIGRSIGISILKSQIATGDDCISLGDGSKRVKITN  236

Query  724   VTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHYH  900
             VTCGPGHGIS+GSLG+   E PV+G+ V N   + T NGVRIKTWP S + G+ TD+H+ 
Sbjct  237   VTCGPGHGISIGSLGKYTNEEPVEGVIVKNCTIMNTTNGVRIKTWPASPNAGIATDMHFS  296

Query  901   KIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVP  1080
              I M +V NPI+IDQEYCP N+C+++ PS +KI+ VS+K+I+G+SAT   V L CSS  P
Sbjct  297   DITMVNVSNPILIDQEYCPWNQCNREIPSNIKINNVSFKNIRGSSATPVAVKLICSSNQP  356

Query  1081  CEDVEIGEIDLTFKGGAKTI---CSNVKPKLTGKQCPKV  1188
             CE+V++  IDL + G    I   C NVKP ++G Q P +
Sbjct  357   CEEVKVANIDLVYNGINGPITSQCMNVKPIVSGIQNPSI  395



>gb|KFK31316.1| hypothetical protein AALP_AA6G096900 [Arabis alpina]
Length=395

 Score =   348 bits (894),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/377 (45%), Positives = 249/377 (66%), Gaps = 7/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
             F+  L+     + + N+ +    D+   L+KA+ EAC A T ST++IPKG + + ++ + 
Sbjct  11    FVFCLVGLSANAKVFNIGSPPGSDITKALLKAFTEACQAPTKSTVMIPKGEYKLGEIEMT  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCKAP+ + +   +KA  D   ++GK++W+    +D F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIRIALQGTVKA--DGNLINGKEKWVAFRNIDGFKLNGGGVFDGEGNNAWRSNNC  128

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F   KLP ++  +F+TN+ IR IT+L++K FH+NV+G KN+TF+   + AP  SPNT
Sbjct  129   HKTFNCKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEDVKIVAPAESPNT  188

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  GI + +S I TGDDC+S+GDG++NL +  VTCGPGHGIS+GSLGR   E  
Sbjct  189   DGIHVGRSDGIRIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISIGSLGRYSHEED  248

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V GI + N     TDNG+RIKTWP++      +DIH+  I +++V NPI+IDQEYCP N+
Sbjct  249   VSGIKIVNCTLQETDNGIRIKTWPSAACSTTASDIHFQNIILKNVTNPILIDQEYCPWNQ  308

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKT  1137
             C+KQK S +K+  +S+K+I+GTS  K+ V L C+ G+PC +VE+G+I++ + G    A  
Sbjct  309   CNKQKSSTIKLVNISFKNIRGTSGNKDAVKLLCAKGLPCTNVELGDINIKYNGADGPATF  368

Query  1138  ICSNVKPKLTGKQCPKV  1188
              C+NV PKL G Q PK 
Sbjct  369   QCANVSPKLMGTQTPKA  385



>ref|NP_199625.1| putative polygalacturonase / pectinase [Arabidopsis thaliana]
 dbj|BAA96994.1| polygalacturonase [Arabidopsis thaliana]
 dbj|BAC43278.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAP81805.1| At5g48140 [Arabidopsis thaliana]
 gb|AED95623.1| putative polygalacturonase / pectinase [Arabidopsis thaliana]
Length=395

 Score =   348 bits (894),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 171/377 (45%), Positives = 249/377 (66%), Gaps = 8/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
             F+  LL     + I N+ +    D+   L+KA+ EAC   T ST++IPKG + + ++ + 
Sbjct  12    FVFCLLGLSANAKIFNINSPPGSDITNALLKAFNEACQFPTKSTVMIPKGEYKLGEIVMM  71

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCKAP+ + ++  +KA     N +GK++W+    ++ F L+GGG  DG+GN     +  
Sbjct  72    GPCKAPIRIALLGTVKAD---GNANGKEKWVAFRNINGFKLNGGGVFDGEGNAAWRVNNC  128

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F   KLP ++  +F+T++ IR IT+L++K FH+NV+G KN+TF+   + AP  SPNT
Sbjct  129   HKTFNCKKLPISIRFDFVTDAKIRGITSLDAKHFHINVIGAKNVTFEDVKIIAPAESPNT  188

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  GI + +S I TGDDC+S+GDG++NL +  VTCGPGHGIS+GSLGR   E  
Sbjct  189   DGIHVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISIGSLGRYSHEEN  248

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V GI + N     TDNG+RIKTWP++      +DIH+  I +++V NPI+IDQEYCP N+
Sbjct  249   VSGIKIINCTLQETDNGLRIKTWPSAACTTTASDIHFENILLKNVSNPILIDQEYCPWNQ  308

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKT  1137
             C+KQKPS +K++ +S+K I+GTS  K+ V L CS G PC++VE+G++++ + G    A  
Sbjct  309   CNKQKPSTIKLANISFKKIRGTSGNKDAVKLLCSKGYPCQNVEVGDVNIQYTGADGPATF  368

Query  1138  ICSNVKPKLTGKQCPKV  1188
              CSNV PKL G Q PK 
Sbjct  369   QCSNVSPKLVGTQIPKA  385



>ref|XP_006407792.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
 gb|ESQ49245.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
Length=382

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 174/371 (47%), Positives = 244/371 (66%), Gaps = 7/371 (2%)
 Frame = +1

Query  91    AHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAP  270
             AHF  S I+ +           L+KA+  AC +T+ S +VIPKG F + ++ + GPCKAP
Sbjct  3     AHFAVSTILVLCLLGISANAEALLKAFTSACQSTSPSKVVIPKGEFKLGEIEMRGPCKAP  62

Query  271   VELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-EKGFKG  447
             VE+ +   +KA  D     GK +W++ G ++ F L+GGG  DG+GN     +   K F+ 
Sbjct  63    VEITLQGTVKA--DGNTNHGKDKWVVFGNINGFKLNGGGAFDGEGNAAWRVNNCHKTFEC  120

Query  448   DKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIA  627
              KLP ++  +F+ N+ I+DI+++++K FH+NVLG KN+T D+  + AP +SPNTDGIH+ 
Sbjct  121   KKLPISVRFDFVENAEIKDISSIDAKNFHINVLGAKNMTMDNIKITAPEDSPNTDGIHLG  180

Query  628   RIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFV  807
             R  G+ + +S I TGDDCIS+GDG++NL +  V CGPGHGISVGSLGR   E  V GI V
Sbjct  181   RSDGVKILNSFISTGDDCISVGDGMKNLHVEKVVCGPGHGISVGSLGRYGHEEDVSGIRV  240

Query  808   SNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKP  984
              N     TDNG+RIKTWP++      +DIH+  I +++V NPI+IDQEYCP N+C+KQK 
Sbjct  241   VNCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVSNPILIDQEYCPWNQCNKQKA  300

Query  985   SKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKTICSNVK  1155
             S +K+  +S+K+I+GTS  K+ V L CS G PC+ VEIG+ID+ + G    A   CSNV 
Sbjct  301   STIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQKVEIGDIDIAYSGADGPATFQCSNVS  360

Query  1156  PKLTGKQCPKV  1188
             P+L G Q PK 
Sbjct  361   PQLLGSQSPKA  371



>gb|ADK92878.1| polygalacturonase [Hypericum perforatum]
Length=398

 Score =   348 bits (892),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 174/365 (48%), Positives = 240/365 (66%), Gaps = 9/365 (2%)
 Frame = +1

Query  94    HFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPV  273
             H+G      V      D    + KAWK+ACAAT A+T+ I KG + +++++ +GPCK+P+
Sbjct  31    HYG------VKVDGKTDDSQAINKAWKDACAATNATTLRIGKGNYMVSKMAFQGPCKSPL  84

Query  274   ELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGD  450
              +      KAP + KN    +EW+    ++  TL GGGT DGQG V    +   K  K  
Sbjct  85    TVDFQGTFKAPSNAKNYK-NQEWVSFTNLNGLTLFGGGTFDGQGAVAWSINNCAKTGKCG  143

Query  451   KLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIAR  630
              LPNNL +  LTNS+IRDIT+L+SKLFH+N++  KNLT +  T+ AP +S NTDGIHI R
Sbjct  144   SLPNNLRMTGLTNSIIRDITSLDSKLFHINIINCKNLTLERITITAPESSLNTDGIHIGR  203

Query  631   IIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVS  810
               G+ +  + I TGDDC+S+GDG + + I  VTCGPGHGIS+GSLGR   E+PV GI V 
Sbjct  204   STGVNITSATIKTGDDCVSIGDGAQQINIEKVTCGPGHGISIGSLGRYHDEQPVVGITVK  263

Query  811   NSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSK  990
             N     T NGVRIKTWP S  G+ +++ +  I M +V NPI+IDQ+YCP ++C  + PS+
Sbjct  264   NCTLTSTMNGVRIKTWPASPSGLASNMRFENIIMNNVSNPIMIDQQYCPYSQCEAKIPSR  323

Query  991   VKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF-KGGAKTICSNVKPKLT  1167
             VKIS VS+  I+GTSAT+  V L CS G+PC++V +G+I+L + KG A + C+NVKP++ 
Sbjct  324   VKISDVSFSGIRGTSATQLAVKLVCSKGIPCQNVAVGDINLAYNKGQATSQCANVKPQVR  383

Query  1168  GKQCP  1182
             G   P
Sbjct  384   GSVVP  388



>sp|Q39766.1|PGLR_GOSBA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium barbadense]
 gb|AAA58322.1| polygalacturonase [Gossypium barbadense]
Length=407

 Score =   348 bits (892),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 173/380 (46%), Positives = 247/380 (65%), Gaps = 12/380 (3%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAK------ANVDVGPLLMKAWKEACAATTASTIVIPKGTFPM  234
              +LF+ A   +    +V AK         D+    + AWKEACA+ T ST+VIPKGT+ +
Sbjct  15    LLLFISASKVQPDAFDVVAKFGAKADGKTDLSKPFLDAWKEACASVTPSTVVIPKGTYLL  74

Query  235   TQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQ  414
             ++V+LEGPCKAP+E+ +   ++AP DP        W+    V++F + GGG  DGQG++ 
Sbjct  75    SKVNLEGPCKAPIEINVQGTIQAPADPSAFK-DPNWVRFYSVENFKMFGGGIFDGQGSIA  133

Query  415   VYPS--KEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKA  588
                +  + + F+  KLP N+  +F+TN++I+DIT+ +SKLFH+NV   KN+T +   ++A
Sbjct  134   YEKNTCENREFRS-KLPVNIRFDFVTNALIQDITSKDSKLFHINVFACKNITLERLKIEA  192

Query  589   PGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLG  768
             P  SPNTDGIH+ +  G+ +  S I TGDDCIS+GDG +N+ I  +TCGPGHGIS+GSLG
Sbjct  193   PDESPNTDGIHMGKSEGVNIIASDIKTGDDCISIGDGTKNMVIKEITCGPGHGISIGSLG  252

Query  769   RTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQE  948
             +   E PV+GI +SN     T NG RIKTWP  H G V++IH+  I M +V +PI+IDQ+
Sbjct  253   KFQNEEPVEGIKISNCTITNTSNGARIKTWPGEHGGAVSEIHFEDITMNNVSSPILIDQQ  312

Query  949   YCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG  1128
             YCP N+C K + SKVK+S +S+K+I+GTSA  E +   CS   PC++VE+ +ID+   G 
Sbjct  313   YCPWNKCKKNEESKVKLSNISFKNIRGTSALPEAIKFICSGSSPCQNVELADIDIQHNGA  372

Query  1129  --AKTICSNVKPKLTGKQCP  1182
               A + C NVKP   GK  P
Sbjct  373   EPATSQCLNVKPITIGKLNP  392



>ref|XP_008229849.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   347 bits (890),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 185/378 (49%), Positives = 239/378 (63%), Gaps = 14/378 (4%)
 Frame = +1

Query  67    FTFILFLLAHFGESAIINVAA-----KANVDVGPLLMKAWKEACAATTASTIVIPKGTFP  231
             F F+L       +SA ++V +     K + D+   L KAW +ACA+T  S IV+PKGTF 
Sbjct  12    FVFLLLASTAKAQSAALDVTSAKYGGKPDSDITQALEKAWTDACASTAPSKIVVPKGTFK  71

Query  232   MTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV  411
                 + +GPCKA +E ++   L+AP D   +     W+    VD  TLSGGGT DGQG +
Sbjct  72    FVGTTFKGPCKAAIEFQLQGTLQAPADGSQLPKDDTWIGFDHVDGLTLSGGGTFDGQGAL  131

Query  412   QVYPS---KEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTV  582
                 +   K +  K   +  NL  +FLTNS I D+T+ +SK FHVN+L  + +  + FTV
Sbjct  132   SWKNNDCNKNRQCKSKHI--NLRFHFLTNSKILDVTSKDSKNFHVNLLKCEKVEINGFTV  189

Query  583   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  762
              AP  S NTDGIHI R  GI + D+ IGTGDDCIS+GDG ++L +T VTCGPGHGI++GS
Sbjct  190   SAPKESMNTDGIHIGRSTGIDIIDTTIGTGDDCISIGDGTKDLTVTNVTCGPGHGIAIGS  249

Query  763   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVI  939
             LGR P E PV GI +       T NGVRIKTWP S   G  +DIH+  I M +V NPI+I
Sbjct  250   LGRYPEEEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPILI  309

Query  940   DQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF  1119
             DQEYCP NEC K  PSK+KIS VS+K+IKGT      V LACS G+PCE+VE+ +IDL +
Sbjct  310   DQEYCPWNECKKGAPSKIKISNVSFKNIKGTCTDPVAVKLACSPGLPCENVELSDIDLKY  369

Query  1120  ---KGGAKTICSNVKPKL  1164
                KG   ++CSNVKP +
Sbjct  370   TGDKGPITSVCSNVKPTI  387



>ref|XP_008229852.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=403

 Score =   347 bits (889),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 184/378 (49%), Positives = 239/378 (63%), Gaps = 14/378 (4%)
 Frame = +1

Query  67    FTFILFLLAHFGESAIINVAA-----KANVDVGPLLMKAWKEACAATTASTIVIPKGTFP  231
             F F+L       +SA ++V +     K + D+   L KAW +ACA+T  S IV+PKGTF 
Sbjct  12    FVFLLLASTAKAQSAALDVTSAKYGGKPDSDITQALEKAWTDACASTAPSKIVVPKGTFK  71

Query  232   MTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV  411
                 + +GPCKA +E ++   L+AP D   +     W+    VD  TLSGGGT DGQG +
Sbjct  72    FVGTTFKGPCKAAIEFQLQGTLQAPADGSQLPKDDTWIGFDHVDGLTLSGGGTFDGQGAL  131

Query  412   QVYPS---KEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTV  582
                 +   K +  K   +  NL  +FLTNS I D+T+ +SK FHVN+L  + +  + FTV
Sbjct  132   SWKNNDCNKNRQCKSKHI--NLRFHFLTNSKILDVTSKDSKNFHVNLLKCEKVEINGFTV  189

Query  583   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  762
              AP  S NTDGIHI R  GI + D+ IGTGDDCIS+GDG ++L +T VTCGPGHGI++GS
Sbjct  190   SAPKESMNTDGIHIGRSTGINITDTTIGTGDDCISIGDGTKDLTVTNVTCGPGHGIAIGS  249

Query  763   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVI  939
             LGR P E PV GI +       T NGVRIKTWP S   G  +DIH+  I M +V NPI+I
Sbjct  250   LGRYPEEEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPILI  309

Query  940   DQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF  1119
             DQEYCP NEC K  PSKVKIS VS+K+IKGT      V LAC+ G+PCE+VE+ +ID+ +
Sbjct  310   DQEYCPWNECKKGVPSKVKISNVSFKNIKGTCTDPVAVKLACAPGLPCENVELSDIDIKY  369

Query  1120  ---KGGAKTICSNVKPKL  1164
                KG   ++CSNVKP +
Sbjct  370   TGDKGPITSVCSNVKPTI  387



>ref|XP_004305963.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=394

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 182/381 (48%), Positives = 242/381 (64%), Gaps = 10/381 (3%)
 Frame = +1

Query  67    FTFILFLLAHFGESAIIN--VAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQ  240
             F   L L   + +  + +     K N D+   L KAW +ACA+T+ S I++PKGTF +  
Sbjct  10    FPIFLLLSIAYADFDVTSSKYGGKPNSDISQPLAKAWSDACASTSPSRIIVPKGTFQLKG  69

Query  241   VSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVY  420
              S +GPCK P+E ++   L+AP D   +     W+    ++  TL G GT DGQG  + +
Sbjct  70    ASFKGPCKGPIEFQVDGTLQAPQDGAQLIKADTWIEFANLERLTLMGTGTFDGQGQ-KAW  128

Query  421   PSKE--KGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPG  594
                +  K  K   +  NL  N + +S+++D+T+LNSK FHVNVLG + LTF HFTVKAPG
Sbjct  129   KENDCNKNPKCSSIAINLRFNSVKHSLVKDVTSLNSKNFHVNVLGCEQLTFQHFTVKAPG  188

Query  595   NSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRT  774
             +S NTDGIHI R  GI + D+ IGTGDDCIS+GDG + L I  VTCGPGHGIS+GSLGR 
Sbjct  189   DSINTDGIHIGRSTGINITDTNIGTGDDCISIGDGTKQLTINKVTCGPGHGISIGSLGRY  248

Query  775   PGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEY  951
               E  V GI V +     T NGVRIKTWPNS      +DIH+  I M +V NPI+IDQEY
Sbjct  249   NNEDHVTGINVKDCTISNTMNGVRIKTWPNSPIATTASDIHFEHITMNNVGNPILIDQEY  308

Query  952   CPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEID--LTFKG  1125
             CP  +C+ Q PSKVKIS VS+K+I+GT+ T E V + C+ G+PC+ V + +ID  LT KG
Sbjct  309   CPYGQCNTQTPSKVKISNVSFKNIRGTTTTAEAVKIVCAKGLPCDKVVLSDIDLKLTGKG  368

Query  1126  GAKTICSNVKPKLTGKQCPKV  1188
                + C+NV+P +T  Q P+ 
Sbjct  369   TLTSQCANVQPTIT--QVPQA  387



>ref|XP_010439352.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/388 (45%), Positives = 250/388 (64%), Gaps = 9/388 (2%)
 Frame = +1

Query  43    MATISYCAFTFILFLLAHFGESA-IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPK  219
             M  +++    F +F L     +A + N+ +K   D+   L+KA+ EAC   T ST++IPK
Sbjct  1     MGRVNFGVSAFFIFCLLGLSANAKVFNIGSKPGCDITKALLKAFNEACQFPTKSTVLIPK  60

Query  220   GTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDG  399
             G + + ++ + GPCKAP+ + +   +KA     N    ++W+    +D F L+GGG  DG
Sbjct  61    GEYKLGEIEMTGPCKAPIRIALQGTVKAD---GNAVHSEKWIAFRNIDGFKLNGGGVFDG  117

Query  400   QGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHF  576
             +GN     +     +K  KLP ++  +F+TN+ IR IT+L++K FH+NV+G KN+TF+  
Sbjct  118   EGNAAWRVNNCHHTWKCKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEEV  177

Query  577   TVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISV  756
              + AP  SPNTDGIH+ R  GI + +S I TGDDC+S+GDG++NL +  VTCGPGHGIS+
Sbjct  178   KIVAPAESPNTDGIHVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISI  237

Query  757   GSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPI  933
             GSLGR   E+ V GI + N     TDNG+RIKTWP +      +DIH+  I +++V NPI
Sbjct  238   GSLGRYGHEQDVMGIKIVNCTLQETDNGLRIKTWPTAACSTSASDIHFENILLKNVSNPI  297

Query  934   VIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDL  1113
             +IDQEYCP N+C K+K S +K+SK+S+K+I+GTS  K+ V L CS G PC++VE+G I++
Sbjct  298   LIDQEYCPWNQCDKKKASTIKLSKISFKNIRGTSGNKDAVKLLCSKGHPCQNVELGNINI  357

Query  1114  TFKGG---AKTICSNVKPKLTGKQCPKV  1188
              + G    A   CSNV PKL G Q PK 
Sbjct  358   KYTGADGPATFQCSNVSPKLMGTQVPKA  385



>ref|XP_010667847.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=400

 Score =   345 bits (885),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 184/393 (47%), Positives = 244/393 (62%), Gaps = 8/393 (2%)
 Frame = +1

Query  37    LKMATISYCAFTFILFLLAHFGESAI--INVAAKANVDVGPLLMKAWKEACAATTASTIV  210
             +K   + +    F LF+     ++ I    + AK N D    LM AWK+ACAA   + IV
Sbjct  1     MKTPNLPFFISLFYLFVCVVRSQNVIDITKLGAKPNGDATQGLMAAWKQACAAPAPTKIV  60

Query  211   IPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFT---LSG  381
             +P G+F +  +   GPCKA V ++I    KAPP+P  M G   W+ +  +   T   L  
Sbjct  61    VPPGSFLLNVIKFTGPCKAAVTIEIAGNFKAPPNPAQMKGSDTWVKIENIQGLTINCLPT  120

Query  382   GGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKN  558
             GGT DGQG +    +   K    + LP N   N LTNS I  I +LNSKL+H+ VLG KN
Sbjct  121   GGTFDGQGQMAWKQNNCAKTGSCNNLPYNFRFNSLTNSKISGIKSLNSKLYHMGVLGCKN  180

Query  559   LTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGP  738
              T    T++AP +S NTDGIHI R  GI V  + IGTGDDCIS+GDG  ++ I  +TCGP
Sbjct  181   FTLFDTTIQAPKDSLNTDGIHIGRSAGIFVTKAKIGTGDDCISMGDGAVDVHIEDITCGP  240

Query  739   GHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMED  918
             GHGIS+GSLGR   E PV G+ V       TDNGVRIK+W NS   + +++H+  I +++
Sbjct  241   GHGISIGSLGRYQKEAPVTGVTVKKCTISDTDNGVRIKSWLNSFEAIASNLHFEDITVKN  300

Query  919   VKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEI  1098
             V NPI+IDQEYCP N C  + PSKVK+S +S+K+I+GT+ +KE V + CSSG PC+ VE+
Sbjct  301   VLNPILIDQEYCPYNHCKAKTPSKVKLSNISFKNIRGTAGSKEAVKILCSSGAPCDKVEL  360

Query  1099  GEIDLTFKGG-AKTICSNVKPKLTGKQCPKVTC  1194
              +IDLTF GG A ++C NVKP  +GKQ P V C
Sbjct  361   ADIDLTFNGGHAVSMCKNVKPITSGKQNP-VAC  392



>ref|XP_006395214.1| hypothetical protein EUTSA_v10004361mg [Eutrema salsugineum]
 gb|ESQ32500.1| hypothetical protein EUTSA_v10004361mg [Eutrema salsugineum]
Length=396

 Score =   345 bits (884),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 173/377 (46%), Positives = 244/377 (65%), Gaps = 8/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
             F+  LL     + +  + +    D+   L+K + EAC   T +T++IPKG + + ++ + 
Sbjct  11    FVFCLLGLSANAKVFKITSPTGSDITSALLKTFNEACQFPTKATVMIPKGEYKLGEIEMV  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCKAP+ + +   +KA     N+ GK  W+   +++ F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIRIALQGTVKAD---GNIKGKDFWVAFKKINGFKLNGGGVFDGEGNAAWRVNNC  127

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F+  KLP ++  +F+T++ IR IT+L+SK FH+NV+G KN+TF+   + AP  SPNT
Sbjct  128   HKTFECKKLPISVRFDFVTDAKIRGITSLDSKNFHINVIGAKNMTFEDIKIVAPAGSPNT  187

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  GI + +S I TGDDCIS+GDG+ NL +  VTCGPGHGISVGSLGR   E  
Sbjct  188   DGIHVGRSDGIKIINSFISTGDDCISVGDGMRNLLVERVTCGPGHGISVGSLGRYGHEED  247

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V GI V N     TDNGVRIKTWP++      ++IH+  I +++V NPI+IDQEYCP N+
Sbjct  248   VTGIRVVNCTLQNTDNGVRIKTWPSAKCATTASEIHFENILLKNVSNPILIDQEYCPWNQ  307

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKT  1137
             C+KQKPS +K+  +S+K I+GTS  K+ V L CS G PC++VEIG+I++ + G    A  
Sbjct  308   CNKQKPSTIKLVNISFKKIRGTSGNKDAVKLLCSKGYPCKNVEIGDINIKYTGADGPATF  367

Query  1138  ICSNVKPKLTGKQCPKV  1188
              CSNV PKL G Q PK 
Sbjct  368   SCSNVSPKLKGTQVPKA  384



>ref|XP_009124109.1| PREDICTED: polygalacturonase-like [Brassica rapa]
Length=396

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/377 (46%), Positives = 251/377 (67%), Gaps = 7/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
             FIL LL     + + ++ + +  D+   L+KA+  AC + + S +VIPKG F + ++ + 
Sbjct  11    FILCLLGFSANAEVFSIGSSSGSDITQALLKAFTSACQSPSPSKVVIPKGEFKLGEIEMR  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCKAPVE+ +   +KA  D   + GK++W++ G ++ F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPVEITLQGTVKA--DGNAIQGKEKWVVFGNINGFKLNGGGAFDGEGNAAWRVNNC  128

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F   KLP ++  +F+ N+ I+DI+++++K FH+NVLG KN+T  +  + AP +SPNT
Sbjct  129   HKTFNCKKLPISIRFDFVENAEIKDISSIDAKNFHINVLGAKNMTMSNIKITAPEDSPNT  188

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  G+ + DS I TGDDCIS+GDG  NL +  VTCGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRSDGVKILDSFISTGDDCISVGDGTSNLHVEKVTCGPGHGISVGSLGRYGKEQD  248

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V GI V N     TDNG+RIKTWP++      +DIH+  I +++V NPI+IDQEYCP N+
Sbjct  249   VSGIRVVNCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVTNPILIDQEYCPWNQ  308

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKG--GAKTI  1140
             C+K+K S +K+  +S+K+++GTS  K+ V L CS G PC++VEIG+ID+ + G  G  T 
Sbjct  309   CNKKKASTIKLVNISFKNVRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIKYSGEDGPATF  368

Query  1141  -CSNVKPKLTGKQCPKV  1188
              CSNV PKL G Q P+ 
Sbjct  369   QCSNVSPKLLGAQSPEA  385



>ref|XP_008231346.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231347.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231348.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231349.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   345 bits (884),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 175/355 (49%), Positives = 232/355 (65%), Gaps = 9/355 (3%)
 Frame = +1

Query  127   AKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAP  306
             AK   DV   L KAW +ACA+ +AS +V+P GT+ + + +  GPCKAP+E+++   L+AP
Sbjct  36    AKPGSDVSTALAKAWSDACASPSASKVVVPSGTYKLKEANFRGPCKAPIEMQVQGTLQAP  95

Query  307   PDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNLSLN  477
              D   +     W+    +D  TLSGGGT DGQG +   Q    K K  K   +P NL   
Sbjct  96    ADASQLTRPDTWVGFQYIDMLTLSGGGTFDGQGALSWNQNDCHKNKNCK--PIPVNLRFE  153

Query  478   FLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDS  657
             FLTNS ++DIT+LNSK FH++V    + TF   T+ AP +S NTDGIHI    GI +  +
Sbjct  154   FLTNSKVQDITSLNSKFFHMHVFRCNHTTFQQLTITAPDDSRNTDGIHIGASTGINITHA  213

Query  658   VIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDN  837
              IGTGDDCIS+GD    + +T VTCGPGHGIS+GSLG+   E+ V GI V N     TDN
Sbjct  214   KIGTGDDCISIGDDSHEITVTDVTCGPGHGISIGSLGKYKDEKDVTGIIVKNCTLTNTDN  273

Query  838   GVRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSY  1014
             GVRIKT+P+S  P   + IHY  I M +V NPI++DQ YCP  +C ++ PSKVKIS VS+
Sbjct  274   GVRIKTFPDSPSPSTASGIHYEDIIMVNVSNPILVDQLYCPYTQCEQKPPSKVKISNVSF  333

Query  1015  KDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTG  1170
             K+IKG+S T   V L C++G+PCE+VE+ +IDLT+   KG   ++CSNVKP +TG
Sbjct  334   KNIKGSSFTPLAVKLVCTTGIPCENVELTDIDLTYGGDKGPLTSMCSNVKPTITG  388



>emb|CAA72003.1| polygalacturonase [Medicago sativa]
Length=395

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 178/379 (47%), Positives = 239/379 (63%), Gaps = 9/379 (2%)
 Frame = +1

Query  76    ILFLLAHFGESAIINVAA---KANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVS  246
             +LF      +  I ++ +    ++ D+      AWK AC +TTAS ++IP+G + M  V 
Sbjct  14    LLFATLGIAQPNIFDIKSFGGASHADITMAFTNAWKAACGSTTASKVMIPRGVYKMHAVD  73

Query  247   LEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPS  426
             ++GPCKAP+E+++   ++AP +P  ++   +W+  G VD+FTLSG G  DG G      +
Sbjct  74    VKGPCKAPIEVQVDGTIQAPQNPDELNDAYQWIKFGYVDYFTLSGKGVFDGNGETAWRQN  133

Query  427   K-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  603
                K     +   N   NFL +S++RDIT+ +SK FHVNVLG  N TFD  T+ AP  S 
Sbjct  134   DCGKNSTCKRRSMNFGFNFLKHSIVRDITSKDSKNFHVNVLGCTNFTFDSVTITAPVTSI  193

Query  604   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  783
             NTDGIHI R   + V ++ I TGDDC+SLGDG   + +  V CGPGHGISVGSLG+ P E
Sbjct  194   NTDGIHIGRSTDVKVLNTNIATGDDCVSLGDGSRQITVQNVNCGPGHGISVGSLGKYPKE  253

Query  784   RPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHYHKIEMEDVKNPIVIDQEYCP  957
               V+ + V N     TDNGVRIKTWP+S PG   +TD+H+  I M +V NP++IDQEYCP
Sbjct  254   EAVEHVLVKNCTITNTDNGVRIKTWPSS-PGTSPITDMHFEDIIMVNVLNPVIIDQEYCP  312

Query  958   NNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG-AK  1134
              N+CSK  PSK+KISKV +K+I+GTS TK+ V+L CS   PC+ VE+  + LTF G    
Sbjct  313   WNQCSKLVPSKIKISKVIFKNIRGTSKTKDGVVLICSKSFPCDAVELNNVALTFNGAPVN  372

Query  1135  TICSNVKPKLTGKQCPKVT  1191
               C NVKP LTG   PK T
Sbjct  373   AKCVNVKPILTGPT-PKCT  390



>ref|XP_006299382.1| hypothetical protein CARUB_v10015541mg [Capsella rubella]
 gb|EOA32280.1| hypothetical protein CARUB_v10015541mg [Capsella rubella]
Length=400

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 181/383 (47%), Positives = 247/383 (64%), Gaps = 8/383 (2%)
 Frame = +1

Query  55    SYCAFTFILFLLAHFGESA-IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFP  231
             SY     ILF+L     +A +  V      D+   L+KA+  AC A TAS +VIPKG F 
Sbjct  3     SYLGIFAILFVLLGVSANAEVFPVGGSPGSDITQALLKAFTSACQAPTASKVVIPKGEFK  62

Query  232   MTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV  411
             + ++ + GPCKAP+E+ +   +KA  D   + GK+ W++  ++  F L+GGGT DG+GN 
Sbjct  63    LGEIEMAGPCKAPIEINLQGTVKA--DGTAIHGKERWVVFTKIVGFKLNGGGTFDGEGNA  120

Query  412   QVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKA  588
                 +   +     KLP ++  +F+  + IRDI+T+++K FH+NV+G K + FD+  V A
Sbjct  121   AWRVNNCHQTEACKKLPISIRFDFVEKAEIRDISTIDAKNFHINVIGAKEMVFDNVKVIA  180

Query  589   PGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLG  768
             P  SPNTDGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  V CGPGHGISVGSLG
Sbjct  181   PAESPNTDGIHLGRSDGVKILNSKIATGDDCISVGDGMKNLHVEKVVCGPGHGISVGSLG  240

Query  769   RTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQ  945
             R   E+ V GI V N   IGTDNG+RIKTWP++      + IH+  I + +V NPI+IDQ
Sbjct  241   RYGHEQDVAGITVKNCTLIGTDNGLRIKTWPSAACSTTASGIHFEDIILNNVSNPILIDQ  300

Query  946   EYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKG  1125
             EYCP N C+KQKPS +K+  +S+K+I+GTS  K+ V L CS   PC +VEIG I+L +KG
Sbjct  301   EYCPWNHCNKQKPSTIKLVDISFKNIRGTSGNKDAVKLLCSKAHPCVNVEIGNINLEYKG  360

Query  1126  --GAKTI-CSNVKPKLTGKQCPK  1185
               G  T  CSNV PKL G Q PK
Sbjct  361   ADGPPTFTCSNVTPKLVGTQNPK  383



>ref|XP_010482057.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   343 bits (881),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/388 (45%), Positives = 248/388 (64%), Gaps = 9/388 (2%)
 Frame = +1

Query  43    MATISYCAFTFILFLLAHFGESA-IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPK  219
             M  I +    F +F L     +A + N+ +K   D+   L+KA+ EAC   T ST++IPK
Sbjct  1     MGRIHFGVSAFFVFCLLGLSANAKVFNIGSKPGCDITKALLKAFNEACQFPTKSTVLIPK  60

Query  220   GTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDG  399
             G + + ++ + GPCKAP+ + +   +KA     N    ++W+    +D F L+GGG  DG
Sbjct  61    GEYKLGEIEMMGPCKAPIRIALQGTVKAD---GNAVHSEKWIAFRNIDGFKLNGGGVFDG  117

Query  400   QGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHF  576
             +GN     +     +K  KLP ++  +F+TN+ IR IT+L++K FH+NV+G KN+TF+  
Sbjct  118   EGNAAWRVNNCHHTWKCKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEEV  177

Query  577   TVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISV  756
              + AP  SPNTDGIH+ R  GI + +S I TGDDC+S+GDG++NL +  VTCGPGHGIS+
Sbjct  178   KIVAPAESPNTDGIHVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISI  237

Query  757   GSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPI  933
             GSLGR   E+ V GI + N     TDNG+RIKTWP +      +DIH+  I +++V NPI
Sbjct  238   GSLGRYGHEQDVMGIKIVNCTLQETDNGLRIKTWPTAACSTSASDIHFENILLKNVSNPI  297

Query  934   VIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDL  1113
             +IDQEYCP N+C K+K S +K+SK+S+K+I+GTS  K+ V L CS   PC++VE+G I++
Sbjct  298   LIDQEYCPWNQCDKKKASTIKLSKISFKNIRGTSGNKDAVKLLCSKAHPCQNVELGNINI  357

Query  1114  TFKGG---AKTICSNVKPKLTGKQCPKV  1188
              + G    A   CSNV PKL G Q PK 
Sbjct  358   KYTGADGPATFQCSNVSPKLMGTQVPKA  385



>ref|XP_008245680.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=403

 Score =   343 bits (881),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 183/378 (48%), Positives = 238/378 (63%), Gaps = 14/378 (4%)
 Frame = +1

Query  67    FTFILFLLAHFGESAIINVAA-----KANVDVGPLLMKAWKEACAATTASTIVIPKGTFP  231
             F F+L       +SA ++V +     K + D+   L KAW +ACA+T  S IV+PKGTF 
Sbjct  12    FVFLLLASTAKAQSAALDVTSAKYGGKPDSDITQALEKAWTDACASTAPSKIVVPKGTFK  71

Query  232   MTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV  411
                 + +GPCKA +E ++   L+AP D   +     W+    VD  TLSGGGT DGQG +
Sbjct  72    FVGTTFKGPCKAAIEFQLQGTLQAPADGSQLPKDDTWIGFDHVDGLTLSGGGTFDGQGAL  131

Query  412   QVYPS---KEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTV  582
                 +   K +  K   +  NL  +FLTNS I D+T+ +SK FHVN+   + +  + FT+
Sbjct  132   SWKNNDCNKNRQCKSKHI--NLRFHFLTNSKILDVTSKDSKNFHVNLQKCEKVEINGFTI  189

Query  583   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  762
              AP  S NTDGIHI R  GI + D+ IGTGDDCIS+GDG ++L +T VTCGPGHGI++GS
Sbjct  190   SAPKESMNTDGIHIGRSTGIDIIDTTIGTGDDCISIGDGTKDLTVTNVTCGPGHGIAIGS  249

Query  763   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVI  939
             LGR P E PV GI +       T NGVRIKTWP S   G  +DIH+  I M +V NPI+I
Sbjct  250   LGRYPEEEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPILI  309

Query  940   DQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF  1119
             DQEYCP NEC K  PSKVKIS VS+K+IKGT      V LAC+ G+PCE+VE+ +IDL +
Sbjct  310   DQEYCPWNECKKGVPSKVKISNVSFKNIKGTCTDPVAVKLACAPGLPCENVELSDIDLKY  369

Query  1120  ---KGGAKTICSNVKPKL  1164
                KG   ++CSNVKP +
Sbjct  370   IGDKGPITSVCSNVKPTI  387



>ref|XP_006299755.1| hypothetical protein CARUB_v10015950mg [Capsella rubella]
 gb|EOA32653.1| hypothetical protein CARUB_v10015950mg [Capsella rubella]
Length=447

 Score =   345 bits (885),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 174/378 (46%), Positives = 248/378 (66%), Gaps = 11/378 (3%)
 Frame = +1

Query  79    LFLLAHFGESA----IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVS  246
             +F++   G SA    +  + +    D+     KA+K AC A T S ++IPKG F + ++ 
Sbjct  10    IFVVCLLGLSANGHEVFRIGSPPGSDITQAFFKAFKAACQAPTPSKVLIPKGQFRLGEII  69

Query  247   LEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPS  426
             +EGPCK P+E  ++  ++A  D     GK +W++  +++ F L+GGGT DGQG      +
Sbjct  70    MEGPCKFPIEFTLLGTVQA--DGNAGQGKDKWVVFRKMNGFKLNGGGTFDGQGTAAWRVN  127

Query  427   KEKGFKG-DKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  603
                  K   KLP +L  +F+TN+VIRDI++++SK FHVNV+G +N+TFD+  + AP  SP
Sbjct  128   NCHQTKSCKKLPISLRFDFVTNAVIRDISSVDSKNFHVNVIGARNMTFDNVKILAPAESP  187

Query  604   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  783
             NTDGIH+ R  G+++ +S I TGDDC+S+GDG+ NL +  V CGPGHGISVGSLGR   E
Sbjct  188   NTDGIHLGRSDGVSIINSRISTGDDCVSVGDGMVNLLVKNVLCGPGHGISVGSLGRYGHE  247

Query  784   RPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPN  960
               V+GI V N     TDNG+RIKTWP++      +DIH+  I + +V NPI+IDQEYCP 
Sbjct  248   ENVRGIRVINCTVQETDNGLRIKTWPSAACSTTASDIHFEDIILRNVSNPILIDQEYCPW  307

Query  961   NECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---A  1131
             N C+KQK S +K++ +S++ I+GTS  K+ V L CS G PCE+V +G+ID+ + G    A
Sbjct  308   NHCNKQKSSSIKLANISFRKIRGTSGNKDAVKLLCSKGYPCENVVVGDIDIQYTGADGPA  367

Query  1132  KTICSNVKPKLTGKQCPK  1185
               +CSNV+PKL G Q PK
Sbjct  368   TFMCSNVRPKLVGIQNPK  385



>ref|XP_010675884.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=388

 Score =   343 bits (879),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 169/350 (48%), Positives = 229/350 (65%), Gaps = 4/350 (1%)
 Frame = +1

Query  88    LAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKA  267
             L H     I    AK N D     + AWK ACA+TT S +++P+G++ +  + L+GPCK+
Sbjct  28    LRHGAVLDITRHGAKPNGDATQAFLHAWKVACASTTPSKVLVPRGSYILHAIKLQGPCKS  87

Query  268   PVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLS---GGGTLDGQGNVQVYPSK-EK  435
              V ++I+   KAP DP    G+  W+ + R+D  T++   G G  DG G +    +   K
Sbjct  88    RVTIEILGNFKAPADPAQFKGEDTWVKIERIDGLTITAPKGAGVFDGAGQIAWKQNDCSK  147

Query  436   GFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDG  615
               K + LP N   NFLTNSVI  IT+LNSKLFH+ +LG K L     TV AP +S NTDG
Sbjct  148   TGKCNSLPYNFRFNFLTNSVINGITSLNSKLFHMAILGCKQLRIHDITVTAPADSLNTDG  207

Query  616   IHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVK  795
             IHI R  G+ +  + IGTGDDC+S+GDG +N+ I  +TCGPGHGISVGSLGR P E PV+
Sbjct  208   IHIGRSDGVNITAAHIGTGDDCVSIGDGAKNVHIEQITCGPGHGISVGSLGRYPNEEPVQ  267

Query  796   GIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSK  975
             GI V       T NGVR+KTW NS+ GVVT +H+  I +E+V NPI++DQEYCP N C +
Sbjct  268   GITVKGCTIKNTHNGVRVKTWHNSYEGVVTGLHFEDIIVENVLNPIIVDQEYCPYNHCKQ  327

Query  976   QKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKG  1125
             + PSKVK+S + +++++GTS++KE V + CSSGVPCE V++  IDL + G
Sbjct  328   KTPSKVKLSDIKFQNVRGTSSSKEAVKVVCSSGVPCEKVQLVNIDLKYTG  377



>ref|XP_008465833.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=384

 Score =   343 bits (879),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 176/360 (49%), Positives = 237/360 (66%), Gaps = 11/360 (3%)
 Frame = +1

Query  127   AKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAP  306
             A  N D+   L  AWK AC +T+ S ++IP+ T+ ++++ L GPCK  +++++  IL+AP
Sbjct  18    AMPNTDIFQALTNAWKAACGSTSQSQVLIPEETYKLSKIELTGPCKNRIQIQLQGILQAP  77

Query  307   PDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGF--KGDKLPNNLSLNF  480
              D      +  W+    +D FTL+G G  DGQG V  +   +     K  K   N+  +F
Sbjct  78    ADL----AEDNWISFKYIDQFTLTGKGVFDGQGKV-AWGKNDCAINPKCAKFAINVRFDF  132

Query  481   LTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSV  660
             + N+++ DIT+ +SK FH NVLG KNLTF +  + AP +SPNTDGIHI R IGI V ++ 
Sbjct  133   IKNAIVSDITSKDSKSFHFNVLGCKNLTFQNVNINAPEDSPNTDGIHIGRSIGINVINTN  192

Query  661   IGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNG  840
             IGTGDDCISLGDG + + IT VTCGPGHGISVGSLGR  GE PV+GI   N   I T NG
Sbjct  193   IGTGDDCISLGDGSQQVAITNVTCGPGHGISVGSLGRYVGEAPVQGIRAKNCTLINTTNG  252

Query  841   VRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYK  1017
             VRIKT P+S   GV +DIH+  I M +V NP+VIDQEYCP+N+C K+ PSKVKIS VS+ 
Sbjct  253   VRIKTRPSSPSLGVASDIHFEDIIMVNVINPMVIDQEYCPSNQCDKKNPSKVKISNVSFT  312

Query  1018  DIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI---CSNVKPKLTGKQCPKV  1188
             +I+GT+A    V   CSS  PCED+++ +I+LT+ G    I   C  VKP ++G Q P++
Sbjct  313   NIRGTAANALAVSFVCSSQFPCEDIKVTDINLTYNGSGDPISSTCKYVKPIVSGIQNPQI  372



>ref|XP_008229862.1| PREDICTED: polygalacturonase-like [Prunus mume]
Length=726

 Score =   353 bits (906),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 181/379 (48%), Positives = 248/379 (65%), Gaps = 18/379 (5%)
 Frame = +1

Query  67    FTFILFLLAHFG--ESAIINVAAKA-----NVDVGPLLMKAWKEACAATTASTIVIPKGT  225
             + F+  LLA     +S++ +V + A     N D+   L  AW++ACA+T  + +VIPKGT
Sbjct  5     WIFVFLLLASIAKVQSSVFDVTSAAYGGKPNSDITQALANAWRDACASTWPTKVVIPKGT  64

Query  226   FPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQG  405
             + +    L+GPCKAP+E+++   LKAP D K +  +  W+    VD  TL GGG+ DGQ 
Sbjct  65    YNLRGAILQGPCKAPIEVQVQGNLKAPLDSKYLTKQDTWVGFQYVDRLTLYGGGSFDGQN  124

Query  406   NVQVYPSKEKGFKG-DKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTV  582
             N      K K  K  D +  NL L+F+TN++IRDIT+L+SK FH+NV G +N+TF + T+
Sbjct  125   NCY----KNKYCKATDAI--NLRLDFVTNAMIRDITSLDSKHFHINVFGCRNVTFQYVTI  178

Query  583   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  762
              AP +S NTDGIHI R  GIT+  + IGTGDDCISLGDG + + +T VTCGPGHGIS+GS
Sbjct  179   TAPEDSANTDGIHIGRSYGITIDHTTIGTGDDCISLGDGSQRIIVTNVTCGPGHGISIGS  238

Query  763   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHP-GVVTDIHYHKIEMEDVKNPIVI  939
             LG+   E PV G+ V N     T NG+RIKTWP S   G  T IH+  I M +V NPI I
Sbjct  239   LGKYQSEVPVAGVLVKNCTLTNTQNGLRIKTWPGSPAFGTATHIHFQDIAMVNVGNPIFI  298

Query  940   DQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF  1119
             DQ+YCP ++C+++ PS V+IS VS+ +IKGTSAT   V L CS  +PC++V + +ID+T+
Sbjct  299   DQQYCPYSQCAQKAPSTVQISSVSFVNIKGTSATPVAVQLMCSRKLPCQNVGLEDIDITY  358

Query  1120  ---KGGAKTICSNVKPKLT  1167
                KG   + C+ VKP+ T
Sbjct  359   SGDKGPLTSQCAYVKPQFT  377



>ref|XP_010464426.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=398

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 178/379 (47%), Positives = 251/379 (66%), Gaps = 12/379 (3%)
 Frame = +1

Query  79    LFLLAHFGESA----IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVS  246
             +F+L   G SA    + NV A    D+   L+KA+  AC  T  S +VIPKG F + ++ 
Sbjct  10    IFVLCLVGFSANAHEVFNVNAPPGSDITQALLKAFTAACQCTAPSRVVIPKGEFKLCEII  69

Query  247   LEGPCKAPVELKIMAILKAPPDPKNMD-GKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYP  423
             + GPCKAP+E+ ++  L A  D  N+  GK +W++  +++ F L+GGGT DG+G+     
Sbjct  70    MTGPCKAPIEINLLGTLLA--DGSNIHHGKDKWVVFRKINGFKLNGGGTFDGEGSAAWRV  127

Query  424   SK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNS  600
             +   K     KLP ++  +F+TN+ IRDI++++SK FHVNV+G  N+TFD+  + AP  S
Sbjct  128   NNCHKTSNCKKLPISIRFDFVTNAEIRDISSVDSKNFHVNVIGAMNMTFDNVKILAPAES  187

Query  601   PNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPG  780
             PNTDGIH+ R  G+++ +S I TGDDCIS+GDG+ NL +  V CGPGHGIS+GSLGR P 
Sbjct  188   PNTDGIHLGRSDGVSIINSRISTGDDCISVGDGMVNLLVKNVVCGPGHGISIGSLGRYPH  247

Query  781   ERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCP  957
             E+ V+GI V N     TDNG+RIKTWP +    V + IH+  I +++V NPI+IDQEYCP
Sbjct  248   EQNVRGIKVINCTVQETDNGLRIKTWPTAACSTVASGIHFEDIILKNVSNPILIDQEYCP  307

Query  958   NNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---  1128
              N+C+KQK S +K+  VS+ +I+GTS  K+ V L CS G PCE+V +G I++ + G    
Sbjct  308   WNQCNKQKSSSIKLIDVSFTNIRGTSGNKDAVKLLCSKGYPCENVVVGNINIEYTGRDGP  367

Query  1129  AKTICSNVKPKLTGKQCPK  1185
             A  +CSNVKP+L G Q PK
Sbjct  368   ATFMCSNVKPRLVGIQNPK  386



>ref|XP_011003515.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Populus euphratica]
Length=397

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 179/386 (46%), Positives = 246/386 (64%), Gaps = 12/386 (3%)
 Frame = +1

Query  64    AFTFILFLLAHFGESAIINV---AAKAN--VDVGPLLMKAWKEACAATTASTIVIPKGTF  228
             A+     LL    + +  +V    AKAN   D    +  AWK+ACAA  AST+VI KG +
Sbjct  11    AYHLCFLLLVTQVQGSNFDVKAYGAKANGMTDDSKAINSAWKDACAAKEASTVVIAKGNY  70

Query  229   PMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGN  408
              +  +  EGPC APV +K+   LKAP DPK +  + +W+    V+  T+SGGG  DGQG 
Sbjct  71    MVGPLKFEGPCTAPVTVKVQGTLKAPADPKRL--RDDWVAFRNVEGLTVSGGGIFDGQGA  128

Query  409   VQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVK  585
             +    +   K  K + LP NL    LTNS I  IT+LNSKLFH+N+L   N+TF +  + 
Sbjct  129   IAWSVNNCAKTGKCNSLPTNLQFTKLTNSKIEGITSLNSKLFHMNILNCNNVTFQNIVIN  188

Query  586   APGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSL  765
             AP NS NTDGIHI R   + +  + I TGDDC+SLGDG + + +  VTCGPGHGIS+GSL
Sbjct  189   APKNSLNTDGIHIGRSTMVNITGATIKTGDDCVSLGDGCQQINVEKVTCGPGHGISIGSL  248

Query  766   GRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQ  945
             GR   E+PV G+ V N     T+NGVRIKTWP S  GV +++++  I M +V NPI+IDQ
Sbjct  249   GRYHDEQPVIGVTVRNCTLTNTENGVRIKTWPASPSGVASNVNFEDIIMNNVSNPILIDQ  308

Query  946   EYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF--  1119
             EYCP N C  + PS+VKIS V ++ I+GTSAT+  V + CS G+PC++V + +I+L +  
Sbjct  309   EYCPYNNCLAKVPSRVKISDVRFEGIRGTSATQVAVKIVCSRGLPCQNVFVEDINLVYNG  368

Query  1120  -KGGAKTICSNVKPKLTGKQCPKVTC  1194
              +G + ++C+NVKP+++GK  P  TC
Sbjct  369   KEGSSTSLCANVKPQVSGKVFP-ATC  393



>emb|CDY22137.1| BnaC01g39640D [Brassica napus]
Length=396

 Score =   341 bits (874),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/377 (45%), Positives = 249/377 (66%), Gaps = 7/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
             FI  LL     + + ++ + +  D+   L+KA+  AC + + S +VIP+G F + ++ + 
Sbjct  11    FIFCLLGFSANAEVFSIDSSSGSDITQALLKAFTSACQSPSPSKVVIPEGEFKLGEIEMR  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCKAPVE+ +   +KA  D   + GK++W++ G ++ F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPVEITLQGTVKA--DGNAIQGKEKWVVFGNINGFKLNGGGAFDGEGNAAWRVNNC  128

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F   KLP ++  +F+ N+ I+DI+++++K FH+NVLG KN+T  +  + AP +SPNT
Sbjct  129   HKTFNCKKLPISIRFDFVENAEIKDISSIDAKNFHINVLGAKNMTMSNIKITAPEDSPNT  188

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  G+ + +S I TGDDCIS+GDG  NL +  VTCGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRSDGVKILNSFISTGDDCISVGDGTNNLHVEKVTCGPGHGISVGSLGRYGKEQD  248

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V GI V N     TDNG+RIKTWP++      +DIH+  I +++V NPI+IDQEYCP N+
Sbjct  249   VSGIRVVNCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVTNPILIDQEYCPWNQ  308

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKT  1137
             C+K+K S +K+  +S+K+++GTS  K+ V L CS G PC++VEIG+ID+ + G    A  
Sbjct  309   CNKKKASTIKLVNISFKNVRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIKYSGADGPATF  368

Query  1138  ICSNVKPKLTGKQCPKV  1188
              CSNV PKL G Q P+ 
Sbjct  369   QCSNVSPKLLGAQSPEA  385



>ref|XP_004292143.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=498

 Score =   344 bits (882),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 184/382 (48%), Positives = 240/382 (63%), Gaps = 12/382 (3%)
 Frame = +1

Query  40    KMATISYCAFTFIL-FLLAH---FGESAIINVAAKANVDVGPLLMKAWKEACAATTASTI  207
             K+  +   +F  +L F   H   F +        K N D+   L+ AW +ACA+   STI
Sbjct  4     KLMNVLTISFLLVLAFTPVHSSVFFDVTSAKYGGKPNTDITKALLNAWTDACASPWESTI  63

Query  208   VIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGG  387
              +PKGT+ +      G CKAP+EL++   L+AP +   +     W+    ++  TLSGGG
Sbjct  64    YVPKGTYGLKGAIFVGHCKAPIELQVEGTLQAPEETGQVTSPDTWVGFRYLNRLTLSGGG  123

Query  388   TLDGQGNV---QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKN  558
             T DG+G +   Q   +  K  K   +  N+  +F+ +++I+DIT+L+SK FH NV    N
Sbjct  124   TFDGRGALSWKQNDCNTNKNCKSRVV--NIRFDFVNDTIIKDITSLDSKNFHFNVFACNN  181

Query  559   LTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGP  738
             +TF H T+ APG+S NTDGIHIAR   +TV ++ IGTGDDCISLGDG   LK T VTCGP
Sbjct  182   ITFQHATITAPGDSVNTDGIHIARSTMVTVANTSIGTGDDCISLGDGTSQLKFTNVTCGP  241

Query  739   GHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMED  918
             GHGIS+GSLG    E+PV G+ + N  F  T NG RIKTWP S+ G+V+DIHY  I M +
Sbjct  242   GHGISIGSLGGHRDEQPVTGVIIKNVTFNSTQNGARIKTWPGSYGGLVSDIHYEDIIMVN  301

Query  919   VKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEI  1098
             V NPI+IDQEYCP N C+K+ PSKVKIS VS+K+IKGTS T   V   CS  VPCE+VEI
Sbjct  302   VSNPIIIDQEYCPWNLCNKKIPSKVKISNVSFKNIKGTSTTPLAVNFICSWSVPCENVEI  361

Query  1099  GEIDLTF---KGGAKTICSNVK  1155
               IDLT+   KG   + CSNVK
Sbjct  362   SGIDLTYTGHKGFISSQCSNVK  383



>ref|XP_008245812.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   341 bits (874),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 174/355 (49%), Positives = 231/355 (65%), Gaps = 9/355 (3%)
 Frame = +1

Query  127   AKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAP  306
             AK   DV   L KAW +ACA+ +AS +V+P GT+ + + +  GPCKAP+E+++   L+AP
Sbjct  36    AKPGSDVSTALAKAWSDACASPSASKVVVPSGTYNLKEANFRGPCKAPIEMQVQGTLQAP  95

Query  307   PDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNLSLN  477
              D   +     W+    +D  TLSGGGT DGQG +   Q    K K  K   +P NL   
Sbjct  96    ADAGQLTRPDTWVGFQYIDMLTLSGGGTFDGQGALSWNQNDCHKNKNCK--PIPVNLRFE  153

Query  478   FLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDS  657
             FLTNS ++DIT+LNSK FH++V    + TF   T+ AP +S NTDGIHI    GI +  +
Sbjct  154   FLTNSKVQDITSLNSKFFHMHVFRCNHTTFQQLTITAPDDSRNTDGIHIGASTGINITHA  213

Query  658   VIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDN  837
              IGTGDDCIS+GD    + +T VTCGPGHGIS+GSLG+   E+ V GI V N     TDN
Sbjct  214   KIGTGDDCISIGDDSHEITVTDVTCGPGHGISIGSLGKYKDEKDVTGIIVKNCTLTNTDN  273

Query  838   GVRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSY  1014
             GVRIKT+P+S  P   + IHY  I M +V NPI++DQ YCP  +C ++ PSKVKIS VS+
Sbjct  274   GVRIKTFPDSPSPSTASGIHYEDIIMVNVSNPILVDQLYCPYTQCEQKPPSKVKISNVSF  333

Query  1015  KDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTG  1170
             K+IKG+S T   V L C++G+PCE+VE+ +IDLT+   KG   ++CSNVKP + G
Sbjct  334   KNIKGSSFTPLAVKLVCTTGIPCENVELIDIDLTYGGDKGPLTSMCSNVKPTIAG  388



>ref|XP_010442229.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   340 bits (873),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 171/388 (44%), Positives = 249/388 (64%), Gaps = 9/388 (2%)
 Frame = +1

Query  43    MATISYCAFTFILFLLAHFGESA-IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPK  219
             M  +++    F +F L     +A + N+ +K   D+   L+KA+ +AC   T ST++IPK
Sbjct  1     MGRVNFGVSAFFIFCLLGLSANAKVFNIGSKPGCDITKALLKAFNQACQFPTKSTVLIPK  60

Query  220   GTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDG  399
             G + + ++ + GPCKAP+ + +   +KA     N    ++W+    +D F L+GGG  DG
Sbjct  61    GEYKLGEIEMMGPCKAPIRIALQGTVKAD---GNAVHSEKWIAFHNIDGFKLNGGGVFDG  117

Query  400   QGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHF  576
             +GN     +     +K  KLP ++  +F+TN+ IR IT+L++K FH+NV+G KN+TF+  
Sbjct  118   EGNAAWRVNNCHHTWKCKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEEV  177

Query  577   TVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISV  756
              + AP  SPNTDGI + R  GI + +S I TGDDC+S+GDG++NL +  VTCGPGHGIS+
Sbjct  178   KIVAPAESPNTDGILVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISI  237

Query  757   GSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPI  933
             GSLGR   E+ V GI + N     TDNG+RIKTWP +      +DIH+  I +++V NPI
Sbjct  238   GSLGRYGHEQDVMGIKIVNCTLQETDNGLRIKTWPTAACSTSASDIHFENILLKNVSNPI  297

Query  934   VIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDL  1113
             +IDQEYCP N+C K+K S +K+SK+S+K+I+GTS  K+ V L CS G PC++VE+G I++
Sbjct  298   LIDQEYCPWNQCDKKKASTIKLSKISFKNIRGTSGNKDAVKLLCSKGHPCQNVELGNINI  357

Query  1114  TFKGG---AKTICSNVKPKLTGKQCPKV  1188
              + G    A   CSNV PKL G Q PK 
Sbjct  358   KYTGSDGPATFQCSNVSPKLMGTQVPKA  385



>ref|XP_006489998.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=402

 Score =   340 bits (873),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 175/399 (44%), Positives = 249/399 (62%), Gaps = 20/399 (5%)
 Frame = +1

Query  55    SYCAFTFILFLLAHFGESA-IINVAAKAN---VDVGPL----------LMKAWKEACAAT  192
             S C+   +L +L  F  +  IIN A+      +D G +             AW+EAC   
Sbjct  4     SSCSQLLVLAILVLFSLAQNIINAASNGVFNVIDFGAIADGIRDNSRAFENAWREACYWN  63

Query  193   TASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFT  372
             T ST+++P G + +T V  +GPCKAP+  ++  ++ APP    +  K+ W+    +  FT
Sbjct  64    TYSTVLVPPGKYLVTSVVFKGPCKAPISFQLQGLILAPPGLSKLADKESWITFESLRSFT  123

Query  373   LSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGG  552
             L+GGGT  GQG      ++       +LP ++  N L +S I  + +++SK FH+N+LG 
Sbjct  124   LTGGGTFHGQGRTAWPENQCHKNSNCQLPISIRFNKLNDSTITGVQSVDSKFFHINILGC  183

Query  553   KNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTC  732
              NL  +   + AP +SPNTDGIHI R  GI + +S+I TGDDC+SLGDG +N+ ++ V+C
Sbjct  184   YNLKLNKINISAPDDSPNTDGIHIGRSNGIEISNSIIATGDDCVSLGDGSQNVLVSDVSC  243

Query  733   GPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEM  912
             GPGHGISVGSLG+   E  V G+ V N  F GT NGVRIKTWP+S  G  ++  +  + M
Sbjct  244   GPGHGISVGSLGKYKKEEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFM  303

Query  913   EDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDV  1092
              +V+NPIVIDQEYCP+N+C+ + PS+VKIS V +++I+GTS TKE V + CS  +PC++V
Sbjct  304   NNVENPIVIDQEYCPHNQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNV  363

Query  1093  EIGEIDLTF-----KGGAKTICSNVKPKLTGKQCPKVTC  1194
             EIG+I+L +     KG A + CSNVKP L GKQ P  TC
Sbjct  364   EIGDINLVYNGIDDKGPAISSCSNVKPTLVGKQIP-ATC  401



>ref|XP_008222765.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   340 bits (873),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 174/356 (49%), Positives = 230/356 (65%), Gaps = 9/356 (3%)
 Frame = +1

Query  124   AAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKA  303
             +AK   DV   L KAW +ACA+ +AS +V+P GT+ + + +  GPCKAP+E+++   L+A
Sbjct  35    SAKPGSDVTKALAKAWSDACASPSASKVVVPSGTYKLKEATFRGPCKAPIEMQVRGTLQA  94

Query  304   PPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNLSL  474
             P +         W+    +D FTLSGGGT DGQG +   Q    K K  K   +P NL  
Sbjct  95    PANAGQFTRPDTWVGFQYIDKFTLSGGGTFDGQGALVWGQNDCHKNKNCK--PIPINLRF  152

Query  475   NFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKD  654
              F+TNS ++DIT+LNSK FH++V   K+ TF H T+ AP  S NTDGIHI    GI +  
Sbjct  153   EFITNSRVQDITSLNSKNFHMHVFRCKHTTFQHLTITAPEESRNTDGIHIGASTGINITH  212

Query  655   SVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTD  834
             + I TGDDC+S+GD    + +T VTCGPGHGIS+GSLGR   E+ V GI V N     T 
Sbjct  213   AKIRTGDDCVSIGDDSHQITVTDVTCGPGHGISIGSLGRYKEEKAVTGIIVKNCTLTNTQ  272

Query  835   NGVRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVS  1011
             NGVRIKTWP+S      +DIHY  I M +V NPI+IDQ YCP   C ++ PSKVKI+ VS
Sbjct  273   NGVRIKTWPDSPSSSTASDIHYENIIMVNVSNPILIDQLYCPYTRCDQKPPSKVKINNVS  332

Query  1012  YKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTG  1170
             +K+IKG+S T   V L CS G+PCE+V++ +IDLT+   +G   ++CSNVKP +TG
Sbjct  333   FKNIKGSSFTPLAVKLVCSRGLPCENVKLTDIDLTYGGDQGPLTSLCSNVKPTITG  388



>ref|XP_006279754.1| hypothetical protein CARUB_v10027711mg [Capsella rubella]
 gb|EOA12652.1| hypothetical protein CARUB_v10027711mg [Capsella rubella]
Length=395

 Score =   340 bits (871),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 171/388 (44%), Positives = 249/388 (64%), Gaps = 9/388 (2%)
 Frame = +1

Query  43    MATISYCAFTFILFLLAHFGESA-IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPK  219
             M  +++    F +F L     +A + N+ +    D+   L+K + EAC   T ST++IPK
Sbjct  1     MGRVNFGVSAFFVFCLLGLSANAKVFNIGSPPGSDITKALLKTFNEACQFPTKSTVLIPK  60

Query  220   GTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDG  399
             G + + ++ + GPCKAP+ + +   LKA     N    ++W+    ++ F L+GGG  DG
Sbjct  61    GEYKLGEIEMLGPCKAPIRIALQGTLKAD---GNAVHNQKWVAFRNINGFKLNGGGVFDG  117

Query  400   QGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHF  576
             +GN     +   K  +  KLP ++  +++T+  +R IT+L++K FH+NV+G KNLTF+  
Sbjct  118   EGNAAWRVNNCHKTEQCKKLPISIRFDYITDGKVRGITSLDAKNFHINVIGAKNLTFEEV  177

Query  577   TVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISV  756
              + AP  SPNTDGIH+ R  GI + +SVI TGDDC+S+GDG++NL +  VTCGPGHGISV
Sbjct  178   RIIAPAESPNTDGIHVGRSDGIKIINSVITTGDDCVSVGDGMKNLLVERVTCGPGHGISV  237

Query  757   GSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPI  933
             GSLGR   E+ VKGI + N     TDNG+RIKTWP++      +DIH+  I +++V NPI
Sbjct  238   GSLGRYGHEQDVKGIKIINCTLQETDNGIRIKTWPSAACSTSASDIHFENIVLKNVTNPI  297

Query  934   VIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDL  1113
             +IDQEYCP N C+K KPS +K+S +S+K+I+GTS  K+ V L CS G PC++VE+G ID+
Sbjct  298   LIDQEYCPWNHCNKAKPSTIKLSNISFKNIRGTSGNKDAVKLLCSKGFPCQNVELGNIDI  357

Query  1114  TFKGG---AKTICSNVKPKLTGKQCPKV  1188
              + G    A   C+NV PK+ G Q PK 
Sbjct  358   KYTGADGPATFQCANVSPKIMGTQVPKA  385



>emb|CDY05701.1| BnaC02g38360D [Brassica napus]
Length=397

 Score =   339 bits (869),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/379 (45%), Positives = 243/379 (64%), Gaps = 10/379 (3%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
             F+  LLA    +    + A+   D+   L K +KEAC     ST++IPKG F + ++ + 
Sbjct  11    FVFCLLALSANAREFRITARPGSDITGELSKLFKEACQCVDKSTVLIPKGEFKLGEIEMM  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPS--  426
             GPCKAP+   +   ++A     N++GK  W+   R+ +F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIIFVLQGTVRAD---GNVNGKDFWVAFRRITNFRLNGGGIFDGEGNASWRANNC  127

Query  427   -KEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  603
              K    +  +LP ++  +++T+  +RDIT+L++K FH+NV+G KNLTF+   + AP  SP
Sbjct  128   HKTSLTQCKRLPISIRFDYITDGKVRDITSLDAKNFHINVIGAKNLTFEDIRIVAPDESP  187

Query  604   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  783
             NTDGIH+ R  GI + ++ I TGDDCIS+GDG++NL +  VTCGPGHGIS+GSLG    E
Sbjct  188   NTDGIHVGRSDGIKIINTNIKTGDDCISVGDGMKNLLVERVTCGPGHGISIGSLGLYGHE  247

Query  784   RPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPN  960
               V G+ V N     TDNGVRIKTWP++      + IH+  I +++V NPI+IDQEYCP 
Sbjct  248   EDVTGVKVVNCTLRNTDNGVRIKTWPSAACSTTASGIHFENIILQNVSNPILIDQEYCPW  307

Query  961   NECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---A  1131
             N C+K KPS +K+  + +K+IKG+S  K+ V L CS G PC++VEIG+ID+T+ G    A
Sbjct  308   NRCNKNKPSSIKLVDIKFKNIKGSSGNKDAVKLLCSKGFPCKNVEIGDIDITYNGKDGPA  367

Query  1132  KTICSNVKPKLTGKQCPKV  1188
                CSNV PKL GKQCPK 
Sbjct  368   TFQCSNVSPKLVGKQCPKA  386



>ref|XP_004158053.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=2882

 Score =   365 bits (937),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 191/368 (52%), Positives = 260/368 (71%), Gaps = 17/368 (5%)
 Frame = +1

Query  112   IINVAAKANVDV-GPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIM  288
             + +  AK N D+ GPLL+ AWK+ACA+TT S ++IPKG++ ++Q +L+GPCK+P+EL+I 
Sbjct  633   VTSFGAKPNGDITGPLLV-AWKDACASTTPSKVLIPKGSYGLSQSNLKGPCKSPIELQIE  691

Query  289   AILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKG--DKLPN  462
               L+A PDPK  DG    L++  +D  T+SG G LDGQG    +   +   K    KLP 
Sbjct  692   GTLQASPDPKG-DGL---LLLEYIDQLTVSGTGVLDGQGKAG-WEKNDCHLKKICTKLPM  746

Query  463   NLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGI  642
              L LNF+TNS+++DIT+L+SK +H+N+LG KNLT DH T+ AP NSPNTDGIH++    I
Sbjct  747   TLKLNFITNSIVKDITSLDSKNYHINLLGCKNLTIDHVTITAPENSPNTDGIHVSSSEQI  806

Query  643   TVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKF  822
              + ++ I TGDDCIS+GD  + + I+ VTCGPGHGIS+GSLG+   E+ V G+ V   K 
Sbjct  807   NILNTNIATGDDCISVGDTNKQIVISDVTCGPGHGISIGSLGKYSKEKEVVGVTVKKCKL  866

Query  823   IGTDNGVRIKTWPNS---HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKV  993
               T NGVRIKTWP+S    P   TD+H+  IEM +V NPI+IDQEYCP N+C+++ PSK+
Sbjct  867   TSTTNGVRIKTWPDSVGTFPA--TDMHFEDIEMVNVSNPIIIDQEYCPWNQCNRKVPSKI  924

Query  994   KISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGA---KTICSNVKPKL  1164
             KISKVS+K+I+GTSAT   V + CS   PCE+VE+ +IDLT+ G     K+ C+NVKP +
Sbjct  925   KISKVSFKNIRGTSATAVAVKIVCSQSNPCEEVEVADIDLTYSGSEGPIKSQCANVKPVI  984

Query  1165  TGKQCPKV  1188
             TGKQ P +
Sbjct  985   TGKQNPPI  992



>emb|CDX86325.1| BnaA06g30420D [Brassica napus]
Length=397

 Score =   338 bits (866),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 172/378 (46%), Positives = 242/378 (64%), Gaps = 10/378 (3%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
             F++ LL     +    + A    D+  LL+KA+ EAC   T S+++IPKG + + Q+ + 
Sbjct  11    FVVCLLGLSANAKDFTITAPPGSDITSLLLKAFNEACQFPTRSSVLIPKGEYKLRQIEMM  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPS--  426
             GPCKAP+ + +   +KA     N++G   W+   R++ F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIRITLQGTVKAD---GNVNGNDYWVAFRRINGFKLNGGGIFDGEGNAAWRANNC  127

Query  427   -KEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  603
              K    +  KLP ++  +F+T++ IR IT+L+SK FH+NVLG +N+T +  T+ AP  SP
Sbjct  128   HKMALTQCKKLPISIRFDFVTDAKIRGITSLDSKNFHINVLGARNMTLEEITIIAPEESP  187

Query  604   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  783
             NTDGIH+ R +G+ + +S I TGDDCIS+GDG  +L +  VTCGPGHGIS+GSLG    E
Sbjct  188   NTDGIHVGRSVGVQIINSNIKTGDDCISIGDGTRDLLVERVTCGPGHGISIGSLGLYVKE  247

Query  784   RPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPN  960
               V GI V NS  I TDNGVRIKTWP++      + IH+  I +++V NPI+IDQEYCP 
Sbjct  248   EDVTGIRVVNSTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILIDQEYCPW  307

Query  961   NECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---A  1131
             N C+K KPS +K+  +S+K I+GTS  K+ V L CS G PC++V+IG+ID+ + G    A
Sbjct  308   NRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVQIGDIDIKYTGADGPA  367

Query  1132  KTICSNVKPKLTGKQCPK  1185
                CSNV P L G Q PK
Sbjct  368   TFQCSNVSPTLMGTQVPK  385



>emb|CDY22140.1| BnaC01g39610D [Brassica napus]
Length=397

 Score =   338 bits (866),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 171/377 (45%), Positives = 243/377 (64%), Gaps = 7/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
             F+L LL +   + +       N D+   ++KA+  AC A   S ++IPKG F + +  + 
Sbjct  11    FVLCLLGYSANAEVFTAGGPPNSDITAAVLKAFTSACQAPAPSQVLIPKGDFKLGETVMT  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCK+P+E  +   +KA  D  +  GK  W++  +++ F L+GGGT DG+GN     +  
Sbjct  71    GPCKSPIEFTLQGNVKA--DGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKANNC  128

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F+  KLP ++  +F+ N+ I+DIT+L++K FH NV+ GKN+TFD+  + AP  SPNT
Sbjct  129   HKTFECKKLPISVRFDFVDNAEIKDITSLDAKNFHFNVISGKNMTFDNIKIIAPAESPNT  188

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  G+ + ++ I TGDDCIS+GDG++NL I  V CGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRCEGVKILNTKIATGDDCISVGDGMKNLLIEKVVCGPGHGISVGSLGRYGWEQD  248

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V  I V N    GTDNG+RIKTWP++        IH+  I +  V NPI+IDQEYCP N+
Sbjct  249   VTDINVKNCTLEGTDNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCPWNQ  308

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKG--GAKTI  1140
             C+K KPS +K+  +++++I+GTS  K+ V L CS G PCE+VEIG+I++ + G  G  T 
Sbjct  309   CNKNKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGPDGPPTF  368

Query  1141  -CSNVKPKLTGKQCPKV  1188
              C+NV PKL G Q PK 
Sbjct  369   ECTNVTPKLVGTQNPKA  385



>ref|XP_009134997.1| PREDICTED: polygalacturonase [Brassica rapa]
Length=397

 Score =   338 bits (866),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 172/377 (46%), Positives = 244/377 (65%), Gaps = 7/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
              +L LL +   + +  V      D+   L+KA+  AC A   S ++IPKG F + ++++ 
Sbjct  11    LVLCLLGYSANAEVFTVGGPPGSDITAALLKAFTSACQAPAPSQVLIPKGDFKLGEIAMT  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCK+PVE  +   +KA  D  +  GK  W++  +++ F L+GGGT DG+GN     +  
Sbjct  71    GPCKSPVEFTLQGNVKA--DGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKANNC  128

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F+  KLP ++  +F+ N+ I+DIT+L++K FH NV+ GKN+TFD+  + AP  SPNT
Sbjct  129   HKTFECKKLPISVRFDFVDNAEIKDITSLDAKNFHFNVISGKNMTFDNIKIIAPAESPNT  188

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  G+ + ++ I TGDDCIS+GDG++NL I  V CGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRCEGVKILNTKISTGDDCISVGDGMKNLLIEKVVCGPGHGISVGSLGRYGWEQD  248

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V  I V N    GTDNG+RIKTWP++        IH+  I +  V NPI+IDQEYCP N+
Sbjct  249   VNDIKVINCTLEGTDNGLRIKTWPSAACTTTAAGIHFENIILNKVSNPILIDQEYCPWNQ  308

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKG--GAKTI  1140
             C+K KPS +K+  +++++I+GTS  K+ V L CS G PCE+VEIG+I++ + G  G  T 
Sbjct  309   CNKSKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGPDGPPTF  368

Query  1141  -CSNVKPKLTGKQCPKV  1188
              C+NV PKL G Q PK 
Sbjct  369   ECTNVTPKLVGTQNPKA  385



>gb|AAM74219.1|AF518563_1 putative pollen polygalacturonase [Brassica oleracea]
Length=397

 Score =   337 bits (865),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 171/377 (45%), Positives = 244/377 (65%), Gaps = 7/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
              +L LL +   + +  V      D+   L+KA+  AC A   S ++IPKG F + ++++ 
Sbjct  11    LVLCLLGYSANAEVFTVGGPPGSDITAALLKAFTSACQAPAPSQVLIPKGDFKLGEIAMT  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCK+PVE  +   +KA  D  +  GK  W++  +++ F L+GGGT DG+GN     +  
Sbjct  71    GPCKSPVEFTLQGNVKA--DGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKANNC  128

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F+  KLP ++  +F+ N+ I+D+T+L++K FH NV+ GKN+TFD+  + AP  SPNT
Sbjct  129   HKTFECKKLPISVRFDFVDNAEIKDVTSLDAKNFHFNVISGKNMTFDNIKIIAPAESPNT  188

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  G+ + ++ I TGDDCIS+GDG++NL I  V CGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRCEGVKILNTKISTGDDCISVGDGMKNLLIEKVVCGPGHGISVGSLGRYGWEQD  248

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V  I V N    GTDNG+RIKTWP++        IH+  I +  V NPI+IDQEYCP N+
Sbjct  249   VNDIKVINCTLEGTDNGLRIKTWPSAACTTTAAGIHFENIILNKVSNPILIDQEYCPWNQ  308

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKG--GAKTI  1140
             C+K KPS +K+  +++++I+GTS  K+ V L CS G PCE+VEIG+I++ + G  G  T 
Sbjct  309   CNKSKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGADGPPTF  368

Query  1141  -CSNVKPKLTGKQCPKV  1188
              C+NV PKL G Q PK 
Sbjct  369   ECTNVTPKLVGTQNPKA  385



>ref|XP_004161033.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=405

 Score =   337 bits (865),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 182/399 (46%), Positives = 245/399 (61%), Gaps = 21/399 (5%)
 Frame = +1

Query  43    MATISYCAF---TFILFLLAHFGES-----AIINVAAKANV----DVGPLLMKAWKEACA  186
             M  I Y      TF++ LL+   ES      I  +    N+    DV   L  AW +ACA
Sbjct  1     MGMIKYSNLSITTFLMSLLSFTIESQSHVDVIFPLRKYGNIVSGDDVTEALKDAWNDACA  60

Query  187   ATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDH  366
             +   S +VIP G F + +   +GPCK+P+E+++   L+AP  P        W+    VD 
Sbjct  61    SVRPSAVVIPDGIFKVREGEFKGPCKSPIEIRVRGTLQAPKHPHG----DSWITFAYVDR  116

Query  367   FTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNV  543
              T+SG G  DGQG      +   K      LP +L  +F+TNS++R IT+L+SK FHVN+
Sbjct  117   MTISGKGVFDGQGKAGWEKNDCHKRIDCVNLPISLRFDFITNSIVRGITSLDSKNFHVNI  176

Query  544   LGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITG  723
             LG  NLTF    + AP +SPNTDGIHI R IGI++  S I TGDDCISLGDG + +KIT 
Sbjct  177   LGCNNLTFQGVNIIAPEDSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRVKITN  236

Query  724   VTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYH  900
             VTCGPGHGIS+GSLG+   E PV  + V N   + T NG+RIKTWP+S   G+ T++H+ 
Sbjct  237   VTCGPGHGISIGSLGKYTNEEPVDDVVVKNCTIMNTTNGIRIKTWPSSPVAGIATNMHFS  296

Query  901   KIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVP  1080
              I M +V NPI+IDQEYCP N+C+++ PS +KI+ VS+K+IKG+SAT   V L CSS  P
Sbjct  297   DITMVNVSNPILIDQEYCPWNQCNREIPSNIKINNVSFKNIKGSSATPVAVKLICSSNKP  356

Query  1081  CEDVEIGEIDLTF---KGGAKTICSNVKPKLTGKQCPKV  1188
             CE+V++  IDL +    G   + C NVKP ++G Q P +
Sbjct  357   CEEVKVANIDLVYNGINGPVTSQCMNVKPIISGIQNPSI  395



>gb|AAP42648.1| polygalacturonase [Brassica napus]
Length=397

 Score =   337 bits (864),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 171/377 (45%), Positives = 244/377 (65%), Gaps = 7/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
              +L LL +   + +  V      D+   L+KA+  AC A   S ++IPKG F + ++++ 
Sbjct  11    LVLCLLGYSANAEVFTVGGPPGSDITAALLKAFTSACQAPAPSQVLIPKGDFKLGEIAMT  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCK+PVE  +   +KA  D  +  GK  W++  +++ F L+GGGT DG+GN     +  
Sbjct  71    GPCKSPVEFTLQGNVKA--DGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKANNC  128

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F+  KLP ++  +F+ N+ I+D+T+L++K FH NV+ GKN+TFD+  + AP  SPNT
Sbjct  129   HKTFECKKLPISVRFDFVDNAEIKDVTSLDAKNFHFNVISGKNMTFDNIKIIAPAESPNT  188

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  G+ + ++ I TGDDCIS+GDG++NL I  V CGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRCEGVKILNTKISTGDDCISVGDGMKNLLIEKVVCGPGHGISVGSLGRYGWEQD  248

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V  I V N    GTDNG+RIKTWP++        IH+  I +  V NPI+IDQEYCP N+
Sbjct  249   VNDIKVINCTLEGTDNGLRIKTWPSAACTTTAAGIHFENIILNKVSNPILIDQEYCPWNQ  308

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKG--GAKTI  1140
             C+K KPS +K+  +++++I+GTS  K+ V L CS G PCE+VEIG+I++ + G  G  T 
Sbjct  309   CNKSKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGPDGPPTF  368

Query  1141  -CSNVKPKLTGKQCPKV  1188
              C+NV PKL G Q PK 
Sbjct  369   ECTNVTPKLVGTQNPKA  385



>gb|ACP74159.1| putative polygalacturonase [Brassica rapa subsp. oleifera]
Length=397

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/378 (45%), Positives = 240/378 (63%), Gaps = 10/378 (3%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
             F++ LL     +    + A    D+  LL+K + EAC   T S+++IPKG + + Q+ + 
Sbjct  11    FVVCLLGLSANAKDFTITAPPGSDITSLLLKTFNEACQFPTRSSVLIPKGEYKLRQIEMM  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKE  432
             GPCKAP+ + +   +KA     N++G   W+   R++ F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIRITLQGTVKAD---GNVNGNDYWVAFRRINGFKLNGGGIFDGEGNAAWRANNR  127

Query  433   KGF---KGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  603
                   +  KLP ++  +F+T++ IR IT+L+SK FH+NVLG +N+T +  T+ AP  SP
Sbjct  128   HKMALTQCKKLPISIRFDFVTDAKIRGITSLDSKNFHINVLGARNMTLEEITIIAPEESP  187

Query  604   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  783
             NTDGIH+ R +G+ + +S I TGDDCIS+GDG  +L +  VTCGPGHGIS+GSLG    E
Sbjct  188   NTDGIHVGRSVGVQIINSNIKTGDDCISIGDGTRDLLVERVTCGPGHGISIGSLGLYVKE  247

Query  784   RPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPN  960
               V GI V NS  I TDNGVRIKTWP++      + IH+  I +++V NPI+IDQEYCP 
Sbjct  248   EDVTGIRVVNSTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILIDQEYCPW  307

Query  961   NECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---A  1131
             N C+K KPS +K+  +S+K I+GTS  K+ V L CS G PC++V+IG+ID+ + G    A
Sbjct  308   NRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVQIGDIDIKYTGADGPA  367

Query  1132  KTICSNVKPKLTGKQCPK  1185
                CSNV P L G Q PK
Sbjct  368   TFQCSNVSPTLMGTQVPK  385



>ref|XP_009129707.1| PREDICTED: polygalacturonase-like [Brassica rapa]
 ref|XP_009102886.1| PREDICTED: polygalacturonase-like [Brassica rapa]
Length=397

 Score =   337 bits (863),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 171/379 (45%), Positives = 242/379 (64%), Gaps = 10/379 (3%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
             F+  LLA    +    + A+   D+   L K +KEAC     ST++IPKG F + ++ + 
Sbjct  11    FVFCLLALSANAREFRITARPGSDITGELSKLFKEACQCVDKSTVLIPKGEFKLGEIEMM  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPS--  426
             GPCKAP+   +   ++A     N++GK  W+   R+ +F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIIFVLQGTVRAD---GNVNGKDFWVAFRRITNFRLNGGGIFDGEGNASWRANNC  127

Query  427   -KEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  603
              K    +  +LP ++  +++T+  +RDIT+L++K FH+NV+G KNLTF+   + AP  SP
Sbjct  128   HKTSLTQCKRLPISIRFDYITDGKVRDITSLDAKNFHINVIGAKNLTFEDIRIVAPEESP  187

Query  604   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  783
             NTDGIH+ R  GI + ++ I TGDDCIS+GDG++NL +  V+CGPGHGIS+GSLG    E
Sbjct  188   NTDGIHVGRSDGIKIINTNIKTGDDCISVGDGMKNLLVERVSCGPGHGISIGSLGLYGHE  247

Query  784   RPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPN  960
               V G+ V N     TDNGVRIKTWP++      + IH+  I + +V NPI+IDQEYCP 
Sbjct  248   EDVTGVKVVNCTLRNTDNGVRIKTWPSAACSTTASGIHFENIILHNVSNPILIDQEYCPW  307

Query  961   NECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---A  1131
             N C+K KPS +K+  + +K+IKG+S  K+ V L CS G PC++VEIG+ID+T+ G    A
Sbjct  308   NRCNKNKPSSIKLVDIKFKNIKGSSGNKDAVKLLCSKGFPCKNVEIGDIDITYNGKDGPA  367

Query  1132  KTICSNVKPKLTGKQCPKV  1188
                CSNV PKL GKQCPK 
Sbjct  368   TFQCSNVSPKLVGKQCPKA  386



>ref|XP_009151612.1| PREDICTED: polygalacturonase [Brassica rapa]
 gb|ABG38467.1| pollen-expressed protein MF6t [Brassica juncea]
Length=397

 Score =   336 bits (861),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 171/378 (45%), Positives = 241/378 (64%), Gaps = 10/378 (3%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
             F++ LL     +    + A    D+  LL+K + EAC   T S+++IPKG + + Q+ + 
Sbjct  11    FVVCLLGLSANAKDFTITAPPGSDITSLLLKTFNEACQFPTRSSVLIPKGEYKLRQIEMM  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPS--  426
             GPCKAP+ + +   +KA     N++G   W+   R++ F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIRITLQGTVKAD---GNVNGNDYWVAFRRINGFKLNGGGIFDGEGNAAWRANNC  127

Query  427   -KEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  603
              K    +  KLP ++  +F+T++ IR IT+L+SK FH+NVLG +N+T +  T+ AP  SP
Sbjct  128   HKMALTQCKKLPISIRFDFVTDAKIRGITSLDSKNFHINVLGARNMTLEEITIIAPEESP  187

Query  604   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  783
             NTDGIH+ R +G+ + +S I TGDDCIS+GDG  +L +  VTCGPGHGIS+GSLG    E
Sbjct  188   NTDGIHVGRSVGVQIINSNIKTGDDCISIGDGTRDLLVERVTCGPGHGISIGSLGLYVKE  247

Query  784   RPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPN  960
               V GI V NS  I TDNGVRIKTWP++      + IH+  I +++V NPI+IDQEYCP 
Sbjct  248   EDVTGIRVVNSTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILIDQEYCPW  307

Query  961   NECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---A  1131
             N C+K KPS +K+  +S+K I+GTS  K+ V L CS G PC++V+IG+ID+ + G    A
Sbjct  308   NRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVQIGDIDIKYTGADGPA  367

Query  1132  KTICSNVKPKLTGKQCPK  1185
                CSNV P L G Q PK
Sbjct  368   TFQCSNVSPTLMGTQVPK  385



>ref|XP_008455507.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=402

 Score =   336 bits (862),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 242/371 (65%), Gaps = 25/371 (7%)
 Frame = +1

Query  112   IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMA  291
             I    AK N D+  +L  AWK+ACA+T  S ++IP G + + Q  L GPC + +E+++  
Sbjct  30    ITTYGAKPNTDITQVLANAWKDACASTNPSQLLIPTGVYQLNQSLLIGPCNSTIEVRMEG  89

Query  292   ILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD-------  450
              L+A PDP  +      ++   +D  T+SG G  DGQG        EKG++ +       
Sbjct  90    TLQAHPDPIGIG----LVLFRHIDQLTISGTGAFDGQG--------EKGWEKNDCHLKKA  137

Query  451   --KLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHI  624
               +LP N+  NF+TNS+++DIT+L+SK FH+N+L  KN+TF + T+ AP  SPNTDGIH+
Sbjct  138   CTRLPMNVRFNFITNSIVKDITSLDSKNFHINLLSCKNVTFQNVTIIAPEKSPNTDGIHV  197

Query  625   ARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIF  804
             +    I + ++ I TGDDC+S+GDG + + IT VTCGPGHGIS+GSLG+   E+ V G+ 
Sbjct  198   SNSEEINILNTKISTGDDCVSVGDGNKQITITNVTCGPGHGISIGSLGKYTTEKEVAGVT  257

Query  805   VSNSKFIGTDNGVRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQK  981
             V +   I T NGVRIK+WP+S      +D+H+  IEM +V NPI+IDQEYCP+N+C+K+ 
Sbjct  258   VKSCNLINTSNGVRIKSWPDSAVAYTASDLHFEDIEMVNVSNPIIIDQEYCPSNQCNKKI  317

Query  982   PSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI---CSNV  1152
             PSK+KI  VS+K+I+GTSAT   +   CS  +PC+DVE+ +I+L++ G    I   C NV
Sbjct  318   PSKIKIRNVSFKNIRGTSATFVAIKFICSKDLPCDDVEVADINLSYTGTQGRITSQCRNV  377

Query  1153  KPKLTGKQCPK  1185
              P +TGKQ P+
Sbjct  378   IPIITGKQNPR  388



>ref|XP_010675930.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/365 (45%), Positives = 227/365 (62%), Gaps = 8/365 (2%)
 Frame = +1

Query  112   IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMA  291
             I    AK + DV    + +W  ACA+   S +++P G + +  + L+GPC+ P  ++I+ 
Sbjct  38    ITTKGAKPDADVTQAFLDSWTAACASVKPSKVLVPAGNYILGAIKLKGPCQTPTVIEILG  97

Query  292   ILKAPPDPKNMDGKKEWLIVGRVDHFTL---SGGGTLDGQGNV--QVYPSKEKGFKGDKL  456
               KAPPD    + +  W  V  VD   L    GGG  DGQG    ++    +    G  L
Sbjct  98    NFKAPPDVAAFNKEDTWFKVEYVDSLILITGKGGGVFDGQGQAAWKLNECTKNANCGFDL  157

Query  457   PNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARII  636
             P N   NF+TNS +  +T++NSKL+H  +LG K L     T+ AP +SPNTDGIHI R  
Sbjct  158   PYNFRFNFVTNSKVSGLTSINSKLYHFALLGCKQLEMSDITITAPADSPNTDGIHIGRSD  217

Query  637   GITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNS  816
             G+ V+   IGTGDDC+S GDG +N+ + GVTCGPGHG+SVGSLG+ P E PV  I + N 
Sbjct  218   GVIVRGFTIGTGDDCVSFGDGAKNVLVEGVTCGPGHGLSVGSLGKYPNEEPVSNITIRNC  277

Query  817   KFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVK  996
                 TDNGVR+KTW NS+   VT +++  I +E+V+NP+++DQEYCP N C  + PSKVK
Sbjct  278   TIKNTDNGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPWNHCKAKTPSKVK  337

Query  997   ISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---AKTICSNVKPKLT  1167
             IS + +K++KG S+ KE V L CS GVPC+ VE+ +IDL + G    A ++C  VKP LT
Sbjct  338   ISDIRFKNVKGKSSGKEAVKLICSEGVPCDKVELADIDLQYTGTDGPAVSMCKFVKPLLT  397

Query  1168  GKQCP  1182
             GKQ P
Sbjct  398   GKQSP  402



>ref|XP_004144529.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=412

 Score =   336 bits (862),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 175/371 (47%), Positives = 243/371 (65%), Gaps = 25/371 (7%)
 Frame = +1

Query  112   IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMA  291
             I    AK N D+   L  AWK+ACA+T +S ++IP G + + Q  L GPCK+ +E+++  
Sbjct  40    ITTYGAKPNTDITQALANAWKDACASTYSSKLLIPMGVYHLNQSILHGPCKSTIEVRMEG  99

Query  292   ILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD-------  450
              L+A PDP   DG    ++   +D  TLSG G  DGQG        EKG++ +       
Sbjct  100   TLQAHPDPIG-DG---LVLFQYIDQLTLSGTGAFDGQG--------EKGWEKNDCHLKKI  147

Query  451   --KLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHI  624
               KLP N+  +F+TNS+++DIT+L+SK FH N+LG KN+TF + T+ AP NSPNTDGIH+
Sbjct  148   CTKLPMNVKFSFVTNSMVKDITSLDSKNFHFNLLGCKNVTFQNVTIIAPENSPNTDGIHV  207

Query  625   ARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIF  804
             +    I + ++ I TGDDCIS+GD  + + IT VTCGPGHGIS+GSLG+   E+ V G+ 
Sbjct  208   SSSEVINIFNTRISTGDDCISVGDSNKQITITNVTCGPGHGISIGSLGKYTKEKEVAGVT  267

Query  805   VSNSKFIGTDNGVRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQK  981
             V + K I T NGVRIKTWP+       +D+H+  IEM +V NP++IDQEYCP+N+C+K+ 
Sbjct  268   VKSCKLINTSNGVRIKTWPDCAVAYTASDLHFEDIEMVNVSNPVIIDQEYCPSNQCNKKI  327

Query  982   PSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNV  1152
             PSK+KIS VS+K+I+GTSAT   V   CS+   CE VE+ +IDL +   +G   + C NV
Sbjct  328   PSKIKISNVSFKNIRGTSATFVAVKFICSTVFSCEGVEVTDIDLAYIGTQGRITSQCRNV  387

Query  1153  KPKLTGKQCPK  1185
              P +TGKQ P+
Sbjct  388   IPIITGKQNPR  398



>ref|XP_009124086.1| PREDICTED: polygalacturonase [Brassica rapa]
 ref|XP_009124094.1| PREDICTED: polygalacturonase [Brassica rapa]
Length=397

 Score =   335 bits (860),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 170/377 (45%), Positives = 242/377 (64%), Gaps = 7/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
              +L LL +   + +       N D+   ++KA+  AC A   S ++IPKG F + +  + 
Sbjct  11    LVLCLLGYSANAEVFTAGGPPNSDITAAVLKAFTSACQAPAPSQVLIPKGDFKLGETVMT  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCK+P+E  +   +KA  D  +  GK  W++  +++ F L+GGGT DG+GN     +  
Sbjct  71    GPCKSPIEFTLQGNVKA--DGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKANNC  128

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F+  KLP ++  +F+ N+ I+DIT+L++K FH NV+ GKN+TFD+  + AP  SPNT
Sbjct  129   HKTFECKKLPISVRFDFVDNAEIKDITSLDAKNFHFNVISGKNMTFDNIKIIAPAESPNT  188

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  G+ + ++ I TGDDCIS+GDG++NL I  V CGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRCEGVKILNTKIATGDDCISVGDGMKNLLIEKVVCGPGHGISVGSLGRYGWEQD  248

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V  I V N    GTDNG+RIKTWP++        IH+  I +  V NPI+IDQEYCP N+
Sbjct  249   VTDINVKNCTLEGTDNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCPWNQ  308

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKG--GAKTI  1140
             C+K KPS +K+  +++++I+GTS  K+ V L CS G PCE+VEIG+I++ + G  G  T 
Sbjct  309   CNKNKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIDYTGPDGPPTF  368

Query  1141  -CSNVKPKLTGKQCPKV  1188
              C+NV PKL G Q PK 
Sbjct  369   ECTNVTPKLVGTQNPKA  385



>ref|XP_006492955.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score =   336 bits (861),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 175/404 (43%), Positives = 250/404 (62%), Gaps = 25/404 (6%)
 Frame = +1

Query  55    SYCAFTFILFLLAHFGESA-IINVAAKAN---VDVGPL----------LMKAWKEACAAT  192
             S C+   +L +L  F  +  IIN A+      +D G +             AW+EAC   
Sbjct  4     SSCSQLLVLAILVLFSLAQNIINAASNGVFNVIDFGAIADGIRDNSRAFENAWREACYWN  63

Query  193   TASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFT  372
             T ST+++P G + +T V  +GPCKAP+  ++  ++ APP    +  K+ W+    +  FT
Sbjct  64    TYSTVLVPPGKYLVTSVVFKGPCKAPISFQLQGLILAPPGLSKLADKESWITFESLRSFT  123

Query  373   LSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGG  552
             L+GGGT  GQG      ++       +LP ++  N L +S I  + +++SK FH+N+LG 
Sbjct  124   LTGGGTFHGQGRTAWPENQCHKNSNCQLPISIRFNKLNDSTITGVQSVDSKFFHINILGC  183

Query  553   KNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDG-----LENLKI  717
              NL  +   + AP +SPNTDGIHI R  GI + +S+I TGDDC+SLGDG     ++N+ +
Sbjct  184   YNLKLNKINISAPDDSPNTDGIHIGRSNGIEISNSIIATGDDCVSLGDGSQNVLVQNVLV  243

Query  718   TGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHY  897
             + V+CGPGHGISVGSLG+   E  V G+ V N  F GT NGVRIKTWP+S  G  ++  +
Sbjct  244   SDVSCGPGHGISVGSLGKYKKEEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTF  303

Query  898   HKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGV  1077
               + M +V+NPIVIDQEYCP+N+C+ + PS+VKIS V +++I+GTS TKE V + CS  +
Sbjct  304   EDLFMNNVENPIVIDQEYCPHNQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEI  363

Query  1078  PCEDVEIGEIDLTF-----KGGAKTICSNVKPKLTGKQCPKVTC  1194
             PC++VEIG+I+L +     KG A + CSNVKP L GKQ P  TC
Sbjct  364   PCQNVEIGDINLVYNGIDDKGPAISSCSNVKPTLVGKQIP-ATC  406



>emb|CDP04342.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   331 bits (849),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 161/287 (56%), Positives = 207/287 (72%), Gaps = 6/287 (2%)
 Frame = +1

Query  343   LIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDITTL  516
             + +  VD  TLSGGGTL+GQG  + +   E   K +  KLPN LSLNF+ N+VIRD+T+L
Sbjct  1     MTIMYVDQLTLSGGGTLEGQG-AKAWTQNECRVKTECSKLPNTLSLNFVNNTVIRDLTSL  59

Query  517   NSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGD  696
             NSKLFHVN+ G  N+TF HFT+ APG+SPNTDGIHI    G+ + DS IGTGDDCIS+GD
Sbjct  60    NSKLFHVNLFGCNNVTFQHFTITAPGDSPNTDGIHIGHSTGVVITDSNIGTGDDCISIGD  119

Query  697   GLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPG  876
             G + + I+ VTCGPGHGISVGSLGR   E PV+GIFV++    GT NGVR+K+WP S  G
Sbjct  120   GAKQVNISKVTCGPGHGISVGSLGRYDNELPVEGIFVTDCIISGTLNGVRVKSWPASKSG  179

Query  877   VVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVI  1056
               T++H+  I M++V NP++IDQEYCPNN+C+   PS VKI++VS+K+I GTSAT   V 
Sbjct  180   CATNMHFEGIIMQNVSNPMIIDQEYCPNNQCTNTAPSSVKIAQVSFKNITGTSATPAVVT  239

Query  1057  LACSSGVPCEDVEIGEIDLTFKGGAKTI---CSNVKPKLTGKQCPKV  1188
             L CS  +PCE VE+ +IDL + G    +   C+NVKP L+GK  P +
Sbjct  240   LLCSKSIPCESVEVADIDLAYNGNQGNVSSNCANVKPALSGKLNPPI  286



>ref|XP_004163433.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=412

 Score =   335 bits (858),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 174/371 (47%), Positives = 243/371 (65%), Gaps = 25/371 (7%)
 Frame = +1

Query  112   IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMA  291
             I    AK N D+   L  AWK+ACA+T +S ++IP G + + Q  L GPCK+ +E+++  
Sbjct  40    ITTYGAKPNTDITQALANAWKDACASTYSSKLLIPMGVYHLNQSILHGPCKSTIEVRMEG  99

Query  292   ILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD-------  450
              L+A PDP   DG    ++   +D  TLSG G  DGQG        EKG++ +       
Sbjct  100   TLQAHPDPIG-DG---LVLFQYIDQLTLSGTGAFDGQG--------EKGWEKNDCHLKKI  147

Query  451   --KLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHI  624
               KLP N+  +F+TNS+++DIT+L+SK FH N+LG KN+TF + T+ AP NSPNTDGIH+
Sbjct  148   CTKLPMNVKFSFVTNSMVKDITSLDSKNFHFNLLGCKNVTFQNVTIIAPENSPNTDGIHV  207

Query  625   ARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIF  804
             +    I + ++ I TGDDCIS+GD  + + IT VTCGPGHGIS+GSLG+   E+ V G+ 
Sbjct  208   SSSEVINIFNTRISTGDDCISVGDSNKQITITNVTCGPGHGISIGSLGKYTKEKEVAGVT  267

Query  805   VSNSKFIGTDNGVRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQK  981
             V + K I T NGVRIKTWP+       +D+H+  IEM +V NP++IDQEYCP+N+C+K+ 
Sbjct  268   VKSCKLINTSNGVRIKTWPDCAVAYTASDLHFEDIEMVNVSNPVIIDQEYCPSNQCNKKI  327

Query  982   PSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNV  1152
             PSK+KI+ VS+K+I+GTSAT   V   CS+   CE VE+ +IDL +   +G   + C NV
Sbjct  328   PSKIKINNVSFKNIRGTSATFVAVKFICSTVFSCEGVEVTDIDLAYIGTQGRITSQCRNV  387

Query  1153  KPKLTGKQCPK  1185
              P +TGKQ P+
Sbjct  388   IPIITGKQNPR  398



>ref|XP_010038560.1| PREDICTED: exopolygalacturonase [Eucalyptus grandis]
Length=407

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 170/391 (43%), Positives = 239/391 (61%), Gaps = 17/391 (4%)
 Frame = +1

Query  52    ISYCAFTFILFLLAHFGESAIINVAAKANVDV-------------GPLLMKAWKEACAAT  192
             ++  A    L  LA    +  +++  +A +DV               +++ AW +AC + 
Sbjct  6     MARAAIFLYLLSLAAAMRTGGVSMIGQAEIDVRKFGAKADGRSDDSQIIVNAWNKACTSP  65

Query  193   TASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFT  372
             + ST+VI KG++    +  +GPCKA V LK+   +KAP D      +  W++   +D  T
Sbjct  66    SPSTVVISKGSYLAGPLKFQGPCKADVNLKVEGAVKAPADLNKFKSQGSWVLFQNIDGLT  125

Query  373   LSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLG  549
             LSGGG+ DGQG      +   +  K + LP NL    + NS ++DIT+LNSKLFHV +L 
Sbjct  126   LSGGGSFDGQGAAAWKENNCAQTGKCNSLPTNLQFTSINNSHVQDITSLNSKLFHVELLN  185

Query  550   GKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVT  729
               N+T  H T+ AP +S NTDGIH+ R +G+ +  + I TGDDC+SLGDG + + I GVT
Sbjct  186   CNNVTLQHVTIDAPEDSLNTDGIHVGRSMGVNIIGADIRTGDDCVSLGDGSQQVHIEGVT  245

Query  730   CGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIE  909
             CGPGHGISVGSLG+   E+PV G+ V N     T NG+R+KTWPNS  GV + +H+  I 
Sbjct  246   CGPGHGISVGSLGKYHDEQPVVGVTVRNCTLTNTMNGIRVKTWPNSPSGVASGMHFEDIT  305

Query  910   MEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCED  1089
             + +V  PI+IDQ YCP N C ++ PSKVKIS VS+++I+GTSAT   V L CS GVPC+ 
Sbjct  306   VNNVSTPILIDQNYCPYNNCQQKIPSKVKISDVSFRNIRGTSATPLAVKLVCSRGVPCQK  365

Query  1090  VEIGEIDLTF---KGGAKTICSNVKPKLTGK  1173
             VE+ +I+L +    G A + C NVKP + GK
Sbjct  366   VELADINLRYNGRNGTATSQCENVKPTIAGK  396



>ref|XP_006495222.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score =   334 bits (857),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 174/404 (43%), Positives = 249/404 (62%), Gaps = 25/404 (6%)
 Frame = +1

Query  55    SYCAFTFILFLLAHFGESA-IINVAAKAN---VDVGPL----------LMKAWKEACAAT  192
             S C+   +L +L  F  +  IIN A+      +D G +             AW+EAC   
Sbjct  4     SSCSQLLVLAILVLFSLAQNIINAASNGVFNVIDFGAMADGIRDNSKAFENAWREACNWN  63

Query  193   TASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFT  372
             T ST+++P G + +T    +GPCKAP+  ++  ++ APP    +  K+ W+    +  FT
Sbjct  64    TYSTVLVPPGKYFVTSAVFKGPCKAPISFQLQGLILAPPGLSKLADKESWITFESLRSFT  123

Query  373   LSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGG  552
             L+GGGT  GQG      ++       +LP ++  N L +S I  + +++SK FH+N+LG 
Sbjct  124   LTGGGTFHGQGRTAWPENQCHKNSNCQLPISIRFNKLNDSTITGVQSVDSKFFHINILGC  183

Query  553   KNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDG-----LENLKI  717
              NL  +   + AP +SPNTDGIHI R  GI + +S+I TGDDC+SLGDG     ++N+ +
Sbjct  184   YNLKLNKINISAPDDSPNTDGIHIGRSNGIEISNSIIATGDDCVSLGDGSQNVLVQNVLV  243

Query  718   TGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHY  897
             + V+CGPGHGISVGSLG+   E  V G+ V N  F GT NGVRIKTWP+S  G  ++  +
Sbjct  244   SDVSCGPGHGISVGSLGKYKKEEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTF  303

Query  898   HKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGV  1077
               + M +V+NPIVIDQEYCP+N+C+ + PS+VKIS V +++I+GTS TKE V + CS  +
Sbjct  304   EDLFMNNVENPIVIDQEYCPHNQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEI  363

Query  1078  PCEDVEIGEIDLTF-----KGGAKTICSNVKPKLTGKQCPKVTC  1194
             PC++VEIG+I+L +     KG A + CSNVKP L GKQ P  TC
Sbjct  364   PCQNVEIGDINLVYNGIDDKGPAISSCSNVKPTLVGKQIP-ATC  406



>emb|CDY54512.1| BnaC07g49180D [Brassica napus]
Length=397

 Score =   333 bits (853),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 169/378 (45%), Positives = 240/378 (63%), Gaps = 10/378 (3%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
             F++ LL     +    + A    D+  LL+K + EAC   T S+++IPKG + + Q+ + 
Sbjct  11    FVVCLLGLSANAKDFTITAPPGSDITSLLLKTFNEACQFPTKSSVLIPKGEYKLRQIEMM  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPS--  426
             GPCKAP+ + +   +KA     N++G   W+   R++ F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIRITLQGTVKAD---GNVNGNDFWVAFRRINGFKLNGGGVFDGEGNAAWRANNC  127

Query  427   -KEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  603
              K    +  KLP ++  +F+T++ IR IT+++SK FH+NVLG +N+T +  T+ AP  SP
Sbjct  128   HKMALTQCKKLPISIRFDFVTDAKIRGITSMDSKNFHINVLGARNMTLEEITIIAPEESP  187

Query  604   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  783
             NTDGIH+ R +G+ + +S I TGDDCIS+GDG  +L +  VTCGPGHGIS+GSLG    E
Sbjct  188   NTDGIHVGRSVGVQIINSNIKTGDDCISIGDGTRDLLVERVTCGPGHGISIGSLGLYVKE  247

Query  784   RPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPN  960
               V GI V N   I TDNGVRIKTWP++      + IH+  I +++V NPI+IDQEYCP 
Sbjct  248   EDVTGIRVVNCTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILIDQEYCPW  307

Query  961   NECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGG---A  1131
             N C+K KPS +K+  +S+K I+GTS  K+ V L CS G PC++VEIG+I++ + G    A
Sbjct  308   NRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVEIGDINIQYTGADGPA  367

Query  1132  KTICSNVKPKLTGKQCPK  1185
                CSNV P L G Q PK
Sbjct  368   TFQCSNVSPTLMGTQVPK  385



>ref|XP_004295350.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase clone GBGA483-like 
[Fragaria vesca subsp. vesca]
Length=400

 Score =   332 bits (852),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 173/388 (45%), Positives = 245/388 (63%), Gaps = 9/388 (2%)
 Frame = +1

Query  61    CAFTFILF-LLAHFGESAIINVAAKAN--VDVGPLLMKAWKEACAATTASTIVIPKGTFP  231
             C    + F L A+  +  +    AKA+   D    + KAW +AC AT+ ST+VI K  + 
Sbjct  10    CFLFLVAFSLTANAADFDVRKYGAKADGKTDDSQAINKAWTDACTATSQSTVVIEKRNYL  69

Query  232   MTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNV  411
             +  V   GPCKAP+ +K+   L AP +P+ +  +  W++   VD+ ++ GG   DGQG +
Sbjct  70    VGPVRFGGPCKAPISIKVAGTLVAPAEPEKLKSQDGWVVFQNVDNLSVFGGXVFDGQGKL  129

Query  412   QVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKA  588
                 +   K  K + LP N+ +  +TNS I+D T+LNSKLFH+NV+  K+LT    T+ A
Sbjct  130   AWSRNDFAKTGKCNSLPINIRITGVTNSHIQDKTSLNSKLFHINVINSKHLTLQRITIDA  189

Query  589   PGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLG  768
             P  S NTDGIHI R   I V D+ I TGDDC+SLGDG +N+ +  VTCG GHGIS+GSLG
Sbjct  190   PQESLNTDGIHIGRSSYINVTDANIKTGDDCVSLGDGSQNINVEKVTCGSGHGISIGSLG  249

Query  769   RTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVK-NPIVIDQ  945
             R   E+PV+G+ V   +   T NGVRIKTWP S  GV +D+H+  I M++VK NP+++DQ
Sbjct  250   RYHDEQPVQGVTVRYCQISNTTNGVRIKTWPASPNGVASDLHFEDISMDNVKTNPVLVDQ  309

Query  946   EYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKG  1125
             EYCP  +C  + PSKVKIS VS+K+I+GT+     V L CS G+PC++V++ +I+LT+ G
Sbjct  310   EYCPYGQCQAKLPSKVKISNVSFKNIRGTTQDLVAVKLVCSRGIPCQNVQVADINLTYNG  369

Query  1126  G----AKTICSNVKPKLTGKQCPKVTCK  1197
                  A + C+NVKP ++G   P+V  K
Sbjct  370   NKNGTAISECANVKPTVSGFNHPQVCAK  397



>ref|XP_004154764.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=406

 Score =   332 bits (852),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 183/400 (46%), Positives = 244/400 (61%), Gaps = 22/400 (6%)
 Frame = +1

Query  43    MATISYCAF---TFILFLLAHFGES-----AIINVAAKANV----DVGPLLMKAWKEACA  186
             M  I Y      TF++ LL+   ES      I  +    N+    DV   L  AW +ACA
Sbjct  1     MGMIKYSNLLITTFLMSLLSFTIESQSHVDVIFPLRKYGNIVSGDDVTEALKDAWNDACA  60

Query  187   ATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDH  366
             +   S +VIP G F + +   +GPCK+P+E+++   L+AP  P        W+    VD 
Sbjct  61    SVRPSAVVIPDGIFKLREGEFKGPCKSPIEIRVRGTLQAPKHPHG----DSWITFAYVDR  116

Query  367   FTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNN-LSLNFLTNSVIRDITTLNSKLFHVN  540
              T+SG G  DGQG      +   K      LP   L  +F+TNS++R IT+L+SK FHVN
Sbjct  117   MTISGKGVFDGQGKAGWEKNDCHKRIDCVNLPIVILRFDFITNSIVRGITSLDSKNFHVN  176

Query  541   VLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKIT  720
             +LG  NLTF    + AP +SPNTDGIHI R IGI++  S I TGDDCISLGDG + +KIT
Sbjct  177   ILGCNNLTFQGVNIIAPEDSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRVKIT  236

Query  721   GVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHY  897
              VTCGPGHGIS+GSLG+   E PV  + V N   + T NGVRIKTWP+S   G+ T++H+
Sbjct  237   NVTCGPGHGISIGSLGKYTNEEPVDDVVVKNCTIMNTTNGVRIKTWPSSPVAGIATNMHF  296

Query  898   HKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGV  1077
               I M +V NPI+IDQEYCP N+C+++ PS +KI+ VS+K+IKG+SAT   V L CSS  
Sbjct  297   SDITMINVSNPILIDQEYCPWNQCNREIPSNIKINNVSFKNIKGSSATPVAVKLICSSNQ  356

Query  1078  PCEDVEIGEIDLTF---KGGAKTICSNVKPKLTGKQCPKV  1188
             PCE+V++  IDL +    G   + C NVKP ++G Q P +
Sbjct  357   PCEEVKVANIDLVYNGINGPVTSQCMNVKPIISGIQNPSI  396



>gb|AAO24261.1| putative pollen polygalacturonase [Turnera subulata]
Length=382

 Score =   332 bits (850),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 170/349 (49%), Positives = 230/349 (66%), Gaps = 8/349 (2%)
 Frame = +1

Query  139   VDVGPLLMKAW-KEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDP  315
              D+   L  A+ K+ACA+ T S +V+P G + M  V ++GPCK+ VE+++   LKAP +P
Sbjct  36    ADIAEALSAAFQKDACASATPSKVVVPAGEYTMGPVDMKGPCKSTVEVQVDGNLKAPAEP  95

Query  316   KNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQ-VYPSKEKGFKGDKLPNNLSLNFLTNS  492
             K   G+  W+    +D  T SG G  DGQG++     +  K       P N     L ++
Sbjct  96    K---GEPGWVSFEYIDGLTFSGKGVFDGQGHIAWANNNCNKNPNCKSFPLNFRFTSLKHA  152

Query  493   VIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  672
             +I+D+T+ +SK FHVNV+  +N+TF +F + AP  S NTDGIH+ R  GI + DS IGTG
Sbjct  153   LIKDLTSKDSKNFHVNVINCENVTFQNFVIDAPAESLNTDGIHMGRSKGIKIIDSKIGTG  212

Query  673   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  852
             DDCIS+GDG E + +TGVTCGPGHGIS+GSLGR   E+PV+G+ V N     TDNGVRIK
Sbjct  213   DDCISIGDGTEQVTVTGVTCGPGHGISIGSLGRYDNEQPVRGVLVKNCILKNTDNGVRIK  272

Query  853   TWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGT  1032
             +WP    G  +DIH+  I ME+V NP++IDQEYCP N+C+K  PSKVKIS VS+K+IKGT
Sbjct  273   SWPAMKGGEASDIHFEDITMENVTNPVIIDQEYCPWNQCTKDAPSKVKISNVSFKNIKGT  332

Query  1033  SATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTG  1170
             + T E V + CSS +PCE V++  IDL +   +G AK+ C N K  +TG
Sbjct  333   TNTPEAVKIICSSALPCEQVQLNGIDLKYTGTQGPAKSECKNAKLTVTG  381



>ref|XP_004293444.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=405

 Score =   332 bits (850),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/354 (48%), Positives = 233/354 (66%), Gaps = 14/354 (4%)
 Frame = +1

Query  130   KANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPP  309
             K N D+   L  AWK+ACAATT S +++PKGTF +     +GPCKAP+ +++  IL+APP
Sbjct  44    KPNTDISQPLANAWKDACAATTPSRVIVPKGTFQLKGAVFKGPCKAPITVQVDGILQAPP  103

Query  310   DPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPN------NLS  471
                 +  K+ W+    V+  T+SG GT DGQG      +  K    +K PN      N+ 
Sbjct  104   IEAQLANKEFWVQFLEVERLTVSGTGTFDGQGQ-----NSWKDNDCNKNPNCGGLAINVR  158

Query  472   LNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVK  651
              + + NS++RD+T+LNSK FH N+LG ++LTF H T+KAPG+SPNTDGIH+ R  GI + 
Sbjct  159   FDKVKNSLVRDVTSLNSKNFHFNILGCEHLTFQHVTIKAPGDSPNTDGIHMGRSTGINIT  218

Query  652   DSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGT  831
             D  IGTGDDCIS+GDG   L ++ V+CGPGHGIS+GSLGR   E  V G+ + +     T
Sbjct  219   DMNIGTGDDCISVGDGTRQLTVSKVSCGPGHGISIGSLGRYDNEDDVSGLNIRDCTLSNT  278

Query  832   DNGVRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKV  1008
              NGVRIKT+P S      +DIH+ KI M +V NP++IDQEYCP  +C+KQ PSKVKIS V
Sbjct  279   LNGVRIKTFPASPKATTASDIHFEKITMNNVANPVLIDQEYCPWGQCNKQIPSKVKISNV  338

Query  1009  SYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF--KGGAKTICSNVKPKL  1164
             S+K+I GT++T E + + C+ G+ C+ V + +IDL    KG   + C+NV+P +
Sbjct  339   SFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDIDLKLSGKGTLTSHCANVQPTI  392



>ref|XP_004514023.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=390

 Score =   331 bits (849),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 173/347 (50%), Positives = 234/347 (67%), Gaps = 5/347 (1%)
 Frame = +1

Query  136   NVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDP  315
             N D+   L  AWKEAC + + S +V+P G + + Q+ LEGPCKAP+E+K+  I++AP +P
Sbjct  37    NGDITNALKNAWKEACESRSRSKVVVPSGRYKLQQIDLEGPCKAPIEVKVNGIIQAPKNP  96

Query  316   KNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTN  489
              +++G+ +W+    ++ FTLSG GT DGQG +  +   + G   +  +L  N    FL N
Sbjct  97    FHLNGQDQWIRFQYINFFTLSGKGTFDGQGEM-AWKQNDCGRNTNCKRLAMNFGFAFLNN  155

Query  490   SVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGT  669
             SVI+DI + +SK FH NV G  N+TF +F + AP +SPNTDGIHI +   + + +S IG+
Sbjct  156   SVIKDINSKDSKYFHANVFGCNNVTFTNFNINAPESSPNTDGIHIGKSSRVKISNSKIGS  215

Query  670   GDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRI  849
             GDDCISLGDG   + I  VTCGPGHGISVGSLG+ P E PV  + V N     TDNGVRI
Sbjct  216   GDDCISLGDGSTQITIQNVTCGPGHGISVGSLGKYPNEDPVVDLIVKNCTLNNTDNGVRI  275

Query  850   KTWP-NSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIK  1026
             KTWP  S   + + +H+  I M +V NPI+IDQ+YCP N+CSKQ PSK+KI KV +K+I+
Sbjct  276   KTWPGTSVISIASHLHFEDIVMVNVSNPIIIDQQYCPWNQCSKQSPSKIKIKKVIFKNIR  335

Query  1027  GTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI-CSNVKPKL  1164
             GTSAT+E V L  S GVPCE V + +I+L+F G   T  C+NVKP +
Sbjct  336   GTSATQEGVSLIRSRGVPCEAVVLSDINLSFNGSKVTAKCANVKPTI  382



>sp|P35337.1|PGLR_BRANA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Brassica napus]
 gb|AAA70402.1| polygalacturonase [Brassica napus]
Length=397

 Score =   331 bits (849),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/377 (44%), Positives = 240/377 (64%), Gaps = 7/377 (2%)
 Frame = +1

Query  73    FILFLLAHFGESAIINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLE  252
              +L LL +   + +       N D+   ++KA+  AC A   S ++IPKG F + +  + 
Sbjct  11    LVLCLLGYSANAEVFTAGGPPNSDITAAVLKAFTSACQAPAPSQVLIPKGDFKLGETVMT  70

Query  253   GPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-  429
             GPCK+P+E  +   +K   D  +  GK  W++  +++ F L+GGGT DG+GN     +  
Sbjct  71    GPCKSPIEFTLQGNVKT--DGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKANNC  128

Query  430   EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  609
              K F+  KLP ++  +F+ N+ I+D+T+L++K FH NV+ GKN+TFD+  + AP  SPNT
Sbjct  129   HKTFECKKLPISVRFDFVDNAEIKDVTSLDAKNFHFNVISGKNMTFDNIKIIAPAESPNT  188

Query  610   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  789
             DGIH+ R  G+ + ++ I TGDDCIS+GDG++NL I  V CGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRCEGVKILNTKIATGDDCISVGDGMKNLLIEKVVCGPGHGISVGSLGRYGWEQD  248

Query  790   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNE  966
             V  I V N    GT NG+RIKTWP++        IH+  I +  V NPI+IDQEYCP N+
Sbjct  249   VTDITVKNCTLEGTSNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCPWNQ  308

Query  967   CSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKG--GAKTI  1140
             C+K KPS +K+  +++++I+GTS  K+ V L CS G PCE+VEIG+I++ + G  G  T 
Sbjct  309   CNKNKPSTIKLVDITFRNIRGTSENKDAVKLLCSKGHPCENVEIGDINIEYTGPDGPPTF  368

Query  1141  -CSNVKPKLTGKQCPKV  1188
              C+NV PKL G Q PK 
Sbjct  369   ECTNVTPKLVGAQNPKA  385



>ref|XP_008366919.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Malus 
domestica]
Length=447

 Score =   333 bits (853),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 173/397 (44%), Positives = 240/397 (60%), Gaps = 14/397 (4%)
 Frame = +1

Query  1     GKNNNTKI*VTNLKMATISYCAFTFILFLLAHFGESAIIN---VAAKANVDVGPLLMKAW  171
             G N + ++    +K+  +S+  F F+  +     E   +         + D+   L  AW
Sbjct  19    GVNYDCRLSEQGIKVVILSFSVFLFLASIANAKAEVFYVTNSTYGGNPSGDITLALADAW  78

Query  172   KEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIV  351
             ++AC++   + +VIP+G + +    L GPCK+P+E+++   L+AP +   +  +  W+  
Sbjct  79    RDACSSPWPAKVVIPEGEYYLRGAILHGPCKSPIEVQVQGYLRAPQESSQLLQQNTWVGF  138

Query  352   GRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLF  531
               VD  TL GGGT DGQ N   Y S +          NL  +F+TNSVI  IT+L+SK F
Sbjct  139   QYVDRLTLFGGGTFDGQSNCHKYKSCQS-----NRVFNLRFDFVTNSVIEGITSLDSKNF  193

Query  532   HVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENL  711
             H+NV   +N+TF + T+ AP +S NTDGIHI R  G+T+  ++IGTGDDCISLGDG +N+
Sbjct  194   HINVFACRNVTFQYVTITAPEDSVNTDGIHIGRSFGVTIDHTIIGTGDDCISLGDGSQNI  253

Query  712   KITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--  885
              +T VTCGPGHGIS+GSLG+ P E PV G+ V N     T NGVRIKTWP S P   T  
Sbjct  254   VVTBVTCGPGHGISIGSLGKYPDEEPVVGVRVKNCTLTNTQNGVRIKTWPGS-PTFTTAS  312

Query  886   DIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILAC  1065
              IH+  I M +V NPI IDQEYCP   C K  PSKVKIS +S+ +IKG+SAT   V L C
Sbjct  313   HIHFQXIXMVNVSNPISIDQEYCPYTYCGKDDPSKVKISDISFTNIKGSSATPVAVKLMC  372

Query  1066  SSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLT  1167
             S  +PC+ V + ++DLT+   KG   + C+ VKP +T
Sbjct  373   SRKIPCDGVGLTDVDLTYIGSKGPLTSQCAYVKPYIT  409



>gb|ABE77145.1| putative polygalacturonase [Fragaria x ananassa]
Length=405

 Score =   330 bits (847),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 169/355 (48%), Positives = 233/355 (66%), Gaps = 14/355 (4%)
 Frame = +1

Query  130   KANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPP  309
             K N D+   L  AWK+ACAATT S +++PKGTF +     +GPCKAP+ +++  IL+APP
Sbjct  44    KPNTDISQPLANAWKDACAATTPSRVIVPKGTFQLKGAVFKGPCKAPITVQVDGILQAPP  103

Query  310   DPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPN------NLS  471
                 +  K+ W+    V+  T+SG GT DGQG      +  K    +K PN      N+ 
Sbjct  104   IEAQLANKEFWVQFLEVERLTVSGTGTFDGQGQ-----NSWKDNDCNKNPNCGGLAINVR  158

Query  472   LNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVK  651
              + + NS++RD+T+LNSK FH N+LG ++LTF H  VKAPG+SPNTDGIH+ R   I + 
Sbjct  159   FDRVKNSLVRDVTSLNSKNFHFNILGCEHLTFQHVIVKAPGDSPNTDGIHMGRSTRINIT  218

Query  652   DSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGT  831
             D+ IGTGDDCIS+GDG   L ++ V+CGPGHGIS+GSLGR   E  V G+ + +     T
Sbjct  219   DTNIGTGDDCISVGDGTRQLTVSKVSCGPGHGISIGSLGRYDNEDDVSGLNIRDCTLSNT  278

Query  832   DNGVRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKV  1008
              NGVRIKT+P S      +DIH+ KI M +V NP++IDQEYCP  +C+KQ PSKVKIS V
Sbjct  279   LNGVRIKTFPASPKATTASDIHFEKITMNNVANPVLIDQEYCPWGQCNKQIPSKVKISNV  338

Query  1009  SYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF--KGGAKTICSNVKPKLT  1167
             S+K+I GT++T E + + C+ G+ C+ V + +IDL    KG   + C+NV+P +T
Sbjct  339   SFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDIDLKLSGKGTLTSHCANVQPTIT  393



>ref|XP_010675940.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   330 bits (847),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 166/368 (45%), Positives = 228/368 (62%), Gaps = 24/368 (7%)
 Frame = +1

Query  127   AKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAP  306
             AK + DV    + +W  ACA+   S +++P G + +  ++L+GPC+ P  ++I+   KAP
Sbjct  43    AKPDADVTQAFLDSWTAACASKKPSKVLVPAGNYILGAITLKGPCQTPTVIEILGNFKAP  102

Query  307   PDPKNMDGKKEWLIVGRVDHFTL---SGGGTLDGQGNVQVYPSKEKGFKGDK--------  453
              D      +  W  V  VD   +    GGG  DGQG        + G+K ++        
Sbjct  103   SDVAAFKKEDSWFKVENVDSLIIISGKGGGVFDGQG--------QAGWKKNECTKNANCA  154

Query  454   --LPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIA  627
               LP N+  NF++NS +  +T+LNSK FHV +LG K L     T+ AP +SPNTDGIHI 
Sbjct  155   FDLPYNIRFNFVSNSKVSGLTSLNSKSFHVVLLGCKQLELSDMTITAPADSPNTDGIHIG  214

Query  628   RIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFV  807
             R   I V+   IGTGDDC+S GDG +N+ I GVTCGPGHG+SVGSLG+ P E PV  I +
Sbjct  215   RSENIIVRGWTIGTGDDCVSFGDGAKNVLIEGVTCGPGHGLSVGSLGKYPNEEPVSNITI  274

Query  808   SNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPS  987
              N     TDNGVR+KTW NS+   VT +++  I +E+V+NP+++DQEYCP N C  + PS
Sbjct  275   RNCTIKNTDNGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPWNHCKAKTPS  334

Query  988   KVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKP  1158
             KVKIS + +K++KG S+TKE V L CS GVPC+ VE+ +ID+ +    G A ++C  VKP
Sbjct  335   KVKISDIRFKNVKGKSSTKEAVKLICSEGVPCDKVELADIDIQYTGPDGPAVSMCKFVKP  394

Query  1159  KLTGKQCP  1182
              LTGKQ P
Sbjct  395   LLTGKQSP  402



>ref|XP_006371365.1| hypothetical protein POPTR_0019s09490g [Populus trichocarpa]
 gb|ERP49162.1| hypothetical protein POPTR_0019s09490g [Populus trichocarpa]
Length=326

 Score =   327 bits (838),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 171/320 (53%), Positives = 213/320 (67%), Gaps = 11/320 (3%)
 Frame = +1

Query  37   LKMATISYCAFTFILFLLAHFGESAIIN-----VAAKANVDVGPLLMKAWKEACAATTAS  201
            + +  +S    +F LFLL      A  N         A  D+   L  AWK ACA+T  S
Sbjct  1    MGLEVVSSAIISFSLFLLLASTTQAQSNGVFDVTKYGAGKDITEALTNAWKSACASTKPS  60

Query  202  TIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSG  381
             ++IP GT+ + +V+L GPCKA ++L++  ILKAP DP  + G   W+    VD FTLSG
Sbjct  61   KVLIPSGTYWLRKVTLAGPCKAAIKLQVDGILKAPVDPNKLSGG-HWVNFRYVDQFTLSG  119

Query  382  GGTLDGQGNVQVYPS---KEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGG  552
             GT DGQG V    S   K+K  KG  LP NL  +F+TN+++RDITTL+SK FHVNVLG 
Sbjct  120  RGTFDGQGKVAWSKSTCHKDKNCKG--LPMNLRFDFITNALVRDITTLDSKNFHVNVLGC  177

Query  553  KNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTC  732
            KNLTF HFTV+APG S NTDGIHI R  GI + DS I TGDDCIS+GDG E L ITGVTC
Sbjct  178  KNLTFQHFTVRAPGESVNTDGIHIGRSTGIYIIDSKISTGDDCISVGDGTEELHITGVTC  237

Query  733  GPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEM  912
            GPGHGISVGSLG+ P E+PV GIFV N     T NGVRIK+WP  + GV +++H+  I M
Sbjct  238  GPGHGISVGSLGKYPNEKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVM  297

Query  913  EDVKNPIVIDQEYCPNNECS  972
             +V+NP++IDQ YCP N+C+
Sbjct  298  NNVQNPVIIDQGYCPWNQCT  317



>emb|CAN65674.1| hypothetical protein VITISV_002009 [Vitis vinifera]
Length=1260

 Score =   350 bits (898),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 176/350 (50%), Positives = 233/350 (67%), Gaps = 6/350 (2%)
 Frame = +1

Query  157   LMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKK  336
             L+ AW+ ACA+   S +VIP G + + QV++EGPCKAP+ L +   ++AP D      + 
Sbjct  909   LLTAWEAACASPIVSRVVIPAGIYALGQVTIEGPCKAPINLIVKGTVRAPVDTSRFKPQA  968

Query  337   EWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKG-DKLPNNLSLNFLTNSVIRDITT  513
              W+    +D FTLSG G  DGQG   V+  K    K   +LP NL  NFLTNS+I+DIT+
Sbjct  969   GWVAFQHLDQFTLSGYGVFDGQGQ-SVWGQKCSRTKYCHQLPINLRFNFLTNSIIKDITS  1027

Query  514   LNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLG  693
              +SK FH+NVLG +N+TF    + AP +S NTDGIHI R  G+ +  S I TGDDC+S+G
Sbjct  1028  KDSKQFHINVLGCRNITFFQVAITAPEDSQNTDGIHIGRSRGVNITHSTIQTGDDCVSIG  1087

Query  694   DGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHP  873
             DG E + IT V CGPGHGISVGSLG    E PV GI V N     T NGVR+KT+P+S  
Sbjct  1088  DGSEQIDITKVNCGPGHGISVGSLGLYKNEAPVIGIRVKNCTLSDTTNGVRVKTYPSSPQ  1147

Query  874   GVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETV  1053
             G  T++H+H I M +V NPI+IDQEYCP+N+C+ Q PS+VK+S +S+K+I+GT++T+  V
Sbjct  1148  GTATEMHFHDIVMNNVSNPIIIDQEYCPHNQCNLQVPSRVKLSNISFKNIRGTTSTELAV  1207

Query  1054  ILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTGKQCPKVTC  1194
              L CS G PC+ VE+G IDL +   +G A + C NV+  L G Q PK TC
Sbjct  1208  NLVCSKGAPCQKVELGNIDLKYTGPEGTASSQCKNVEATLWGTQQPK-TC  1256


 Score =   203 bits (516),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 110/278 (40%), Positives = 155/278 (56%), Gaps = 35/278 (13%)
 Frame = +1

Query  145  VGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNM  324
            V    M AWK AC  T  ST+V+  GT+ +  V  +GPC+AP+  ++   LKAP D    
Sbjct  665  VSRAFMSAWKVACTCTDPSTVVVXGGTYVVGPVQFQGPCRAPMGFRVQGTLKAPTDLNRF  724

Query  325  DGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRD  504
            + +  W+I   +D   +SGGGT +GQG+                       +  N+  R 
Sbjct  725  ELQDGWVIFQDIDXLIISGGGTFBGQGHTA---------------------WGQNNCAR-  762

Query  505  ITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCI  684
                          G  NL   + T+ A G+S NTDGIH+ R  G+ + D++I TGDD +
Sbjct  763  -------------TGTCNLLLVYVTINATGDSLNTDGIHMGRSTGVNISDAIIKTGDDSL  809

Query  685  SLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPN  864
            S+GDG +++ +  VTCGPGHGISVGSLG+   E PV G+ V N   I T NG+R+KTWP+
Sbjct  810  SIGDGSQHINVEKVTCGPGHGISVGSLGKYHNEEPVVGVTVKNCTLINTMNGIRVKTWPD  869

Query  865  SHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQ  978
            S   V TD+H+  I M +V NPI+I+QEYCP ++C  +
Sbjct  870  SPASVATDLHFEDIIMNNVGNPILINQEYCPYDQCQAK  907



>gb|ABR26683.1| polygalacturonase [Fragaria chiloensis]
Length=405

 Score =   330 bits (845),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 177/388 (46%), Positives = 244/388 (63%), Gaps = 28/388 (7%)
 Frame = +1

Query  73    FILFLL---------AHFGESAIINVAA-----KANVDVGPLLMKAWKEACAATTASTIV  210
             F +FLL         A F  S   +V +     K N D+   L  AWK+ACAATT S ++
Sbjct  11    FSVFLLSSSAYASRVAQFLASGDFDVTSPKYGGKPNTDISQPLANAWKDACAATTPSRVI  70

Query  211   IPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGT  390
             +PKGTF +     +GPCKAP+ +++  IL+APP    +  K+ W+    V+  T+SG GT
Sbjct  71    VPKGTFQLKGAVFKGPCKAPITVQVDGILQAPPIEAQLANKEFWVQFLEVERLTVSGTGT  130

Query  391   LDGQGNVQVYPSKEKGFKGDKLPN------NLSLNFLTNSVIRDITTLNSKLFHVNVLGG  552
              DGQG      +  K    +K PN      N+  + + NS++RD+T+LNSK FH N+LG 
Sbjct  131   FDGQGQ-----NSWKDNDCNKNPNCGGLAINVRFDKVKNSLVRDVTSLNSKNFHFNILGC  185

Query  553   KNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTC  732
             ++LTF H TVKAPG+S NTDGIH+ R   I + D+ IGTGDDCIS+GDG   L ++ V+C
Sbjct  186   EHLTFQHVTVKAPGDSSNTDGIHMGRSTEINITDTNIGTGDDCISVGDGTRQLTVSKVSC  245

Query  733   GPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHYHKIE  909
             GPGHGIS+GSLGR   E  V G+ + +     T NGVRIKT+P S      +DIH+ KI 
Sbjct  246   GPGHGISIGSLGRYDNEDDVSGLNIRDCTLSNTLNGVRIKTFPASPKATPASDIHFEKIT  305

Query  910   MEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCED  1089
             M +V NP++IDQEYCP  +C+KQ PSKVKIS VS+K+I GT++T E + + C+ G+ C+ 
Sbjct  306   MNNVANPVLIDQEYCPWGQCNKQIPSKVKISNVSFKNIIGTTSTAEALKIVCAKGLHCDQ  365

Query  1090  VEIGEIDLTF--KGGAKTICSNVKPKLT  1167
             V + +IDL    KG   + C+NV+P +T
Sbjct  366   VVLSDIDLKLSGKGTLTSHCANVQPTIT  393



>gb|AHL24657.1| Sal k 6.01 allergen, partial [Salsola kali]
Length=381

 Score =   329 bits (843),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 179/366 (49%), Positives = 234/366 (64%), Gaps = 6/366 (2%)
 Frame = +1

Query  112   IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMA  291
             I    AK N D    L+ AWKEACAA   + IV+P G F +  V L+GPCKAP+ ++I  
Sbjct  6     ITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAPLTIEIAG  65

Query  292   ILKAPPDPKNMDGKKEWLIVGRVDHFT---LSGGGTLDGQGNVQVYPSK-EKGFKGDKLP  459
               KAP D   M G+  W+ +  V   T   L  GGT DGQG      +K  +    + LP
Sbjct  66    NFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGMCNSLP  125

Query  460   NNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIG  639
              N   N LTN+ I  I +LNSKL+H+ V+G KN+T    T+ AP +S NTDG+HI R  G
Sbjct  126   YNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHIGRSNG  185

Query  640   ITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSK  819
             +   +S IGTGDDCIS+GDG  ++ + G+TCGPGHGIS+GS+G+   E P  GIFV N  
Sbjct  186   VHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIFVKNCS  245

Query  820   FIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKI  999
             F  TDNGVRIK+W NS     +D+H+  I + +V NP++IDQEYCP N C ++ PSKVK+
Sbjct  246   FTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTPSKVKL  305

Query  1000  SKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAK-TICSNVKPKLTGKQ  1176
             SK+S+K++ G + + E V L CSS VPC+ VE+ +IDLTF GGA  + C NVKP +TGKQ
Sbjct  306   SKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQCKNVKPIVTGKQ  365

Query  1177  CPKVTC  1194
              P V C
Sbjct  366   NP-VAC  370



>ref|XP_002526193.1| hypothetical protein RCOM_0764760 [Ricinus communis]
 gb|EEF36197.1| hypothetical protein RCOM_0764760 [Ricinus communis]
Length=392

 Score =   329 bits (844),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 165/345 (48%), Positives = 221/345 (64%), Gaps = 6/345 (2%)
 Frame = +1

Query  142   DVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKN  321
             D+   L+ AWK AC+   AS I+IP   + +  V LEGPCK  + L+I   L AP DP  
Sbjct  40    DISKALLDAWKAACSTPGASRILIPHAKYALRDVLLEGPCKGSMVLQIKGTLMAPSDPSE  99

Query  322   MDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVI  498
                +  W+    VDH T+SGG  LDG+G +    +          LP NL  +F+TN++I
Sbjct  100   HHSQG-WITFQHVDHLTISGG-NLDGRGKIAWGKNTCRTNVNCKNLPMNLRFDFVTNTII  157

Query  499   RDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDD  678
              D+T+ +SK FH+N++G +N T     + APG+S NTDGIHI R  G+ + DS IGTGDD
Sbjct  158   EDLTSRDSKNFHMNLIGCQNFTLQRIKIIAPGDSANTDGIHIGRSNGVNIIDSKIGTGDD  217

Query  679   CISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTW  858
             CIS+GDG  N+KITGV CGPGHGIS+GSLG+   E PV G++V     I T NG+RIK+W
Sbjct  218   CISIGDGSRNIKITGVRCGPGHGISIGSLGKYKNEEPVSGVYVKKCDLINTTNGIRIKSW  277

Query  859   PNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSA  1038
             P  + G  TD+H+  I M +V N I+IDQ YCP N C+ +  S VKISKV++ +IKGTS+
Sbjct  278   PGLYSGTATDLHFEDISMNNVSNAILIDQMYCPWNHCNSKASSNVKISKVTFSNIKGTSS  337

Query  1039  TKETVILACSSGVPCEDVEIGEIDLTFK---GGAKTICSNVKPKL  1164
                 V L CS G+PCE VE+  I++ +K   G AK+ C+NVKPK+
Sbjct  338   IPTIVKLLCSKGLPCEGVELNNINVVYKGPEGPAKSECTNVKPKI  382



>gb|AAP37458.1| polygalacturonase [Fragaria x ananassa]
Length=405

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/355 (48%), Positives = 232/355 (65%), Gaps = 14/355 (4%)
 Frame = +1

Query  130   KANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPP  309
             K N D+   L  AWK+ACAATT S +++PKGTF +     +GPCKAP+ +++  IL+APP
Sbjct  44    KPNTDISQPLANAWKDACAATTPSRVIVPKGTFQLKGAVFKGPCKAPITVQVDGILQAPP  103

Query  310   DPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPN------NLS  471
                 +  K+ W+    V+  T+SG GT DGQG      +  K    +K PN      N+ 
Sbjct  104   IEAQLANKEFWVQFLEVERLTVSGTGTFDGQGQ-----NSWKDNDCNKNPNCGGLAINVR  158

Query  472   LNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVK  651
              + + NS++RD+T+LNSK FH N+LG ++LTF H  VKAPG+SPNTDGIH+ R   I + 
Sbjct  159   FDRVKNSLVRDVTSLNSKNFHFNILGCEHLTFQHVIVKAPGDSPNTDGIHMGRSTRINIT  218

Query  652   DSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGT  831
             D+ IGTGDDCIS+GDG   L ++ V+CGPGHGIS+GSLGR   E  V G+ + +     T
Sbjct  219   DTNIGTGDDCISVGDGTRQLTVSKVSCGPGHGISIGSLGRYDNEDDVSGLNIRDCTLSNT  278

Query  832   DNGVRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKV  1008
              NGVRIKT+P S      +DIH+ KI M  V NP++IDQEYCP  +C+KQ PSKVKIS V
Sbjct  279   LNGVRIKTFPASPKATTASDIHFEKITMNYVANPVLIDQEYCPWGQCNKQIPSKVKISNV  338

Query  1009  SYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTF--KGGAKTICSNVKPKLT  1167
             S+K+I GT++T E + + C+ G+ C+ V + +IDL    KG   + C+NV+P +T
Sbjct  339   SFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDIDLKLSGKGTLTSHCANVQPTIT  393



>ref|XP_010999531.1| PREDICTED: polygalacturonase-like [Populus euphratica]
Length=326

 Score =   326 bits (836),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/320 (53%), Positives = 215/320 (67%), Gaps = 11/320 (3%)
 Frame = +1

Query  37   LKMATISYCAFTFILFLLAHFGESAIIN-----VAAKANVDVGPLLMKAWKEACAATTAS  201
            + +  +S    +F LFLL      A  N         A  D+   L  AWK+ACA+T  S
Sbjct  1    MGLEVVSSAIISFSLFLLLASTTQAQSNGVFDVTKYGAGKDITEALANAWKDACASTKPS  60

Query  202  TIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSG  381
             ++IP+GT+ + +V++ GPCKA ++L++  IL+AP DP  + G  +W+    VD FTLSG
Sbjct  61   KVLIPRGTYWLRKVTIAGPCKAAIKLQVDGILQAPVDPNKLSGG-DWVNFRYVDQFTLSG  119

Query  382  GGTLDGQGNVQVYPS---KEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGG  552
             GT DGQG V    S   K+K  KG  LP N+  +F+TN+++RDITTL+SK FHVNVLG 
Sbjct  120  SGTFDGQGKVAWSKSTCHKDKNCKG--LPMNMRFDFITNALVRDITTLDSKNFHVNVLGC  177

Query  553  KNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTC  732
            KNLTF HFTV+AP  S NTDGIHI R  GI + DS I TGDDCIS+GDG E L ITGVTC
Sbjct  178  KNLTFQHFTVRAPRESVNTDGIHIGRSTGIYIIDSKISTGDDCISVGDGTEELHITGVTC  237

Query  733  GPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEM  912
            GPGHGISVGSLG+ P E+PV GIFV N     T NGVRIK+WP  + GV +++H+  I M
Sbjct  238  GPGHGISVGSLGKYPNEKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVM  297

Query  913  EDVKNPIVIDQEYCPNNECS  972
             +V+NP++IDQ YCP N+CS
Sbjct  298  NNVQNPVIIDQVYCPWNQCS  317



>ref|XP_009350286.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=408

 Score =   328 bits (842),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/382 (44%), Positives = 232/382 (61%), Gaps = 16/382 (4%)
 Frame = +1

Query  52    ISYCAFTFILFLLAHFGESAIINVA-----AKANVDVGPLLMKAWKEACAATTASTIVIP  216
             + Y  F F+        ++ +  V         + D+   L  AW++AC++   + +VIP
Sbjct  2     VGYWIFVFLFLASVANAKAEVFYVTNSTYGGNPSGDITLALADAWRDACSSPWPAKVVIP  61

Query  217   KGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLD  396
             +G + +    L GPCK+P+E+++   L+AP +   +  +  W+    VD  TL GGGT D
Sbjct  62    EGEYYLRGAILRGPCKSPIEIQVQGYLRAPQESSQLLQQNTWIGFQYVDRLTLFGGGTFD  121

Query  397   GQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHF  576
             GQ N   Y S +          NL  +F+TNSVI  IT+L+SK FH+NV   +N+TF + 
Sbjct  122   GQSNCHKYKSCQS-----NRVFNLRFDFVTNSVIEGITSLDSKNFHINVFACRNVTFQYV  176

Query  577   TVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISV  756
             T+ APG+S NTDGIHI R  G+++  + IGTGDDC+SLGDG +N+ +T VTCGPGHGIS+
Sbjct  177   TITAPGDSVNTDGIHIGRSFGVSIDHTTIGTGDDCVSLGDGSQNIVVTNVTCGPGHGISI  236

Query  757   GSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--DIHYHKIEMEDVKNP  930
             GSLG+ P E PV G+ V+N     T NGVRIKTWP S P   T   IH+  I M +V NP
Sbjct  237   GSLGKYPNEEPVVGVRVTNCTLTNTQNGVRIKTWPGS-PTFTTASHIHFQDITMVNVSNP  295

Query  931   IVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEID  1110
             I IDQEYCP   C K  PSKVKIS +S+ +IKG+SAT   V L CS  +PC+ V + ++D
Sbjct  296   ISIDQEYCPYTYCGKDDPSKVKISDISFTNIKGSSATPVAVKLMCSRKIPCDGVGLTDVD  355

Query  1111  LT---FKGGAKTICSNVKPKLT  1167
             LT    KG   + C+ VKP +T
Sbjct  356   LTNIGSKGPLTSQCAYVKPYIT  377



>ref|XP_010668126.1| PREDICTED: exopolygalacturonase clone GBGA483-like, partial [Beta 
vulgaris subsp. vulgaris]
Length=366

 Score =   324 bits (830),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 162/358 (45%), Positives = 223/358 (62%), Gaps = 24/358 (7%)
 Frame = +1

Query  157   LMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKK  336
              + +W  ACA+   S +++P G + +  ++L+GPC+ P  ++I+   KAP D      + 
Sbjct  4     FLDSWTAACASKKPSKVLVPAGNYILGAITLKGPCQTPTVIEILGNFKAPSDVAAFKKED  63

Query  337   EWLIVGRVDHFTL---SGGGTLDGQGNVQVYPSKEKGFKGDK----------LPNNLSLN  477
              W  V  VD   +    GGG  DGQG        + G+K ++          LP N+  N
Sbjct  64    SWFKVENVDSLIIISGKGGGVFDGQG--------QAGWKKNECTKNANCAFDLPYNIRFN  115

Query  478   FLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDS  657
             F++NS +  +T+LNSK FHV +LG K L     T+ AP +SPNTDGIHI R   I V+  
Sbjct  116   FVSNSKVSGLTSLNSKSFHVVLLGCKQLELSDMTITAPADSPNTDGIHIGRSENIIVRGW  175

Query  658   VIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDN  837
              IGTGDDC+S GDG +N+ I GVTCGPGHG+SVGSLG+ P E PV  I + N     TDN
Sbjct  176   TIGTGDDCVSFGDGAKNVLIEGVTCGPGHGLSVGSLGKYPNEEPVSNITIRNCTIKNTDN  235

Query  838   GVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYK  1017
             GVR+KTW NS+   VT +++  I +E+V+NP+++DQEYCP N C  + PSKVKIS + +K
Sbjct  236   GVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPWNHCKAKTPSKVKISDIRFK  295

Query  1018  DIKGTSATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTGKQCP  1182
             ++KG S+TKE V L CS GVPC+ VE+ +ID+ +    G A ++C  VKP LTGKQ P
Sbjct  296   NVKGKSSTKEAVKLICSEGVPCDKVELADIDIQYTGPDGPAVSMCKFVKPLLTGKQSP  353



>ref|XP_010557773.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Tarenaya 
hassleriana]
Length=406

 Score =   325 bits (832),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 168/343 (49%), Positives = 226/343 (66%), Gaps = 5/343 (1%)
 Frame = +1

Query  169   WKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLI  348
             WK+AC AT  STI + KG + +T++   GPCK PV ++++  LKAP +    +    W+ 
Sbjct  53    WKQACGATGKSTITVGKGEYLVTRIDFNGPCKGPVTVELLGNLKAPAEVTKTEAHGGWVN  112

Query  349   VGRVDHFTLSGGGT-LDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNS  522
              G +  FTL+G G+ LDGQG +    +   K  K + LP N+    LTNS IR IT+ NS
Sbjct  113   FGNLVDFTLNGHGSILDGQGALAWKKNDCAKTGKCNNLPINVRFTGLTNSRIRSITSSNS  172

Query  523   KLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGL  702
             KLFH+N+L  KN+T +   + AP  S NTDGIHI R  G+ +  + + TGDDC+S+GDG 
Sbjct  173   KLFHMNILNCKNITLEDIGIDAPPESLNTDGIHIGRSNGVNLLGAHVRTGDDCVSIGDGS  232

Query  703   ENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVV  882
             ENL I  V CGPGHGI++GSLGR P E+PV+G+ V +     T NGVRIKTWP S  G+ 
Sbjct  233   ENLVIENVRCGPGHGIAIGSLGRYPNEQPVRGVHVRHCTISNTMNGVRIKTWPASPAGIA  292

Query  883   TDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILA  1062
             +++H+  I ME+V  PI++DQEYCP N C +  PS VKIS VS+K+I+GTS+TK  V L 
Sbjct  293   SNLHFEDIVMENVGTPILVDQEYCPYNHCKRGSPSMVKISDVSFKNIRGTSSTKTAVKLV  352

Query  1063  CSSGVPCEDVEIGEIDLTFKGG---AKTICSNVKPKLTGKQCP  1182
             CS GVPC  VE+ +I+LT+ G    A + C+NVKP L+GK  P
Sbjct  353   CSKGVPCSKVELSDINLTYNGKDGPAVSECANVKPILSGKIIP  395



>ref|XP_004162885.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=402

 Score =   325 bits (832),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 180/394 (46%), Positives = 241/394 (61%), Gaps = 33/394 (8%)
 Frame = +1

Query  70    TFILFLLAHFGES-----AIINVAAKAN----VDVGPLLMKAWKEACAATTASTIVIPKG  222
             TF++ LL+   ES      I ++    N    VDV   L  AW +ACA+   S ++IPKG
Sbjct  11    TFLMILLSFTIESRSHVDVIFHLRKYGNIVSGVDVTEALKDAWNDACASVPPSAVIIPKG  70

Query  223   TFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQ  402
              F + +   +GPCK+P+E+++   L+A   P+       W+    VD   LSGG   DGQ
Sbjct  71    IFKVREGEFKGPCKSPIEMRVRGTLQALNHPQG----DSWITFVYVDRMKLSGG-VFDGQ  125

Query  403   GNVQVYPSKEKGFKGD--------KLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKN  558
             G       KE   K D         LP +L  NF+TN ++R IT+L+SK  HVN+LG  N
Sbjct  126   G-------KEGWXKNDCHKCINCANLPISLRFNFITNXIVRRITSLDSKNSHVNILGCNN  178

Query  559   LTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGP  738
             LTF    + AP +SPNTD IHI R I I++  S I  GDDCISLG+G + +K+T VTCGP
Sbjct  179   LTFQGVNIIAPEDSPNTDEIHIGRSIRISILKSRIAIGDDCISLGNGSKRVKVTDVTCGP  238

Query  739   GHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHYHKIEME  915
             GHGIS+GSLG+   E PV+G+ V N   + T NGVRIKTW  S   G+   +H+  I M 
Sbjct  239   GHGISIGSLGKYTNEEPVEGVVVKNCTIMNTTNGVRIKTWSASPVAGIAIIMHFSDITMI  298

Query  916   DVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVE  1095
             +V NPI+IDQEYCP N+C++Q PSK+KI+KVS+K+I+G SAT   V L CSS +PCE+V+
Sbjct  299   NVSNPILIDQEYCPWNQCNRQIPSKIKINKVSFKNIRGCSATSVAVKLICSSNLPCEEVK  358

Query  1096  IGEIDLTF---KGGAKTICSNVKPKLTGKQCPKV  1188
             +  IDL +   KG   + C NVKP L+G Q P +
Sbjct  359   VANIDLVYNGTKGSITSQCMNVKPILSGIQNPSI  392



>ref|XP_004144612.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
 ref|XP_004162886.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
Length=402

 Score =   324 bits (830),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/382 (43%), Positives = 237/382 (62%), Gaps = 12/382 (3%)
 Frame = +1

Query  73    FILFLL------AHFGESAIINVAAKAN--VDVGPLLMKAWKEACAATTASTIVIPKGTF  228
             FILFL       A   +  +    A+AN   D    +MKAWK+AC++T  S IVIP G +
Sbjct  12    FILFLFIGLITNAQAADFHVKRYGARANGNSDDSQAIMKAWKDACSSTKPSKIVIPGGRY  71

Query  229   PMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGGGTLDGQGN  408
              +  +  +GPC AP+ +++   L+AP + K M     W++   ++  TLSG GT DG+G+
Sbjct  72    VVDSMKFQGPCLAPIHVQVEGRLQAPTNIKKMRNDASWIVFQYINGLTLSGKGTFDGRGS  131

Query  409   VQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVK  585
             +    ++     K   LP +L    L NS+I+DIT+ +SK FHVNV   +NLT  +  + 
Sbjct  132   LAWKQNQCASSGKCGSLPISLRFYSLNNSLIKDITSTDSKFFHVNVHNCRNLTLQNINID  191

Query  586   APGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSL  765
             APG+SPNTDGIHI    G+T+ ++ I TGDDC+S+GDG + +K+  VTCGPGHGIS+GSL
Sbjct  192   APGDSPNTDGIHIGGSSGVTIHNARIKTGDDCVSIGDGSQQIKVEKVTCGPGHGISIGSL  251

Query  766   GRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQ  945
             G+   E+PV GI V +     T  GVRIK+WP S  G+ +++ +  I M +V  PI+IDQ
Sbjct  252   GKYKNEKPVSGITVRDCTITNTMFGVRIKSWPASTKGIASNMQFESIVMNNVGTPILIDQ  311

Query  946   EYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKG  1125
             +YCP   C++Q PS+V+IS V +K+I+GTS T+  V L CS G PC++V++  I+L + G
Sbjct  312   QYCPYGTCNRQIPSRVQISNVGFKNIRGTSTTQVAVKLVCSRGYPCKNVKLSNINLKYSG  371

Query  1126  GAKTI---CSNVKPKLTGKQCP  1182
                T    CSNVKP + G   P
Sbjct  372   TNGTAISECSNVKPAIAGSVVP  393



>ref|XP_010689005.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=413

 Score =   323 bits (828),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 168/401 (42%), Positives = 243/401 (61%), Gaps = 28/401 (7%)
 Frame = +1

Query  64    AFTFIL----FLLAHF------GESAII------NVAAKAN--VDVGPLLMKAWKEACAA  189
             +F FI+    FL  +        ESAII      N  AK +   D G  +++AWK+AC +
Sbjct  7     SFKFIIVGAVFLCTYLLTCIKNSESAIISNFNVVNYGAKCDGKTDDGKPILEAWKQACNS  66

Query  190   TTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHF  369
               AST+VIP G + +  V  +GPCKA V +++   L+AP        +  W++   +   
Sbjct  67    NIASTVVIPPGNYILGPVDFQGPCKAAVTVRVEGYLRAPSMLDVFKLRDGWIVFRDISGL  126

Query  370   TLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLG  549
             T+ GGGT DGQG +    +         +P N+    +TN  + +IT+L+SK+FH+N++ 
Sbjct  127   TIEGGGTFDGQGMIAWKENNCAKSGSCSMPTNIRFTGITNGEVNNITSLDSKMFHMNIIK  186

Query  550   GKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVT  729
                +TF   T+ AP +SPNTDGIHI R   I +  + I TGDDC+SLGDG +++ I  +T
Sbjct  187   CNYMTFKGITIDAPVSSPNTDGIHIGRSSMINITGATIRTGDDCVSLGDGSQHISINNIT  246

Query  730   CGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIE  909
             CGPGHGISVGSLG+ PGE+PV G+ V N   + T NG+R+KTWPNS  G+ + +H+  I 
Sbjct  247   CGPGHGISVGSLGKYPGEQPVVGVIVRNCTLVNTMNGLRVKTWPNSFNGIASGLHFQDII  306

Query  910   MEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCED  1089
             +++V NP++IDQ+YCP++ C  Q PSKVK+S V +K+IKGTSATK  + L CS  +PCE+
Sbjct  307   IDNVSNPVLIDQDYCPDDLCKLQVPSKVKVSDVLFKNIKGTSATKMAIQLKCSKIMPCEN  366

Query  1090  VEIGEIDLTFKGG----------AKTICSNVKPKLTGKQCP  1182
             V + +IDL + G           A + C NV+P + GK  P
Sbjct  367   VTLDDIDLCYLGNKGNNRNTTSTATSECFNVRPAIMGKLSP  407



>ref|XP_008462107.1| PREDICTED: exopolygalacturonase clone GBGA483 [Cucumis melo]
Length=403

 Score =   321 bits (822),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 168/398 (42%), Positives = 240/398 (60%), Gaps = 20/398 (5%)
 Frame = +1

Query  37    LKMATISYCAFTFILFLLAHFGESAIINVAA------------KANVDVGPLLMKAWKEA  180
             +  +TI   + TFILFL        I NV A              N D    +MKAWK+A
Sbjct  1     MSSSTIFSRSTTFILFLFIGL----ITNVQAVDFHVKRYGARANGNSDDSQAIMKAWKDA  56

Query  181   CAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRV  360
             C++T  S IVIP G + +  +  +GPC AP+ +++   L+AP + K M     W++   +
Sbjct  57    CSSTKPSKIVIPGGRYVVDSMKFQGPCLAPIHVQVEGRLQAPTNIKKMRNDASWIVFQYI  116

Query  361   DHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDITTLNSKLFHV  537
             +  T+SG GT DG+G++    ++     K   LP +L    L NS+I+DIT+ +SK FH+
Sbjct  117   NGLTVSGKGTFDGRGSLAWKQNQCASSGKCGSLPISLRFFSLNNSLIKDITSTDSKFFHM  176

Query  538   NVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKI  717
             NV   +N+T  +  + APG+SPNTDGIHI    GIT+ D+ I TGDDC+S+GDG + + +
Sbjct  177   NVHNCRNVTLRNINIDAPGDSPNTDGIHIGGSSGITIHDARIKTGDDCVSIGDGSQQINV  236

Query  718   TGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHY  897
               VTCGPGHGIS+GSLG+   E+PV GI V +     T  GVRIKTWP S  G+ +++ +
Sbjct  237   EKVTCGPGHGISIGSLGKYKNEKPVSGITVRDCTITNTMFGVRIKTWPASTKGIASNMQF  296

Query  898   HKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGV  1077
               I M++V  PI+IDQ+YCP   C  Q PS+V+IS V +K+I+GTS T+  V L CS G 
Sbjct  297   ENIVMDNVGTPILIDQQYCPYGTCHHQVPSRVQISDVGFKNIRGTSTTQVAVKLVCSRGY  356

Query  1078  PCEDVEIGEIDLTFKGGAKTI---CSNVKPKLTGKQCP  1182
             PC++V++  I+L + G   T    CSNVKP + G+  P
Sbjct  357   PCKNVKLSNINLKYSGTNGTAISECSNVKPAVVGRVVP  394



>ref|XP_010675916.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 164/361 (45%), Positives = 223/361 (62%), Gaps = 10/361 (3%)
 Frame = +1

Query  127   AKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAP  306
             AK   DV    + +W  ACA+   S +++P G + +  ++L+GPC+ P  ++I+   KAP
Sbjct  43    AKPGADVTQAFLDSWTAACASKKPSKVLVPAGNYLLGAITLKGPCQTPTVIEILGNFKAP  102

Query  307   PDPKNMDGKKEWLIVGRVDHFTLSGGG---TLDGQGNV---QVYPSKEKGFKGDKLPNNL  468
              D         W  V  VD   + GG      DGQG     +   SK      D LP N+
Sbjct  103   SDVAAFKKADSWFKVENVDSVIIIGGKGGGVFDGQGQAGWKKNECSKNANCAFD-LPYNI  161

Query  469   SLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITV  648
               NF++NS +  +T+LNSK FH+ ++G K L     TV AP +SPNTDGIHI R   I V
Sbjct  162   RFNFVSNSKVSGLTSLNSKSFHIVLMGCKQLELSGMTVTAPADSPNTDGIHIGRSENIIV  221

Query  649   KDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIG  828
             +   IGTGDDC+S GDG +N+ I GVTCGPGHG+SVGSLG+ P E PV  I + N     
Sbjct  222   RGWTIGTGDDCVSFGDGAKNVLIEGVTCGPGHGLSVGSLGKYPNEEPVSNITIRNCIIKN  281

Query  829   TDNGVRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKV  1008
             TDNGVR+KTW NS+   VT +++  I +E+V+NP+++DQEYCP N C  + PSKVKIS +
Sbjct  282   TDNGVRVKTWHNSYESTVTGLYFEDITLENVRNPVIVDQEYCPWNHCKARTPSKVKISDI  341

Query  1009  SYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFK---GGAKTICSNVKPKLTGKQC  1179
              +K+++G S+TKE V L CS GVPC+ VE+ +ID+ +    G A ++C  VKP LTGKQ 
Sbjct  342   RFKNVRGKSSTKEAVKLICSQGVPCDKVELADIDIQYTGPGGPAVSMCKFVKPLLTGKQS  401

Query  1180  P  1182
             P
Sbjct  402   P  402



>ref|XP_010253373.1| PREDICTED: exopolygalacturonase-like [Nelumbo nucifera]
Length=341

 Score =   315 bits (807),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 163/334 (49%), Positives = 220/334 (66%), Gaps = 8/334 (2%)
 Frame = +1

Query  205   IVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKNMDGKKEWLIVGRVDHFTLSGG  384
             ++IPKGT+ + +V   GPCK  +   I  +++APPDP  +     W++   +   T  GG
Sbjct  4     VIIPKGTYILNEVKFLGPCKGQINFWIEGVVQAPPDPIAIK-SDVWVVFETITGLTXFGG  62

Query  385   GTLDGQGNVQVYPSKEKGFKGDK---LPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGK  555
             GT D QG  + +   +     D    LP N+  NF+TN +I DIT+LNSK+F++ + GG 
Sbjct  63    GTFDSQGQ-KAWTVNDCSMHFDTCWILPTNVRFNFITNGLIHDITSLNSKMFNLFLFGGN  121

Query  556   NLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCG  735
             N+TF H TV AP NS NTDGIHI R  G+ + D+ IGTGDDC+S+GDG ++L ++ VTCG
Sbjct  122   NVTFQHITVTAPANSLNTDGIHIGRSTGVKILDATIGTGDDCVSVGDGTKDLIVSKVTCG  181

Query  736   PGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHYHKIEME  915
             PGH IS+GSLG    E P+ G+ VS+      DNGVRIKTWPNS PG  +DI +  I M 
Sbjct  182   PGHSISIGSLGNYDNEEPMAGLHVSDCTLTNIDNGVRIKTWPNSKPGSASDISFTGIVMN  241

Query  916   DVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVE  1095
             +V NPI++DQ YCP+  CS Q+PS+VK+S V++ +IKGT AT++ VIL+CS  VPCE+VE
Sbjct  242   NVSNPIILDQNYCPHAICSLQQPSRVKVSGVNFDNIKGTLATQQCVILSCSPIVPCENVE  301

Query  1096  IGEIDLTFK---GGAKTICSNVKPKLTGKQCPKV  1188
             IGEI+L +    G   + C NVKP  TG Q P V
Sbjct  302   IGEINLVYNGPLGPGNSTCLNVKPTFTGHQVPPV  335



>ref|XP_004169306.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=424

 Score =   316 bits (810),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 161/371 (43%), Positives = 233/371 (63%), Gaps = 25/371 (7%)
 Frame = +1

Query  112   IINVAAKANVDVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMA  291
             I    AK N D+   L  AWK+ACA+T +S ++IP G + + Q  L+GPCK+ ++ ++  
Sbjct  46    ITTYGAKPNTDITQALANAWKDACASTNSSILLIPIGVYQLNQSILDGPCKSTIDFRLEG  105

Query  292   ILKAPPDP-KNMDGKKEWLIVGRVDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD------  450
              L+A P+P  NM      ++   +D  T+SG G  DGQ        K+ G K D      
Sbjct  106   TLQAHPNPIGNM-----MVLFEHIDQLTVSGTGAFDGQ-------RKKGGDKNDCRLEKT  153

Query  451   --KLPNNLSLNFLTNSVIRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHI  624
               K P N+  N + NS+++DIT+L+S+ FH+N+   KN+T  + T+ +P ++PN+DGIH+
Sbjct  154   CAKFPRNVKFNSINNSIVKDITSLDSQNFHINLFDCKNVTLQNVTIISPESNPNSDGIHV  213

Query  625   ARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIF  804
             +    I + ++ I  G DC+S+GD  + + IT VTCGPG GIS+GSLGR      V G+ 
Sbjct  214   SSSEEINILNTQISNGADCVSVGDSSKQITITNVTCGPGDGISIGSLGRYANRTEVTGVT  273

Query  805   VSNSKFIGTDNGVRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQK  981
             V + K I T NGVRIK+WP+S      +D+H+  IEM +V NP+VI+QEYCP ++C K+ 
Sbjct  274   VKSCKLINTWNGVRIKSWPDSASAYTASDLHFEDIEMVNVSNPVVINQEYCPFDQCDKKI  333

Query  982   PSKVKISKVSYKDIKGTSATKETVILACSSGVPCEDVEIGEIDLTFKGGAKTI---CSNV  1152
             PSK+KIS VS+K+I+GTSAT   + L CS  +PCEDVE+ +IDLT+ G    I   C NV
Sbjct  334   PSKIKISNVSFKNIRGTSATSVAIQLICSKDLPCEDVEVADIDLTYTGTQGRITSQCRNV  393

Query  1153  KPKLTGKQCPK  1185
              P +TGKQ P+
Sbjct  394   IPIITGKQNPR  404



>ref|XP_002884670.1| exopolygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60929.1| exopolygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   317 bits (811),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 170/352 (48%), Positives = 221/352 (63%), Gaps = 7/352 (2%)
 Frame = +1

Query  142   DVGPLLMKAWKEACAATTASTIVIPKGTFPMTQVSLEGPCKAPVELKIMAILKAPPDPKN  321
             D     M AWKEACAA   STI +PKG + +  +  +GPCK PV L++   LKAP   K 
Sbjct  89    DDSAAFMAAWKEACAA--GSTITVPKGEYLVESLEFKGPCKGPVTLELNGNLKAPATVKT  146

Query  322   MDGKKEWLIVGRVDHFTLSGG-GTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSV  495
                   W+    +  FTL+G     DGQG++    +   K  K + LP N+    LTNS 
Sbjct  147   TKPHAGWIDFENLADFTLNGNKAIFDGQGSLAWKANDCAKTGKCNSLPINIRFTGLTNSK  206

Query  496   IRDITTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGD  675
             I+ IT+ NSKLFH+N+L  KN+T +   + AP  S NTDGIHI R  G+ +  + I TGD
Sbjct  207   IKSITSTNSKLFHMNILNCKNITLEDIGIDAPPESLNTDGIHIGRSNGVNLIGAKIKTGD  266

Query  676   DCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKT  855
             DC+S+GDG ENL +  V CGPGHGIS+GSLGR P E+PVKG+ V       TDNGVRIKT
Sbjct  267   DCVSIGDGTENLIVENVECGPGHGISIGSLGRYPNEQPVKGVTVRKCLIKNTDNGVRIKT  326

Query  856   WPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNECSKQKPSKVKISKVSYKDIKGTS  1035
             WP S PG+ ++I +  I M++V  P++IDQEYCP   C    PSKVK+S V+ K+IKGTS
Sbjct  327   WPGSPPGIASNILFEDITMDNVSTPVLIDQEYCPYGHCKAGVPSKVKLSDVTIKNIKGTS  386

Query  1036  ATKETVILACSSGVPCEDVEIGEIDLTF---KGGAKTICSNVKPKLTGKQCP  1182
             ATK  V L CS GVPC ++ + +I+L     +G A + CSN+KP L+GK  P
Sbjct  387   ATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKPILSGKLVP  438



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3772102660690