BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24970_g2_i1 len=1390 path=[7501:0-57 2898:58-81 2922:82-176
3017:177-201 7829:202-307 3148:308-343 8986:344-345 3184:346-363
2810:364-375 1883:376-410 3247:411-501 3338:502-504 3341:505-603
2591:604-669 1420:670-711 1462:712-783 1534:784-840 9125:841-875
2039:876-882 2046:883-924 2088:925-953 9183:954-960 6508:961-995
8097:996-1041 6589:1042-1084 8343:1085-1085 2400:1086-1127
2442:1128-1196 6743:1197-1268 6815:1269-1301 8633:1302-1315
6851:1316-1389]

Length=1390
                                                                      Score     E

ref|XP_009804151.1|  PREDICTED: polygalacturonase-like                  454   2e-153   
ref|XP_009764608.1|  PREDICTED: polygalacturonase-like                  453   5e-153   
ref|XP_009612480.1|  PREDICTED: polygalacturonase-like                  452   9e-153   
ref|XP_009601010.1|  PREDICTED: polygalacturonase-like                  447   1e-150   
ref|XP_009599317.1|  PREDICTED: polygalacturonase                       446   4e-150   
dbj|BAO02513.1|  predicted polygalacturonase ortholog                   444   2e-149   
pir||S46530  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...    443   3e-149
pir||S46529  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...    441   2e-148
sp|Q05967.1|PGLR_TOBAC  RecName: Full=Polygalacturonase; Short=PG...    441   3e-148   Nicotiana tabacum [American tobacco]
ref|XP_004253347.1|  PREDICTED: polygalacturonase-like                  440   6e-148   
emb|CAA50335.1|  polygalacturonase                                      438   2e-147   Nicotiana tabacum [American tobacco]
ref|XP_009780910.1|  PREDICTED: polygalacturonase                       435   4e-146   
emb|CDP18013.1|  unnamed protein product                                434   2e-145   
emb|CDP04348.1|  unnamed protein product                                430   4e-144   
emb|CDP04343.1|  unnamed protein product                                423   3e-141   
dbj|BAA89477.1|  polygalacturonase                                      419   1e-139   Salix gilgiana
dbj|BAA89476.1|  polygalacturonase                                      417   7e-139   Salix gilgiana
dbj|BAA89478.1|  polygalacturonase                                      415   3e-138   Salix gilgiana
ref|XP_006366630.1|  PREDICTED: polygalacturonase-like                  414   5e-138   
ref|XP_010999488.1|  PREDICTED: exopolygalacturonase-like               412   3e-137   
ref|XP_006387858.1|  hypothetical protein POPTR_0519s00220g             412   3e-137   
ref|XP_004243884.1|  PREDICTED: polygalacturonase-like                  411   7e-137   
ref|XP_007009871.1|  Pectin lyase-like superfamily protein, putative    409   7e-136   
ref|XP_010999485.1|  PREDICTED: exopolygalacturonase-like               409   9e-136   
ref|XP_002325639.2|  hypothetical protein POPTR_0019s09470g             409   3e-135   Populus trichocarpa [western balsam poplar]
ref|XP_010999486.1|  PREDICTED: exopolygalacturonase-like               407   3e-135   
ref|XP_006371366.1|  hypothetical protein POPTR_0019s09500g             407   4e-135   
ref|XP_006371367.1|  hypothetical protein POPTR_0019s09510g             404   3e-134   
ref|XP_010999532.1|  PREDICTED: exopolygalacturonase-like               404   4e-134   
dbj|BAA89479.1|  polygalacturonase                                      404   4e-134   Salix gilgiana
ref|XP_010040513.1|  PREDICTED: exopolygalacturonase-like               404   7e-134   
ref|XP_010042444.1|  PREDICTED: exopolygalacturonase-like               402   2e-133   
ref|XP_006469749.1|  PREDICTED: polygalacturonase-like                  402   4e-133   
ref|XP_010999487.1|  PREDICTED: exopolygalacturonase-like               402   4e-133   
ref|XP_010042729.1|  PREDICTED: exopolygalacturonase-like               402   6e-133   
ref|XP_010038565.1|  PREDICTED: exopolygalacturonase-like               401   6e-133   
ref|XP_006447720.1|  hypothetical protein CICLE_v10015423mg             399   6e-132   
ref|XP_010040848.1|  PREDICTED: exopolygalacturonase-like               399   7e-132   
ref|XP_010042694.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    399   8e-132   
gb|KHN24677.1|  Polygalacturonase                                       397   4e-131   
ref|XP_010038564.1|  PREDICTED: exopolygalacturonase-like               398   2e-130   
ref|XP_003552049.1|  PREDICTED: polygalacturonase                       395   2e-130   
ref|XP_010093135.1|  hypothetical protein L484_009327                   393   1e-129   
ref|XP_007009872.1|  Pectin lyase-like superfamily protein, putative    392   2e-129   
ref|XP_003522976.1|  PREDICTED: polygalacturonase-like                  392   2e-129   
ref|XP_003522977.1|  PREDICTED: polygalacturonase-like                  392   3e-129   
ref|XP_011069588.1|  PREDICTED: polygalacturonase-like                  391   8e-129   
ref|XP_002274096.1|  PREDICTED: exopolygalacturonase                    389   3e-128   Vitis vinifera
ref|XP_010536243.1|  PREDICTED: exopolygalacturonase-like               390   3e-128   
ref|XP_003522975.1|  PREDICTED: polygalacturonase-like                  389   6e-128   
ref|XP_008379966.1|  PREDICTED: exopolygalacturonase-like               387   2e-127   
ref|XP_010067918.1|  PREDICTED: exopolygalacturonase-like               387   3e-127   
ref|XP_010067907.1|  PREDICTED: exopolygalacturonase-like               387   3e-127   
ref|XP_010112807.1|  hypothetical protein L484_020039                   386   5e-127   
ref|XP_010536244.1|  PREDICTED: exopolygalacturonase-like               387   5e-127   
ref|XP_007049259.1|  Polygalacturonase                                  386   9e-127   
ref|XP_008379967.1|  PREDICTED: exopolygalacturonase-like               385   1e-126   
gb|KHN15656.1|  Polygalacturonase                                       384   2e-126   
gb|KCW88710.1|  hypothetical protein EUGRSUZ_A01065                     387   2e-126   
ref|XP_002282594.1|  PREDICTED: exopolygalacturonase                    385   2e-126   Vitis vinifera
ref|XP_009365184.1|  PREDICTED: exopolygalacturonase-like               385   2e-126   
ref|XP_011097041.1|  PREDICTED: polygalacturonase-like                  384   3e-126   
ref|XP_010112808.1|  hypothetical protein L484_020040                   384   6e-126   
ref|XP_008342227.1|  PREDICTED: exopolygalacturonase clone GBGA48...    383   1e-125   
ref|XP_007049261.1|  Pectin lyase-like superfamily protein, putative    387   1e-125   
ref|XP_011097079.1|  PREDICTED: polygalacturonase-like                  383   1e-125   
ref|XP_009365185.1|  PREDICTED: exopolygalacturonase-like               383   1e-125   
ref|XP_002282573.1|  PREDICTED: exopolygalacturonase                    382   2e-125   Vitis vinifera
ref|XP_010532220.1|  PREDICTED: exopolygalacturonase-like               384   2e-125   
ref|XP_010112811.1|  hypothetical protein L484_020043                   382   2e-125   
gb|KHN10402.1|  Polygalacturonase                                       380   2e-125   
emb|CBI22050.3|  unnamed protein product                                380   2e-124   
ref|XP_004488391.1|  PREDICTED: polygalacturonase-like                  379   3e-124   
ref|XP_002274125.1|  PREDICTED: exopolygalacturonase                    379   3e-124   Vitis vinifera
emb|CDP04350.1|  unnamed protein product                                379   5e-124   
gb|KCW46858.1|  hypothetical protein EUGRSUZ_K00662                     378   6e-124   
ref|XP_003544118.1|  PREDICTED: polygalacturonase-like isoform X1       378   9e-124   
gb|KHN46909.1|  Polygalacturonase                                       377   1e-123   
emb|CBI28390.3|  unnamed protein product                                379   1e-123   
ref|XP_009365186.1|  PREDICTED: exopolygalacturonase-like               377   1e-123   
ref|XP_008455553.1|  PREDICTED: exopolygalacturonase-like               377   2e-123   
ref|XP_008229848.1|  PREDICTED: exopolygalacturonase-like               377   3e-123   
ref|XP_003527123.1|  PREDICTED: polygalacturonase-like                  377   3e-123   
ref|XP_008441641.1|  PREDICTED: exopolygalacturonase-like               377   4e-123   
gb|AFK41055.1|  unknown                                                 376   7e-123   
gb|ADP09681.1|  polygalacturonase                                       376   7e-123   
ref|XP_011097055.1|  PREDICTED: polygalacturonase-like                  375   1e-122   
ref|XP_008467043.1|  PREDICTED: exopolygalacturonase-like               374   2e-122   
ref|XP_004308599.1|  PREDICTED: exopolygalacturonase-like               374   2e-122   
ref|XP_003595659.1|  Polygalactorunase PG11                             375   2e-122   
ref|XP_008245681.1|  PREDICTED: exopolygalacturonase clone GBGA48...    374   2e-122   
ref|XP_007152047.1|  hypothetical protein PHAVU_004G097300g             374   3e-122   
gb|AES65915.2|  polygalacturonase 11c, putative                         374   5e-122   
ref|XP_010038561.1|  PREDICTED: exopolygalacturonase-like               377   6e-122   
sp|Q40312.1|PGLR_MEDSA  RecName: Full=Polygalacturonase; Short=PG...    373   2e-121   Medicago sativa [alfalfa]
gb|ADC53480.1|  polygalacturonase                                       372   2e-121   Gossypium hirsutum [American cotton]
ref|XP_006595658.1|  PREDICTED: polygalacturonase-like isoform X2       370   6e-121   
ref|XP_010038563.1|  PREDICTED: exopolygalacturonase-like               370   9e-121   
ref|XP_011097018.1|  PREDICTED: polygalacturonase-like                  369   2e-120   
ref|XP_009365183.1|  PREDICTED: exopolygalacturonase-like               369   2e-120   
ref|XP_004173029.1|  PREDICTED: polygalacturonase-like                  370   2e-120   
ref|XP_008460220.1|  PREDICTED: exopolygalacturonase-like               368   5e-120   
ref|XP_004170151.1|  PREDICTED: polygalacturonase-like                  368   7e-120   
gb|KGN43464.1|  hypothetical protein Csa_7G037910                       368   7e-120   
gb|KCW46859.1|  hypothetical protein EUGRSUZ_K00664                     368   8e-120   
ref|XP_002310765.1|  hypothetical protein POPTR_0007s11860g             367   1e-119   Populus trichocarpa [western balsam poplar]
ref|XP_011039263.1|  PREDICTED: exopolygalacturonase-like               367   1e-119   
gb|KFK38253.1|  hypothetical protein AALP_AA3G089200                    367   1e-119   
ref|XP_010112809.1|  hypothetical protein L484_020041                   367   1e-119   
ref|XP_004162875.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    367   2e-119   
emb|CBI22052.3|  unnamed protein product                                386   2e-119   
ref|XP_008459709.1|  PREDICTED: exopolygalacturonase-like               368   2e-119   
ref|XP_009334235.1|  PREDICTED: exopolygalacturonase-like               367   3e-119   
ref|XP_004153076.1|  PREDICTED: polygalacturonase-like                  367   3e-119   
ref|XP_011099769.1|  PREDICTED: polygalacturonase-like                  367   3e-119   
ref|XP_004295347.1|  PREDICTED: polygalacturonase-like                  367   4e-119   
ref|XP_008381794.1|  PREDICTED: exopolygalacturonase-like               366   4e-119   
ref|XP_009134996.1|  PREDICTED: polygalacturonase-like                  365   9e-119   
ref|XP_011097019.1|  PREDICTED: polygalacturonase-like                  365   1e-118   
ref|XP_006407791.1|  hypothetical protein EUTSA_v10020866mg             365   1e-118   
ref|XP_004140444.1|  PREDICTED: exopolygalacturonase-like               365   1e-118   
gb|AAO62938.1|  polygalactorunase PG11 precursor                        365   2e-118   Medicago sativa [alfalfa]
ref|XP_004165943.1|  PREDICTED: polygalacturonase-like                  365   2e-118   
ref|XP_008449697.1|  PREDICTED: exopolygalacturonase-like               364   3e-118   
gb|ABN13878.1|  polygalacturonase                                       363   4e-118   
ref|XP_008349086.1|  PREDICTED: exopolygalacturonase-like               363   5e-118   
ref|XP_004167279.1|  PREDICTED: exopolygalacturonase-like               363   7e-118   
gb|ADK92878.1|  polygalacturonase                                       363   7e-118   
ref|XP_010657416.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    362   1e-117   
ref|XP_008391258.1|  PREDICTED: exopolygalacturonase-like               362   1e-117   
ref|NP_187441.1|  polygalacturonase-like protein                        362   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008449696.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    362   2e-117   
ref|XP_004490643.1|  PREDICTED: polygalacturonase-like                  362   2e-117   
ref|XP_007142511.1|  hypothetical protein PHAVU_008G286900g             361   3e-117   
ref|XP_003595656.1|  Polygalactorunase PG11                             361   4e-117   
gb|ABL63521.1|  pollen-specific protein MF9l                            361   5e-117   Brassica oleracea var. alboglabra
ref|XP_002865611.1|  hypothetical protein ARALYDRAFT_494865             360   6e-117   
sp|Q6H9K0.1|PGLR2_PLAAC  RecName: Full=Exopolygalacturonase; AltN...    360   8e-117   Platanus x hispanica [London plane tree]
gb|EYU42735.1|  hypothetical protein MIMGU_mgv1a007533mg                360   1e-116   
emb|CDY07974.1|  BnaC03g35490D                                          360   1e-116   
gb|ABG38468.1|  pollen-expressed protein MF9c                           359   2e-116   Brassica oleracea
gb|EYU42734.1|  hypothetical protein MIMGU_mgv1a007528mg                359   3e-116   
ref|XP_003633345.1|  PREDICTED: exopolygalacturonase                    358   3e-116   
ref|NP_199625.1|  putative polygalacturonase / pectinase                358   4e-116   Arabidopsis thaliana [mouse-ear cress]
gb|EYU42739.1|  hypothetical protein MIMGU_mgv1a007536mg                358   5e-116   
gb|EYU42736.1|  hypothetical protein MIMGU_mgv1a007545mg                358   6e-116   
ref|XP_008229862.1|  PREDICTED: polygalacturonase-like                  368   8e-116   
ref|XP_006395214.1|  hypothetical protein EUTSA_v10004361mg             357   1e-115   
ref|XP_010547226.1|  PREDICTED: polygalacturonase-like                  357   1e-115   
ref|XP_010439352.1|  PREDICTED: polygalacturonase-like                  357   2e-115   
sp|P24548.1|PGLR_OENOR  RecName: Full=Exopolygalacturonase; Short...    355   2e-115   Oenothera organensis
ref|XP_010548798.1|  PREDICTED: polygalacturonase-like                  357   2e-115   
gb|KFK31316.1|  hypothetical protein AALP_AA6G096900                    357   2e-115   
gb|AFK35534.1|  unknown                                                 357   3e-115   
ref|XP_010548800.1|  PREDICTED: polygalacturonase-like                  356   3e-115   
ref|XP_010248093.1|  PREDICTED: exopolygalacturonase-like               355   5e-115   
ref|XP_004292143.1|  PREDICTED: polygalacturonase-like                  359   5e-115   
sp|Q39786.1|PGLR_GOSHI  RecName: Full=Polygalacturonase; Short=PG...    356   6e-115   Gossypium hirsutum [American cotton]
ref|NP_187440.1|  polygalacturonase-like protein                        355   7e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008229852.1|  PREDICTED: exopolygalacturonase-like               355   9e-115   
ref|XP_002884669.1|  hypothetical protein ARALYDRAFT_478121             355   1e-114   
ref|XP_010482057.1|  PREDICTED: polygalacturonase-like                  355   1e-114   
ref|XP_009334234.1|  PREDICTED: exopolygalacturonase-like               355   2e-114   
ref|XP_008465833.1|  PREDICTED: exopolygalacturonase-like               353   2e-114   
ref|XP_008245680.1|  PREDICTED: exopolygalacturonase-like               354   3e-114   
emb|CDP04342.1|  unnamed protein product                                350   3e-114   
gb|EYU42733.1|  hypothetical protein MIMGU_mgv1a007538mg                354   3e-114   
ref|XP_003544285.1|  PREDICTED: polygalacturonase-like                  353   3e-114   
emb|CAA05892.1|  polygalacturonase                                      353   4e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008229849.1|  PREDICTED: exopolygalacturonase-like               353   5e-114   
ref|NP_187439.1|  polygalacturonase-like protein                        352   7e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008222765.1|  PREDICTED: exopolygalacturonase-like               353   8e-114   
ref|XP_002884668.1|  polygalacturonase 3                                352   8e-114   
ref|XP_006299274.1|  hypothetical protein CARUB_v10015428mg             352   9e-114   
gb|ABY21306.1|  pollen allergen Pla o 2                                 351   2e-113   Platanus orientalis
ref|XP_004161033.1|  PREDICTED: exopolygalacturonase-like               352   2e-113   
ref|XP_004491599.1|  PREDICTED: polygalacturonase-like                  351   2e-113   
sp|Q39766.1|PGLR_GOSBA  RecName: Full=Polygalacturonase; Short=PG...    352   2e-113   Gossypium barbadense [Egyptian cotton]
ref|XP_011003515.1|  PREDICTED: exopolygalacturonase clone GBGA48...    351   3e-113   
gb|KHN40047.1|  Polygalacturonase                                       350   4e-113   
ref|XP_008231346.1|  PREDICTED: exopolygalacturonase-like               351   4e-113   
ref|XP_010442229.1|  PREDICTED: polygalacturonase-like                  350   6e-113   
gb|KFK38252.1|  hypothetical protein AALP_AA3G089100                    350   7e-113   
ref|XP_006407793.1|  hypothetical protein EUTSA_v10020872mg             350   9e-113   
emb|CAN65676.1|  hypothetical protein VITISV_002011                     356   1e-112   Vitis vinifera
ref|XP_010667847.1|  PREDICTED: exopolygalacturonase-like               349   2e-112   
ref|XP_010418169.1|  PREDICTED: polygalacturonase-like                  349   2e-112   
ref|XP_010458152.1|  PREDICTED: polygalacturonase-like                  348   6e-112   
ref|XP_006279754.1|  hypothetical protein CARUB_v10027711mg             347   7e-112   
ref|XP_010464425.1|  PREDICTED: polygalacturonase-like                  347   8e-112   
ref|XP_010486355.1|  PREDICTED: polygalacturonase-like                  347   1e-111   
ref|XP_006407792.1|  hypothetical protein EUTSA_v10020872mg             346   2e-111   
ref|XP_008245812.1|  PREDICTED: exopolygalacturonase-like               347   2e-111   
ref|XP_004305963.1|  PREDICTED: exopolygalacturonase-like               346   2e-111   
ref|XP_010038560.1|  PREDICTED: exopolygalacturonase                    346   3e-111   
ref|XP_004154764.1|  PREDICTED: polygalacturonase-like                  346   3e-111   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    373   7e-111   
ref|XP_006299382.1|  hypothetical protein CARUB_v10015541mg             345   8e-111   
emb|CAA72003.1|  polygalacturonase                                      344   1e-110   Medicago sativa [alfalfa]
gb|AAO24261.1|  putative pollen polygalacturonase                       343   2e-110   Turnera subulata [white alder]
ref|XP_009350286.1|  PREDICTED: exopolygalacturonase-like               344   3e-110   
ref|XP_008366919.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    345   4e-110   
ref|XP_004514023.1|  PREDICTED: polygalacturonase-like                  342   5e-110   
ref|XP_010675930.1|  PREDICTED: exopolygalacturonase-like               343   8e-110   
ref|XP_006299755.1|  hypothetical protein CARUB_v10015950mg             343   1e-109   
ref|XP_006489998.1|  PREDICTED: exopolygalacturonase-like               342   2e-109   
ref|XP_006371365.1|  hypothetical protein POPTR_0019s09490g             338   2e-109   
ref|XP_004144612.1|  PREDICTED: exopolygalacturonase clone GBGA48...    341   3e-109   
ref|XP_009124109.1|  PREDICTED: polygalacturonase-like                  341   3e-109   
gb|KHN43962.1|  Polygalacturonase                                       340   4e-109   
ref|XP_004293444.1|  PREDICTED: polygalacturonase-like                  341   4e-109   
ref|XP_010999531.1|  PREDICTED: polygalacturonase-like                  338   4e-109   
ref|XP_010464426.1|  PREDICTED: polygalacturonase-like                  340   4e-109   
ref|XP_003518573.1|  PREDICTED: polygalacturonase-like                  340   5e-109   
emb|CDX86325.1|  BnaA06g30420D                                          340   5e-109   
ref|XP_002526193.1|  hypothetical protein RCOM_0764760                  340   8e-109   Ricinus communis
ref|XP_008462107.1|  PREDICTED: exopolygalacturonase clone GBGA483      340   1e-108   
gb|ACP74159.1|  putative polygalacturonase                              339   1e-108   
gb|ABE77145.1|  putative polygalacturonase                              340   1e-108   Fragaria x ananassa
gb|ABR26683.1|  polygalacturonase                                       339   2e-108   Fragaria chiloensis
ref|XP_004144529.1|  PREDICTED: polygalacturonase-like                  339   2e-108   
emb|CDY54512.1|  BnaC07g49180D                                          338   2e-108   
ref|XP_010675884.1|  PREDICTED: exopolygalacturonase-like               338   2e-108   
ref|XP_009151612.1|  PREDICTED: polygalacturonase                       338   3e-108   
emb|CDY05701.1|  BnaC02g38360D                                          338   3e-108   
ref|XP_004295350.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    338   5e-108   
ref|XP_008455507.1|  PREDICTED: exopolygalacturonase-like               337   7e-108   
ref|XP_004163433.1|  PREDICTED: polygalacturonase-like                  338   8e-108   
gb|AAP37458.1|  polygalacturonase                                       337   1e-107   Fragaria x ananassa
ref|XP_006492955.1|  PREDICTED: exopolygalacturonase-like               337   1e-107   
gb|AHL24657.1|  Sal k 6.01 allergen                                     336   2e-107   
emb|CDY22137.1|  BnaC01g39640D                                          336   2e-107   
ref|XP_009134997.1|  PREDICTED: polygalacturonase                       335   6e-107   
ref|XP_006495222.1|  PREDICTED: exopolygalacturonase-like               335   6e-107   
ref|XP_009129707.1|  PREDICTED: polygalacturonase-like                  335   7e-107   
emb|CDY22140.1|  BnaC01g39610D                                          334   9e-107   
gb|AAP42648.1|  polygalacturonase                                       334   9e-107   Brassica napus [oilseed rape]
gb|AAM74219.1|AF518563_1  putative pollen polygalacturonase             334   1e-106   Brassica oleracea
ref|XP_004162885.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    333   5e-106   
ref|XP_009124086.1|  PREDICTED: polygalacturonase                       332   8e-106   
ref|XP_010557773.1|  PREDICTED: exopolygalacturonase clone GBGA48...    332   1e-105   
ref|XP_010675940.1|  PREDICTED: exopolygalacturonase-like               332   2e-105   
ref|XP_006407789.1|  hypothetical protein EUTSA_v10020501mg             335   3e-105   
emb|CAN65674.1|  hypothetical protein VITISV_002009                     350   7e-105   Vitis vinifera
ref|XP_010099972.1|  hypothetical protein L484_014009                   329   1e-104   
sp|P35337.1|PGLR_BRANA  RecName: Full=Polygalacturonase; Short=PG...    328   2e-104   Brassica napus [oilseed rape]
ref|XP_010668126.1|  PREDICTED: exopolygalacturonase clone GBGA48...    325   1e-103   
ref|XP_002884670.1|  exopolygalacturonase                               327   2e-103   
ref|XP_004296118.1|  PREDICTED: polygalacturonase-like                  327   4e-103   
ref|XP_010689005.1|  PREDICTED: exopolygalacturonase-like               324   1e-102   
ref|XP_004289173.1|  PREDICTED: polygalacturonase-like                  323   2e-102   
ref|XP_006375551.1|  hypothetical protein POPTR_0014s16040g             323   2e-102   
ref|XP_002526191.1|  Polygalacturonase precursor, putative              321   1e-101   Ricinus communis
ref|XP_010675951.1|  PREDICTED: exopolygalacturonase-like isoform X1    321   3e-101   
ref|XP_010675916.1|  PREDICTED: exopolygalacturonase-like               320   6e-101   
ref|XP_011073814.1|  PREDICTED: exopolygalacturonase clone GBGA48...    318   1e-100   
ref|XP_004169306.1|  PREDICTED: polygalacturonase-like                  319   2e-100   
ref|XP_010486356.1|  PREDICTED: exopolygalacturonase clone GBGA48...    318   5e-100   
ref|XP_010458380.1|  PREDICTED: exopolygalacturonase clone GBGA48...    317   1e-99    
ref|XP_008229865.1|  PREDICTED: polygalacturonase                       314   1e-99    
ref|XP_010464428.1|  PREDICTED: exopolygalacturonase clone GBGA48...    317   1e-99    
gb|KCW46857.1|  hypothetical protein EUGRSUZ_K00661                     315   2e-99    
ref|XP_008367231.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    313   4e-99    
ref|XP_010458261.1|  PREDICTED: exopolygalacturonase clone GBGA48...    316   4e-99    
ref|XP_002862616.1|  polygalacturonase                                  316   5e-99    
ref|XP_004144611.1|  PREDICTED: polygalacturonase-like                  318   6e-99    
ref|XP_002885005.1|  polygalacturonase                                  316   7e-99    
ref|XP_004292620.1|  PREDICTED: polygalacturonase-like                  320   1e-98    
ref|XP_010064300.1|  PREDICTED: exopolygalacturonase-like               313   1e-98    
ref|XP_010675960.1|  PREDICTED: exopolygalacturonase clone GBGA48...    311   2e-98    
ref|XP_006299516.1|  hypothetical protein CARUB_v10015686mg             314   2e-98    
ref|XP_010253373.1|  PREDICTED: exopolygalacturonase-like               310   4e-98    
ref|XP_008462134.1|  PREDICTED: exopolygalacturonase-like               316   4e-98    
ref|XP_009147020.1|  PREDICTED: exopolygalacturonase clone GBGA48...    314   1e-97    
ref|XP_007143499.1|  hypothetical protein PHAVU_007G076800g             308   1e-97    
ref|XP_010064302.1|  PREDICTED: exopolygalacturonase-like               310   5e-97    
ref|XP_002437276.1|  hypothetical protein SORBIDRAFT_10g024020          308   2e-96    Sorghum bicolor [broomcorn]
emb|CDP04349.1|  unnamed protein product                                301   4e-96    
ref|NP_187442.1|  polygalacturonase-like protein                        308   6e-96    Arabidopsis thaliana [mouse-ear cress]
emb|CAA51692.1|  exopolygalacturonase                                   308   6e-96    
emb|CAA51033.1|  exopolygalacturonase                                   308   9e-96    
gb|KCW66880.1|  hypothetical protein EUGRSUZ_F00634                     305   1e-95    
ref|NP_188020.1|  exopolygalacturonase / galacturan 1,4-alpha-gal...    307   2e-95    
emb|CAA11160.1|  polygalacturonase                                      307   2e-95    
gb|AAL32525.1|  polygalacturonase; pectinase                            307   2e-95    
ref|NP_001152243.1|  polygalacturonase precursor                        303   1e-94    
ref|XP_010913888.1|  PREDICTED: exopolygalacturonase-like               303   1e-94    
gb|KFK38239.1|  hypothetical protein AALP_AA3G087400                    306   2e-94    
ref|XP_009147021.1|  PREDICTED: exopolygalacturonase clone GBGA48...    306   2e-94    
ref|XP_007020651.1|  Pectin lyase-like superfamily protein, putative    303   4e-94    
dbj|BAK05779.1|  predicted protein                                      302   4e-94    
ref|XP_004153799.1|  PREDICTED: polygalacturonase-like                  299   5e-94    
ref|XP_004142607.1|  PREDICTED: polygalacturonase-like                  300   5e-94    
emb|CDX74027.1|  BnaA03g30200D                                          302   5e-94    
emb|CDX80531.1|  BnaC07g29130D                                          302   5e-94    
ref|XP_009134998.1|  PREDICTED: exopolygalacturonase clone GBGA48...    302   7e-94    
emb|CDY07972.1|  BnaC03g35510D                                          302   8e-94    
ref|XP_006421347.1|  hypothetical protein CICLE_v10006970mg             300   1e-93    
ref|XP_008227080.1|  PREDICTED: exopolygalacturonase-like               301   1e-93    
gb|EMT33862.1|  putative Exopolygalacturonase                           300   2e-93    
ref|XP_007199143.1|  hypothetical protein PRUPE_ppa019563mg             299   3e-93    
ref|XP_007043095.1|  Pectin lyase-like superfamily protein isoform 1    300   3e-93    
ref|XP_010324136.1|  PREDICTED: exopolygalacturonase-like               299   3e-93    
ref|XP_010530386.1|  PREDICTED: exopolygalacturonase                    300   3e-93    
ref|XP_010690734.1|  PREDICTED: exopolygalacturonase                    298   8e-93    
ref|XP_006656242.1|  PREDICTED: exopolygalacturonase-like               298   9e-93    
ref|XP_004967187.1|  PREDICTED: polygalacturonase-like                  298   1e-92    
ref|XP_009589812.1|  PREDICTED: exopolygalacturonase-like               298   1e-92    
ref|XP_010266273.1|  PREDICTED: exopolygalacturonase-like               299   2e-92    
ref|XP_002312795.2|  hypothetical protein POPTR_0009s17010g             298   2e-92    
ref|XP_009767891.1|  PREDICTED: exopolygalacturonase-like               297   2e-92    
emb|CBI28399.3|  unnamed protein product                                295   4e-92    
ref|XP_010469513.1|  PREDICTED: exopolygalacturonase-like               296   5e-92    
ref|XP_004174175.1|  PREDICTED: exopolygalacturonase-like               291   9e-92    
ref|XP_008451196.1|  PREDICTED: exopolygalacturonase isoform X3         295   1e-91    
ref|XP_009596400.1|  PREDICTED: exopolygalacturonase-like               296   1e-91    
ref|XP_008451195.1|  PREDICTED: exopolygalacturonase isoform X2         295   1e-91    
ref|XP_003560585.2|  PREDICTED: exopolygalacturonase-like               295   2e-91    
ref|XP_008235914.1|  PREDICTED: exopolygalacturonase                    300   2e-91    
ref|XP_008451194.1|  PREDICTED: exopolygalacturonase isoform X1         295   2e-91    
ref|XP_007143501.1|  hypothetical protein PHAVU_007G0769002g            289   3e-91    
ref|XP_010913952.1|  PREDICTED: exopolygalacturonase-like               295   3e-91    
gb|KGN43365.1|  hypothetical protein Csa_7G027810                       296   3e-91    
ref|XP_004289111.1|  PREDICTED: exopolygalacturonase-like               295   4e-91    
ref|XP_009776874.1|  PREDICTED: exopolygalacturonase-like               294   4e-91    
ref|XP_008798766.1|  PREDICTED: exopolygalacturonase-like               295   4e-91    
ref|XP_003617998.1|  Polygalacturonase                                  292   4e-91    
ref|XP_006442242.1|  hypothetical protein CICLE_v10023493mg             294   5e-91    
ref|XP_006477959.1|  PREDICTED: exopolygalacturonase-like               295   9e-91    
ref|XP_011000860.1|  PREDICTED: exopolygalacturonase-like               294   9e-91    
ref|XP_004144607.1|  PREDICTED: polygalacturonase-like                  295   1e-90    
gb|AAQ63000.1|  oil palm polygalacturonase allergen PEST643             293   2e-90    
gb|EYU29596.1|  hypothetical protein MIMGU_mgv1a020057mg                291   3e-90    
ref|XP_010413907.1|  PREDICTED: exopolygalacturonase-like               291   4e-90    
emb|CDP06168.1|  unnamed protein product                                291   4e-90    
ref|XP_009333810.1|  PREDICTED: exopolygalacturonase-like               292   4e-90    
ref|XP_010259724.1|  PREDICTED: exopolygalacturonase-like               293   6e-90    
ref|XP_010472056.1|  PREDICTED: exopolygalacturonase-like               291   7e-90    
ref|XP_010540121.1|  PREDICTED: exopolygalacturonase                    291   9e-90    
ref|XP_008805455.1|  PREDICTED: exopolygalacturonase-like               291   9e-90    
ref|XP_006492953.1|  PREDICTED: exopolygalacturonase clone GBGA48...    289   1e-89    
ref|XP_009341510.1|  PREDICTED: exopolygalacturonase-like               291   1e-89    
ref|XP_008357338.1|  PREDICTED: exopolygalacturonase-like               291   1e-89    
gb|AFW76314.1|  hypothetical protein ZEAMMB73_313945                    291   1e-89    
ref|XP_010536242.1|  PREDICTED: polygalacturonase-like                  286   1e-89    
ref|XP_010251320.1|  PREDICTED: exopolygalacturonase-like               290   2e-89    
ref|XP_008377875.1|  PREDICTED: exopolygalacturonase-like               290   2e-89    
emb|CDY22139.1|  BnaC01g39620D                                          288   2e-89    
ref|XP_004171844.1|  PREDICTED: polygalacturonase-like                  285   2e-89    
ref|XP_009106547.1|  PREDICTED: exopolygalacturonase                    289   3e-89    
emb|CDY52447.1|  BnaA07g39240D                                          289   3e-89    
ref|XP_010509923.1|  PREDICTED: exopolygalacturonase-like               289   3e-89    
ref|XP_006486583.1|  PREDICTED: exopolygalacturonase-like               290   4e-89    
emb|CDX88444.1|  BnaC06g38880D                                          289   5e-89    
ref|XP_006389987.1|  hypothetical protein EUTSA_v10018650mg             289   5e-89    
gb|KDP24950.1|  hypothetical protein JCGZ_24417                         289   7e-89    
ref|XP_002272193.1|  PREDICTED: exopolygalacturonase                    289   7e-89    
gb|EAZ01647.1|  hypothetical protein OsI_23683                          288   1e-88    
ref|XP_006410452.1|  hypothetical protein EUTSA_v10017763mg             288   1e-88    
gb|KDO51597.1|  hypothetical protein CISIN_1g046411mg                   287   1e-88    
ref|XP_004146727.1|  PREDICTED: polygalacturonase-like                  285   2e-88    
ref|XP_008349920.1|  PREDICTED: exopolygalacturonase-like               287   2e-88    
ref|XP_009398783.1|  PREDICTED: exopolygalacturonase-like               287   2e-88    
ref|XP_010431549.1|  PREDICTED: exopolygalacturonase-like               287   3e-88    
ref|XP_009411633.1|  PREDICTED: exopolygalacturonase-like               287   3e-88    
gb|KDO58458.1|  hypothetical protein CISIN_1g045893mg                   284   3e-88    
ref|XP_006647023.1|  PREDICTED: exopolygalacturonase-like               286   4e-88    
ref|XP_008366452.1|  PREDICTED: exopolygalacturonase-like               286   4e-88    
ref|XP_006493147.1|  PREDICTED: polygalacturonase-like                  286   4e-88    
gb|KCW66879.1|  hypothetical protein EUGRSUZ_F00633                     285   4e-88    
ref|XP_006838947.1|  hypothetical protein AMTR_s00002p00270640          285   5e-88    
ref|XP_011083305.1|  PREDICTED: exopolygalacturonase-like               286   6e-88    
ref|XP_004134494.1|  PREDICTED: exopolygalacturonase-like               286   7e-88    
ref|NP_001141808.1|  uncharacterized protein LOC100273946 precursor     286   7e-88    
ref|XP_011085138.1|  PREDICTED: polygalacturonase                       285   9e-88    
ref|XP_004144956.1|  PREDICTED: exopolygalacturonase-like               285   1e-87    
ref|NP_001058060.1|  Os06g0611400                                       285   2e-87    
ref|XP_004306136.1|  PREDICTED: exopolygalacturonase-like               283   2e-87    
ref|XP_010270548.1|  PREDICTED: exopolygalacturonase-like               285   2e-87    
ref|XP_010259722.1|  PREDICTED: exopolygalacturonase-like               287   2e-87    
emb|CDX79512.1|  BnaC03g18480D                                          285   3e-87    
gb|EAZ37619.1|  hypothetical protein OsJ_21954                          285   3e-87    
gb|KDP27317.1|  hypothetical protein JCGZ_21001                         285   4e-87    
ref|XP_008364854.1|  PREDICTED: exopolygalacturonase-like               284   5e-87    
ref|XP_006856225.1|  hypothetical protein AMTR_s00059p00207430          284   5e-87    
ref|XP_002273801.1|  PREDICTED: exopolygalacturonase                    283   5e-87    
ref|XP_009132913.1|  PREDICTED: exopolygalacturonase-like               283   6e-87    
ref|XP_003519756.1|  PREDICTED: exopolygalacturonase clone GBGE18...    283   1e-86    
ref|XP_008231357.1|  PREDICTED: exopolygalacturonase-like               279   1e-86    
ref|XP_002879431.1|  hypothetical protein ARALYDRAFT_902380             283   1e-86    
ref|XP_006295486.1|  hypothetical protein CARUB_v10024590mg             282   2e-86    
emb|CDX84700.1|  BnaA03g15300D                                          282   2e-86    
gb|EYU31582.1|  hypothetical protein MIMGU_mgv1a023133mg                281   2e-86    
ref|XP_009141290.1|  PREDICTED: exopolygalacturonase-like               282   2e-86    
ref|XP_002529091.1|  Polygalacturonase precursor, putative              281   3e-86    
ref|XP_008803528.1|  PREDICTED: exopolygalacturonase-like               281   3e-86    
ref|XP_006845389.1|  hypothetical protein AMTR_s00019p00055210          281   4e-86    
emb|CDY01524.1|  BnaC07g35140D                                          281   5e-86    
gb|ACN85237.1|  exopolygalacturonase precursor                          281   5e-86    
ref|XP_007022170.1|  Pectin lyase-like superfamily protein, putative    282   6e-86    
ref|XP_009379685.1|  PREDICTED: exopolygalacturonase-like               281   6e-86    
ref|XP_009400098.1|  PREDICTED: exopolygalacturonase-like               283   8e-86    
emb|CDY30445.1|  BnaA04g25460D                                          280   1e-85    
ref|XP_010508362.1|  PREDICTED: polygalacturonase-like                  280   1e-85    
ref|XP_009367790.1|  PREDICTED: exopolygalacturonase-like               280   2e-85    
ref|XP_008383110.1|  PREDICTED: exopolygalacturonase-like               280   2e-85    
ref|XP_002529097.1|  Polygalacturonase precursor, putative              279   2e-85    
gb|KCW80887.1|  hypothetical protein EUGRSUZ_C02251                     280   2e-85    
ref|NP_177961.2|  pectin lyase-like superfamily protein                 280   2e-85    
gb|AAQ62998.1|  oil palm polygalacturonase allergen PEST459             279   2e-85    
ref|XP_010910801.1|  PREDICTED: exopolygalacturonase-like               279   3e-85    
ref|XP_009142235.1|  PREDICTED: polygalacturonase-like                  279   3e-85    
ref|XP_010324075.1|  PREDICTED: exopolygalacturonase-like               279   3e-85    
ref|XP_010507659.1|  PREDICTED: exopolygalacturonase-like               279   3e-85    
emb|CDY23407.1|  BnaC04g49350D                                          278   4e-85    
ref|XP_008438909.1|  PREDICTED: exopolygalacturonase-like               279   4e-85    
ref|XP_010277789.1|  PREDICTED: polygalacturonase-like                  278   5e-85    
ref|XP_003535015.1|  PREDICTED: polygalacturonase-like                  278   5e-85    
ref|XP_002889191.1|  predicted protein                                  278   5e-85    
emb|CDY28013.1|  BnaC05g44150D                                          281   6e-85    
gb|KFK28496.1|  hypothetical protein AALP_AA7G003400                    279   7e-85    
gb|EAZ01129.1|  hypothetical protein OsI_23157                          278   9e-85    
ref|XP_008449197.1|  PREDICTED: exopolygalacturonase-like               276   9e-85    
ref|XP_010650742.1|  PREDICTED: polygalacturonase                       277   1e-84    
ref|XP_008645431.1|  PREDICTED: exopolygalacturonase-like               278   1e-84    
gb|KCW80886.1|  hypothetical protein EUGRSUZ_C02249                     278   1e-84    
gb|KHN08670.1|  Galacturan 1,4-alpha-galacturonidase4                   278   1e-84    
gb|KHN41437.1|  Polygalacturonase                                       277   1e-84    
ref|XP_010269646.1|  PREDICTED: exopolygalacturonase-like               279   2e-84    
ref|XP_008649075.1|  PREDICTED: exopolygalacturonase-like               277   2e-84    
ref|XP_008645416.1|  PREDICTED: exopolygalacturonase-like               278   2e-84    
ref|XP_009419161.1|  PREDICTED: exopolygalacturonase-like               276   2e-84    
ref|XP_004495937.1|  PREDICTED: exopolygalacturonase clone GBGE18...    277   2e-84    
ref|XP_010412966.1|  PREDICTED: exopolygalacturonase-like               276   3e-84    
ref|XP_006845467.1|  hypothetical protein AMTR_s00019p00130680          276   3e-84    
ref|XP_002451722.1|  hypothetical protein SORBIDRAFT_04g006610          278   3e-84    
ref|NP_180874.1|  protein NIMNA                                         284   3e-84    
ref|XP_008649074.1|  PREDICTED: exopolygalacturonase                    276   4e-84    
ref|XP_010547006.1|  PREDICTED: exopolygalacturonase-like               277   4e-84    
ref|XP_010506294.1|  PREDICTED: polygalacturonase-like                  276   4e-84    
ref|XP_006447721.1|  hypothetical protein CICLE_v10017883mg             274   5e-84    
ref|XP_010449495.1|  PREDICTED: exopolygalacturonase-like               276   5e-84    
gb|ABD79098.1|  Zea m 13 allergen                                       276   5e-84    
ref|XP_002890206.1|  glycoside hydrolase family 28 protein              276   5e-84    
ref|XP_003532865.2|  PREDICTED: exopolygalacturonase-like               278   6e-84    
ref|NP_001105432.1|  exopolygalacturonase precursor                     276   7e-84    
ref|XP_004149595.1|  PREDICTED: exopolygalacturonase-like               274   7e-84    
ref|XP_006301427.1|  hypothetical protein CARUB_v10021845mg             275   7e-84    
gb|EYU35786.1|  hypothetical protein MIMGU_mgv1a026431mg                275   8e-84    
ref|XP_009149159.1|  PREDICTED: exopolygalacturonase isoform X2         275   9e-84    
gb|EYU42737.1|  hypothetical protein MIMGU_mgv1a0087912mg               270   9e-84    
ref|XP_002870065.1|  glycoside hydrolase family 28 protein              275   1e-83    
ref|XP_009142978.1|  PREDICTED: polygalacturonase                       275   1e-83    
emb|CAN69218.1|  hypothetical protein VITISV_012014                     286   1e-83    
ref|XP_006411287.1|  hypothetical protein EUTSA_v10017738mg             275   1e-83    
emb|CDY35969.1|  BnaA05g29810D                                          278   1e-83    
ref|XP_008226319.1|  PREDICTED: exopolygalacturonase                    275   1e-83    
emb|CAA40910.1|  polygalacturonase                                      275   1e-83    
gb|KHN29178.1|  Exopolygalacturonase                                    273   1e-83    
ref|XP_010277790.1|  PREDICTED: polygalacturonase-like                  275   1e-83    
ref|XP_006296295.1|  hypothetical protein CARUB_v10025465mg             275   1e-83    
sp|P35338.1|PGLR2_MAIZE  RecName: Full=Exopolygalacturonase; Shor...    275   1e-83    
ref|XP_007143503.1|  hypothetical protein PHAVU_007G0770001g            270   1e-83    
gb|AAF71796.1|AC013430_5  F3F9.9                                        275   2e-83    
gb|ACN85236.1|  polygalacturonase precursor                             275   2e-83    
gb|KGN43436.1|  Polygalacturonase                                       272   2e-83    
emb|CDY07444.1|  BnaA07g25230D                                          274   2e-83    
ref|XP_006414139.1|  hypothetical protein EUTSA_v10027030mg             274   2e-83    
ref|NP_173158.1|  pectin lyase-like protein                             274   2e-83    
ref|NP_179148.1|  glycoside hydrolase family 28 protein / polygal...    274   2e-83    
emb|CDY17902.1|  BnaC04g03170D                                          274   2e-83    
emb|CDY23765.1|  BnaC04g43570D                                          274   2e-83    
gb|EEC80963.1|  hypothetical protein OsI_23684                          275   2e-83    
ref|XP_010025868.1|  PREDICTED: polygalacturonase-like                  273   3e-83    
ref|XP_008226942.1|  PREDICTED: polygalacturonase-like                  274   3e-83    
dbj|BAD25264.1|  putative exopolygalacturonase precursor                275   3e-83    
ref|NP_001046194.1|  Os02g0196700                                       275   3e-83    
emb|CAA46680.1|  polygalacturonase                                      274   3e-83    
ref|XP_002893940.1|  predicted protein                                  274   3e-83    
ref|XP_006295765.1|  hypothetical protein CARUB_v10024886mg             274   3e-83    
emb|CAA40851.1|  polygalacturonase                                      274   3e-83    
dbj|BAH20364.1|  AT3G14040                                              270   4e-83    
gb|KFK37211.1|  hypothetical protein AALP_AA4G228400                    273   5e-83    
gb|EPS61275.1|  polygalacturonase                                       268   5e-83    
ref|XP_007140804.1|  hypothetical protein PHAVU_008G143500g             273   5e-83    
ref|XP_004143823.1|  PREDICTED: polygalacturonase-like                  273   6e-83    
ref|NP_181917.1|  putative polygalacturonase /pectinase                 273   6e-83    
ref|XP_004288736.1|  PREDICTED: polygalacturonase-like                  273   7e-83    
ref|XP_004974598.1|  PREDICTED: exopolygalacturonase-like               272   8e-83    
pir||S16998  polygalacturonase (EC 3.2.1.15) - maize                    271   8e-83 
gb|ABE65925.1|  polygalacturonase/pectinase                             268   8e-83    
ref|XP_008802086.1|  PREDICTED: polygalacturonase-like                  272   8e-83    
emb|CDX90415.1|  BnaA03g43660D                                          273   1e-82    
ref|XP_006856226.1|  hypothetical protein AMTR_s00059p00207710          273   1e-82    
ref|NP_001058061.1|  Os06g0611500                                       273   1e-82    
ref|XP_004248938.2|  PREDICTED: exopolygalacturonase-like               271   1e-82    
gb|EEE66006.1|  hypothetical protein OsJ_21955                          273   1e-82    
ref|XP_006656147.1|  PREDICTED: exopolygalacturonase-like               273   1e-82    
ref|NP_175003.1|  pectin lyase-like superfamily protein                 272   1e-82    
ref|XP_004149596.1|  PREDICTED: exopolygalacturonase-like               270   1e-82    



>ref|XP_009804151.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=401

 Score =   454 bits (1168),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 230/389 (59%), Positives = 277/389 (71%), Gaps = 10/389 (3%)
 Frame = +2

Query  62    AFTFILFMLAHFGES--ATINVAA-----KANVDVGPALLKAWKEGCAATTASTVVIPKG  220
             +F F L  L H GES  A  +V        +N D+  ALL A+KE C +   S VVIPKG
Sbjct  8     SFAFALLFLVHIGESQPAVFDVTKFGAKPDSNEDISKALLSAFKEACNSKIPSKVVIPKG  67

Query  221   TFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQ  400
             T+ M QV L G CKAPIEL+I A LKAPPNP  +    EWLTI +IDHFTLSGGG  DGQ
Sbjct  68    TYLMNQVRLEGNCKAPIELEIQATLKAPPNPSQLKKDMEWLTINHIDHFTLSGGGIFDGQ  127

Query  401   GNVQVYPSKEKGFKG-DKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFT  577
             G      +  K  +   KLPNNLS NFLTNS+IRD+T+L+SKLFH+NVLG KNLTF    
Sbjct  128   GEQGWAQNDCKNSESCGKLPNNLSFNFLTNSIIRDITSLDSKLFHINVLGCKNLTFIGVN  187

Query  578   VKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVG  757
             +KAP  S NTDGIH+AR  G+ + +S IGTGDDCIS+GDG++ + IT VTCGPGHGISVG
Sbjct  188   IKAPAQSLNTDGIHVARSRGLNITNSQIGTGDDCISIGDGIQQMYITNVTCGPGHGISVG  247

Query  758   SLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVI  937
             SLG+TPGE PV G+FV N  FI TDNGVR+KTWP SH GVV D+H+E+I +QNV NP+VI
Sbjct  248   SLGKTPGELPVVGVFVQNCTFIDTDNGVRVKTWPASHNGVVRDLHYEDIIVQNVSNPVVI  307

Query  938   DQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTI  1117
             DQ YCP N+C K  PS VK+SK+S+K I GTS T  A+++ CS GVPCE VE+GDI++T 
Sbjct  308   DQLYCPYNQCKKDLPSQVKISKVSFKNIRGTSRTQDAIKINCSKGVPCEGVEVGDIDITY  367

Query  1118  KG--GAAKSICKNVKPKLTGKVVPPLACG  1198
              G  G AKS C+NV P   GK +PP+  G
Sbjct  368   NGNEGPAKSTCQNVDPSFVGKQIPPVCAG  396



>ref|XP_009764608.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=401

 Score =   453 bits (1165),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 228/395 (58%), Positives = 278/395 (70%), Gaps = 12/395 (3%)
 Frame = +2

Query  50    ISYCAFTFILFMLAHFGESA---------TINVAAKANVDVGPALLKAWKEGCAATTAST  202
             + + +F F+L  LA  G++               A  N D+  A+L A+KE CAAT+ ST
Sbjct  3     LKFISFAFLLLFLARIGDAQPTTSPGVFDVTKYGATTNGDISKAVLDAFKEACAATSPST  62

Query  203   VVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGG  382
             +VIPKGT+ M QV+L GPCKAP+EL++ AILKAP +PK ++   EWLT+ YID FTLSGG
Sbjct  63    IVIPKGTYQMNQVKLQGPCKAPVELQVQAILKAPSDPKQLNADVEWLTVNYIDRFTLSGG  122

Query  383   GTLDGQGNVQVYPSKEKGFKG-DKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNL  559
             G  DGQG      +  K  K    LPNNLS NFLTNS I+D+T+ +SKLFH+NV G KNL
Sbjct  123   GVFDGQGKQAWDQNNCKDSKSCSNLPNNLSFNFLTNSTIQDITSQDSKLFHINVNGCKNL  182

Query  560   TFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPG  739
             TF    + AP  S NTDGIH+AR   + + D VIGTGDDCIS+GD LE L IT VTCGPG
Sbjct  183   TFIRVNITAPPESINTDGIHVARSSNVNITDCVIGTGDDCISVGDELEQLHITRVTCGPG  242

Query  740   HGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNV  919
             HGISVGSLG+TPGE+PV G++V N  FI TDNGVR+KTWP SH GVVTD+H+E+I +QNV
Sbjct  243   HGISVGSLGKTPGEKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTDLHYEDIIVQNV  302

Query  920   KNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIG  1099
              NPIVIDQ YCP N+C+K  PS VK+SK+S K I GTS T  AV L CS G PC+ VE+G
Sbjct  303   SNPIVIDQVYCPYNQCNKDLPSQVKISKVSIKNIRGTSRTQDAVLLLCSKGAPCDGVEVG  362

Query  1100  DINLTIKG--GAAKSICKNVKPKLTGKVVPPLACG  1198
             DI++T  G  G AKS C+NVKPK  GK  PP+  G
Sbjct  363   DIDITYNGKEGPAKSSCENVKPKFVGKQNPPICAG  397



>ref|XP_009612480.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=401

 Score =   452 bits (1163),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 228/395 (58%), Positives = 277/395 (70%), Gaps = 12/395 (3%)
 Frame = +2

Query  50    ISYCAFTFILFMLAHFGESA---------TINVAAKANVDVGPALLKAWKEGCAATTAST  202
             + + +F F+L   A  G++               A  N D+  A+L A+KE CAAT+ ST
Sbjct  3     LKFTSFAFLLLFFARIGDAQPTASPGVFDVTKYGATTNGDISKAVLDAFKEACAATSPST  62

Query  203   VVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGG  382
             +VIPKGT+ M QV+L GPCKAP+EL++ AILKAP +PK +    EWLT+ YID FTLSGG
Sbjct  63    IVIPKGTYQMNQVKLQGPCKAPVELQVQAILKAPSDPKQLSADIEWLTVNYIDRFTLSGG  122

Query  383   GTLDGQGNVQVYPSKEKGFKG-DKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNL  559
             G  DGQG      +  K  K    LPNNLS NFLTNS I+D+T+ +SKLFH+NV G KNL
Sbjct  123   GVFDGQGKQAWGQNNCKDSKSCSNLPNNLSFNFLTNSTIQDITSQDSKLFHINVNGCKNL  182

Query  560   TFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPG  739
             TF    + AP  S NTDGIH+AR   + + D VIGTGDDCIS+GD LE L IT VTCGPG
Sbjct  183   TFIRVNITAPQESINTDGIHVARSSNVNITDCVIGTGDDCISVGDELEQLHITRVTCGPG  242

Query  740   HGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNV  919
             HGISVGSLG+TPGE+PV G++V N  FI TDNGVR+KTWP SH GVVTD+H+E+I +QNV
Sbjct  243   HGISVGSLGKTPGEKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTDLHYEDIIVQNV  302

Query  920   KNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIG  1099
              NPIVIDQ YCP N+C+K  PS VK+SK+S K I GTS T  AV L CS G PC+ VE+G
Sbjct  303   SNPIVIDQVYCPYNQCNKDLPSKVKISKVSIKNIRGTSRTQDAVLLLCSKGAPCDGVEVG  362

Query  1100  DINLTIKG--GAAKSICKNVKPKLTGKVVPPLACG  1198
             DI++T  G  G AKS C+NVKPKL GK  PP+  G
Sbjct  363   DIDITYNGKEGPAKSSCENVKPKLVGKQNPPICAG  397



>ref|XP_009601010.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=401

 Score =   447 bits (1149),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 228/386 (59%), Positives = 273/386 (71%), Gaps = 10/386 (3%)
 Frame = +2

Query  65    FTFILFMLAHFGES--ATINVAA-----KANVDVGPALLKAWKEGCAATTASTVVIPKGT  223
             F F L  L + GES  A  +V        +N D+  ALL A+KE C +   S VVIPKG 
Sbjct  9     FAFALVFLVYTGESQPAVFDVTKFGAKPDSNEDISKALLSAFKEACNSKIPSKVVIPKGI  68

Query  224   FPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQG  403
             + M QV L G CKAPIEL+I A LKAPPNP  +    EWLTI +IDHFTLSGGG  DGQG
Sbjct  69    YLMNQVRLEGNCKAPIELQIQATLKAPPNPSQLKKDMEWLTINHIDHFTLSGGGIFDGQG  128

Query  404   NVQVYPSKEKGFKG-DKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTV  580
                   +  K  +   KLPNNLS NFLTNS+IRD+T+L+SKLFH+NVLG KNLTF    +
Sbjct  129   EQGWAQNDCKNSESCGKLPNNLSFNFLTNSIIRDITSLDSKLFHINVLGCKNLTFIGVNI  188

Query  581   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  760
             KAP  S NTDGIH+AR  G+ + +S IGTGDDCIS+GDG++ + IT VTCGPGHGISVGS
Sbjct  189   KAPAQSLNTDGIHVARSRGVNITNSEIGTGDDCISIGDGVQQMYITNVTCGPGHGISVGS  248

Query  761   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVID  940
             LG+TPGE PV G+FV N  FI TDNGVR+KTWP SH GVV D+H+E+I +QNV NP+VID
Sbjct  249   LGKTPGELPVVGVFVQNCTFIDTDNGVRVKTWPASHNGVVRDLHYEDIIVQNVSNPVVID  308

Query  941   QEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIK  1120
             Q YCP N+C K  PS VK+SK+S+K I GTS T  A+Q+ CS GVPCE VE+GDI++T  
Sbjct  309   QLYCPYNQCKKDLPSQVKISKVSFKNIRGTSRTQDAIQINCSKGVPCEGVEVGDIDITYN  368

Query  1121  G--GAAKSICKNVKPKLTGKVVPPLA  1192
             G  G AKS C+NV P   GK  PP+ 
Sbjct  369   GNEGPAKSSCQNVDPSFVGKQNPPVC  394



>ref|XP_009599317.1| PREDICTED: polygalacturonase [Nicotiana tomentosiformis]
Length=396

 Score =   446 bits (1146),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 225/382 (59%), Positives = 270/382 (71%), Gaps = 10/382 (3%)
 Frame = +2

Query  65    FTFILFMLAHFGESAT-----INVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFP  229
             F  +L  LAHFGES T         A +N D+  ALL A+KE C +T+ ST+VIPKGTF 
Sbjct  9     FALVLLFLAHFGESQTGVFDITKYGANSNADISEALLNAFKEACQSTSPSTIVIPKGTFT  68

Query  230   MTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV  409
             M QV+L GPCK+P+EL+I A LKAP +P  +    EWLT+  +D FT+SGGG LDGQ   
Sbjct  69    MNQVKLEGPCKSPLELQIQATLKAPSDPSQLK-VGEWLTVNKLDQFTMSGGGILDGQAAA  127

Query  410   QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAP  589
                  + K  K +KLPNNLS N LTNS I+D+TTL+SK FHVNV   KNLTF  F V AP
Sbjct  128   AWECKQSK--KCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAP  185

Query  590   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  769
              NSPNTDGIH++R   + + DS   TGDDCIS+GD  E L IT VTCGPGHGISVGSLG 
Sbjct  186   ANSPNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGG  245

Query  770   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEY  949
              P E+PV G+FV N  F  TDNGVRIKTWP SHPGVV D+HFE+I +QNV NP+VIDQ Y
Sbjct  246   NPDEKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVY  305

Query  950   CPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--  1123
             CP N+C+K  PS VK+SK+S++ I GTS T  AV L CS GVPCE +E+GDI++T  G  
Sbjct  306   CPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKE  365

Query  1124  GAAKSICKNVKPKLTGKVVPPL  1189
             G AKS C+N+KP L GK  PP+
Sbjct  366   GPAKSSCENIKPSLKGKQNPPV  387



>dbj|BAO02513.1| predicted polygalacturonase ortholog [Nicotiana alata]
Length=401

 Score =   444 bits (1141),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 225/383 (59%), Positives = 269/383 (70%), Gaps = 10/383 (3%)
 Frame = +2

Query  65    FTFILFMLAHFGESAT-----INVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFP  229
             F  +L  LAHFGES T         A +N D+  ALL A+KE C +T+ ST+VIPKGTF 
Sbjct  9     FALVLLFLAHFGESQTGVFDITKYGANSNADISEALLSAFKEACQSTSPSTIVIPKGTFT  68

Query  230   MTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV  409
             M QV+L GPCK+P+EL+I A LKAP +P  +    EWLT+  ID FT+SGGG LDGQ   
Sbjct  69    MNQVKLEGPCKSPLELQIQATLKAPSDPSQLK-VGEWLTVNKIDQFTMSGGGILDGQAAA  127

Query  410   QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAP  589
                    K  K +KLPNNLS N LTNS I+D+TTL+SK FHVNV   KNLTF  F V AP
Sbjct  128   AWECKNSK--KCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAP  185

Query  590   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  769
              NSPNTDGIH++R   + + DS   TGDDCIS+GD  E L IT VTCGPGHGISVGSLG 
Sbjct  186   ANSPNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGG  245

Query  770   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEY  949
              P E+PV G+FV N  F  TDNGVRIKTWP SHPGVV D+HFE+I +QNV NP+VIDQ Y
Sbjct  246   NPDEKPVIGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVY  305

Query  950   CPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--  1123
             CP N+C+K  PS VK+SK+S++ I GTS T  AV L CS GVPCE +E+GDI+++  G  
Sbjct  306   CPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDISYSGKE  365

Query  1124  GAAKSICKNVKPKLTGKVVPPLA  1192
             G AKS C+N+KP L GK  PP+ 
Sbjct  366   GPAKSSCENIKPSLKGKQNPPVC  388



>pir||S46530 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.X and clone 
pC27.Y) - common tobacco (fragment)
 emb|CAA50334.1| polygalacturonase [Nicotiana tabacum]
 emb|CAA50336.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   443 bits (1139),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 224/379 (59%), Positives = 269/379 (71%), Gaps = 10/379 (3%)
 Frame = +2

Query  74    ILFMLAHFGESAT-----INVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQ  238
             +L  LAHFGES T         A +N D+  ALL A+KE C +T+ ST+VIPKGTF M Q
Sbjct  1     VLLFLAHFGESQTGVFDITKYGANSNADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQ  60

Query  239   VELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVY  418
             V+L GPCK+P+EL+I A LKAP +P  +    EWLT+  +D FT+SGGG LDGQ      
Sbjct  61    VKLEGPCKSPLELQIQATLKAPSDPSQLK-VGEWLTVNKLDQFTMSGGGILDGQAAAAWE  119

Query  419   PSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNS  598
               + K  K +KLPNNLS N LTNS I+D+TTL+SK FHVNV   KNLTF  F V AP NS
Sbjct  120   CKQSK--KCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPANS  177

Query  599   PNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPG  778
             PNTDGIH++R   + + DS   TGDDCIS+GD  E L IT VTCGPGHGISVGSLG  P 
Sbjct  178   PNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNPD  237

Query  779   ERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPN  958
             E+PV G+FV N  F  TDNGVRIKTWP SHPGVV D+HFE+I +QNV NP+VIDQ YCP 
Sbjct  238   EKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPF  297

Query  959   NECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAA  1132
             N+C+K  PS VK+SK+S++ I GTS T  AV L CS GVPCE +E+GDI++T  G  G A
Sbjct  298   NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPA  357

Query  1133  KSICKNVKPKLTGKVVPPL  1189
             KS C+N+KP L GK  PP+
Sbjct  358   KSSCENIKPSLKGKQNPPV  376



>pir||S46529 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.W) - common 
tobacco (fragment)
 emb|CAA50337.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   441 bits (1133),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 223/379 (59%), Positives = 268/379 (71%), Gaps = 10/379 (3%)
 Frame = +2

Query  74    ILFMLAHFGESAT-----INVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQ  238
             +L  LAHFGES T         A +N D+  ALL A+KE C +T+ ST+VIPKGTF M Q
Sbjct  1     VLLFLAHFGESQTGVFDITKYGANSNADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQ  60

Query  239   VELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVY  418
             V+L GPCK+P+EL+I A LKAP +P  +    EWLT+  +D FT+SGGG LDGQ      
Sbjct  61    VKLEGPCKSPLELQIQATLKAPSDPSQLK-VGEWLTVNKLDQFTMSGGGILDGQAAAAWE  119

Query  419   PSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNS  598
               + K  K +KLPNNLS N LTNS I+D+TTL+SK FHVNV   KNLTF  F V AP NS
Sbjct  120   CKQSK--KCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPANS  177

Query  599   PNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPG  778
             PNTDGIH++R   + + DS   TGDDCIS+GD  E L IT VTCGPGHGISVGSLG  P 
Sbjct  178   PNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNPD  237

Query  779   ERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPN  958
             E+PV G+FV N  F  TDNGVRIKTWP SHPGVV D+HFE+I +QNV NP+VIDQ YCP 
Sbjct  238   EKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPF  297

Query  959   NECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAA  1132
             N+C+K  PS VK+SK+S++ I GTS T  AV L CS GVPCE +E+GDI++T  G  G A
Sbjct  298   NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPA  357

Query  1133  KSICKNVKPKLTGKVVPPL  1189
             KS C+N+KP L  K  PP+
Sbjct  358   KSSCENIKPSLKDKQNPPV  376



>sp|Q05967.1|PGLR_TOBAC RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA50338.1| polygalacturonase [Nicotiana tabacum]
Length=396

 Score =   441 bits (1133),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 224/382 (59%), Positives = 269/382 (70%), Gaps = 10/382 (3%)
 Frame = +2

Query  65    FTFILFMLAHFGESAT-----INVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFP  229
             F  +L  LAHFGES T         A +N D+  ALL A+KE C +T+ ST+VIPKGTF 
Sbjct  9     FALVLLFLAHFGESQTGVFDITKYGANSNADISEALLNAFKEACQSTSPSTIVIPKGTFT  68

Query  230   MTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV  409
             M QV+L GPCK+P+EL+I A LKAP +P  +    EWLT+  +D FT+SGGG LDGQ   
Sbjct  69    MNQVKLEGPCKSPLELQIQATLKAPSDPSQLK-VGEWLTVNKLDQFTMSGGGILDGQAAA  127

Query  410   QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAP  589
                  + K  K +KLPNNLS N LTNS I+D+TTL+SK FHVNV   KNLTF  F V AP
Sbjct  128   AWECKQSK--KCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAP  185

Query  590   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  769
              NSPNTDGIH++R   + + DS   TGDDCIS+GD  E L IT VTCGPGHGISVGSLG 
Sbjct  186   ANSPNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGG  245

Query  770   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEY  949
              P E+PV G+FV N  F  TDNGVRIKTWP SHPGVV D+HFE+I +QNV NP+VIDQ Y
Sbjct  246   NPDEKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVY  305

Query  950   CPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--  1123
             CP N+C+K  PS VK+SK+S++ I GTS T  AV L  S GVPCE +E+GDI++T  G  
Sbjct  306   CPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLRSKGVPCEGIEVGDIDITYSGKE  365

Query  1124  GAAKSICKNVKPKLTGKVVPPL  1189
             G AKS C+N+KP L GK  PP+
Sbjct  366   GPAKSSCENIKPSLKGKQNPPV  387



>ref|XP_004253347.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=403

 Score =   440 bits (1132),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 228/387 (59%), Positives = 274/387 (71%), Gaps = 10/387 (3%)
 Frame = +2

Query  50    ISYCAFTFILFMLAHFGES--ATINVA---AKANVDVGPALLKAWKEGCAATTASTVVIP  214
             I +  F   +  LAHFGES  AT ++    A AN D+  A+ KA+KE CA+T+ ST+VIP
Sbjct  5     IKFVYFGLGVLFLAHFGESQNATFDITKYGATANADISEAVGKAFKEACASTSPSTIVIP  64

Query  215   KGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLD  394
             KGTF M QV L GPCK PIEL+I AILKAP +P N     EWLT+  +D FT+SGGGTLD
Sbjct  65    KGTFQMNQVLLEGPCKGPIELQIQAILKAPTDP-NAIKTGEWLTVNKLDFFTMSGGGTLD  123

Query  395   GQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHF  574
             GQG       K K  K  KLPNNLS N LTNS+I+D+TTL+SK FHVNV   KNLTF  F
Sbjct  124   GQGKEAWECKKSK--KCTKLPNNLSFNSLTNSIIKDITTLDSKAFHVNVNQCKNLTFTKF  181

Query  575   TVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISV  754
              V AP +SPNTDGIH+AR   + + +S   TGDDCIS+GD  E L IT VTCGPGHGISV
Sbjct  182   NVSAPADSPNTDGIHVARASSVNITESSFSTGDDCISIGDETEQLYITKVTCGPGHGISV  241

Query  755   GSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIV  934
             GSLG  PGE+PV G+FV N   + TDNGVRIKTWP SHPGVV+DIHFE+I +QNV NPIV
Sbjct  242   GSLGGNPGEKPVVGVFVKNCTLVSTDNGVRIKTWPASHPGVVSDIHFEDIIVQNVSNPIV  301

Query  935   IDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLT  1114
             IDQ YCP+ +C+K  PS VK+SK+S + I GTS T  A+ L CS G PCE VE+GD++++
Sbjct  302   IDQVYCPSGKCNKDLPSQVKISKVSIQNIKGTSRTQNAISLTCSKGSPCEGVEVGDVDIS  361

Query  1115  IKG--GAAKSICKNVKPKLTGKVVPPL  1189
               G  G AKS C+N+KP   GK  P +
Sbjct  362   YSGKEGPAKSSCENIKPTFKGKQTPAV  388



>emb|CAA50335.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   438 bits (1127),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 222/379 (59%), Positives = 268/379 (71%), Gaps = 10/379 (3%)
 Frame = +2

Query  74    ILFMLAHFGESAT-----INVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQ  238
             +L  LAHFGES T         A +N D+  ALL A+KE C +T+ ST+VIPKGTF M Q
Sbjct  1     VLLFLAHFGESQTGVFDITKYGANSNADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQ  60

Query  239   VELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVY  418
             V+L GPCK+P+EL+I A LKAP +P  +    EWLT+  +D FT+SGGG LDGQ      
Sbjct  61    VKLEGPCKSPLELQIQATLKAPSDPSQLK-VGEWLTVNKLDQFTMSGGGILDGQAAAAWE  119

Query  419   PSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNS  598
               + K  K +KLPNNLS N LTNS ++D+TTL+SK FHVNV   KNLTF  F V AP NS
Sbjct  120   CKQSK--KCNKLPNNLSFNSLTNSTVKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPANS  177

Query  599   PNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPG  778
             PNTDGIH++R   + + DS   TGDDCIS+GD  E L IT VTCGPGHGISVGSLG  P 
Sbjct  178   PNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNPD  237

Query  779   ERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPN  958
             E+PV G+FVSN     TDNGVRIKTWP SHPGVV D+ FE+I +QNV NP+VIDQ YCP 
Sbjct  238   EKPVVGVFVSNCTVTNTDNGVRIKTWPASHPGVVNDVRFEDIIVQNVSNPVVIDQVYCPF  297

Query  959   NECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAA  1132
             N+C+K  PS VK+SK+S++ I GTS T  AV L CS GVPCE +E+GDI++T  G  G A
Sbjct  298   NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPA  357

Query  1133  KSICKNVKPKLTGKVVPPL  1189
             KS C+N+KP L GK  PP+
Sbjct  358   KSSCENIKPSLKGKQNPPV  376



>ref|XP_009780910.1| PREDICTED: polygalacturonase [Nicotiana sylvestris]
Length=402

 Score =   435 bits (1119),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 221/374 (59%), Positives = 265/374 (71%), Gaps = 10/374 (3%)
 Frame = +2

Query  92    HFGESAT-----INVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGP  256
             HFGES T         A +N D+  ALL A+KE C +T+ ST+VIPKGTF M QV+L GP
Sbjct  19    HFGESQTGVFDITKYGANSNADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQVKLEGP  78

Query  257   CKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKG  436
             CK+P+EL+I A LKAP +P  +    EWLT+  ID FT+SGGG LDGQ        + K 
Sbjct  79    CKSPLELQIQATLKAPSDPSQLK-VGEWLTVNKIDQFTMSGGGILDGQAAAAWECKQSK-  136

Query  437   FKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGI  616
              K +KLPNNLS N LTNS ++D+TTL+SK FHVNV   KNLTF  F V AP NSPNTDGI
Sbjct  137   -KCNKLPNNLSFNSLTNSTVKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPANSPNTDGI  195

Query  617   HIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKG  796
             H++R   + + DS   TGDDCIS+GD  E L IT VTCGPGHGISVGSLG  P E+PV G
Sbjct  196   HVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNPDEKPVVG  255

Query  797   IFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQ  976
             +FV N  F  TDNGVRIKTWP SHPGVV D+HFE+I +QNV NP+VIDQ YCP N+C+K 
Sbjct  256   VFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPFNKCNKD  315

Query  977   KPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKN  1150
              PS VK+SK+S++ I GTS T  AV L CS GVPCE +E+GDI++T  G  G AKS C+N
Sbjct  316   LPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPAKSSCEN  375

Query  1151  VKPKLTGKVVPPLA  1192
             +KP L GK  PP+ 
Sbjct  376   IKPSLKGKQNPPVC  389



>emb|CDP18013.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   434 bits (1116),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 212/384 (55%), Positives = 273/384 (71%), Gaps = 8/384 (2%)
 Frame = +2

Query  59    CAFTFILFML-AHFGESATINVAAK--ANVDVGPALLKAWKEGCAATTASTVVIPKGTFP  229
             C++ F   ++ A  G      + AK   + D+   L  AWK+ C +TTAST++IPKGTF 
Sbjct  11    CSWLFFTCIVQAQTGPIDVTQLGAKPDGSADMSQVLADAWKQACNSTTASTILIPKGTFL  70

Query  230   MTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV  409
             + +  LAGPCKAP+E++I  I+KAP +P  +    EW+TIKY+D  TLSGGGTLDGQG  
Sbjct  71    LKEASLAGPCKAPVEIQIQGIIKAPEDPAQISKDNEWMTIKYVDQLTLSGGGTLDGQG-A  129

Query  410   QVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVK  583
             + +   E   K +  KLPN LSLNF+ N+VIRDLT+LNSKLFHVN+ G  N+TF HFT+ 
Sbjct  130   KAWTQNECRVKTECSKLPNTLSLNFVNNTVIRDLTSLNSKLFHVNLFGCNNITFQHFTIT  189

Query  584   APGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSL  763
             APG+SPNTDGIHI    G+ + DS IGTGDDCIS+GDG + + I+ VTCGPGHGISVGSL
Sbjct  190   APGDSPNTDGIHIGHSTGVVITDSNIGTGDDCISIGDGAKQVNISKVTCGPGHGISVGSL  249

Query  764   GRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQ  943
             GR   E PV+GIFV++    GT NGVR+K+WP +  G  T++HFE I MQNV NP++IDQ
Sbjct  250   GRYDNELPVEGIFVTDCTISGTLNGVRVKSWPAAKSGSATNMHFEGIIMQNVSNPVIIDQ  309

Query  944   EYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG  1123
             EYCPNN+C+   PS VK++++S+K I+GTSATP AV L CS  +PC+ VEI DI+L   G
Sbjct  310   EYCPNNQCTNTAPSSVKIAQVSFKNITGTSATPAAVTLLCSKSIPCDGVEIADIDLAYNG  369

Query  1124  --GAAKSICKNVKPKLTGKVVPPL  1189
               G   S C NVKP L+GK+ PP+
Sbjct  370   NQGNVSSNCANVKPALSGKLNPPI  393



>emb|CDP04348.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   430 bits (1106),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 211/390 (54%), Positives = 274/390 (70%), Gaps = 8/390 (2%)
 Frame = +2

Query  41    MATISYCAFTFILFML-AHFGESATINVAAK--ANVDVGPALLKAWKEGCAATTASTVVI  211
             + T   C++ F   ++ A  G      + AK   + D+   L  AWK+ C +TT ST++I
Sbjct  5     LGTTLLCSWLFFTCIVQAQTGPIDVTQLGAKPDGSADMSQVLADAWKQACNSTTPSTILI  64

Query  212   PKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTL  391
             PKGTF + +  LAGPCKAP+E++I   +KAP +P  +   KEW++I Y+D  TLSGGGTL
Sbjct  65    PKGTFLLKEASLAGPCKAPVEVQIQGTVKAPEDPAQITKDKEWMSIIYVDQLTLSGGGTL  124

Query  392   DGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTF  565
             DGQG  + +   E   K +  KLPN LSLNF+ N+VIRDLT+LNSKLFHVN+ G  N+TF
Sbjct  125   DGQG-AKAWTQNECRVKTECSKLPNTLSLNFVNNTVIRDLTSLNSKLFHVNLFGCNNITF  183

Query  566   DHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHG  745
              HFT+ APG+SPNTDGIHI    G+ + DS IGTGDDCIS+GDG + + I+ VTCGPGHG
Sbjct  184   QHFTIIAPGDSPNTDGIHIGHSTGVVITDSNIGTGDDCISIGDGAKQVNISKVTCGPGHG  243

Query  746   ISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKN  925
             ISVGSLGR   E PV+GIFV++    GT NGVR+K+WP S  G  T++HFE I MQNV N
Sbjct  244   ISVGSLGRYDNELPVEGIFVTDCTISGTLNGVRVKSWPASKSGSATNMHFEGIIMQNVSN  303

Query  926   PIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDI  1105
             P++IDQEYCPNN+C+   PS VK++++S+K I+GTSATP AV L CS  +PCE VE+ DI
Sbjct  304   PVIIDQEYCPNNQCTNTAPSSVKIAQVSFKNITGTSATPAAVTLLCSKSIPCEGVEVADI  363

Query  1106  NLTIKG--GAAKSICKNVKPKLTGKVVPPL  1189
             +L   G  G+  S C NVKP L+GK+ PP+
Sbjct  364   DLAYNGNQGSVSSNCANVKPALSGKLNPPI  393



>emb|CDP04343.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   423 bits (1087),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/384 (54%), Positives = 269/384 (70%), Gaps = 8/384 (2%)
 Frame = +2

Query  59    CAFTFILFML-AHFGESATINVAAKAN--VDVGPALLKAWKEGCAATTASTVVIPKGTFP  229
             C++ F   ++ A  G    I + AK +   D+   L  AWK+ C +TTAST++IPKGTF 
Sbjct  11    CSWLFFTCIVQARTGPIDVIQLGAKRDGRADMSQVLANAWKQACNSTTASTILIPKGTFL  70

Query  230   MTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV  409
             + +  L GPCKAPI ++I   +KAP +P  +   KEW+TI Y++  TLSGGGTLDGQG  
Sbjct  71    LKEASLVGPCKAPITIQIQGTIKAPADPAQISKDKEWITIMYVNQLTLSGGGTLDGQG-A  129

Query  410   QVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVK  583
             + +   E   K +  KLPN LSLNF+ N+VIRDLT+LNSKLFHVN+    N+TF HFT+ 
Sbjct  130   KAWTQNECRVKTECSKLPNTLSLNFVNNTVIRDLTSLNSKLFHVNLFACNNVTFQHFTIT  189

Query  584   APGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSL  763
             APG+SPNTDGIHI    G+ + +S IGTGDDCIS+GDG + + I+ VTCGPGHGISVGSL
Sbjct  190   APGDSPNTDGIHIGHSTGVVITNSNIGTGDDCISIGDGAKQVNISKVTCGPGHGISVGSL  249

Query  764   GRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQ  943
             GR   E PV+GIFV++    GT NGVR+K+WP S  G  T++HFE I MQNV NP++IDQ
Sbjct  250   GRYDNELPVEGIFVTDCTISGTLNGVRVKSWPASKRGSATNMHFEGIIMQNVSNPVIIDQ  309

Query  944   EYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG  1123
             EYCPNN+C+   PS VK++++S+K I+GTSATP AV L CS  +PCE VE+  I+L   G
Sbjct  310   EYCPNNQCTNTAPSRVKIAQVSFKHITGTSATPAAVTLLCSKSIPCEGVEVAHIDLAYNG  369

Query  1124  --GAAKSICKNVKPKLTGKVVPPL  1189
               G   S C NVKP L+GK+ PP+
Sbjct  370   KQGTLSSKCANVKPVLSGKLNPPI  393



>dbj|BAA89477.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   419 bits (1076),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 210/349 (60%), Positives = 255/349 (73%), Gaps = 8/349 (2%)
 Frame = +2

Query  140   DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKN  319
             D+  AL  AWK+ CA+T  S V+IP GT+ + QV LAGPCKA IEL++  ILKAP NP  
Sbjct  41    DITEALNNAWKDACASTNPSKVLIPSGTYSLRQVTLAGPCKAAIELQVNGILKAPVNPDQ  100

Query  320   MDGKKEWLTIKYIDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNLSLNFLTNS  490
               G   W+  +YID  TLSG GT DGQGNV   +   SK K  +G  LP N+  +F+TN 
Sbjct  101   FSGS-HWVNFRYIDQLTLSGSGTFDGQGNVAWSKSTCSKNKNCEG--LPMNIRFDFITNG  157

Query  491   VIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  670
             ++RD+TT +SK FHVNVLG KNLTF HFTV AP  S NTDGIHI R  GI + DS IGTG
Sbjct  158   LVRDITTRDSKNFHVNVLGCKNLTFQHFTVTAPAESINTDGIHIGRSTGIYIIDSKIGTG  217

Query  671   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  850
             DDCIS+GDG E L +TGVTCGPGHGISVGSLGR P E+PV GIFV N     T NGVRIK
Sbjct  218   DDCISVGDGTEELHVTGVTCGPGHGISVGSLGRYPNEKPVSGIFVKNCTISNTANGVRIK  277

Query  851   TWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGT  1030
             +WP+ + GV +++HFE+I M NV+NPI++DQ YCP N+CS + PS VK+S +S+K I GT
Sbjct  278   SWPDLYGGVASNMHFEDIVMNNVQNPILLDQVYCPWNQCSLKAPSKVKISDVSFKNIRGT  337

Query  1031  SATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTG  1171
             SATPV V+LACSSG+PCE+VE+ +INL   G  G AKS C NVKPK++G
Sbjct  338   SATPVVVKLACSSGIPCEKVELANINLLYSGSEGPAKSQCSNVKPKISG  386



>dbj|BAA89476.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   417 bits (1071),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 209/349 (60%), Positives = 254/349 (73%), Gaps = 8/349 (2%)
 Frame = +2

Query  140   DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKN  319
             D+  AL  AWK+ CA+T  S V IP GT+ + QV LAGPCK+ IEL++  ILKAP NP  
Sbjct  41    DITAALTNAWKDACASTKPSKVRIPSGTYSLRQVTLAGPCKSAIELQVNGILKAPVNPDQ  100

Query  320   MDGKKEWLTIKYIDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNLSLNFLTNS  490
               G   W+  +YIDH TLSG GT DGQGNV   +   SK K  +G  LP N+  +F+TN 
Sbjct  101   FSGG-HWVNFRYIDHLTLSGSGTFDGQGNVAWSKSTCSKNKNCEG--LPMNIRFDFITNG  157

Query  491   VIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  670
             ++RD+TT +SK FHVNVLG KNLTF HFTV AP  S NTDGIHI R  GI + DS IGTG
Sbjct  158   LVRDITTRDSKNFHVNVLGCKNLTFQHFTVTAPAESINTDGIHIGRSTGIYIIDSKIGTG  217

Query  671   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  850
             DDCIS+GDG E L +T VTCGPGHGISVGSLGR P E+PV GIFV N     T NGVRIK
Sbjct  218   DDCISVGDGTEELHVTRVTCGPGHGISVGSLGRYPNEKPVSGIFVKNCTISNTANGVRIK  277

Query  851   TWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGT  1030
             +WP+ + GV +++HFE+I M NV+NPI++DQ YCP N+CS + PS VK+S +S+K I GT
Sbjct  278   SWPDLYGGVASNMHFEDIVMNNVQNPILLDQVYCPWNQCSLKAPSKVKISDVSFKNIRGT  337

Query  1031  SATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTG  1171
             SATPV V+LACSSG+PCE+VE+ +INL   G  G AKS C NVKPK++G
Sbjct  338   SATPVVVKLACSSGIPCEKVELANINLVYSGSEGPAKSQCSNVKPKISG  386



>dbj|BAA89478.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   415 bits (1067),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 206/349 (59%), Positives = 254/349 (73%), Gaps = 8/349 (2%)
 Frame = +2

Query  140   DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKN  319
             D+  AL  AWK+ CA+T  S V+IP GT+ + QV LAGPCKA IEL++  ILKAP NP  
Sbjct  41    DITEALNNAWKDACASTNPSKVLIPSGTYSLRQVTLAGPCKAAIELQVDGILKAPVNPDQ  100

Query  320   MDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPS---KEKGFKGDKLPNNLSLNFLTNS  490
               G   W+  +++D  TLSG GT DGQGNV    S   K+K  +G  LP N+  +F+TN 
Sbjct  101   FSGG-SWVDFRHVDQLTLSGSGTFDGQGNVAWSKSTCNKDKNCEG--LPMNIRFDFITNG  157

Query  491   VIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  670
             ++RD+TT +SK FHVNVLG KNLTF HFT+ APG S NTDGIHI +  GI + DS IGTG
Sbjct  158   LVRDITTRDSKNFHVNVLGCKNLTFQHFTMTAPGESINTDGIHIGQSTGIYIIDSNIGTG  217

Query  671   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  850
             DDCIS+GDG E L +TGVTCGPGHGISVGSLGR P E+PV GIFV N     T NGVRIK
Sbjct  218   DDCISVGDGTEELHVTGVTCGPGHGISVGSLGRYPNEKPVSGIFVKNCTISNTANGVRIK  277

Query  851   TWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGT  1030
             +WP+ + G  +++HFE+I M NV+NP+V+DQEYCP N+CS + PS VK+S +S+K I GT
Sbjct  278   SWPDLYGGAASNMHFEDIVMNNVQNPVVVDQEYCPWNQCSLKSPSKVKISDVSFKNIRGT  337

Query  1031  SATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTG  1171
             SATPV V+LACS G+PCE+VE+ DINL   G  G AKS C NVKP ++G
Sbjct  338   SATPVVVKLACSGGIPCEKVELADINLVYSGSEGPAKSQCSNVKPTISG  386



>ref|XP_006366630.1| PREDICTED: polygalacturonase-like [Solanum tuberosum]
Length=384

 Score =   414 bits (1064),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 208/381 (55%), Positives = 263/381 (69%), Gaps = 8/381 (2%)
 Frame = +2

Query  77    LFMLAHFGESAT-----INVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQV  241
             +  LA  G +           A  N D+  A+L A+KE CA+T+AS +++PKG F M QV
Sbjct  1     MLFLARLGAAQAGVFDVTKFGATPNGDISKAILDAFKEACASTSASRIIVPKGRFQMKQV  60

Query  242   ELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYP  421
             +L GPCKAP+E ++   L+A P+PK +  + EW T+ Y++ FTLSG G  DGQG      
Sbjct  61    KLEGPCKAPLEFQLQGTLEASPDPKILP-EGEWFTVNYLNQFTLSGTGIFDGQGKAAWAQ  119

Query  422   SKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  601
             +     K   LP NLS NFL +S I+D+T+ +SK FH+NV G  NLTF+  T+ AP  S 
Sbjct  120   NDCAKTKCAHLPYNLSFNFLNSSTIQDITSKDSKNFHMNVNGCNNLTFNRITITAPKESI  179

Query  602   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  781
             NTDGIH+AR   + + DSVIGTGDDCIS+GD LE L IT VTCGPGHGISVGSLG+TPGE
Sbjct  180   NTDGIHVARSKNVNITDSVIGTGDDCISVGDELEQLHITKVTCGPGHGISVGSLGKTPGE  239

Query  782   RPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNN  961
             +PV G++V N  FI TDNGVR+KTWP SH GVVT++H+E+I +QNV NPIVIDQ YCP N
Sbjct  240   KPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTELHYEDIIVQNVSNPIVIDQVYCPYN  299

Query  962   ECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAK  1135
             +C+K  PSLVK+SK+S K + GTS T  AV L CS GVPCE VE+GDI++T  G  G AK
Sbjct  300   QCNKDLPSLVKISKVSIKNVKGTSRTQDAVLLLCSKGVPCEGVEVGDIDITYNGKEGPAK  359

Query  1136  SICKNVKPKLTGKVVPPLACG  1198
             + C+NVKP   G   PP+  G
Sbjct  360   TSCENVKPTFVGNQNPPVCAG  380



>ref|XP_010999488.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   412 bits (1060),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 210/389 (54%), Positives = 271/389 (70%), Gaps = 13/389 (3%)
 Frame = +2

Query  35    LKMATISYCAFTFILFMLAHFGESATIN-----VAAKANVDVGPALLKAWKEGCAATTAS  199
             + +  +S    +F LF+L      A  N         A  D+  AL  AWK+ CA+T  S
Sbjct  1     MGLEVVSSAIISFSLFLLLASTTQAQSNGVFDVTKYGAGKDITEALANAWKDACASTKPS  60

Query  200   TVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSG  379
              V+IP+GT+ + +V +AGPCKA I+L++  IL+AP +P  + G  +W+  +Y+D FTLSG
Sbjct  61    KVLIPRGTYWLRKVTIAGPCKAAIKLQVDGILQAPVDPNKLSGG-DWVNFRYVDQFTLSG  119

Query  380   GGTLDGQGNVQVYPS---KEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGG  550
              GT DGQG V    S   ++K  KG  LP N+  +++TN+++RD+TTL+SK FHVNVLG 
Sbjct  120   SGTFDGQGKVAWSRSTCHRDKNCKG--LPMNMRFDYITNALVRDITTLDSKNFHVNVLGC  177

Query  551   KNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTC  730
             KNLTF HFTV+AP  S NTDGIHI R  GI + DS I TGDDCIS+GDG E L ITGVTC
Sbjct  178   KNLTFQHFTVRAPRESVNTDGIHIGRSTGIYIIDSKISTGDDCISVGDGTEELHITGVTC  237

Query  731   GPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDM  910
             GPGHGISVGSLG+ P E+PV GIFV N     T NGVRIK+WP  + GV +++HFE+I M
Sbjct  238   GPGHGISVGSLGKYPNEKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVM  297

Query  911   QNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEV  1090
              NV+NP++IDQ YCP N+CS + PS VK+S +S+K I GTSATPV VQ+ACSSG PCE+V
Sbjct  298   NNVQNPVIIDQGYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGFPCEKV  357

Query  1091  EIGDINLTIK--GGAAKSICKNVKPKLTG  1171
             ++ +INL  K  GG AKS C NVKP ++G
Sbjct  358   KLANINLAYKGPGGPAKSQCSNVKPIISG  386



>ref|XP_006387858.1| hypothetical protein POPTR_0519s00220g [Populus trichocarpa]
 gb|ERP46772.1| hypothetical protein POPTR_0519s00220g [Populus trichocarpa]
Length=393

 Score =   412 bits (1060),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 212/389 (54%), Positives = 269/389 (69%), Gaps = 13/389 (3%)
 Frame = +2

Query  35    LKMATISYCAFTFILFMLAHFGESATIN-----VAAKANVDVGPALLKAWKEGCAATTAS  199
             + +  +S    +F LF+L      A  N         A  D+  AL  AWK  CA+T  S
Sbjct  1     MGLEVVSSAIISFSLFLLLASTTQAQSNGVFDVTKYGAGKDITEALTNAWKSACASTKPS  60

Query  200   TVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSG  379
              V+IP GT+ + +V LAGPCKA I+L++  ILKAP +P  + G   W+  +Y+D FTLSG
Sbjct  61    KVLIPSGTYWLRKVTLAGPCKAAIKLQVDGILKAPVDPNKLSGG-HWVNFRYVDQFTLSG  119

Query  380   GGTLDGQGNVQVYPS---KEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGG  550
              GT DGQG V    S   K+K  KG  LP NL  +F+TN+++RD+TTL+SK FHVNVLG 
Sbjct  120   RGTFDGQGKVAWSKSTCHKDKNCKG--LPMNLRFDFITNALVRDITTLDSKNFHVNVLGC  177

Query  551   KNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTC  730
             KNLTF HFTV+APG S NTDGIHI R  GI + DS I TGDDCIS+GDG E L ITGVTC
Sbjct  178   KNLTFQHFTVRAPGESVNTDGIHIGRSTGIYIIDSKISTGDDCISVGDGTEELHITGVTC  237

Query  731   GPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDM  910
             GPGHGISVGSLG+ P E+PV GIFV N     T NGVRIK+WP  + GV +++HFE+I M
Sbjct  238   GPGHGISVGSLGKYPNEKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVM  297

Query  911   QNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEV  1090
              NV+NP++IDQ YCP N+C+ + PS VK+S +S+K I GTSATPV V++ACSSG PC++V
Sbjct  298   NNVQNPVIIDQGYCPWNQCTLKAPSKVKISDVSFKSIRGTSATPVVVRIACSSGFPCQKV  357

Query  1091  EIGDINLTIK--GGAAKSICKNVKPKLTG  1171
             ++ +INL  +  GG AKS C NVKP ++G
Sbjct  358   KLANINLAYRGPGGPAKSQCSNVKPIISG  386



>ref|XP_004243884.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=392

 Score =   411 bits (1057),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 202/360 (56%), Positives = 257/360 (71%), Gaps = 3/360 (1%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             A  N D+  A+L A+KE CA+T+ S V++PKGTF M QV+L GPCKAP+E ++   L+A 
Sbjct  30    ATPNGDISKAILDAFKEACASTSPSRVIVPKGTFQMKQVKLEGPCKAPLEFQLQGTLQAS  89

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLT  484
             P+PK +  + EW T+ Y++ FTLSG G  DGQG      +     K   LP NLS N+L 
Sbjct  90    PDPKALP-EGEWFTVNYVNQFTLSGTGIFDGQGKAAWAQNDCAKTKCAHLPYNLSFNYLN  148

Query  485   NSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIG  664
             +S I+D+T+ +SK FH+NV G  N T +  T+ AP  S NTDGIH+AR   + + D VIG
Sbjct  149   SSTIQDITSKDSKNFHMNVNGCNNFTLNRVTISAPKESINTDGIHVARSKNVNITDCVIG  208

Query  665   TGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVR  844
             TGDDCIS+GD LE L IT VTCGPGHGISVGSLG+TPGE+PV G++V N  FI TDNGVR
Sbjct  209   TGDDCISIGDELEQLHITKVTCGPGHGISVGSLGKTPGEKPVVGVYVKNCTFINTDNGVR  268

Query  845   IKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKIS  1024
             +KTWP SH GVVT++H+E+I +QNV NP+VIDQ YCP N+C+K  PSLVK+SK+S K + 
Sbjct  269   VKTWPASHQGVVTELHYEDIVVQNVSNPVVIDQVYCPYNQCNKDLPSLVKISKVSIKNVK  328

Query  1025  GTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLACG  1198
             GTS+T  AVQL CS GVPCE VE+GDI++   G  G AK+ C+NVKP   GK  PP+  G
Sbjct  329   GTSSTQDAVQLLCSKGVPCEGVEVGDIDIAYNGKEGPAKTSCENVKPTFVGKQNPPVCAG  388



>ref|XP_007009871.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18681.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=400

 Score =   409 bits (1051),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 205/368 (56%), Positives = 262/368 (71%), Gaps = 8/368 (2%)
 Frame = +2

Query  113   INVAAKA--NVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIM  286
             +N  AKA    D+  AL+ AW+E CA  + S VVIP+G + ++QV LAGPCKAP+E+++ 
Sbjct  32    MNFGAKAGGKTDISQALMAAWREACALVSPSKVVIPEGEYVLSQVTLAGPCKAPVEVQVR  91

Query  287   AILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKE--KGFKGDKLPN  460
               LKAP +P   +    W+T + IDHFTLSG GT DGQG    +   +  +  K +KLP 
Sbjct  92    GNLKAPADPSKFNNVPSWVTFQRIDHFTLSGAGTFDGQGGYAAWAQNDCKQSKKCNKLPI  151

Query  461   NLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGI  640
             N+  NF+TN ++RD+T+++SK FH+N+LG KNLTF + T+ AP  SPNTDGIHI R  GI
Sbjct  152   NIRFNFVTNGLVRDITSVDSKQFHINLLGCKNLTFANITINAPDQSPNTDGIHIGRSSGI  211

Query  641   TVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKF  820
              + DS I TGDDCISLG G +N+ I+ VTCGPGHGISVGSLG+   E PV GI V N   
Sbjct  212   DITDSRISTGDDCISLGGGSQNITISRVTCGPGHGISVGSLGKYKDE-PVFGINVVNCAL  270

Query  821   IGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLS  1000
             I T NGVR+KTWP S  G+ +D+HFE+I M NV NP++IDQEYCP+N+C+ + PS VK+S
Sbjct  271   INTSNGVRVKTWPASLEGIASDMHFEDIVMVNVSNPVLIDQEYCPSNKCNLKAPSRVKIS  330

Query  1001  KISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGK  1174
              +S+K I GTSAT VAV+LACSSG+PCE VEIGDINL+  G  G A S C NVKP + G+
Sbjct  331   NVSFKNIRGTSATQVAVKLACSSGIPCENVEIGDINLSYIGTKGPATSQCSNVKPTIAGR  390

Query  1175  VVPPLACG  1198
                PLACG
Sbjct  391   QT-PLACG  397



>ref|XP_010999485.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   409 bits (1050),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 209/387 (54%), Positives = 266/387 (69%), Gaps = 9/387 (2%)
 Frame = +2

Query  50    ISYCAFTFILFML----AHFGESATINVAAK-ANVDVGPALLKAWKEGCAATTASTVVIP  214
             +S    +F LF+L    A        +V    A+ D+  AL  AWK+ CA+T  S V+IP
Sbjct  6     VSSAIISFSLFLLLASTAKAQSKGVFDVTKYGADKDITEALTNAWKDACASTNPSKVLIP  65

Query  215   KGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLD  394
              GT+ + ++ LAGPCKA IEL++  ILKAP +P    G   W+  +Y+D FTLSG GT D
Sbjct  66    SGTYSLRKLTLAGPCKAAIELQVDGILKAPVDPNQFSGG-HWVNFRYVDKFTLSGSGTFD  124

Query  395   GQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDH  571
             GQG V    S  +K    D LP N+  +F+TN+++RD+TT +SK FHVNVLG KNLTF H
Sbjct  125   GQGKVAWSKSTCQKDKDCDSLPMNIRFDFITNALVRDITTRDSKNFHVNVLGCKNLTFQH  184

Query  572   FTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGIS  751
             FTV APG+S NTDGIH+ +  GI + DS IGTGDDCIS+GDG E L IT VTCGPGHGIS
Sbjct  185   FTVSAPGDSVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITRVTCGPGHGIS  244

Query  752   VGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPI  931
             VGSLG+ P E+PV GIFV +     T NGVRIK+WP  + GV +++HFE+I M NV+NP+
Sbjct  245   VGSLGKYPNEKPVSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPV  304

Query  932   VIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINL  1111
             +IDQ YCP N+CS + PS VK+S +S+K I GTSATPV VQ+ACSSG+PCE+VE+ DI L
Sbjct  305   IIDQVYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVELADIKL  364

Query  1112  TIKG--GAAKSICKNVKPKLTGKVVPP  1186
                G  G  KS C NVKP ++G +  P
Sbjct  365   AYSGPDGPPKSQCSNVKPMISGIMSAP  391



>ref|XP_002325639.2| hypothetical protein POPTR_0019s09470g, partial [Populus trichocarpa]
 gb|EEF00021.2| hypothetical protein POPTR_0019s09470g, partial [Populus trichocarpa]
Length=434

 Score =   409 bits (1050),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 205/352 (58%), Positives = 257/352 (73%), Gaps = 8/352 (2%)
 Frame = +2

Query  131   ANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPN  310
             A  D+  AL  AWK  CA+T  S V+IP GT+ + +V LAGPCKA I+L++  ILKAP +
Sbjct  79    AGKDITEALTNAWKSACASTKPSKVLIPSGTYWLRKVTLAGPCKAAIKLQVDGILKAPVD  138

Query  311   PKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPS---KEKGFKGDKLPNNLSLNFL  481
             P  + G   W+  +Y+D FTLSG GT DGQG V    S   K+K  KG  LP NL  +F+
Sbjct  139   PNKLSGG-HWVNFRYVDQFTLSGRGTFDGQGKVAWSKSTCHKDKNCKG--LPMNLRFDFI  195

Query  482   TNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVI  661
             TN+++RD+TTL+SK FHVNVLG KNLTF HFTV+APG S NTDGIHI R  GI + DS I
Sbjct  196   TNALVRDITTLDSKNFHVNVLGCKNLTFQHFTVRAPGESVNTDGIHIGRSTGIYIIDSKI  255

Query  662   GTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGV  841
              TGDDCIS+GDG E L ITGVTCGPGHGISVGSLG+ P E+PV GIFV N     T NGV
Sbjct  256   STGDDCISVGDGTEELHITGVTCGPGHGISVGSLGKYPNEKPVSGIFVKNCTISDTTNGV  315

Query  842   RIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKI  1021
             RIK+WP  + GV +++HFE+I M NV+NP++IDQ YCP N+C+ + PS VK+S +S+K I
Sbjct  316   RIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQGYCPWNQCTLKAPSKVKISDVSFKSI  375

Query  1022  SGTSATPVAVQLACSSGVPCEEVEIGDINLTIK--GGAAKSICKNVKPKLTG  1171
              GTSATPV V++ACSSG PC++V++ +INL  +  GG AKS C NVKP ++G
Sbjct  376   RGTSATPVVVRIACSSGFPCQKVKLANINLAYRGPGGPAKSQCSNVKPIISG  427



>ref|XP_010999486.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   407 bits (1046),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 208/396 (53%), Positives = 270/396 (68%), Gaps = 17/396 (4%)
 Frame = +2

Query  35    LKMATISYCAFTFILFMLAHFGESATINVAAK---------ANVDVGPALLKAWKEGCAA  187
             + +  +S    +F LF+L     ++T N  +K         A+ D+  AL  AWK+ CA+
Sbjct  1     MGLKVVSSAIISFSLFLLL----ASTANAQSKGVFDVTKYGADKDITEALTNAWKDACAS  56

Query  188   TTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHF  367
             T  S V+I  GT+ + ++ LAGPCKA IEL++  IL+AP +P    G   W+  +Y+D F
Sbjct  57    TNPSKVLISSGTYSLRKLTLAGPCKAAIELQVDGILQAPVDPNQFSGG-HWVNFRYVDKF  115

Query  368   TLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVL  544
             TLSG GT DGQG V    S  +K    D LP N+  +F+TN+++RD+TT +SK FHVNVL
Sbjct  116   TLSGSGTFDGQGKVAWSKSTCQKDKDCDSLPMNIRFDFITNALVRDITTRDSKNFHVNVL  175

Query  545   GGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGV  724
             G KNLTF HFTV APG+S NTDGIH+ +  GI + DS IGTGDDCIS+GDG E L IT V
Sbjct  176   GCKNLTFQHFTVSAPGDSVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITRV  235

Query  725   TCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENI  904
             TCGPGHGISVGSLG+ P E+PV GIFV +     T NGVRIK+WP  + GV +++HFE+I
Sbjct  236   TCGPGHGISVGSLGKYPNEKPVSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDI  295

Query  905   DMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCE  1084
              M NV+NP++IDQ YCP N+CS + PS VK+S +S+K I GTSATPV VQ+ACSSG+PCE
Sbjct  296   VMNNVQNPVIIDQVYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCE  355

Query  1085  EVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPP  1186
             +VE+ DI L   G  G  KS C NVKP ++G +  P
Sbjct  356   KVELADIKLAYSGPDGPPKSQCSNVKPIISGIMSAP  391



>ref|XP_006371366.1| hypothetical protein POPTR_0019s09500g [Populus trichocarpa]
 gb|ERP49163.1| hypothetical protein POPTR_0019s09500g [Populus trichocarpa]
Length=393

 Score =   407 bits (1046),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 208/392 (53%), Positives = 266/392 (68%), Gaps = 9/392 (2%)
 Frame = +2

Query  35    LKMATISYCAFTFILFML----AHFGESATINVAAK-ANVDVGPALLKAWKEGCAATTAS  199
             + +  +S    +F LF+L    A        +V    ++ D+  AL  AWK+ CA+T  S
Sbjct  1     MGLKVVSSAIISFSLFLLLASTAKAQSKGVFDVTKYGSDKDITEALTNAWKDACASTNPS  60

Query  200   TVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSG  379
              V+IP GT+ + ++ LAGPCKA IEL++  +LKAP +P    G   W+   ++D FTLSG
Sbjct  61    KVLIPSGTYSLRKLTLAGPCKAAIELQVDGMLKAPVDPNQFSGG-HWVNFGHVDKFTLSG  119

Query  380   GGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKN  556
              GT DGQG      S  +K    D LP NL  +F+TN+++RD+TT +SK FHVNVLG KN
Sbjct  120   SGTFDGQGKAAWSKSTCQKDKDCDSLPMNLRFDFITNALVRDITTRDSKNFHVNVLGCKN  179

Query  557   LTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGP  736
             LTF HFTV APG S NTDGIH+ +  GI + DS IGTGDDCIS+GDG E L ITGVTCGP
Sbjct  180   LTFQHFTVSAPGESVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITGVTCGP  239

Query  737   GHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQN  916
             GHGISVGSLG+ P E+PV GIFV N     T NGVRIK+WP  + GV +++HFE+I M N
Sbjct  240   GHGISVGSLGKYPNEKPVSGIFVKNCTLSDTTNGVRIKSWPALYGGVASNMHFEDIVMNN  299

Query  917   VKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEI  1096
             V+NP++IDQ YCP N+CS + PS VK+S +S+K I GTSATPV VQ+ACSSG PCE+VE+
Sbjct  300   VQNPVIIDQVYCPWNQCSLKAPSKVKISGVSFKNIRGTSATPVVVQIACSSGFPCEKVEL  359

Query  1097  GDINLTIKG--GAAKSICKNVKPKLTGKVVPP  1186
              DI +   G  G AKS C NVKP ++G +  P
Sbjct  360   ADIKVAYSGPDGPAKSQCSNVKPIISGTMSAP  391



>ref|XP_006371367.1| hypothetical protein POPTR_0019s09510g, partial [Populus trichocarpa]
 gb|ERP49164.1| hypothetical protein POPTR_0019s09510g, partial [Populus trichocarpa]
Length=373

 Score =   404 bits (1038),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 201/352 (57%), Positives = 251/352 (71%), Gaps = 4/352 (1%)
 Frame = +2

Query  140   DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKN  319
             D+  AL  AWK+ CA+T  S V+IP GT+ + ++ LAGPCKA IEL++  +LKAP +P  
Sbjct  21    DITEALTNAWKDACASTNPSKVLIPSGTYSLRKLTLAGPCKAAIELQVDGMLKAPVDPNQ  80

Query  320   MDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVI  496
               G   W+   ++D FTLSG GT DGQG      S  +K    D LP NL  +F+TN+++
Sbjct  81    FSGG-HWVNFGHVDKFTLSGSGTFDGQGKAAWSKSTCQKDKDCDSLPMNLRFDFITNALV  139

Query  497   RDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDD  676
             RD+TT +SK FHVNVLG KNLTF HFTV APG S NTDGIH+ +  GI + DS IGTGDD
Sbjct  140   RDITTRDSKNFHVNVLGCKNLTFQHFTVSAPGESVNTDGIHVGQSTGIYIIDSKIGTGDD  199

Query  677   CISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTW  856
             CIS+GDG E L ITGVTCGPGHGISVGSLG+ P E+PV GIFV N     T NGVRIK+W
Sbjct  200   CISVGDGTEELHITGVTCGPGHGISVGSLGKYPNEKPVSGIFVKNCTLSDTTNGVRIKSW  259

Query  857   PNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSA  1036
             P  + GV +++HFE+I M NV+NP++IDQ YCP N+CS + PS VK+S +S+K I GTSA
Sbjct  260   PALYGGVASNMHFEDIVMNNVQNPVIIDQVYCPWNQCSLKAPSKVKISGVSFKNIRGTSA  319

Query  1037  TPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPP  1186
             TPV VQ+ACSSG PCE+VE+ DI L   G  G +KS C NVKP ++G +  P
Sbjct  320   TPVVVQIACSSGFPCEKVELADIKLAYSGPDGPSKSQCSNVKPIISGIMSAP  371



>ref|XP_010999532.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=384

 Score =   404 bits (1038),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 207/387 (53%), Positives = 266/387 (69%), Gaps = 17/387 (4%)
 Frame = +2

Query  35    LKMATISYCAFTFILFMLAHFGESATINVAAK---------ANVDVGPALLKAWKEGCAA  187
             + +  +S    +F +F+L     S+T    +K         A+ D+  AL  AWK+ CA+
Sbjct  1     MGLKGVSSALISFSIFLLL----SSTAKAQSKGVFDVTKYGADKDITEALTNAWKDACAS  56

Query  188   TTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHF  367
             T  S V+IP GT+ + ++ LAGPCKA IEL++  ILKAP +P    G   W+  +Y+D F
Sbjct  57    TNPSKVLIPSGTYSLRKLTLAGPCKAAIELQVDGILKAPVDPNQFSGG-HWVNFRYVDKF  115

Query  368   TLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVL  544
             TLSG GT DGQG V    S  +K    D LP N+  +F+TN+++RD+TT +SK FHVNVL
Sbjct  116   TLSGSGTFDGQGKVAWSKSTCQKDKDCDSLPMNIRFDFITNALVRDITTRDSKNFHVNVL  175

Query  545   GGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGV  724
             G KNLTF HFTV APG+S NTDGIH+ +  GI + DS IGTGDDCIS+GDG E L IT V
Sbjct  176   GCKNLTFQHFTVSAPGDSVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITRV  235

Query  725   TCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENI  904
             TCGPGHGISVGSLG+ P E+P  GIFV +     T NGVRIK+WP  + GV +++HFE+I
Sbjct  236   TCGPGHGISVGSLGKYPNEKPFSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDI  295

Query  905   DMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCE  1084
              M NV+NP++IDQ YCP N+CS + PS VK+S +S+K I GTSATPV VQ+ACSSG PCE
Sbjct  296   VMNNVQNPVIIDQVYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGFPCE  355

Query  1085  EVEIGDINLTIK--GGAAKSICKNVKP  1159
             +V++ +INL  K  GG AKS C NVKP
Sbjct  356   KVKLANINLAYKGPGGPAKSQCSNVKP  382



>dbj|BAA89479.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   404 bits (1039),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 203/349 (58%), Positives = 250/349 (72%), Gaps = 8/349 (2%)
 Frame = +2

Query  140   DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKN  319
             D+  AL  AWK+ CA+T  S V IP GT+ + QV LAGPCKA IEL++  ILKAP +P  
Sbjct  41    DITEALNNAWKDACASTNPSKVHIPSGTYSLRQVTLAGPCKAAIELQVDGILKAPVDPNQ  100

Query  320   MDGKKEWLTIKYIDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNLSLNFLTNS  490
               G   W+   ++D  TLSG GT DGQG+V   +   SK+K  +G   P N+  +F+TN 
Sbjct  101   FSGG-HWVDFSHVDQLTLSGSGTFDGQGSVAWSKSTCSKDKNCEG--FPMNIRFDFITNG  157

Query  491   VIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  670
              +RD+TT +SK FHVNVL  KNLTF HFTV AP  S NTDGIHI R  GI + DS IGTG
Sbjct  158   FVRDITTRDSKNFHVNVLECKNLTFQHFTVTAPAESINTDGIHIGRSTGIYIIDSKIGTG  217

Query  671   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  850
             DDCIS+GDG E+L +TGVTCGPGHGISVGSLGR P E+PV GIFV N     T NGVRIK
Sbjct  218   DDCISVGDGTEDLHVTGVTCGPGHGISVGSLGRYPNEKPVSGIFVKNCTISNTANGVRIK  277

Query  851   TWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGT  1030
             +WP+ + G  +++HFE+I M NV+NP+ +DQEYCP N+CS + PS VK+S +S+K I GT
Sbjct  278   SWPDLYGGDASNMHFEDIVMNNVQNPVAVDQEYCPWNQCSLKAPSKVKISDVSFKNIRGT  337

Query  1031  SATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTG  1171
             SATPV V+LACSSG+PCE+VE+ DINL   G  G AKS C NVKP ++G
Sbjct  338   SATPVVVKLACSSGIPCEKVELADINLVYSGSEGPAKSQCSNVKPIISG  386



>ref|XP_010040513.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW45154.1| hypothetical protein EUGRSUZ_L01230 [Eucalyptus grandis]
Length=396

 Score =   404 bits (1038),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 204/370 (55%), Positives = 254/370 (69%), Gaps = 9/370 (2%)
 Frame = +2

Query  107   ATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIM  286
             AT       + D+  ALL AWKE CA+TT + V+IP GTF +T+V L GPCKAP+E ++ 
Sbjct  28    ATYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFELQ  87

Query  287   AILKAPPNPK--NMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLP  457
               LKAP +P     DG   W+  ++ID  T+SGGGT DGQG      +   K      LP
Sbjct  88    GTLKAPADPSLFKTDG---WVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKNTNCRTLP  144

Query  458   NNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIG  637
              NL  NF+TN++I D+TTL+SK F VNVLG KN+TF +F V AP +S NTDGIHI R  G
Sbjct  145   TNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRSDG  204

Query  638   ITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSK  817
             + + DS I TGDDC+SLGDG   + + GVTCGPGHGISVGSLG+   E PV+G+FV+N  
Sbjct  205   VNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTNCT  264

Query  818   FIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKL  997
              IG DNGVRIKTWP S PG  +D+HFE+I M NV NP+++DQ YCP N+C    PSL+K+
Sbjct  265   IIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAGVPSLIKI  324

Query  998   SKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTG  1171
             SK+S+KKI GTSA+ VAV++ CS  VPCEEVEI DI+L   G  G A S C NVKP L+G
Sbjct  325   SKVSFKKIRGTSASQVAVKVLCSRSVPCEEVEIADIDLVYNGPEGPATSECANVKPVLSG  384

Query  1172  KVVPPLACGK  1201
             K + P AC K
Sbjct  385   K-LNPAACAK  393



>ref|XP_010042444.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score =   402 bits (1034),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 203/370 (55%), Positives = 254/370 (69%), Gaps = 9/370 (2%)
 Frame = +2

Query  107   ATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIM  286
             AT       + D+  ALL AWKE CA+TT + V+IP GTF +T+V L GPCKAP+E ++ 
Sbjct  28    ATYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFELQ  87

Query  287   AILKAPPNPK--NMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLP  457
               LKAP +P     DG   W+  ++ID  T+SGGGT DGQG      +   K      LP
Sbjct  88    GTLKAPTDPSLFKTDG---WVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKNTNCRTLP  144

Query  458   NNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIG  637
              NL  NF+TN++I D+TTL+SK F VNVLG KN+TF +F V AP +S NTDGIHI R  G
Sbjct  145   TNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRSDG  204

Query  638   ITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSK  817
             + + DS I TGDDC+SLGDG   + + GVTCGPGHGISVGSLG+   E PV+G+FV+N  
Sbjct  205   VNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTNCT  264

Query  818   FIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKL  997
              IG DNGVRIKTWP S PG  +D+HFE+I M NV NP+++DQ YCP N+C    PSL+K+
Sbjct  265   IIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAGVPSLIKI  324

Query  998   SKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTG  1171
             SK+S+KKI GTSA+ VAV++ CS  VPC+EVEI DI+L   G  G A S C NVKP L+G
Sbjct  325   SKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECANVKPVLSG  384

Query  1172  KVVPPLACGK  1201
             K + P AC K
Sbjct  385   K-LNPAACAK  393



>ref|XP_006469749.1| PREDICTED: polygalacturonase-like [Citrus sinensis]
Length=408

 Score =   402 bits (1034),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 199/357 (56%), Positives = 253/357 (71%), Gaps = 5/357 (1%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK N D+  AL  AWKE CAATT S V+IP+GT+ ++ V + GPCKA IEL++   LKA 
Sbjct  31    AKQNADISQALRDAWKEACAATTPSKVLIPQGTYQLSPVTMEGPCKAAIELQVKGTLKAL  90

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFL  481
              +P N+     W++   I+H T+SGGGT DGQG   V PS+ EK     K P NLS N +
Sbjct  91    TDPANVKDAGSWVSFNKIEHLTVSGGGTFDGQG--AVAPSECEKDDYCKKRPINLSFNAI  148

Query  482   TNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVI  661
             TNSV++D+T+LNSK FH+NV+G KN TF   TV AP  S NTDGIH+ R  G+T+ DS I
Sbjct  149   TNSVVQDVTSLNSKQFHINVIGAKNFTFQRVTVTAPEESLNTDGIHVGRSSGVTITDSKI  208

Query  662   GTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGV  841
             GTGDDCIS+GDG + ++I  + CGPGHGISVGSLG+   E+PV GI V       T NGV
Sbjct  209   GTGDDCISIGDGTQQMEINKIDCGPGHGISVGSLGKYQNEQPVVGIRVRECNISNTSNGV  268

Query  842   RIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKI  1021
             RIKTWP S+PG  +D+HFE+I M NV NPI++DQ YCP+N+C+ + PS VKL ++S+K I
Sbjct  269   RIKTWPASYPGTASDLHFEDIKMNNVSNPILLDQVYCPHNQCNAKVPSRVKLDRVSFKNI  328

Query  1022  SGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPP  1186
              GTSAT VA++LACS GVPCE VE+ DI+LT  G  G  KS C N++PK +GK+ PP
Sbjct  329   RGTSATAVAIKLACSGGVPCEGVELADISLTYTGPEGPIKSECTNIQPKTSGKMNPP  385



>ref|XP_010999487.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   402 bits (1032),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 206/396 (52%), Positives = 268/396 (68%), Gaps = 17/396 (4%)
 Frame = +2

Query  35    LKMATISYCAFTFILFMLAHFGESATINVAAK---------ANVDVGPALLKAWKEGCAA  187
             + +  +S    +F +F+L     S+T    +K         A+ D+  AL  AWK+ CA+
Sbjct  1     MGLKGVSSALISFSIFLLL----SSTAKAQSKGVFDVTKYGADKDITEALTNAWKDACAS  56

Query  188   TTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHF  367
             T  S V+IP GT+ + ++ LAGPCKA IEL++  ILKAP +P    G   W+  +Y+D F
Sbjct  57    TNPSKVLIPSGTYSLRKLTLAGPCKAAIELQVDGILKAPVDPNQFSGG-HWVNFRYVDKF  115

Query  368   TLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVL  544
             TLSG GT DGQG +    S  +K    D LP N+  +F+TN+++RD+TT +SK FHVNVL
Sbjct  116   TLSGSGTFDGQGKLAWSKSTCQKDKDCDSLPMNIRFDFITNALVRDITTRDSKNFHVNVL  175

Query  545   GGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGV  724
             G KNLTF HFTV APG+S NTDGIH+ +  GI + DS IGTGDDCIS+GDG E L IT V
Sbjct  176   GCKNLTFQHFTVSAPGDSVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITRV  235

Query  725   TCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENI  904
             TCGPGHGISVGSLG+ P E+P  GIFV +     T NGVRIK+WP  + G  +++HFE+I
Sbjct  236   TCGPGHGISVGSLGKYPNEKPASGIFVKSCTISDTPNGVRIKSWPALYGGGASNMHFEDI  295

Query  905   DMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCE  1084
              M NV+NP++IDQ YCP N+CS + PS VK+S +S+K I GTSATPV VQ+ACSSG+PCE
Sbjct  296   VMNNVQNPVIIDQVYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCE  355

Query  1085  EVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPP  1186
             +VE+ DI L   G  G  KS C NVKP ++G +  P
Sbjct  356   KVELADIKLAYSGPDGPPKSQCSNVKPIMSGIMSAP  391



>ref|XP_010042729.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score =   402 bits (1032),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 202/370 (55%), Positives = 254/370 (69%), Gaps = 9/370 (2%)
 Frame = +2

Query  107   ATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIM  286
             AT       + D+  ALL AWKE CA+TT + V+IP GTF +T+V L GPCKAP+E ++ 
Sbjct  28    ATYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFELQ  87

Query  287   AILKAPPNPK--NMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLP  457
               LKAP +P     DG   W+  ++ID  T+SGGGT DGQG      +   K      LP
Sbjct  88    GTLKAPADPSLFKTDG---WVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKNTNCRTLP  144

Query  458   NNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIG  637
              NL  NF+TN++I D+TTL+SK F VNVLG KN+TF +F V AP +S NTDGIHI R  G
Sbjct  145   TNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRSDG  204

Query  638   ITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSK  817
             + + DS I TGDDC+SLGDG   + + GVTCGPGHGISVGSLG+   E PV+G+FV+N  
Sbjct  205   VNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTNCT  264

Query  818   FIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKL  997
              IG DNGVRIKTWP S PG  +D+HFE+I M NV NP+++DQ YCP ++C    PSL+K+
Sbjct  265   IIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFDQCKAGVPSLIKI  324

Query  998   SKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTG  1171
             SK+S+KKI GTSA+ VAV++ CS  VPC+EVEI DI+L   G  G A S C NVKP L+G
Sbjct  325   SKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECANVKPVLSG  384

Query  1172  KVVPPLACGK  1201
             K + P AC K
Sbjct  385   K-LNPAACAK  393



>ref|XP_010038565.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW46861.1| hypothetical protein EUGRSUZ_K00666 [Eucalyptus grandis]
Length=396

 Score =   401 bits (1031),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 203/370 (55%), Positives = 254/370 (69%), Gaps = 9/370 (2%)
 Frame = +2

Query  107   ATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIM  286
             A+       + D+  ALL AWKE CA+TT + V+IP GTF +T+V L GPCKAP+E ++ 
Sbjct  28    ASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFELQ  87

Query  287   AILKAPPNPK--NMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLP  457
               LKAP +P     DG   W+  ++ID  T+SGGGT DGQG      +   K      LP
Sbjct  88    GTLKAPADPSLFKTDG---WVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKNTNCRTLP  144

Query  458   NNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIG  637
              NL  NF+TN++I D+TTL+SK F VNVLG KN+TF +F V AP +S NTDGIHI R  G
Sbjct  145   TNLRFNFVTNALIHDVTTLDSKNFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRSDG  204

Query  638   ITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSK  817
             + + DS I TGDDC+SLGDG   + + GVTCGPGHGISVGSLG+   E PV+G+FV+N  
Sbjct  205   VNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTNCT  264

Query  818   FIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKL  997
              IG DNGVRIKTWP S PG  +D+HFE+I M NV NP+++DQ YCP N+C    PSL+K+
Sbjct  265   IIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAGVPSLIKI  324

Query  998   SKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTG  1171
             SK+S+KKI GTSA+ VAV++ CS  VPCEEVEI DI+L   G  G A S C NVKP L+G
Sbjct  325   SKVSFKKIRGTSASQVAVKVLCSRSVPCEEVEIADIDLVYNGPEGPATSECANVKPVLSG  384

Query  1172  KVVPPLACGK  1201
             K + P AC K
Sbjct  385   K-LNPAACAK  393



>ref|XP_006447720.1| hypothetical protein CICLE_v10015423mg [Citrus clementina]
 gb|ESR60960.1| hypothetical protein CICLE_v10015423mg [Citrus clementina]
 gb|KDO58459.1| hypothetical protein CISIN_1g015254mg [Citrus sinensis]
Length=410

 Score =   399 bits (1026),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 199/359 (55%), Positives = 254/359 (71%), Gaps = 7/359 (2%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK N D+  AL  AWKE CAATT S V+IP+GT+ ++ V + GPCKA IEL++   LKA 
Sbjct  31    AKQNADISQALRDAWKEACAATTPSKVLIPQGTYQLSPVTMEGPCKAAIELQVKGTLKAL  90

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLP--NNLSLN  475
              +P N+     W++   I+H T+SGGGT DGQG   V PS+ EK     K P  +NLS N
Sbjct  91    TDPANVKDAGSWVSFNKIEHLTVSGGGTFDGQG--AVAPSECEKDDYCKKRPIVSNLSFN  148

Query  476   FLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDS  655
              +TNSV++D+T+LNSK FH+NV+G KN TF   TV AP  S NTDGIH+ R  G+T+ DS
Sbjct  149   AITNSVVQDVTSLNSKQFHINVIGAKNFTFQRVTVTAPEESLNTDGIHVGRSSGVTITDS  208

Query  656   VIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDN  835
              IGTGDDCIS+GDG + ++I  + CGPGHGISVGSLG+   E+PV GI V       T N
Sbjct  209   KIGTGDDCISIGDGTQQMEINKIDCGPGHGISVGSLGKYQNEQPVVGIRVRECNISNTSN  268

Query  836   GVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYK  1015
             GVRIKTWP S+PG  +D+HFE+I M NV NPI++DQ YCP+N+C+ + PS VKL ++S+K
Sbjct  269   GVRIKTWPASYPGTASDLHFEDIKMNNVSNPILLDQVYCPHNQCNAKVPSRVKLDRVSFK  328

Query  1016  KISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPP  1186
              I GTSAT VA++LACS GVPCE VE+ DI+LT  G  G  KS C N++PK +GK+ PP
Sbjct  329   NIRGTSATAVAIKLACSGGVPCEGVELADISLTYTGPEGPIKSECTNIQPKTSGKMNPP  387



>ref|XP_010040848.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW44869.1| hypothetical protein EUGRSUZ_L01551 [Eucalyptus grandis]
 gb|KCW46860.1| hypothetical protein EUGRSUZ_K00665 [Eucalyptus grandis]
Length=396

 Score =   399 bits (1024),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 201/370 (54%), Positives = 253/370 (68%), Gaps = 9/370 (2%)
 Frame = +2

Query  107   ATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIM  286
             A+       + D+  ALL AWKE CA+TT + V+IP GTF +T+V L GPCKAP+E ++ 
Sbjct  28    ASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFELQ  87

Query  287   AILKAPPNPK--NMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLP  457
               LKAP +P     DG   W+  + ID  T+SGGGT DGQG      +   K      LP
Sbjct  88    GTLKAPADPSLFKTDG---WVVFQRIDGLTVSGGGTFDGQGKTAWGQNDCAKNTNCRTLP  144

Query  458   NNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIG  637
              NL  NF+TN++I D+TTL+SK F VNVLG KN+TF +F V AP +S NTDGIHI R  G
Sbjct  145   TNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRSDG  204

Query  638   ITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSK  817
             + + DS I TGDDC+SLGDG   + + GVTCGPGHGISVGSLG+   E PV+G+FV+N  
Sbjct  205   VNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTNCT  264

Query  818   FIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKL  997
              IG DNGVRIKTWP S PG  +D+HFE+I M NV NP+++DQ YCP ++C    PSL+K+
Sbjct  265   IIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFDQCKAGVPSLIKI  324

Query  998   SKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTG  1171
             SK+S+KKI GTSA+ VAV++ CS  VPC+EVEI DI+L   G  G A S C NVKP L+G
Sbjct  325   SKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECANVKPVLSG  384

Query  1172  KVVPPLACGK  1201
             K + P AC K
Sbjct  385   K-LNPAACAK  393



>ref|XP_010042694.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Eucalyptus 
grandis]
Length=396

 Score =   399 bits (1024),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 202/370 (55%), Positives = 253/370 (68%), Gaps = 9/370 (2%)
 Frame = +2

Query  107   ATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIM  286
             A+       + D+  ALL AWKE CA+TT + V+IP GTF +T+V L GPCKAP+E ++ 
Sbjct  28    ASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFELQ  87

Query  287   AILKAPPNPK--NMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLP  457
               LKAP +P     DG   W+  + ID  T+SGGGT DGQG      +   K      LP
Sbjct  88    GTLKAPADPSLFKTDG---WVVFQRIDGLTVSGGGTFDGQGKTAWGQNDCAKNTNCRTLP  144

Query  458   NNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIG  637
              NL  NF+TN++I D+TTL+SK F VNVLG KN+TF +F V AP +S NTDGIHI R  G
Sbjct  145   TNLRFNFVTNALIHDVTTLDSKNFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRSDG  204

Query  638   ITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSK  817
             + + DS I TGDDC+SLGDG   + + GVTCGPGHGISVGSLG+   E PV+G+FV+N  
Sbjct  205   VNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTNCT  264

Query  818   FIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKL  997
              IG DNGVRIKTWP S PG  +D+HFE+I M NV NP+++DQ YCP N+C    PSL+K+
Sbjct  265   IIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAGVPSLIKI  324

Query  998   SKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTG  1171
             SK+S+KKI GTSA+ VAV++ CS  VPC+EVEI DI+L   G  G A S C NVKP L+G
Sbjct  325   SKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECANVKPVLSG  384

Query  1172  KVVPPLACGK  1201
             K + P AC K
Sbjct  385   K-LNPAACAK  393



>gb|KHN24677.1| Polygalacturonase [Glycine soja]
Length=389

 Score =   397 bits (1019),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 198/384 (52%), Positives = 254/384 (66%), Gaps = 5/384 (1%)
 Frame = +2

Query  35    LKMATISYCAFTFIL-FMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVI  211
             +K A I+     F+L F  A  G+        K N ++G A L AW + CA+ TA  +VI
Sbjct  1     MKFAIITILFSLFLLDFGFAQQGDLDISRFGGKPNTNIGQAFLSAWTQACASPTAVKIVI  60

Query  212   PKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTL  391
             P GT+ M  V++ GPCKAPIE+++   ++AP NP ++    +W  ++Y++ FTLSG G  
Sbjct  61    PAGTYQMGAVDVKGPCKAPIEVQVDGTIQAPANPTDLKAAHQWFVVQYVNSFTLSGKGVF  120

Query  392   DGQGNVQVYPSKEKGFKGDK-LPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFD  568
             DGQG      +     K  K L  N   NFL NS++RD+T+ +SK FHVNVLG  N TFD
Sbjct  121   DGQGATAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNFTFD  180

Query  569   HFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGI  748
              F V AP +SPNTDGIHI R   + + ++ I TGDDC+SLGDG +N+ +  V CGPGHGI
Sbjct  181   GFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGCKNITVQNVNCGPGHGI  240

Query  749   SVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHFENIDMQNVK  922
             SVGSLG+   E PV G+ V N    GTDNGVRIKTWPN+ PG   +TD+HFE++ M NV 
Sbjct  241   SVGSLGKYDAEEPVAGLLVKNCTLNGTDNGVRIKTWPNT-PGAITITDMHFEDLTMNNVT  299

Query  923   NPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGD  1102
             NPI+IDQEYCP N+CSKQ PS +K+SK+S+K I GTS T   V L CSSGVPCE VE+ D
Sbjct  300   NPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGTKEGVVLVCSSGVPCEAVEMAD  359

Query  1103  INLTIKGGAAKSICKNVKPKLTGK  1174
             I+LT  G AA + C NVKP +TGK
Sbjct  360   IDLTFNGSAATAKCANVKPTITGK  383



>ref|XP_010038564.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=474

 Score =   398 bits (1023),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 201/370 (54%), Positives = 253/370 (68%), Gaps = 9/370 (2%)
 Frame = +2

Query  107   ATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIM  286
             A+       + D+  ALL AWKE CA+TT + V+IP GTF +T+V L GPCKAP+E ++ 
Sbjct  28    ASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFELQ  87

Query  287   AILKAPPNPK--NMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLP  457
               LKAP +P     DG   W+  + ID  T+SGGGT DGQG      +   K      LP
Sbjct  88    GTLKAPADPSLFKTDG---WVVFQRIDGLTVSGGGTFDGQGKTAWGQNDCAKNTNCRTLP  144

Query  458   NNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIG  637
              NL  NF+TN++I D+TTL+SK F VNVLG KN+TF +F V AP +S NTDGIHI R  G
Sbjct  145   TNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRSDG  204

Query  638   ITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSK  817
             + + DS I TGDDC+SLGDG   + + GVTCGPGHGISVGSLG+   E PV+G+FV+N  
Sbjct  205   VNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTNCT  264

Query  818   FIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKL  997
              IG DNGVRIKTWP S PG  +D+HFE+I M NV NP+++DQ YCP ++C    PSL+K+
Sbjct  265   IIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFDQCKAGVPSLIKI  324

Query  998   SKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTG  1171
             SK+S+KKI GTSA+ VAV++ CS  VPC+EVEI DI+L   G  G A S C NVKP L+G
Sbjct  325   SKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECANVKPVLSG  384

Query  1172  KVVPPLACGK  1201
             K + P AC K
Sbjct  385   K-LNPAACAK  393


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +2

Query  980   PSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNV  1153
             P+ VK+S +S++ I GTSATP+A +L C  GVPC+++E+ DINL   G  GAA S C NV
Sbjct  397   PTKVKISDVSFRDIRGTSATPLAEKLGCGRGVPCQKLELADINLRYNGRNGAATSQCANV  456

Query  1154  KPKLTGKVVPPLACG  1198
             KP +TGK   PL  G
Sbjct  457   KPTITGKSSLPLCAG  471



>ref|XP_003552049.1| PREDICTED: polygalacturonase [Glycine max]
Length=389

 Score =   395 bits (1014),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 197/384 (51%), Positives = 253/384 (66%), Gaps = 5/384 (1%)
 Frame = +2

Query  35    LKMATISYCAFTFIL-FMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVI  211
             +K A I+     F+L F  A  G+        K N ++G A L AW + CA+ T   +VI
Sbjct  1     MKFAIITILFSLFLLDFGFAQQGDLDISRFGGKPNTNIGQAFLSAWTQACASPTTVKIVI  60

Query  212   PKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTL  391
             P GT+ M  V++ GPCKAPIE+++   ++AP NP ++    +W  ++Y++ FTLSG G  
Sbjct  61    PAGTYQMGAVDVKGPCKAPIEVQVDGTIQAPANPTDLKAAHQWFVVQYVNSFTLSGKGVF  120

Query  392   DGQGNVQVYPSKEKGFKGDK-LPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFD  568
             DGQG      +     K  K L  N   NFL NS++RD+T+ +SK FHVNVLG  N TFD
Sbjct  121   DGQGATAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNFTFD  180

Query  569   HFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGI  748
              F V AP +SPNTDGIHI R   + + ++ I TGDDC+SLGDG +N+ +  V CGPGHGI
Sbjct  181   GFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGCKNITVQNVNCGPGHGI  240

Query  749   SVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHFENIDMQNVK  922
             SVGSLG+   E PV G+ V N    GTDNGVRIKTWPN+ PG   +TD+HFE++ M NV 
Sbjct  241   SVGSLGKYDAEEPVAGLLVKNCTLNGTDNGVRIKTWPNT-PGAITITDMHFEDLTMNNVM  299

Query  923   NPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGD  1102
             NPI+IDQEYCP N+CSKQ PS +K+SK+S+K I GTS T   V L CSSGVPCE VE+ D
Sbjct  300   NPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGTKEGVVLVCSSGVPCEAVEMAD  359

Query  1103  INLTIKGGAAKSICKNVKPKLTGK  1174
             I+LT  G AA + C NVKP +TGK
Sbjct  360   IDLTFNGSAATAKCANVKPTITGK  383



>ref|XP_010093135.1| hypothetical protein L484_009327 [Morus notabilis]
 gb|EXB53587.1| hypothetical protein L484_009327 [Morus notabilis]
Length=394

 Score =   393 bits (1009),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/389 (52%), Positives = 252/389 (65%), Gaps = 3/389 (1%)
 Frame = +2

Query  35    LKMATISYCAFTFILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIP  214
             LKM TI    F  +   L++          A A VD+  ALLK WK+ CA  + S V+IP
Sbjct  3     LKMNTIEIVLFMLVASNLSNAQVFDVTKNGANAKVDITQALLKTWKQACATKSRSQVLIP  62

Query  215   KGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLD  394
             KGTF ++Q    GPCKAPIE  +   L AP    N  G   W++ ++ID  T++GGGT +
Sbjct  63    KGTFKVSQATFQGPCKAPIEFNLQGTLLAPAVDGNFKGGDSWISFEHIDSLTVTGGGTFN  122

Query  395   GQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHF  574
             GQG      +         LP N+  NFLTNSV++ +T+L+SK FHVNVLG KN+TF HF
Sbjct  123   GQGKTAWGKTCTSSQYCGNLPINVRFNFLTNSVVQYVTSLDSKQFHVNVLGCKNITFQHF  182

Query  575   TVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISV  754
              V APG+S NTDGIHI R   + V DS I TGDDCIS+G+G + + I  V CGPGHGIS+
Sbjct  183   KVSAPGDSLNTDGIHIGRSTDVKVLDSNIQTGDDCISIGEGSQQVTINKVNCGPGHGISI  242

Query  755   GSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIV  934
             GSLG    E  VKG+FV +     T NGVRIKTWP+S PG  +D+HFE+I + NV NPIV
Sbjct  243   GSLGMYANEEAVKGVFVKSCTLKNTQNGVRIKTWPDSQPGTASDMHFEDIQLDNVGNPIV  302

Query  935   IDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLT  1114
             IDQEYCP N+C+ +  S VKLS IS+K I G+S+T VAV+L CS G PC+ V++ DINL+
Sbjct  303   IDQEYCPWNKCNAKVSSRVKLSNISFKNIRGSSSTAVAVKLVCSKGYPCQNVQLSDINLS  362

Query  1115  IKG--GAAKSICKNVKPKLTGKVVPPLAC  1195
              KG  GA  S CKNVKP L+GK   P AC
Sbjct  363   YKGSEGAITSECKNVKPILSGK-ENPRAC  390



>ref|XP_007009872.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18682.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=399

 Score =   392 bits (1008),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 202/369 (55%), Positives = 258/369 (70%), Gaps = 11/369 (3%)
 Frame = +2

Query  113   INVAAKAN--VDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIM  286
             +N  AKA+   D+  AL+ AW++ CA  + S VVIP+G + ++QV LAGPCKAP+E+++ 
Sbjct  32    MNFGAKADGKTDISQALMAAWRKACAVVSPSKVVIPEGEYILSQVTLAGPCKAPLEVQVR  91

Query  287   AILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPS---KEKGFKGDKLP  457
               LKA  +P   +    W+T + ID FTLSG GT DGQG    +     K+ G + +KLP
Sbjct  92    GTLKATADPSKFNNVPTWVTFQRIDRFTLSGAGTFDGQGGKAAWAQNDCKQVG-RCNKLP  150

Query  458   NNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIG  637
              NL  N +TN ++RD+T+++SK  H+N+L  KNLTF + TV AP  SPNTDGIHI R  G
Sbjct  151   INLRFNAVTNGLVRDITSVDSKQTHINLLSCKNLTFANITVNAPAQSPNTDGIHIGRSSG  210

Query  638   ITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSK  817
             I + DS I TGDDC+SLG+G + + +  VTCGPGHGISVGSLGR   E PV GI V+N  
Sbjct  211   INITDSRISTGDDCVSLGEGSQKITVRRVTCGPGHGISVGSLGRYR-EDPVFGITVANCT  269

Query  818   FIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKL  997
              I T NGVR+KTWP S  G+ +D+HFE+I M NV NP++IDQEYCP N+C+K  PS VK+
Sbjct  270   LINTSNGVRVKTWPASLEGIASDMHFEDIVMVNVSNPVLIDQEYCPGNKCAK-APSRVKI  328

Query  998   SKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTG  1171
             S +S+K I GTSAT VAV+L CSSG+PCE VEIGDINL+  G  G A S C NVKP +TG
Sbjct  329   SNVSFKNIRGTSATQVAVELRCSSGIPCENVEIGDINLSYIGTEGPATSRCSNVKPIITG  388

Query  1172  KVVPPLACG  1198
             K   PLACG
Sbjct  389   KQT-PLACG  396



>ref|XP_003522976.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   392 bits (1007),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 196/384 (51%), Positives = 252/384 (66%), Gaps = 5/384 (1%)
 Frame = +2

Query  35    LKMATISYCAFTFIL-FMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVI  211
             +K   I+     F+L F  A  G+        K N ++G A L AW + CA+ TA  +VI
Sbjct  1     MKFTIITIFFSLFLLDFGFAQQGDLDISRFGGKPNTNIGQAFLSAWTQACASPTAVKIVI  60

Query  212   PKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTL  391
             P GT+ M  V++ GPCKAPIE+++   ++AP NP ++    +W  ++Y++ FTLSG G  
Sbjct  61    PAGTYQMGAVDVKGPCKAPIEVQVDGTIQAPANPTDLKAAHQWFVVQYVNSFTLSGKGVF  120

Query  392   DGQGNVQVYPSKEKGFKGDK-LPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFD  568
             DGQG      +     K  K L  N   NFL NS++RD+T+ +SK FHVNVLG  N TFD
Sbjct  121   DGQGATAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNFTFD  180

Query  569   HFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGI  748
              F V AP +SPNTDGIHI R   + + ++ I TGDDC+SLGDG +N+ +  V CGPGHGI
Sbjct  181   GFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGCKNITVQNVNCGPGHGI  240

Query  749   SVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHFENIDMQNVK  922
             SVGSLG+   E PV G  V N    GTDNGVRIKTWPN+ PG   +TD+HFE++ M NV 
Sbjct  241   SVGSLGKYDSEEPVAGFLVKNCTLNGTDNGVRIKTWPNT-PGAITITDMHFEDLTMNNVT  299

Query  923   NPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGD  1102
             NPI+IDQEYCP N+CSKQ PS +K+SK+S+K I GTS +   V L CSSGVPCE VE+ D
Sbjct  300   NPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEGVEMAD  359

Query  1103  INLTIKGGAAKSICKNVKPKLTGK  1174
             I+LT  G AA + C NVKP +TGK
Sbjct  360   IDLTFNGAAATAKCANVKPTITGK  383



>ref|XP_003522977.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   392 bits (1006),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 196/384 (51%), Positives = 252/384 (66%), Gaps = 5/384 (1%)
 Frame = +2

Query  35    LKMATISYCAFTFIL-FMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVI  211
             +K   I+     F+L F  A  G+        K N ++G A L AW + CA+ TA  +VI
Sbjct  1     MKFTIITIFFSLFLLDFGFAQQGDLDISRFGGKPNTNIGQAFLSAWTQACASPTAVKIVI  60

Query  212   PKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTL  391
             P GT+ M  V++ GPCKAPIE+++   ++AP NP ++    +W  ++Y++ FTLSG G  
Sbjct  61    PAGTYQMGAVDVKGPCKAPIEVQVDGTIQAPTNPTDLKAAHQWFVVQYVNSFTLSGKGVF  120

Query  392   DGQGNVQVYPSKEKGFKGDK-LPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFD  568
             DGQG      +     K  K L  N   NFL NS++RD+T+ +SK FHVNVLG  N TFD
Sbjct  121   DGQGATAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNFTFD  180

Query  569   HFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGI  748
              F V AP +SPNTDGIHI R   + + ++ I TGDDC+SLGDG +N+ +  V CGPGHGI
Sbjct  181   GFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGCKNITVQNVNCGPGHGI  240

Query  749   SVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHFENIDMQNVK  922
             SVGSLG+   E PV G  V N    GTDNGVRIKTWPN+ PG   +TD+HFE++ M NV 
Sbjct  241   SVGSLGKYDSEEPVAGFLVKNCTLNGTDNGVRIKTWPNT-PGAITITDMHFEDLTMNNVT  299

Query  923   NPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGD  1102
             NPI+IDQEYCP N+CSKQ PS +K+SK+S+K I GTS +   V L CSSGVPCE VE+ D
Sbjct  300   NPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEGVEMAD  359

Query  1103  INLTIKGGAAKSICKNVKPKLTGK  1174
             I+LT  G AA + C NVKP +TGK
Sbjct  360   IDLTFNGAAATAKCANVKPTITGK  383



>ref|XP_011069588.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=401

 Score =   391 bits (1005),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 196/362 (54%), Positives = 258/362 (71%), Gaps = 7/362 (2%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK+  D+  AL+ AWKE C +T+ ST+VIP+GT+ ++QV+L GP KAP+EL++  IL+A 
Sbjct  34    AKSGGDISQALMDAWKEACNSTSPSTIVIPRGTWSLSQVKLLGPNKAPLELQVQGILQAN  93

Query  305   PNPKNMDGKK-EWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKE--KGFKGDKLPNNLSLN  475
             PNP  +  K+ EW+TI Y+++FTLSGGG  DGQG  Q +   +  K     KLP NLS N
Sbjct  94    PNPGQLPNKEGEWITINYVNYFTLSGGGVFDGQGQ-QAWKQNDCHKNRNCAKLPMNLSFN  152

Query  476   FLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDS  655
             F+ NS+IRD+TT +SK FHVN +G  N+TF  FTV APG+SPNTDGIH+ R   I +KDS
Sbjct  153   FVNNSIIRDVTTKDSKNFHVNCIGSHNVTFLRFTVSAPGDSPNTDGIHLGRDTMINIKDS  212

Query  656   VIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDN  835
             +I TGDDC+S+GD  + + I  VTCGPGHGISVGSLG    E+ V+GIFV+N  FIGT N
Sbjct  213   IIKTGDDCVSIGDESKEIHIQNVTCGPGHGISVGSLGGYAEEKDVQGIFVTNCTFIGTQN  272

Query  836   GVRIKTWPNSHPGV-VTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISY  1012
             GVR+KTWP++   + V+D+HFE++ M NV +PI+IDQEYCP+N C K +PS +K+S +S 
Sbjct  273   GVRVKTWPSAPAQLTVSDLHFEDLIMDNVSSPIIIDQEYCPHNLCKKDRPSSIKISNVSI  332

Query  1013  KKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPP  1186
             K + GT+ +  AV L CS   PCE VE+GDI+LT  G  G   + C NVKPK  GK  PP
Sbjct  333   KNVRGTTNSAEAVTLICSGLKPCENVEVGDIDLTYNGNQGPITTKCMNVKPKFVGKQNPP  392

Query  1187  LA  1192
             + 
Sbjct  393   VC  394



>ref|XP_002274096.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28389.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   389 bits (1000),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 201/369 (54%), Positives = 251/369 (68%), Gaps = 5/369 (1%)
 Frame = +2

Query  101   ESATINV---AAKAN-VDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAP  268
             E A+ +V    AKA+  D+  ALL AWKE CA+ T S+V++P GT+ + Q+   GPCKAP
Sbjct  24    EGASFDVTKHGAKADGSDISQALLAAWKEACASPTPSSVLVPAGTYGLGQICFEGPCKAP  83

Query  269   IELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD  448
             I L +   LKAP + KN      W+  + IDHFTLSG G  DGQG         +     
Sbjct  84    INLIVEGTLKAPVDTKNFKADAGWVAFQNIDHFTLSGKGVFDGQGPAVWGKKCARSSYCG  143

Query  449   KLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIAR  628
              LP NL  NFLTNS++RD+TT +SK FHVNVLG KNL+F HFTV AP  S NTDGIHI R
Sbjct  144   ALPINLKFNFLTNSMVRDVTTKDSKQFHVNVLGCKNLSFYHFTVSAPEESLNTDGIHIGR  203

Query  629   IIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVS  808
               GI + ++ I TGDDCIS+GDG E + I  VTCGPGHGISVGSLG+   E PV GI V+
Sbjct  204   SSGINITNTNIKTGDDCISIGDGSEQITIDQVTCGPGHGISVGSLGKYANEAPVVGIKVT  263

Query  809   NSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSL  988
              S    T NG+R+KTWP S  G+ +++HFE+I M NV NPI+IDQEYCP ++C +Q PS 
Sbjct  264   GSTLTNTQNGIRVKTWPASPAGIASNMHFEDIIMNNVGNPILIDQEYCPYSQCKQQIPSR  323

Query  989   VKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKGGAAKSICKNVKPKLT  1168
             VK+S +++K I GTS+T +AV+L CSSGVPC+ V++ DINL   GGA  SICKNVKP L 
Sbjct  324   VKISDVTFKNIRGTSSTELAVKLVCSSGVPCQNVQLTDINLKFNGGAPTSICKNVKPIL-  382

Query  1169  GKVVPPLAC  1195
             G V  P +C
Sbjct  383   GGVQQPRSC  391



>ref|XP_010536243.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score =   390 bits (1001),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 194/389 (50%), Positives = 258/389 (66%), Gaps = 9/389 (2%)
 Frame = +2

Query  26    VTNLKMATISYCAFTFILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTV  205
             VT+L +A+    A   + F +A++G   T       + D+  A   AWK  C++T+ S +
Sbjct  15    VTHLLVASFVQSAADSVTFSIANYGLKGT------EDEDITKAFSVAWKAACSSTSPSKL  68

Query  206   VIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGG  385
             ++PKGT+ + QV   GPCKAP+EL++   +KAP +P +   K  W++ + ID F L G G
Sbjct  69    IVPKGTYVLRQVVFEGPCKAPLELQVHGTIKAPEDPSDFIEKAGWISFQRIDRFALVGNG  128

Query  386   TLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLT  562
             T DGQG+     +   K  + +KLP N+  NF+TN +++D+T+LNSKLFH+NVLG  NLT
Sbjct  129   TFDGQGSTAWSQNDCHKTGECNKLPINIRFNFITNGLVQDITSLNSKLFHINVLGCNNLT  188

Query  563   FDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGH  742
             F    +KAP +SPNTDGIHI R   I + DSV+ TGDDCIS+G G EN+ I  V CGPGH
Sbjct  189   FSRVNIKAPEDSPNTDGIHIGRSKNINITDSVMSTGDDCISMGRGSENIAIERVKCGPGH  248

Query  743   GISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVK  922
             GISVGSLGR   E PV GI V N  F  TDNGVR+KTW +S   + T ++F++I + NV 
Sbjct  249   GISVGSLGRYTKEEPVSGIIVRNCTFFNTDNGVRVKTWMSSEKAIATGLYFQDIAVVNVS  308

Query  923   NPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGD  1102
             NP+VIDQEYCP N C  +KPS VKLS IS++ I GTS+T +A++LACSSGVPCE VEI D
Sbjct  309   NPVVIDQEYCPYNHCKAKKPSQVKLSNISFRNIHGTSSTQMAMKLACSSGVPCENVEISD  368

Query  1103  INLTIKG--GAAKSICKNVKPKLTGKVVP  1183
             I++   G  G + S C NV PK+ GK  P
Sbjct  369   IDIKYTGSDGDSMSDCTNVSPKIFGKQYP  397



>ref|XP_003522975.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   389 bits (998),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 195/384 (51%), Positives = 251/384 (65%), Gaps = 5/384 (1%)
 Frame = +2

Query  35    LKMATISYCAFTFIL-FMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVI  211
             +K   I+     F+L F  A  G+        K N ++G A L AW + CA+ TA  +VI
Sbjct  1     MKFTIITIFFSLFLLDFGFAQQGDLDISRFGGKPNTNIGQAFLSAWTQACASPTAVKIVI  60

Query  212   PKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTL  391
             P GT+ M  V++ GPCKAPIE+++   ++AP NP ++    +W  ++Y++ FTLSG G  
Sbjct  61    PAGTYQMGAVDVKGPCKAPIEVQVDGTIQAPANPTDLKAAHQWFVVQYVNSFTLSGKGVF  120

Query  392   DGQGNVQVYPSKEKGFKGDK-LPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFD  568
             DGQG      +     K  K L  N   NFL NS++RD+T+ +SK FHVNVLG  N TFD
Sbjct  121   DGQGATAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNFTFD  180

Query  569   HFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGI  748
              F V AP +SPNTDGIHI R   + + ++ I TGDDC+SLGDG +N+ +  V CGPGHGI
Sbjct  181   GFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGSKNITVQNVNCGPGHGI  240

Query  749   SVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHFENIDMQNVK  922
             SVGSLG+   E PV G  V N     TDNGVRIKTWPN+ PG   +TD+HFE++ M NV 
Sbjct  241   SVGSLGKYDSEEPVAGFLVKNCTLNETDNGVRIKTWPNT-PGAITITDMHFEDLTMNNVT  299

Query  923   NPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGD  1102
             NPI+IDQEYCP N+CSKQ PS +K+SK+S+K I GTS +   V L CSSGVPCE VE+ D
Sbjct  300   NPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQDGVVLVCSSGVPCEGVEMAD  359

Query  1103  INLTIKGGAAKSICKNVKPKLTGK  1174
             I+LT  G AA + C NVKP +TGK
Sbjct  360   IDLTFNGAAATAKCANVKPTITGK  383



>ref|XP_008379966.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=400

 Score =   387 bits (995),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/367 (53%), Positives = 247/367 (67%), Gaps = 9/367 (2%)
 Frame = +2

Query  116   NVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAIL  295
             N   KAN D+  AL KAW + CA+T+AS +V+P GT+        GPCKAPIE ++   L
Sbjct  34    NYGGKANSDITQALSKAWTDACASTSASKIVVPSGTYKFVGATFKGPCKAPIEFQLQGTL  93

Query  296   KAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNL  466
             +AP +   +     W+  + ID  TLSGGGT DG G     Q   +K K  K   +  NL
Sbjct  94    QAPEDGSQLPKADTWIGFERIDGLTLSGGGTFDGLGATAWKQNDCNKNKNCKSIAI--NL  151

Query  467   SLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITV  646
               NF+TNS+IRD+TT +SK FHVN+LG  N+ F HFTV AP  S NTDGIHI R  GI +
Sbjct  152   RFNFVTNSIIRDITTKDSKNFHVNLLGCNNVAFQHFTVSAPKESINTDGIHIGRSTGINI  211

Query  647   KDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIG  826
              D+ IGTGDDCIS+GDG + L +T VTCGPGHGIS+GSLG+   E PV GIF+ N     
Sbjct  212   TDTTIGTGDDCISIGDGTKQLHVTNVTCGPGHGISIGSLGKYENEEPVSGIFIKNCTITN  271

Query  827   TDNGVRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSK  1003
             TDNGVRIKTWP S   GVV+D+HFE+I M NVKNP++IDQEYCP N+C+ Q PS VK+S 
Sbjct  272   TDNGVRIKTWPASPANGVVSDVHFEDIIMDNVKNPVIIDQEYCPYNQCTLQVPSKVKISN  331

Query  1004  ISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKV  1177
             +S+K I G+S+TPV ++L CS G+PCE VE+ +I+LT  G  G+  S CK++KP +   V
Sbjct  332   VSFKNIKGSSSTPVGIKLVCSGGLPCENVELSNIDLTYTGKEGSITSECKHIKPTIN-NV  390

Query  1178  VPPLACG  1198
               PLAC 
Sbjct  391   AQPLACA  397



>ref|XP_010067918.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW88713.1| hypothetical protein EUGRSUZ_A01068 [Eucalyptus grandis]
Length=401

 Score =   387 bits (994),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 196/394 (50%), Positives = 257/394 (65%), Gaps = 15/394 (4%)
 Frame = +2

Query  41    MATISYCAFTFILFMLAHFGESATINVA-----AKANVDVGPALLKAWKEGCAATTASTV  205
             M  IS       L   A    S   ++A        + D+  AL+ AWKE CAAT AS V
Sbjct  1     MGKISILPAAIALLFFASTARSLVCDIAKYGAGGGTSSDITQALVSAWKEACAATEASKV  60

Query  206   VIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNM--DGKKEWLTIKYIDHFTLSG  379
             ++P GT+ + +V L GPCK+ IE+++   L+AP +P  M  DG   W+  + +D  TLSG
Sbjct  61    LVPAGTYVLREVVLEGPCKSSIEVQVDGTLQAPADPAQMKTDG---WVAFRGVDLLTLSG  117

Query  380   GGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGK  553
              GT DGQG    +   +   K D   LP N+  + +TN +++D+T+L+SK FHVNVL  K
Sbjct  118   SGTFDGQGKT-AWTKNDCNLKTDCVTLPINIRFDSVTNGMVKDITSLDSKQFHVNVLNCK  176

Query  554   NLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCG  733
             NLTF H T+ APG+SPNTDGIHI R  GI + D+ I TGDDCIS+GDG E + ITGVTCG
Sbjct  177   NLTFQHVTITAPGDSPNTDGIHIGRSTGINIIDTGIKTGDDCISIGDGSEQMTITGVTCG  236

Query  734   PGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQ  913
             PGHGISVGSLG+ P E+PV G+ V N    GT NG+RIKTWP S  G  +D+HFE+I + 
Sbjct  237   PGHGISVGSLGKYPNEQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLD  296

Query  914   NVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVE  1093
             NV NP++IDQ+YCP N+C  Q PS +K+S +S+ +I GTS+T  AV LACSS +PC EVE
Sbjct  297   NVGNPVIIDQQYCPWNQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVE  356

Query  1094  IGDINLTIKG--GAAKSICKNVKPKLTGKVVPPL  1189
             I DI++   G  G A S+C NVKP ++GK  P +
Sbjct  357   ISDIDIAYHGPEGPATSVCSNVKPTISGKQNPAI  390



>ref|XP_010067907.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=401

 Score =   387 bits (994),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 196/394 (50%), Positives = 257/394 (65%), Gaps = 15/394 (4%)
 Frame = +2

Query  41    MATISYCAFTFILFMLAHFGESATINVA-----AKANVDVGPALLKAWKEGCAATTASTV  205
             M  IS       L   A    S   ++A        + D+  AL+ AWKE CAAT AS V
Sbjct  1     MGKISILPAAIALLFFASTARSLVCDIAKYGAGGGTSSDITQALVSAWKEACAATEASKV  60

Query  206   VIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNM--DGKKEWLTIKYIDHFTLSG  379
             ++P GT+ + +V L GPCK+ IE+++   L+AP +P  M  DG   W+  + +D  TLSG
Sbjct  61    LVPAGTYVLREVVLEGPCKSSIEVQVDGTLQAPADPAQMKTDG---WVAFRGVDLLTLSG  117

Query  380   GGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGK  553
              GT DGQG    +   +   K D   LP N+  + +TN +++D+T+L+SK FHVNVL  K
Sbjct  118   SGTFDGQGKT-AWTKNDCNLKTDCVTLPINIRFDSVTNGMVKDITSLDSKQFHVNVLNCK  176

Query  554   NLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCG  733
             NLTF H T+ APG+SPNTDGIHI R  GI + D+ I TGDDCIS+GDG E + ITGVTCG
Sbjct  177   NLTFQHVTITAPGDSPNTDGIHIGRSTGINIIDTGIKTGDDCISIGDGSEQMTITGVTCG  236

Query  734   PGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQ  913
             PGHGISVGSLG+ P E+PV G+ V N    GT NG+RIKTWP S  G  +D+HFE+I + 
Sbjct  237   PGHGISVGSLGKYPNEQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLD  296

Query  914   NVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVE  1093
             NV NP++IDQ+YCP N+C  Q PS +K+S +S+ +I GTS+T  AV LACSS +PC EVE
Sbjct  297   NVGNPVIIDQQYCPWNQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVE  356

Query  1094  IGDINLTIKG--GAAKSICKNVKPKLTGKVVPPL  1189
             I DI++   G  G A S+C NVKP ++GK  P +
Sbjct  357   ISDIDIAYHGPEGPATSVCSNVKPTISGKQNPAI  390



>ref|XP_010112807.1| hypothetical protein L484_020039 [Morus notabilis]
 gb|EXC34922.1| hypothetical protein L484_020039 [Morus notabilis]
Length=396

 Score =   386 bits (992),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 196/377 (52%), Positives = 250/377 (66%), Gaps = 6/377 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATI----NVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQ  238
             F+L  +    +   +       AK+N D   AL +AWK  CA+   S VV+PKGTF +++
Sbjct  13    FVLLAITATAQCGNVYDITKYGAKSNNDANQALGQAWKAACASKVPSKVVVPKGTFRLSR  72

Query  239   VELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVY  418
                 GPCKAPIE  I+  L+AP NP        W+T + ID  TL GGGT DG G     
Sbjct  73    AAFFGPCKAPIEFMIVGTLQAPQNPGGFKDGDGWVTFQDIDRLTLDGGGTFDGNGQNVWG  132

Query  419   PSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNS  598
                 +     KLP NL  NF+ NSVI+ +T+LNSK FH+ VLGG NL+F +  + AP +S
Sbjct  133   KHCTRLNYCSKLPINLRFNFIKNSVIKSVTSLNSKQFHIMVLGGVNLSFRNLKIIAPEDS  192

Query  599   PNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPG  778
              NTDGIHI R   I++ DS I TGDDCIS+GDG +NL + GVTCGPGHGIS+GSLG+   
Sbjct  193   YNTDGIHIGRSTNISITDSYIQTGDDCISVGDGTKNLTVKGVTCGPGHGISIGSLGKYRN  252

Query  779   ERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPN  958
             E PV+GI V +  F  T NGVRIKTWPN++ G  +D+ FEN+ MQNV +P++IDQEYCP 
Sbjct  253   EAPVQGITVRDCTFKNTQNGVRIKTWPNANEGSASDLRFENLYMQNVGSPVLIDQEYCPW  312

Query  959   NECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAA  1132
             N+C+ Q PS VKLSKIS+K I GTS+TP+AV L CS G PC+ VE+G+I+L  KG  G A
Sbjct  313   NQCNTQNPSKVKLSKISFKNIWGTSSTPLAVNLICSRGYPCQNVEVGNIDLKYKGKDGPA  372

Query  1133  KSICKNVKPKLTGKVVP  1183
              S+CKNV  K+TGK+ P
Sbjct  373   HSVCKNVNVKVTGKMNP  389



>ref|XP_010536244.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score =   387 bits (993),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 194/389 (50%), Positives = 256/389 (66%), Gaps = 9/389 (2%)
 Frame = +2

Query  26    VTNLKMATISYCAFTFILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTV  205
             VT+L +A+    A   I F + ++G   T       + D+  A   AW+  C++T+ S +
Sbjct  15    VTHLLVASFVQSAADSITFSITNYGLKGT------EDEDITKAFSVAWEAACSSTSPSKL  68

Query  206   VIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGG  385
             ++PKGT+ + QV   GPCKAP+EL++   +KAP +P     K  W++ + ID F L G G
Sbjct  69    IVPKGTYVLRQVVFEGPCKAPLELQVHGTIKAPEDPSYFIEKAGWISFQRIDRFALVGNG  128

Query  386   TLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLT  562
             T DGQG+     +   K  + +KLP N+  NF+TN +++D+T+LNSKLFH+NVLG  NLT
Sbjct  129   TFDGQGSTAWSQNDCHKTGECNKLPINIRFNFITNGLVQDITSLNSKLFHINVLGCNNLT  188

Query  563   FDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGH  742
             F    +KAP +SPNTDGIHI R   I + DSV+ TGDDCIS+G G EN+ I  V CGPGH
Sbjct  189   FSRVNIKAPEDSPNTDGIHIGRSKNINITDSVMSTGDDCISMGRGSENIAIERVKCGPGH  248

Query  743   GISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVK  922
             GISVGSLGR   E PV GI V N  F  TDNGVR+KTW +S   + T ++F++I + NV 
Sbjct  249   GISVGSLGRYTKEEPVSGIIVRNCTFFNTDNGVRVKTWMSSEKAIATGLYFQDIAVVNVS  308

Query  923   NPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGD  1102
             NPIVIDQEYCP N C  +KPS VKLS IS++ I GTS+T +A++LACSSGVPCE VEI D
Sbjct  309   NPIVIDQEYCPYNHCKAKKPSQVKLSNISFRNIHGTSSTQMAMKLACSSGVPCENVEISD  368

Query  1103  INLTIKG--GAAKSICKNVKPKLTGKVVP  1183
             I++   G  G + S C NV PK+ GK  P
Sbjct  369   IDIKYTGSDGDSMSDCTNVSPKIFGKQYP  397



>ref|XP_007049259.1| Polygalacturonase [Theobroma cacao]
 gb|EOX93416.1| Polygalacturonase [Theobroma cacao]
Length=405

 Score =   386 bits (991),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 199/375 (53%), Positives = 255/375 (68%), Gaps = 11/375 (3%)
 Frame = +2

Query  98    GESATINVAAK------ANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPC  259
              +S  ++V AK         D+   LL AWKE CA+TT S +VIPKGT+ +++  L GPC
Sbjct  24    AQSTVVDVVAKYGAKADEKTDLSTPLLNAWKEACASTTPSKIVIPKGTYRLSRASLDGPC  83

Query  260   KAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGN-VQVYPSKEKG  436
             K+ IEL++  I+KAP +P        W+   ++DH T+SGGG  DGQG  V    +  K 
Sbjct  84    KSAIELQVSGIIKAPADPSAFK-DPNWVVFNHVDHLTISGGGVFDGQGAAVWGKNNCAKN  142

Query  437   FKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGI  616
                  LP NL  N+++N++++ +TT +SK FHVNVLG +N TF HFTV AP NS NTDGI
Sbjct  143   KYCAALPINLRFNYVSNAIVQGITTKDSKQFHVNVLGCRNFTFQHFTVSAPENSINTDGI  202

Query  617   HIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKG  796
             HI R  G+ V D+ I TGDDC+SLGDG +N+ +  VTCGPGHGISVGSLG+   E PV G
Sbjct  203   HIGRSNGVKVLDTNIKTGDDCVSLGDGSKNVIVERVTCGPGHGISVGSLGKFNDEEPVSG  262

Query  797   IFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQ  976
             IFV N     T NGVR+KTWP+SHPG  TD+HFE+I + NV NPI+IDQEYCP N C+ +
Sbjct  263   IFVRNCTLSNTMNGVRVKTWPDSHPGSATDMHFEDIILNNVGNPILIDQEYCPWNLCNLK  322

Query  977   KPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIK--GGAAKSICKN  1150
              PS +KLS IS+KKI GTS+T  AV+L CS G+PC+ VE+ DI++T K  GG A S C N
Sbjct  323   VPSRIKLSNISFKKIRGTSSTQQAVRLVCSRGLPCDRVELADIDITYKGPGGPATSECTN  382

Query  1151  VKPKLTGKVVPPLAC  1195
             VKP+ +GK  PP AC
Sbjct  383   VKPRTSGKQNPP-AC  396



>ref|XP_008379967.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=400

 Score =   385 bits (990),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 199/389 (51%), Positives = 255/389 (66%), Gaps = 14/389 (4%)
 Frame = +2

Query  65    FTFILFMLAHFGESATINVAA-----KANVDVGPALLKAWKEGCAATTASTVVIPKGTFP  229
             F F+L +     +S+  +V +     KAN D+  A  KAW + CA+T AS +V+P+GT+ 
Sbjct  12    FVFMLLVSTSNAKSSIYDVTSAKYGGKANSDISQAFSKAWTDACASTLASKIVVPRGTYK  71

Query  230   MTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV  409
                    GPCKAPIE+++   L+AP +   +     W+  + ID  TLSGGGT DGQG  
Sbjct  72    FVGATFKGPCKAPIEIQLQGTLQAPADGSKLPKADTWVGFERIDGLTLSGGGTFDGQGAT  131

Query  410   ---QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTV  580
                Q   +K K  K   +  NL  NF+TNS+IRD+TT +SK FHVNVLG  N+ F HFTV
Sbjct  132   AWKQNDCNKNKNCKSIAI--NLRFNFVTNSIIRDITTKDSKNFHVNVLGCNNVVFQHFTV  189

Query  581   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  760
              AP  S NTDGIHI R  GI + DS IGTGDDCIS+GDG + L +T VTCGPGHGIS+GS
Sbjct  190   SAPKESMNTDGIHIGRSTGINITDSTIGTGDDCISIGDGTKQLHVTKVTCGPGHGISIGS  249

Query  761   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVI  937
             LGR   E PV GIF+ N     TDNGVRIKTWP S   GVV+D+HFE+I M NV NP++I
Sbjct  250   LGRYQNEEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIMDNVGNPVII  309

Query  938   DQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTI  1117
             DQEYCP N+C+ + PS VK+S +S+K I G+S+TPV +++ CS G+PCE V++ DI+LT 
Sbjct  310   DQEYCPWNQCTLKVPSKVKISNVSFKNIKGSSSTPVGIKIVCSGGLPCENVQLSDIDLTY  369

Query  1118  KG--GAAKSICKNVKPKLTGKVVPPLACG  1198
              G  G   S CK+VKP +   V   LAC 
Sbjct  370   SGNKGPITSQCKHVKPTIN-NVARALACA  397



>gb|KHN15656.1| Polygalacturonase, partial [Glycine soja]
Length=350

 Score =   384 bits (985),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 186/344 (54%), Positives = 236/344 (69%), Gaps = 4/344 (1%)
 Frame = +2

Query  152   ALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGK  331
             A L AW + CA+ TA  +VIP GT+ M  V++ GPCKAPIE+++   ++AP NP ++   
Sbjct  2     AFLSAWTQACASPTAVKIVIPAGTYQMGAVDVKGPCKAPIEVQVDGTIQAPANPTDLKAA  61

Query  332   KEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDK-LPNNLSLNFLTNSVIRDLT  508
              +W  ++Y++ FTLSG G  DGQG      +     K  K L  N   NFL NS++RD+T
Sbjct  62    HQWFVVQYVNSFTLSGKGVFDGQGATAWKQNDCTTNKNCKMLCMNFGFNFLNNSIVRDIT  121

Query  509   TLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISL  688
             + +SK FHVNVLG  N TFD F V AP +SPNTDGIHI R   + + ++ I TGDDC+SL
Sbjct  122   SKDSKNFHVNVLGCNNFTFDGFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSL  181

Query  689   GDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH  868
             GDG +N+ +  V CGPGHGISVGSLG+   E PV G  V N    GTDNGVRIKTWPN+ 
Sbjct  182   GDGCKNITVQNVNCGPGHGISVGSLGKYDSEEPVAGFLVKNCTLNGTDNGVRIKTWPNT-  240

Query  869   PGV--VTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATP  1042
             PG   +TD+HFE++ M NV NPI+IDQEYCP N+CSKQ PS +K+SK+S+K I GTS + 
Sbjct  241   PGAITITDMHFEDLTMNNVTNPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQ  300

Query  1043  VAVQLACSSGVPCEEVEIGDINLTIKGGAAKSICKNVKPKLTGK  1174
               V L CSSGVPCE VE+ DI+LT  G AA + C NVKP +TGK
Sbjct  301   EGVVLVCSSGVPCEAVEMADIDLTFNGSAATAKCANVKPTITGK  344



>gb|KCW88710.1| hypothetical protein EUGRSUZ_A01065 [Eucalyptus grandis]
Length=466

 Score =   387 bits (995),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 196/396 (49%), Positives = 259/396 (65%), Gaps = 15/396 (4%)
 Frame = +2

Query  35    LKMATISYCAFTFILFMLAHFGESATINVA-----AKANVDVGPALLKAWKEGCAATTAS  199
             ++M  IS       L   A    S   ++A        + D+  AL+ AWKE CAAT AS
Sbjct  64    VEMGKISILPAAIALLFFASTARSLVCDIAKYGAGGGTSSDITQALVSAWKEACAATEAS  123

Query  200   TVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNM--DGKKEWLTIKYIDHFTL  373
              V++P GT+ + +V L GPCK+ IE+++   L+AP +P  M  DG   W+  + +D  TL
Sbjct  124   KVLVPAGTYVLREVVLEGPCKSSIEVQVDGTLQAPADPAQMKTDG---WVAFRGVDLLTL  180

Query  374   SGGGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLG  547
             SG GT DGQG    +   +   K D   LP N+  + +TN +++D+T+L+SK FHVNVL 
Sbjct  181   SGSGTFDGQGKT-AWTKNDCNLKTDCVTLPINIRFDSVTNGMVKDITSLDSKQFHVNVLN  239

Query  548   GKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVT  727
              KNLTF H T+ APG+SPNTDGIHI R  GI + D+ I TGDDCIS+GDG E + ITGVT
Sbjct  240   CKNLTFQHVTITAPGDSPNTDGIHIGRSTGINIIDTGIKTGDDCISIGDGSEQMTITGVT  299

Query  728   CGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENID  907
             CGPGHGISVGSLG+ P E+PV G+ V N    GT NG+RIKTWP S  G  +D+HFE+I 
Sbjct  300   CGPGHGISVGSLGKYPNEQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDIT  359

Query  908   MQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEE  1087
             + NV NP++IDQ+YCP N+C  Q PS +K+S +S+ +I GTS+T  AV LACSS +PC E
Sbjct  360   LDNVGNPVIIDQQYCPWNQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTE  419

Query  1088  VEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPL  1189
             VEI DI++   G  G A S+C NVKP ++GK  P +
Sbjct  420   VEISDIDIAYHGPEGPATSVCSNVKPTISGKQNPAI  455



>ref|XP_002282594.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   385 bits (989),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 187/375 (50%), Positives = 247/375 (66%), Gaps = 8/375 (2%)
 Frame = +2

Query  74    ILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAG  253
             I+F +  +G           N D+  ALLKAW + C++  ASTV+IP GT+ + Q+ +AG
Sbjct  26    IIFDVTKYG------ARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAG  79

Query  254   PCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEK  433
             PCKAPI   +   + AP +      +  W+T + ID FTLSG G  DGQG +        
Sbjct  80    PCKAPINFVVQGTVMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKIVWGTKCLS  139

Query  434   GFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDG  613
                 ++LP NL  NF+TNS+++D+T+ +SK FH+N+LG KNLTF +  + AP  S NTDG
Sbjct  140   SAYCNQLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNIVISAPQESLNTDG  199

Query  614   IHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVK  793
             IHI R  GI + DS I TGDDC+S+GDG E + I  VTCGPGHGISVGSLG+ P E PV 
Sbjct  200   IHIGRSSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVV  259

Query  794   GIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSK  973
             GI V N     T NGVR+KTWP SH G  +++HFE+I M NV NPI+IDQEYCP+N+C+ 
Sbjct  260   GISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNL  319

Query  974   QKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICK  1147
             + PS +K+S +S++ I GT++T VAV+L CS GVPC +VE+GDINL   G  G A S CK
Sbjct  320   KSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGVPCHDVELGDINLEYNGNEGPAMSQCK  379

Query  1148  NVKPKLTGKVVPPLA  1192
             N+KP L G  +P + 
Sbjct  380   NIKPNLLGVQLPRIC  394



>ref|XP_009365184.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   385 bits (989),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 194/367 (53%), Positives = 247/367 (67%), Gaps = 9/367 (2%)
 Frame = +2

Query  116   NVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAIL  295
             N   KAN D+  AL KAW + CA+T+A  +V+P GT+        GPCKAPIE ++   L
Sbjct  34    NYGGKANSDITQALSKAWTDACASTSAGKIVVPSGTYKFVGATFKGPCKAPIEFQLQGTL  93

Query  296   KAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNL  466
             +AP +   +     W+  + ID  TLSGGGT DG G     Q   +K K  K   +  NL
Sbjct  94    QAPEDGSQLPKADTWIGFERIDGLTLSGGGTFDGLGATAWKQNDCNKNKNCK--SIAINL  151

Query  467   SLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITV  646
               NF+TNS+IRD+TT +SK FHVN+LG  N+ F HFTV AP  S NTDGIHI R  GI +
Sbjct  152   RFNFVTNSIIRDITTKDSKNFHVNLLGCNNVAFQHFTVSAPKESINTDGIHIGRSTGINI  211

Query  647   KDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIG  826
              D+ IGTGDDCIS+GDG + L +T VTCGPGHGIS+GSLG+   E PV GIF+ N     
Sbjct  212   TDTTIGTGDDCISIGDGTKQLHVTNVTCGPGHGISIGSLGKYENEEPVSGIFIKNCTISN  271

Query  827   TDNGVRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSK  1003
             TDNGVRIKTWP S   GVV+D+HFE+I M NVKNP++IDQEYCP+N+C+ Q PS VK+S 
Sbjct  272   TDNGVRIKTWPASPANGVVSDVHFEDIIMDNVKNPVIIDQEYCPHNQCTLQVPSKVKISN  331

Query  1004  ISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKV  1177
             +S+K I G+S+TPV ++L CS G+PCE VE+ +I+LT  G  G+  S CK++KP +   V
Sbjct  332   VSFKNIKGSSSTPVGIKLVCSGGLPCENVELSNIDLTYTGKEGSITSECKHIKPTID-NV  390

Query  1178  VPPLACG  1198
               PLAC 
Sbjct  391   AQPLACA  397



>ref|XP_011097041.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=401

 Score =   384 bits (987),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 193/363 (53%), Positives = 254/363 (70%), Gaps = 9/363 (2%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK+  D+  AL+ AWKE C +T+ ST+V+P+GT+ ++QV+L GP KAP+EL++   L+A 
Sbjct  34    AKSGGDISQALMDAWKEACNSTSPSTIVVPRGTWSLSQVKLLGPNKAPLELQVQGTLQAN  93

Query  305   PNPKNMDGKK-EWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKE--KGFKGDKLPNNLSLN  475
             PNP  +  K+ EW+TI Y+++FTLSGGG  DGQG  Q +   +  K     KLP NLS N
Sbjct  94    PNPGQLPNKEGEWITINYVNYFTLSGGGVFDGQGQ-QAWKQNDCHKNRNCAKLPMNLSFN  152

Query  476   FLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDS  655
             F+ NS+IRD+TT +SK FHVN +   N+TF  FTV APG+SPNTDGIH+ R   I +KDS
Sbjct  153   FVNNSIIRDVTTKDSKNFHVNCISSHNVTFLRFTVSAPGDSPNTDGIHLGRDTMINIKDS  212

Query  656   VIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDN  835
             +I TGDDC+S+GD  + + I  VTCGPGHGISVGSLG    E+ V+GI+V+N  FIGT N
Sbjct  213   IIKTGDDCVSIGDESKEIHIQNVTCGPGHGISVGSLGGYAEEKDVQGIYVTNCTFIGTTN  272

Query  836   GVRIKTWPNSHPGVVT--DIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKIS  1009
             GVR+KTWP S P  +T  D+HFE++ M NV +PI+IDQEYCP+N C K +PS +K++ +S
Sbjct  273   GVRVKTWP-SAPATLTVSDLHFEDLIMDNVSSPIIIDQEYCPHNLCKKDRPSSIKITNVS  331

Query  1010  YKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVP  1183
              K + GT+ T  AV   CS   PCE VE+GDI+LT  G  G   + C NVKPK  GK  P
Sbjct  332   IKNVRGTTNTAEAVTFICSGLKPCENVEVGDIDLTYNGNQGPITTKCANVKPKFVGKQNP  391

Query  1184  PLA  1192
             P+ 
Sbjct  392   PVC  394



>ref|XP_010112808.1| hypothetical protein L484_020040 [Morus notabilis]
 gb|EXC34923.1| hypothetical protein L484_020040 [Morus notabilis]
Length=394

 Score =   384 bits (985),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 182/356 (51%), Positives = 248/356 (70%), Gaps = 2/356 (1%)
 Frame = +2

Query  122   AAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKA  301
              A+ N+D+  AL  AWK+ CA+     V+IP+GT+ +++  L GPCK PI++++   L+A
Sbjct  34    GAQLNMDITQALSNAWKDACASPIRGKVLIPRGTYKLSRATLEGPCKVPIKVQLQGTLRA  93

Query  302   PPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFL  481
             P +P   +    W+T + +D  TL+GGGT DGQG+     + E+     KLP N   +F+
Sbjct  94    PTDPSGFNEGDGWVTFRNVDGLTLAGGGTFDGQGSAVWGKNCEQQQYCGKLPINFRFDFV  153

Query  482   TNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVI  661
             TNS+IRD+ +LNSK FH+NVLGG+N+TF    + AP +SPNTDGIHI R  GI++ D+VI
Sbjct  154   TNSLIRDIISLNSKQFHINVLGGQNVTFSRVKIIAPEDSPNTDGIHIGRSSGISITDTVI  213

Query  662   GTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGV  841
              TGDDC+SLGDG + + I  VTCGPGHGISVGSLG+   E PV+G+ V N     T NGV
Sbjct  214   QTGDDCVSLGDGCKEISIRRVTCGPGHGISVGSLGKYSNEDPVEGVIVRNCTIRNTSNGV  273

Query  842   RIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKI  1021
             R+KTWP+SH G+ +++HFE+I M+NV NP++IDQEYCP N+C+ + PS +K+S +S+K I
Sbjct  274   RVKTWPDSHDGLASNLHFEDIVMENVGNPVLIDQEYCPWNQCNAKVPSRIKISDVSFKNI  333

Query  1022  SGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVP  1183
              GTS T +AV L CSSG PC+ VEI DI+L   G  G   S CKNVKP ++GK  P
Sbjct  334   RGTSTTALAVNLVCSSGFPCQNVEIADIDLQYSGNDGPIMSQCKNVKPTISGKQNP  389



>ref|XP_008342227.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Malus domestica]
Length=400

 Score =   383 bits (984),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 196/389 (50%), Positives = 261/389 (67%), Gaps = 11/389 (3%)
 Frame = +2

Query  68    TFILFMLAHF--GESATINV---AAKAN--VDVGPALLKAWKEGCAATTASTVVIPKGTF  226
             TF LF++A F   ++A I++    AKA+   D   A+  AWKE C + T STVVI KG +
Sbjct  10    TFFLFLVALFIKAKAADIDIKKFGAKADGKTDDSQAINSAWKEACTSATPSTVVIAKGNY  69

Query  227   PMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGN  406
              +  V+  GPCKAP+ L++   L+AP  P+ +  +  W+  + ID  ++SGGGT DGQG+
Sbjct  70    MVGPVKFQGPCKAPVSLRVEGTLQAPAEPEKLKSQDGWVIFQNIDALSVSGGGTFDGQGS  129

Query  407   VQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVK  583
             +    +   K  K + LP +L L  LTN+ I+D+T+ NSKLFH+N+L  KN+T  H T+K
Sbjct  130   IAWSKNDCAKTGKCNSLPISLRLTGLTNAHIQDITSTNSKLFHMNILNCKNVTLQHVTIK  189

Query  584   APGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSL  763
             APG S NTDGIHI R   I +  + I TGDDC+S+GDG + + I  VTCGPGHGIS+GSL
Sbjct  190   APGESLNTDGIHIGRSTNINITGAEIQTGDDCVSIGDGSQQINIEKVTCGPGHGISIGSL  249

Query  764   GRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNV-KNPIVID  940
             GR   E+PV+G+ V N     T NGVR+KTWP S  GV +D+HFE+I M+NV  +P++ID
Sbjct  250   GRYHDEQPVRGVTVRNCTIKNTSNGVRVKTWPASPNGVASDLHFEDIIMENVTTSPVLID  309

Query  941   QEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIK  1120
             QEYCPN +C  + PS VK+S +S+K I GTSA PVAV+LACS G+PC+ VEI DINLT  
Sbjct  310   QEYCPNGQCQAKMPSRVKISNVSFKNIRGTSADPVAVKLACSKGIPCQNVEISDINLTCN  369

Query  1121  G--GAAKSICKNVKPKLTGKVVPPLACGK  1201
             G  G   S+C NV P +TGKV+PP    K
Sbjct  370   GKNGTCTSVCSNVNPTVTGKVIPPACSAK  398



>ref|XP_007049261.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOX93418.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=515

 Score =   387 bits (994),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 202/375 (54%), Positives = 256/375 (68%), Gaps = 11/375 (3%)
 Frame = +2

Query  98    GESATINVAAK------ANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPC  259
              +S  ++V AK         D+   LL AWKE CA+TT S +VIPKGT+ +++  L GPC
Sbjct  24    AQSTVVDVVAKYGAKADEKTDLSTPLLHAWKEACASTTPSKIVIPKGTYRLSRATLDGPC  83

Query  260   KAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGN-VQVYPSKEKG  436
             K+ IEL++   +KAP +P        W+   ++DH T+SGGG  DGQG  V    +  K 
Sbjct  84    KSAIELQVSGTIKAPADPSAFK-DPNWVVFNHVDHLTISGGGVFDGQGAAVWGKNNCAKN  142

Query  437   FKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGI  616
                  LP NL  NF++N++++ +TT +SK FHVNVLG KN TF HFTV AP NS NTDGI
Sbjct  143   KYCAALPINLRFNFVSNAIVQGITTKDSKQFHVNVLGCKNFTFQHFTVSAPENSINTDGI  202

Query  617   HIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKG  796
             HI R  GI + D+ I TGDDC+SLGDG +N+ +  VTCGPGHGISVGSLG+  GE PV G
Sbjct  203   HIGRSNGIKILDTNIKTGDDCVSLGDGSKNVIVERVTCGPGHGISVGSLGKFKGEEPVSG  262

Query  797   IFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQ  976
             IF+ N     T NGVR+KTWP+SHPG  TD+HFE+I + NV NPI+IDQEYCP N C+ +
Sbjct  263   IFIRNCTISNTMNGVRVKTWPDSHPGSATDMHFEDIILNNVGNPILIDQEYCPWNLCNLK  322

Query  977   KPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIK--GGAAKSICKN  1150
              PS VKLS IS+KKI GTS+T  AV+L CS G+PC+ VE+ DI++T K  GG A S C N
Sbjct  323   VPSRVKLSNISFKKIWGTSSTQQAVKLVCSRGLPCDRVELADIDITYKGPGGPAISQCIN  382

Query  1151  VKPKLTGKVVPPLAC  1195
             VKP+L+GK  PP AC
Sbjct  383   VKPRLSGKQNPP-AC  396



>ref|XP_011097079.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=401

 Score =   383 bits (984),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 192/363 (53%), Positives = 254/363 (70%), Gaps = 9/363 (2%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK+  D+  AL+ AWKE C +T+ ST+V+P+GT+ ++QV+L GP KAP+EL++   L+A 
Sbjct  34    AKSGGDISQALMDAWKEACNSTSPSTIVVPRGTWSLSQVKLLGPNKAPLELQVQGTLQAN  93

Query  305   PNPKNMDGKK-EWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKE--KGFKGDKLPNNLSLN  475
             PNP  +  K+ EW+TI Y+++FTLSGGG  DGQG  + +   +  K     KLP NLS N
Sbjct  94    PNPGQLPNKEGEWITINYVNYFTLSGGGVFDGQGQ-EAWKQNDCHKNRNCAKLPMNLSFN  152

Query  476   FLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDS  655
             F+ NS+IRD+TT +SK FHVN +   N+TF  FTV APG+SPNTDGIH+ R   I +KDS
Sbjct  153   FVNNSIIRDVTTKDSKNFHVNCISSHNVTFLRFTVSAPGDSPNTDGIHLGRDTMINIKDS  212

Query  656   VIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDN  835
             +I TGDDC+S+GD  + + I  VTCGPGHGISVGSLG    E+ V+GI+V+N  FIGT N
Sbjct  213   IIKTGDDCVSIGDESKEIHIQNVTCGPGHGISVGSLGGYAEEKDVQGIYVTNCTFIGTTN  272

Query  836   GVRIKTWPNSHPGVVT--DIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKIS  1009
             GVR+KTWP S P  +T  D+HFE++ M NV +PI+IDQEYCP+N C K +PS +K++ +S
Sbjct  273   GVRVKTWP-SAPATLTVSDLHFEDLIMDNVSSPIIIDQEYCPHNLCKKDRPSSIKITNVS  331

Query  1010  YKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVP  1183
              K + GT+ T  AV   CS   PCE VE+GDI+LT  G  G   + C NVKPK  GK  P
Sbjct  332   IKNVRGTTNTAEAVTFICSGLKPCENVEVGDIDLTYNGNQGPITTKCANVKPKFVGKQNP  391

Query  1184  PLA  1192
             P+ 
Sbjct  392   PVC  394



>ref|XP_009365185.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   383 bits (983),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 197/389 (51%), Positives = 255/389 (66%), Gaps = 14/389 (4%)
 Frame = +2

Query  65    FTFILFMLAHFGESATINVAA-----KANVDVGPALLKAWKEGCAATTASTVVIPKGTFP  229
             F F+L +     +S+  +V +     KAN D+     KAW + CA+T AS +V+P+GT+ 
Sbjct  12    FVFLLLVSTSNAKSSIYDVTSATYGGKANSDISRPFSKAWTDACASTLASKIVVPRGTYK  71

Query  230   MTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV  409
                    GPCKAPIE+++   L+AP +   +     W+  + ID  TLSGGGT DGQG  
Sbjct  72    FVGATFKGPCKAPIEIQLQGTLQAPVDGSKLSKADTWVGFERIDGLTLSGGGTFDGQGAT  131

Query  410   ---QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTV  580
                Q   +K K  K   +  NL  NF+TNS+IRD+TT +SK FHVNVLG  N+ F HFTV
Sbjct  132   AWKQNDCNKNKNCKSIAI--NLRFNFVTNSIIRDITTKDSKNFHVNVLGCNNVAFQHFTV  189

Query  581   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  760
              AP  S NTDGIHI R  GI + DS+IGTGDDCIS+GDG + L +T VTCGPGHGIS+GS
Sbjct  190   SAPKESMNTDGIHIGRSTGINITDSIIGTGDDCISIGDGTKQLHVTKVTCGPGHGISIGS  249

Query  761   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVI  937
             LGR   E PV GIF+ N     TDNGVRIKTWP S   GVV+D+HFE+I M NV NP++I
Sbjct  250   LGRYQNEEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIMDNVGNPVII  309

Query  938   DQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTI  1117
             DQEYCP N+C+ + PS VK+S +S+K I G+S++PV +++ CS G+PCE V++ DI+LT 
Sbjct  310   DQEYCPWNQCTLKVPSKVKISNVSFKNIKGSSSSPVGIKIVCSGGLPCENVQLSDIDLTY  369

Query  1118  KG--GAAKSICKNVKPKLTGKVVPPLACG  1198
              G  G   S CK+VKP +   V   LAC 
Sbjct  370   TGNKGPITSQCKHVKPTIN-NVARALACA  397



>ref|XP_002282573.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   382 bits (982),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 186/375 (50%), Positives = 246/375 (66%), Gaps = 8/375 (2%)
 Frame = +2

Query  74    ILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAG  253
             I+F +  +G           N D+  ALLKAW + C++  ASTV+IP GT+ + Q+ +AG
Sbjct  26    IIFDVTKYG------ARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAG  79

Query  254   PCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEK  433
             PCKAPI   +   + AP +      +  W+T + ID FTLSG G  DGQG          
Sbjct  80    PCKAPINFVVQGTVMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKTVWGTKCLS  139

Query  434   GFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDG  613
                 ++LP NL  NF+TNS+++D+T+ +SK FH+N+LG KNLTF +  + AP  S NTDG
Sbjct  140   SSYCNQLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNVVISAPQESLNTDG  199

Query  614   IHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVK  793
             IHI R  GI + DS I TGDDC+S+GDG E + I  VTCGPGHGISVGSLG+ P E PV 
Sbjct  200   IHIGRSSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVV  259

Query  794   GIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSK  973
             GI V N     T NGVR+KTWP SH G  +++HFE+I M NV NPI+IDQEYCP+N+C+ 
Sbjct  260   GISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNL  319

Query  974   QKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICK  1147
             + PS +K+S +S++ I GT++T VAV+L CS G PC++VE+GDINL   G  G A S CK
Sbjct  320   KSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGEPCQDVELGDINLEYNGNEGPAMSQCK  379

Query  1148  NVKPKLTGKVVPPLA  1192
             N+KP L G  +P + 
Sbjct  380   NIKPNLLGVQLPRIC  394



>ref|XP_010532220.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=436

 Score =   384 bits (985),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 191/355 (54%), Positives = 242/355 (68%), Gaps = 4/355 (1%)
 Frame = +2

Query  140   DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKN  319
             D+  A   AWK  C++ + S +VIP G++ + QV   GPCKAP+EL++  I+KAP +P +
Sbjct  75    DITKAFSIAWKAACSSPSLSQLVIPNGSYILRQVRFEGPCKAPLELQVHGIIKAPEDPSD  134

Query  320   MDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQ-VYPSKEKGFKGDKLPNNLSLNFLTNSVI  496
                K  W+T + IDHFTL G GT DGQG+    +    K  + +KLP N+  NF+TN ++
Sbjct  135   FIEKAGWITFQRIDHFTLVGNGTFDGQGSTAWSHNDCHKTGECNKLPINIRFNFITNGLV  194

Query  497   RDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDD  676
             +D+T+LNSKLFH+NVLG  NLTFD   +KAP +SPNTDGIHI R   I + DS + TGDD
Sbjct  195   QDITSLNSKLFHINVLGCTNLTFDRVKIKAPEDSPNTDGIHIGRSKNINIIDSEMSTGDD  254

Query  677   CISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTW  856
             CIS+G G EN+ I  V CGPGHGISVGSLGR   E PV GI V N  F  TDNGVR+KTW
Sbjct  255   CISMGRGSENITIERVKCGPGHGISVGSLGRYTKEEPVSGIIVRNCTFFNTDNGVRVKTW  314

Query  857   PNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSA  1036
              +S   + T +HF +I + NV NPIVIDQEYCP + C  +KPS VKLS IS+K I GTS+
Sbjct  315   LSSEKAIATGLHFHDITVVNVSNPIVIDQEYCPYDHCKAKKPSQVKLSNISFKNIHGTSS  374

Query  1037  TPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLAC  1195
             T +A++LACSSGVPCE VEI +I++   G  G + S C NV PK  GK  P  AC
Sbjct  375   TKMAMKLACSSGVPCENVEISNIDIKYIGSDGVSMSDCTNVSPKTFGKQYPS-AC  428



>ref|XP_010112811.1| hypothetical protein L484_020043 [Morus notabilis]
 gb|EXC34926.1| hypothetical protein L484_020043 [Morus notabilis]
Length=394

 Score =   382 bits (981),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 197/380 (52%), Positives = 250/380 (66%), Gaps = 7/380 (2%)
 Frame = +2

Query  74    ILFMLAHFGESATINV---AAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVE  244
             +L + A    +   +V    AK N D   ALL  WKE CA+ T S +V+PKG F +TQ  
Sbjct  12    LLVLFASHANAQVFDVTANGAKPNADSTQALLTTWKEACASATRSKIVVPKGVFKVTQAL  71

Query  245   LAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQG-NVQVYP  421
               GPCKAPIE  +   L+APP      G   W+  +++D  T+SG G  DGQG +     
Sbjct  72    FQGPCKAPIEFNLQGTLQAPPVGGGFKGGDTWIGFEHVDFLTVSGNGVFDGQGKSAWGKK  131

Query  422   SKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  601
                  + G +LP NL  +F+TNS+++D+TTL+SK FHVNVLG KN+TF +F V AP NS 
Sbjct  132   CDHTEYCGKQLPINLRFDFVTNSLVQDVTTLDSKQFHVNVLGCKNVTFHNFHVIAPENSV  191

Query  602   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  781
             NTDGIHI R   I + +S+I TGDDC+S+GDG + + +T VTCGPGHG  +GSLG+   E
Sbjct  192   NTDGIHIGRSTDIKILNSIIQTGDDCVSIGDGSKQIYLTQVTCGPGHGFGIGSLGKYLNE  251

Query  782   RPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNN  961
              PV+GIFV+      T NGVRIKTWPNS+PG  +DIHF +I M+NV NP++IDQEYCP N
Sbjct  252   LPVQGIFVTGCTLKNTLNGVRIKTWPNSYPGTASDIHFADITMENVGNPVLIDQEYCPWN  311

Query  962   ECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAK  1135
             +C+ + PS VKLS IS+KKI GTS+TP+AV L CSSG PC+ V I DINL   G  G   
Sbjct  312   QCNLKVPSKVKLSNISFKKIHGTSSTPLAVNLVCSSGAPCQNVVIQDINLKYSGSQGPIT  371

Query  1136  SICKNVKPKLTGKVVPPLAC  1195
             S CKNVKP + G V  P AC
Sbjct  372   SKCKNVKPTV-GGVQNPAAC  390



>gb|KHN10402.1| Polygalacturonase, partial [Glycine soja]
Length=350

 Score =   380 bits (977),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 185/344 (54%), Positives = 235/344 (68%), Gaps = 4/344 (1%)
 Frame = +2

Query  152   ALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGK  331
             A L AW + CA+ TA  +VIP GT+ M  V++ GPCKAPIE+++   ++AP NP ++   
Sbjct  2     AFLSAWTQACASPTAVKIVIPAGTYQMGAVDVKGPCKAPIEVQVDGTIQAPANPTDLKAA  61

Query  332   KEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDK-LPNNLSLNFLTNSVIRDLT  508
              +W  ++Y++ FTLSG G  DGQG      +     K  K L  N   NFL NS++RD+T
Sbjct  62    HQWFVVQYVNSFTLSGKGVFDGQGATAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDIT  121

Query  509   TLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISL  688
             + +SK FHVNVLG  N TFD F V AP +SPNTDGIHI R   + + ++ I TGDDC+SL
Sbjct  122   SKDSKNFHVNVLGCNNFTFDGFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSL  181

Query  689   GDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH  868
             GDG +N+ +  V CGPGHGISVGSLG+   E PV G  V N     TDNGVRIKTWPN+ 
Sbjct  182   GDGCKNITVQNVNCGPGHGISVGSLGKYDSEEPVAGFLVKNCTLNETDNGVRIKTWPNT-  240

Query  869   PGV--VTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATP  1042
             PG   +TD+HFE++ M NV NPI+IDQEYCP N+CSKQ PS +K+SK+S+K I GTS + 
Sbjct  241   PGAITITDMHFEDLTMNNVMNPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQ  300

Query  1043  VAVQLACSSGVPCEEVEIGDINLTIKGGAAKSICKNVKPKLTGK  1174
               V L CSSGVPCE VE+ DI+LT  G AA + C NVKP +TGK
Sbjct  301   EGVVLVCSSGVPCEAVEMADIDLTFNGSAATAKCANVKPTITGK  344



>emb|CBI22050.3| unnamed protein product [Vitis vinifera]
Length=414

 Score =   380 bits (977),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 185/368 (50%), Positives = 243/368 (66%), Gaps = 8/368 (2%)
 Frame = +2

Query  74    ILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAG  253
             I+F +  +G           N D+  ALLKAW + C++  ASTV+IP GT+ + Q+ +AG
Sbjct  26    IIFDVTKYG------ARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAG  79

Query  254   PCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEK  433
             PCKAPI   +   + AP +      +  W+T + ID FTLSG G  DGQG          
Sbjct  80    PCKAPINFVVQGTVMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKTVWGTKCLS  139

Query  434   GFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDG  613
                 ++LP NL  NF+TNS+++D+T+ +SK FH+N+LG KNLTF +  + AP  S NTDG
Sbjct  140   SSYCNQLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNVVISAPQESLNTDG  199

Query  614   IHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVK  793
             IHI R  GI + DS I TGDDC+S+GDG E + I  VTCGPGHGISVGSLG+ P E PV 
Sbjct  200   IHIGRSSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVV  259

Query  794   GIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSK  973
             GI V N     T NGVR+KTWP SH G  +++HFE+I M NV NPI+IDQEYCP+N+C+ 
Sbjct  260   GISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNL  319

Query  974   QKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICK  1147
             + PS +K+S +S++ I GT++T VAV+L CS G PC++VE+GDINL   G  G A S CK
Sbjct  320   KSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGEPCQDVELGDINLEYNGNEGPAMSQCK  379

Query  1148  NVKPKLTG  1171
             N+KP L G
Sbjct  380   NIKPNLLG  387



>ref|XP_004488391.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=391

 Score =   379 bits (973),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 194/375 (52%), Positives = 249/375 (66%), Gaps = 13/375 (3%)
 Frame = +2

Query  77    LFMLAHFGESATINV-----AAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQV  241
                LA  G   ++++         N D+  A + AW E CA+TTA  +VIP GT+ M +V
Sbjct  11    FLFLADLGAVQSLDLDISKFGGAPNADITQAFISAWNEACASTTAVKIVIPAGTYNMREV  70

Query  242   ELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV---Q  412
             ++ GPCKAPIE+++   +KAP NP  + G  +W+ I Y +  TLSG G  DGQG     Q
Sbjct  71    DVKGPCKAPIEIQVDGTIKAPANPDELKGADQWVKIGYTNFLTLSGKGVFDGQGAAAWKQ  130

Query  413   VYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPG  592
                S  K  K   L  N   NFL NS++RD+T+ +SK FHVNVLG  N TFD FTV AP 
Sbjct  131   NDCSTNKNCK--MLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNFTFDGFTVTAPA  188

Query  593   NSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRT  772
              S NTDGIHI R   + V ++ IGTGDDC+SLGDG + + +  V CGPGHGISVGSLG+ 
Sbjct  189   TSLNTDGIHIGRSTDVKVLNTNIGTGDDCVSLGDGDKQITVQNVHCGPGHGISVGSLGKY  248

Query  773   PGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPG--VVTDIHFENIDMQNVKNPIVIDQE  946
               E PV+G+ + N     TDNGVRIKTWP++ PG   VTD++FE+I M NV+NPI+IDQE
Sbjct  249   TTESPVEGVLIKNCTLTETDNGVRIKTWPDA-PGTITVTDMNFEDITMVNVRNPIIIDQE  307

Query  947   YCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKGG  1126
             YCP N+CSK+ PS +K+SK+S+K I GTSATP  V L CSSGVPC+ VE+ +I+LT  G 
Sbjct  308   YCPWNQCSKKNPSKIKISKVSFKNIKGTSATPEGVLLICSSGVPCDGVELNNIDLTFNGA  367

Query  1127  AAKSICKNVKPKLTG  1171
              AK+ C NVKP +TG
Sbjct  368   PAKANCSNVKPIITG  382



>ref|XP_002274125.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   379 bits (973),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 188/376 (50%), Positives = 250/376 (66%), Gaps = 10/376 (3%)
 Frame = +2

Query  74    ILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAG  253
             I+F +  +G        A  + D+  ALLKAW + C++  ASTV+IP GT+ + Q+ + G
Sbjct  26    IIFDVTKYG------ARADGHSDISQALLKAWGDSCSSPVASTVMIPNGTYALGQITIGG  79

Query  254   PCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEK  433
             PCKAPI   +   + AP +      +  W+  + ID FTLSGGG  DGQG   V+  K  
Sbjct  80    PCKAPINFVVQGTVMAPVDTSRFKAEAGWIAFQQIDQFTLSGGGVFDGQGKT-VWGRKCP  138

Query  434   GFKGDK-LPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTD  610
              +   K LP NL  NF+TNS+++D+T+ +SK FH+N+LG KNL F +  + AP  S NTD
Sbjct  139   HYAYCKQLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLAFYNVAISAPDESLNTD  198

Query  611   GIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPV  790
             GIHI R  GI + DS I TGDDC+S+GDG E + I  VTCGPGHGISVGSLG+ P E PV
Sbjct  199   GIHIGRSSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPV  258

Query  791   KGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECS  970
              GI V N     T NGVR+KT+P SH G+ +++HFE+I M NV NPI+IDQEYCP+N+C+
Sbjct  259   VGISVKNCTLTNTQNGVRVKTFPASHQGIASEMHFEDIVMNNVGNPIIIDQEYCPHNQCN  318

Query  971   KQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSIC  1144
              + PS +KLS +S++ I GT++T VAV+L CS GVPC++VE+GDINL   G  G A S C
Sbjct  319   LKSPSRIKLSNVSFRNIRGTTSTQVAVKLLCSQGVPCQDVELGDINLKYNGKEGPAMSQC  378

Query  1145  KNVKPKLTGKVVPPLA  1192
             KN+KP L G  +P + 
Sbjct  379   KNIKPNLLGVQLPRIC  394



>emb|CDP04350.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   379 bits (973),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 195/358 (54%), Positives = 246/358 (69%), Gaps = 7/358 (2%)
 Frame = +2

Query  140   DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKN  319
             D+  ALL AWK  C +   ST+VIP+GTF + Q  L GPCKAPIEL++   LKAP NP N
Sbjct  41    DISQALLSAWKAACNSPKPSTIVIPRGTFGLLQATLEGPCKAPIELQVQGTLKAPQNP-N  99

Query  320   MDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTNSV  493
             +    EW+TI+Y+DHFTLSG GT DGQG  + +   +     D  KLPNN S NFL NS+
Sbjct  100   LIKDGEWVTIQYLDHFTLSGSGTFDGQG-ARAWAQNDCAKASDCSKLPNNFSFNFLNNSI  158

Query  494   IRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGD  673
             I  + +LNSKLFH+N+LG  N+T    T+ APG S NTDGIH+ R  G+ + DS IGTGD
Sbjct  159   ISGIASLNSKLFHMNILGCNNVTLSRLTITAPGTSLNTDGIHVGRSSGVNITDSTIGTGD  218

Query  674   DCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKT  853
             DC+SLGDG + + IT V CGPGHGIS+GSLGR   E PV G+FV N   I T  GVR+K+
Sbjct  219   DCVSLGDGSKQVSITNVVCGPGHGISIGSLGRYKNEEPVVGVFVRNCTLINTLTGVRVKS  278

Query  854   WPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTS  1033
             WP++  G  TD+HF++I M+NV +PIVIDQEYCPNN+C+   PS VK+SK+S+  I GTS
Sbjct  279   WPSATTGAATDVHFDDITMRNVTSPIVIDQEYCPNNQCTLGAPSRVKISKVSFNNIRGTS  338

Query  1034  ATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLACGK  1201
             A+ +AV+L CS   PCE VEIGDI+L   G  G   + C NV+P   G+  PP+ C K
Sbjct  339   ASALAVKLVCSKTFPCEGVEIGDIDLAYHGSLGNITTNCANVQPTFMGRQNPPI-CAK  395



>gb|KCW46858.1| hypothetical protein EUGRSUZ_K00662, partial [Eucalyptus grandis]
Length=395

 Score =   378 bits (971),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 188/359 (52%), Positives = 249/359 (69%), Gaps = 9/359 (3%)
 Frame = +2

Query  140   DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKN  319
             D+  +LL AWK+ CA+TT + V I  GTF +++V L GPCKA +E +I   L+AP +P  
Sbjct  40    DITQSLLGAWKKACASTTRAKVFIAGGTFALSEVVLEGPCKAHVEFEIRGRLQAPADPSR  99

Query  320   M--DGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNS  490
                DG   W+  + ID  T+SGGGT DGQG +    +  +K      LP NL  NF++N+
Sbjct  100   FKTDG---WVVFQRIDGLTVSGGGTFDGQGKIAWGQNDCDKNTNCRTLPTNLRFNFVSNA  156

Query  491   VIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  670
             +I ++TTL+SK FHVNVLG KNLTF++F V APG+S NTDGIHI R +G+ + D+ I TG
Sbjct  157   IIHNVTTLDSKNFHVNVLGAKNLTFENFHVNAPGDSVNTDGIHIGRSLGVNILDTNIKTG  216

Query  671   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  850
             DDC+SLGDG   + + GVTCGPGHGISVGSLG+   E PV G+FV+N    G  NG RIK
Sbjct  217   DDCVSLGDGSRQITVRGVTCGPGHGISVGSLGKYDNEEPVSGVFVTNCTITGATNGARIK  276

Query  851   TWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGT  1030
             TW  S  G+ TD+HF+++ M +V NP++IDQ YCP N+C  Q PSLVK+S +S+++I GT
Sbjct  277   TWLASKIGIATDMHFQDVQMNDVANPVLIDQGYCPFNQCQAQIPSLVKISNVSFERIRGT  336

Query  1031  SATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLACGK  1201
             S+T VAV++ACS  +PCE VEI DINL  KG  G A S C NV+P ++G +  PLAC +
Sbjct  337   SSTKVAVKIACSKRIPCEGVEIADINLVYKGPDGPATSECSNVRPLISG-MQNPLACAE  394



>ref|XP_003544118.1| PREDICTED: polygalacturonase-like isoform X1 [Glycine max]
Length=392

 Score =   378 bits (970),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 190/380 (50%), Positives = 250/380 (66%), Gaps = 8/380 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAA-KANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVEL  247
             F+L  ++   +S  IN+       D+  AL KAW+E CAAT+AS +VIP G++ M  V+L
Sbjct  14    FLLLAISSTTQSVDINIKKFGGGADITQALTKAWEEACAATSASKIVIPGGSYKMEAVDL  73

Query  248   AGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK  427
              GPC APIE++    L+AP +P  +DG  EWL +++++ FTLSG G  DGQG    +   
Sbjct  74    KGPCMAPIEIQFDGTLQAPADPNALDGADEWLKVQHVNFFTLSGKGVFDGQG-ATAWKQN  132

Query  428   EKGFKGD--KLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  601
             + G   +  K   N   NFL NS++RD+T+ +SK FHVNVLG  N TFD F V AP  S 
Sbjct  133   DCGTNKNCKKRSKNFGFNFLNNSMVRDITSKDSKNFHVNVLGCNNFTFDGFHVSAPNTSI  192

Query  602   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  781
             NTDGIHI R   + + ++ I TGDDC+SLGDG + + +  V CGPGHGISVGSLG+ P E
Sbjct  193   NTDGIHIGRSTDVKILNTNIATGDDCVSLGDGSKKITVQNVNCGPGHGISVGSLGKYPEE  252

Query  782   RPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHFENIDMQNVKNPIVIDQEYCP  955
              PV+ + V N     TDNGVRIKTWP+S PG   +TD+HFE+I M +V NP++IDQEYCP
Sbjct  253   EPVEQLLVKNCTLTNTDNGVRIKTWPSS-PGASPITDMHFEDITMVDVMNPVIIDQEYCP  311

Query  956   NNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKGGAAK  1135
              N+CSKQ PS +K+SK+++K I GTS T   V L CS GVPCE+VE+ ++ LT  G    
Sbjct  312   WNQCSKQAPSKIKISKVTFKNIQGTSKTKEGVTLICSKGVPCEDVELNNVALTFNGAPIV  371

Query  1136  SICKNVKPKLTGKVVPPLAC  1195
             + C NVKP +TGK  P   C
Sbjct  372   AKCANVKPIVTGK-APACTC  390



>gb|KHN46909.1| Polygalacturonase [Glycine soja]
Length=390

 Score =   377 bits (969),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 190/380 (50%), Positives = 250/380 (66%), Gaps = 8/380 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAA-KANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVEL  247
             F+L  ++   +S  IN+       D+  AL KAW+E CAAT+AS +VIP G++ M  V+L
Sbjct  12    FLLLAISSTTQSVDINIKKFGGGADITQALTKAWEEACAATSASKIVIPGGSYKMEAVDL  71

Query  248   AGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK  427
              GPC APIE++    L+AP +P  +DG  EWL +++++ FTLSG G  DGQG    +   
Sbjct  72    KGPCMAPIEIQFDGTLQAPADPNALDGADEWLKVQHVNFFTLSGKGVFDGQG-ATAWKQN  130

Query  428   EKGFKGD--KLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  601
             + G   +  K   N   NFL NS++RD+T+ +SK FHVNVLG  N TFD F V AP  S 
Sbjct  131   DCGTNKNCKKRSKNFGFNFLNNSMVRDITSKDSKNFHVNVLGCNNFTFDGFHVSAPNTSI  190

Query  602   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  781
             NTDGIHI R   + + ++ I TGDDC+SLGDG + + +  V CGPGHGISVGSLG+ P E
Sbjct  191   NTDGIHIGRSTDVKILNTNIATGDDCVSLGDGSKKITVQNVNCGPGHGISVGSLGKYPEE  250

Query  782   RPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHFENIDMQNVKNPIVIDQEYCP  955
              PV+ + V N     TDNGVRIKTWP+S PG   +TD+HFE+I M +V NP++IDQEYCP
Sbjct  251   EPVEQLLVKNCTLTNTDNGVRIKTWPSS-PGASPITDMHFEDITMVDVMNPVIIDQEYCP  309

Query  956   NNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKGGAAK  1135
              N+CSKQ PS +K+SK+++K I GTS T   V L CS GVPCE+VE+ ++ LT  G    
Sbjct  310   WNQCSKQAPSKIKISKVTFKNIQGTSKTKEGVTLICSKGVPCEDVELNNVALTFNGAPIV  369

Query  1136  SICKNVKPKLTGKVVPPLAC  1195
             + C NVKP +TGK  P   C
Sbjct  370   AKCANVKPIVTGK-APACTC  388



>emb|CBI28390.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   379 bits (974),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 187/370 (51%), Positives = 248/370 (67%), Gaps = 10/370 (3%)
 Frame = +2

Query  74    ILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAG  253
             I+F +  +G        A  + D+  ALLKAW + C++  ASTV+IP GT+ + Q+ + G
Sbjct  26    IIFDVTKYG------ARADGHSDISQALLKAWGDSCSSPVASTVMIPNGTYALGQITIGG  79

Query  254   PCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEK  433
             PCKAPI   +   + AP +      +  W+  + ID FTLSGGG  DGQG   V+  K  
Sbjct  80    PCKAPINFVVQGTVMAPVDTSRFKAEAGWIAFQQIDQFTLSGGGVFDGQGKT-VWGRKCP  138

Query  434   GFKGDK-LPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTD  610
              +   K LP NL  NF+TNS+++D+T+ +SK FH+N+LG KNL F +  + AP  S NTD
Sbjct  139   HYAYCKQLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLAFYNVAISAPDESLNTD  198

Query  611   GIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPV  790
             GIHI R  GI + DS I TGDDC+S+GDG E + I  VTCGPGHGISVGSLG+ P E PV
Sbjct  199   GIHIGRSSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPV  258

Query  791   KGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECS  970
              GI V N     T NGVR+KT+P SH G+ +++HFE+I M NV NPI+IDQEYCP+N+C+
Sbjct  259   VGISVKNCTLTNTQNGVRVKTFPASHQGIASEMHFEDIVMNNVGNPIIIDQEYCPHNQCN  318

Query  971   KQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSIC  1144
              + PS +KLS +S++ I GT++T VAV+L CS GVPC++VE+GDINL   G  G A S C
Sbjct  319   LKSPSRIKLSNVSFRNIRGTTSTQVAVKLLCSQGVPCQDVELGDINLKYNGKEGPAMSQC  378

Query  1145  KNVKPKLTGK  1174
             KN+KP L G+
Sbjct  379   KNIKPNLLGQ  388



>ref|XP_009365186.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   377 bits (969),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/389 (50%), Positives = 252/389 (65%), Gaps = 14/389 (4%)
 Frame = +2

Query  65    FTFILFMLAHFGESATINVAA-----KANVDVGPALLKAWKEGCAATTASTVVIPKGTFP  229
             F F+L +     +S+  +V +     KAN D+  A  KAW + CA+T AS +V+P+GT+ 
Sbjct  12    FVFLLLVSTSNAKSSIYDVTSATYGGKANSDISQAFSKAWTDACASTLASKIVVPRGTYK  71

Query  230   MTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV  409
                    GPCKAPIE+++   L+AP +   +     W+  + ID  TLSGGGT DGQG  
Sbjct  72    FVGATFKGPCKAPIEIQLQGTLQAPVDGSKLSKADTWVGFERIDGLTLSGGGTFDGQGAT  131

Query  410   ---QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTV  580
                Q   +K K  K   +  NL  NF+TNS+IRD+TT +SK FHVNVLG  N+ F  FTV
Sbjct  132   AWKQNDCNKNKNCK--SIAINLRFNFVTNSIIRDITTKDSKNFHVNVLGCNNVAFQRFTV  189

Query  581   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  760
              AP  S NTDGIHI R  GI + DS+IGTGDDCIS+GDG + L +T VTCGPGHGIS+GS
Sbjct  190   SAPKESMNTDGIHIGRSTGINITDSIIGTGDDCISIGDGTKQLHVTKVTCGPGHGISIGS  249

Query  761   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVI  937
             LGR   E PV GIF+ N     TDNGVRIKTWP S   GVV+D+HFE+I M NV NP++I
Sbjct  250   LGRYQNEEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIMDNVGNPVII  309

Query  938   DQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTI  1117
             DQEYCP N+C+ + PS VK+S +S+K I G+S   V +++ CS G+PCE V++ DI+LT 
Sbjct  310   DQEYCPWNQCTLKVPSKVKISNVSFKNIKGSSVGIVGIKIVCSGGLPCENVQLSDIDLTY  369

Query  1118  KG--GAAKSICKNVKPKLTGKVVPPLACG  1198
              G  G   S CK+VKP +   V   LAC 
Sbjct  370   TGNKGPITSQCKHVKPTIN-NVARALACA  397



>ref|XP_008455553.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=403

 Score =   377 bits (969),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/408 (48%), Positives = 263/408 (64%), Gaps = 24/408 (6%)
 Frame = +2

Query  41    MATISYCAFTFILFMLAHFGESATINVAAKANV--------------DVGPALLKAWKEG  178
             M+ I Y +   I F++A    S T+   +  +V              DV  AL  AW + 
Sbjct  1     MSVIKYSSLLVITFLMALL--SFTVESRSHVDVIFHLRKYGNIVSGADVTEALKDAWNDA  58

Query  179   CAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYI  358
             CA+   S VVIPKGTF + + E  GPCK+P+E+++   L+AP +P        W+T  Y+
Sbjct  59    CASLRPSAVVIPKGTFKVREGEFKGPCKSPVEVRVRGTLQAPKHPHG----DSWITFAYV  114

Query  359   DHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHV  535
             D  TLSGGG  DGQG      +   K     +LP +L  NF+TNS++R +T+L+SK FHV
Sbjct  115   DRMTLSGGGVFDGQGKAGWEKNDCHKHISCARLPISLRFNFITNSIVRRITSLDSKNFHV  174

Query  536   NVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKI  715
             N+LG  NLTFD   + AP +SPNTDGIHI R IGI++  S I TGDDCISLGDG + +KI
Sbjct  175   NILGCNNLTFDGVNIIAPEDSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRVKI  234

Query  716   TGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIH  892
             T VTCGPGHGIS+GSLG+   E PV+G+ V N   + T NGVRIKTWP S   G+ T++H
Sbjct  235   TNVTCGPGHGISIGSLGKYTNEEPVEGVIVKNCTIMNTTNGVRIKTWPASPVAGIATNMH  294

Query  893   FENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSG  1072
             F +I M NV NPI+IDQEYCP N+C+++ PS +K++K+S+K I G+SATPVAV+L CSS 
Sbjct  295   FLDITMVNVSNPILIDQEYCPWNQCNRKIPSKIKINKVSFKNIRGSSATPVAVKLICSSN  354

Query  1073  VPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLACGK*TT  1210
             +PCEEV++ +I+L   G  G+  S C NVKP ++G   PP+     TT
Sbjct  355   LPCEEVKVANIDLVYNGIKGSLTSECMNVKPIISGTQNPPICSSSYTT  402



>ref|XP_008229848.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=399

 Score =   377 bits (968),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 197/363 (54%), Positives = 242/363 (67%), Gaps = 9/363 (2%)
 Frame = +2

Query  128   KANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPP  307
             K N D+  AL KAW + CA+T+ ST+V+PKGTF        GPCKAPI  ++  IL+AP 
Sbjct  37    KPNSDITQALSKAWTDACASTSPSTLVVPKGTFKFLGTTFKGPCKAPIAFQLQGILQAPV  96

Query  308   NPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNLSLNF  478
             +   +  K  W++  +ID  T+SGGGT DGQG +   Q    K K  K   +  NL  NF
Sbjct  97    DGNQLPKKDTWISFDHIDRLTISGGGTFDGQGAIAWKQNDCHKNKNCKSIAI--NLRFNF  154

Query  479   LTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSV  658
             +TNS I  +TT +SK FHVNVLG  N+ F HFTV AP  S NTDGIHI R  GI++ DS 
Sbjct  155   ITNSRIEYITTKDSKNFHVNVLGCTNVAFHHFTVSAPKESINTDGIHIGRSTGISIIDST  214

Query  659   IGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNG  838
             I TGDDCIS+GDG +NL +T VTCGPGHGIS+GSLGR   E PV GI + N     T NG
Sbjct  215   IKTGDDCISIGDGTKNLNVTNVTCGPGHGISIGSLGRYQKEEPVSGITIKNCTLTDTQNG  274

Query  839   VRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYK  1015
             VRIKTWP S   G  +DIHFE+I M NV NPI+IDQEYCP N+C+ + PS VK+S +S+K
Sbjct  275   VRIKTWPASPSAGTASDIHFEDIIMVNVGNPILIDQEYCPWNQCTLKVPSKVKISNVSFK  334

Query  1016  KISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPL  1189
              I GTS TP+A++L CS G+PCE VE+ DI+L   G  G   S C NVKPK+T +V  PL
Sbjct  335   NIKGTSTTPLALKLVCSKGLPCENVELSDIDLKYTGNQGPLTSKCTNVKPKIT-RVTKPL  393

Query  1190  ACG  1198
             AC 
Sbjct  394   ACA  396



>ref|XP_003527123.1| PREDICTED: polygalacturonase-like [Glycine max]
 gb|KHN05204.1| Polygalacturonase [Glycine soja]
Length=389

 Score =   377 bits (967),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 190/382 (50%), Positives = 248/382 (65%), Gaps = 3/382 (1%)
 Frame = +2

Query  35    LKMATISYCAFTFILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIP  214
               + TI +  F  + F  A  G+        K N D+  A L AW + CA+TTA  +VIP
Sbjct  3     FTIITIFFSLF-LVDFGFAQQGDLDISRFGGKPNSDISQAFLSAWTQACASTTAVKIVIP  61

Query  215   KGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLD  394
              GT+ M  V++ GPCKAPIE+++   ++AP N  N+ G  +WL +++++ FTLSG G  D
Sbjct  62    AGTYQMGAVDVKGPCKAPIEVQVDGTIQAPTNVVNLKGADQWLKVQHVNSFTLSGKGVFD  121

Query  395   GQGNVQVYPSKEKGFKGDK-LPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDH  571
             GQG      +     K  K L  N   NFL NS++RDLT+ +SK FHVNVLG  N+TFD 
Sbjct  122   GQGPTAWKQNDCTTNKNCKMLCMNFGFNFLNNSIVRDLTSKDSKNFHVNVLGCNNMTFDG  181

Query  572   FTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGIS  751
             F + AP  SPNTDGIHI R   + V ++ I TGDDCISLGDG +N+ +  V CGPGHGIS
Sbjct  182   FKISAPAESPNTDGIHIGRSTDVKVLNTNIATGDDCISLGDGNKNITVQNVNCGPGHGIS  241

Query  752   VGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHFENIDMQNVKNP  928
             VGSLGR   E  V+G+ V N     TDNG+RIKTWP++   + VTD+HFE+I M+NV NP
Sbjct  242   VGSLGRYDNEEAVEGLLVKNCTLNNTDNGLRIKTWPSTPLTITVTDMHFEDITMENVSNP  301

Query  929   IVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDIN  1108
             ++IDQEYCP N+CSK+ PS +K+SK+S+K I GTS T   V   CSS  PCE VE+ D++
Sbjct  302   VIIDQEYCPWNQCSKKNPSKIKISKVSFKNIKGTSGTKEGVIFICSSVAPCEGVEMTDVD  361

Query  1109  LTIKGGAAKSICKNVKPKLTGK  1174
             LT  G A  + C NVKP +TGK
Sbjct  362   LTFNGAATTAKCANVKPVITGK  383



>ref|XP_008441641.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=404

 Score =   377 bits (967),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 199/386 (52%), Positives = 266/386 (69%), Gaps = 31/386 (8%)
 Frame = +2

Query  77    LFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGP  256
             +F +  FG        AK + D+  AL+ AWKEGCA+ T S V+IPKG++ ++Q  L GP
Sbjct  29    VFDVTSFG--------AKPDADITGALVSAWKEGCASITPSKVLIPKGSYGLSQSNLKGP  80

Query  257   CKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKG  436
             CK+ IEL+I   L+AP +PK  DG    L ++Y+D  T+SG G LDGQG       KE  
Sbjct  81    CKSSIELQIEGTLQAPSDPKG-DG---LLILEYVDRLTVSGMGVLDGQG-------KEGW  129

Query  437   FKGD--------KLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPG  592
              K D        KLP NL LNF+TNS+++D+T+L+SK +H+N+LG KNLTFDH T+ APG
Sbjct  130   EKNDCHLKKICTKLPMNLKLNFITNSIVKDITSLDSKNYHINLLGCKNLTFDHVTITAPG  189

Query  593   NSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRT  772
             +SPNTDGIH++    I + ++ I TGDDCIS+GD  + + I+ VTCGPGHGIS+GSLG+ 
Sbjct  190   DSPNTDGIHVSSSEEINILNTNIATGDDCISVGDTNKQIVISDVTCGPGHGISIGSLGKY  249

Query  773   PGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHFENIDMQNVKNPIVIDQEY  949
               E+ V G+ V   K   T NGVRIKTWP+S      +D+HFE+I+M NV NP++IDQEY
Sbjct  250   SKEKEVVGVTVKKCKLTSTTNGVRIKTWPDSVGTFPASDMHFEDIEMVNVSNPVIIDQEY  309

Query  950   CPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--  1123
             CP N+C+++ PS +K+SK+S+K I GTSATPVAV++ CS   PCEEVE+ DI+LT  G  
Sbjct  310   CPWNQCNRKVPSKIKISKVSFKNIRGTSATPVAVKIVCSKSNPCEEVEVADIDLTYSGSE  369

Query  1124  GAAKSICKNVKPKLTGKVVPPLACGK  1201
             G  KS C NVKP ++GK  PP+ CG+
Sbjct  370   GPIKSQCANVKPVISGKQNPPI-CGE  394



>gb|AFK41055.1| unknown [Lotus japonicus]
Length=394

 Score =   376 bits (965),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 189/383 (49%), Positives = 251/383 (66%), Gaps = 5/383 (1%)
 Frame = +2

Query  35    LKMATISYCAFTFILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIP  214
             L +A I++ +F +  F  A              N D+  A   AWK+ C +TT++ +VIP
Sbjct  5     LNIAIIAFVSFLY-GFSTAQSWVLEISKFGGAPNADITQAFTNAWKKACESTTSAKIVIP  63

Query  215   KGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLD  394
              GT+ M  V++ GPCKA IE+++   +KAP NP+N  G   W+   YI  FTLSG G  D
Sbjct  64    HGTYKMGAVQVQGPCKAHIEVQVDGTIKAPVNPRNFKGAGTWVQFSYISFFTLSGKGVFD  123

Query  395   GQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDH  571
             G G      +   K      LP N + N++ NS++RD+T+ +SK F+VNVLG  N TFD 
Sbjct  124   GVGETAWKRNDCSKNKHCTLLPMNFAFNYVNNSIVRDITSKDSKSFNVNVLGCNNFTFDG  183

Query  572   FTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGIS  751
             F + A   SPNTDGIH+ R   + + ++ IGTGDDC+SLGDG++N+ +  V CGPGHG+S
Sbjct  184   FKIVALALSPNTDGIHVGRSTDVKILNTNIGTGDDCVSLGDGIKNVLVRNVNCGPGHGVS  243

Query  752   VGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHFENIDMQNVKN  925
             VGSLG+ P E+PV+G +V N     TDNGVRIKTWP S PG   +TD+HFE+I M NVKN
Sbjct  244   VGSLGKYPDEKPVEGFYVKNCTLTNTDNGVRIKTWP-STPGTAPITDMHFEDIIMVNVKN  302

Query  926   PIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDI  1105
             PI+IDQEYCP N+CSK+ PS +K+SK+S+K I GTSATP  V L CSSGVPC+ VE+  +
Sbjct  303   PIIIDQEYCPWNQCSKKSPSKIKISKVSFKNIRGTSATPEGVILICSSGVPCDTVELNGV  362

Query  1106  NLTIKGGAAKSICKNVKPKLTGK  1174
             +LT  G  A + C NVKP +TGK
Sbjct  363   DLTFNGAPATAKCANVKPIVTGK  385



>gb|ADP09681.1| polygalacturonase [Cucurbita pepo]
Length=416

 Score =   376 bits (966),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 192/364 (53%), Positives = 249/364 (68%), Gaps = 10/364 (3%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK N D   AL  AWKE CA+ T S V++PKGT+ + +  L GPCK+PIEL +   L+A 
Sbjct  47    AKPNADATQALADAWKEACASATPSKVLVPKGTYQLGESRLKGPCKSPIELLVEGTLQAS  106

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNF  478
             P     DG    L ++YIDH TLSG G  DGQG    +   +   K +  KLP NL  NF
Sbjct  107   PTDTEGDG---LLVMEYIDHLTLSGTGVFDGQGKAG-WEKNDCHLKKECKKLPMNLKFNF  162

Query  479   LTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSV  658
             +TNS+++D+T+L+SK FH+NVL GKNLTFDH  + AP NSPNTDGIH+     + + ++ 
Sbjct  163   ITNSIVKDITSLDSKNFHINVLAGKNLTFDHLKITAPHNSPNTDGIHLGDSEDVYILNTA  222

Query  659   IGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNG  838
             I TGDDCIS+G     + I+ VTCGPGHGIS+GSLG+   E+ V G+ V   K IGT NG
Sbjct  223   IATGDDCISVGYTNRKITISDVTCGPGHGISIGSLGKYKTEKEVVGVTVKKCKLIGTTNG  282

Query  839   VRIKTWPNSHPGV-VTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYK  1015
             VRIK+WP+S      +D+HFE+I+M+NV NPI+IDQEYCP N+C+++ PS +K+SK+S+K
Sbjct  283   VRIKSWPDSAVSYPASDMHFEDIEMENVANPIIIDQEYCPWNQCNRKVPSAIKISKVSFK  342

Query  1016  KISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPL  1189
              I GTS+TPVAV+L CS   PCE VEI DI+LT  G  G A S C NVKP ++GK  PP+
Sbjct  343   NIRGTSSTPVAVKLVCSKSNPCEGVEIADIDLTYSGKEGPAVSECSNVKPTISGKQNPPI  402

Query  1190  ACGK  1201
              C K
Sbjct  403   -CAK  405



>ref|XP_011097055.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=399

 Score =   375 bits (964),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 192/363 (53%), Positives = 253/363 (70%), Gaps = 11/363 (3%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK+  D+  AL+ AWKE C +T+ ST+VIP+GT+ ++QV+L GP KAP+EL++   L+A 
Sbjct  34    AKSGGDISQALMDAWKEACNSTSPSTIVIPRGTWSLSQVKLLGPNKAPLELQVQGTLQA-  92

Query  305   PNPKNMDGKK-EWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKE--KGFKGDKLPNNLSLN  475
              NP  +  K+ EW+TI Y+++FTLSGGG  DG+G  + +   +  K     KLP NLS N
Sbjct  93    -NPGQLPNKEGEWITINYVNYFTLSGGGVFDGRGQ-EAWKQNDCHKNKNCAKLPMNLSFN  150

Query  476   FLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDS  655
             F+ NS+IRD+TT +SK FHVN +   N+TF  FTV APG+SPNTDGIH+ R   I +KDS
Sbjct  151   FVNNSIIRDVTTKDSKNFHVNCISSHNVTFLRFTVSAPGDSPNTDGIHLGRDTMINIKDS  210

Query  656   VIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDN  835
             +I TGDDC+S+GD  + + I  VTCGPGHGISVGSLG    E+ V+GI+V+N  FIGT N
Sbjct  211   IIKTGDDCVSIGDESKEIHIQNVTCGPGHGISVGSLGGYAEEKDVQGIYVTNCTFIGTTN  270

Query  836   GVRIKTWPNSHPGVVT--DIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKIS  1009
             GVR+KTWP S P  +T  D+HFE++ M NV +PI+IDQEYCP+N C K +PS +K+S +S
Sbjct  271   GVRVKTWP-SAPATLTVSDLHFEDLIMDNVSSPIIIDQEYCPHNLCKKDRPSSIKISNVS  329

Query  1010  YKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVP  1183
              K + GT+ T  AV   CS   PCE VE+GDI+LT  G  G   + C NVKPK  GK  P
Sbjct  330   IKNVRGTTNTAEAVTFICSGLKPCENVEVGDIDLTYNGNQGPITTKCANVKPKFVGKQNP  389

Query  1184  PLA  1192
             P+ 
Sbjct  390   PVC  392



>ref|XP_008467043.1| PREDICTED: exopolygalacturonase-like, partial [Cucumis melo]
Length=365

 Score =   374 bits (959),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 192/361 (53%), Positives = 256/361 (71%), Gaps = 11/361 (3%)
 Frame = +2

Query  134   NVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNP  313
             N DV  AL  AWKE CA+TT S V+IPKG++ ++Q  L GPCK+ IEL+I   L+AP +P
Sbjct  1     NADVTAALASAWKEACASTTPSKVLIPKGSYGLSQSNLKGPCKSAIELQIEGTLQAPADP  60

Query  314   KNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTN  487
             K  DG    L ++Y+D  T+SG G LDGQG    +   +   K +  KLP NL LNF+TN
Sbjct  61    KG-DG---LLLLEYVDQLTVSGTGVLDGQGKAG-WEKNDCHLKKECTKLPMNLKLNFVTN  115

Query  488   SVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGT  667
             S+++D+T+L+SK +H+N+LG KNLTFDH T+ APGNSPNTDGIH++    I + ++ I T
Sbjct  116   SIVKDITSLDSKNYHINLLGCKNLTFDHVTITAPGNSPNTDGIHVSSSEQINILNTNIAT  175

Query  668   GDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRI  847
             GDDCIS+GD  + + I+ VTCGPGHGIS+GSLG+   E+ V G+ V   K   T NGVRI
Sbjct  176   GDDCISVGDTNKQVVISDVTCGPGHGISIGSLGKYSKEKEVVGVTVKKCKLTDTTNGVRI  235

Query  848   KTWPNSHPGV-VTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKIS  1024
             KTWP+S      +D+HFE+I+M NV NP++IDQEYCP N+C+++ PS +K+S +S+K I 
Sbjct  236   KTWPDSAVAFPASDMHFEDIEMVNVSNPVIIDQEYCPWNQCNRKVPSKIKISNVSFKNIR  295

Query  1025  GTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLACG  1198
             GTSATPVAV++ CS   PCE VE+ DI+LT  G  G  KS C NVKP ++GK  PP+ CG
Sbjct  296   GTSATPVAVKIVCSQSNPCEGVEVADIDLTYSGSEGPIKSQCANVKPVISGKQNPPI-CG  354

Query  1199  K  1201
             +
Sbjct  355   E  355



>ref|XP_004308599.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=392

 Score =   374 bits (961),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 186/363 (51%), Positives = 246/363 (68%), Gaps = 7/363 (2%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK N D+  A+  AWK+ CA+T  S V++PKG + + +    GPCKAPIEL++   L+A 
Sbjct  29    AKPNSDITQAIANAWKDACASTMPSKVIVPKGIYKLKEANFNGPCKAPIELQVCGTLQAS  88

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKE--KGFKGDKLPNNLSLNF  478
             P+   +     W+   Y+D FTLSG G  DGQG  Q + + +  K  K   +  N+  + 
Sbjct  89    PDGAQLSKPDTWIMFSYLDRFTLSGTGIFDGQGQ-QAWKANDCHKNPKCSSIAINMRFHS  147

Query  479   LTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSV  658
             + NS++RD+++LNSK FHVNVLG + LTF HFTV AP  S NTDGIHI R  GI + DS 
Sbjct  148   VKNSLVRDVSSLNSKNFHVNVLGCERLTFQHFTVTAPETSVNTDGIHIGRSTGINITDSN  207

Query  659   IGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNG  838
             I TGDDCIS+GDG + L IT VTCGPGHGIS+GSLGR P E PV GI++ +     T NG
Sbjct  208   ISTGDDCISIGDGTKQLTITKVTCGPGHGISIGSLGRYPKEEPVTGIYIKSCTLSNTMNG  267

Query  839   VRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYK  1015
             +RIKTWPNS    + +DIHFE+I M NV NPI+IDQEYCP N C+KQ  S VK+S +S++
Sbjct  268   IRIKTWPNSPAASIASDIHFEDIIMNNVGNPILIDQEYCPWNLCNKQVASKVKISNVSFR  327

Query  1016  KISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPL  1189
              I GTS+TP+A+++ C+ G+PC++VE+ DINL   G  G+  S C NV+P +T +V  PL
Sbjct  328   NIRGTSSTPLALKILCAKGLPCDKVEMTDINLKYNGKQGSLTSQCSNVRPTIT-RVPNPL  386

Query  1190  ACG  1198
             AC 
Sbjct  387   ACA  389



>ref|XP_003595659.1| Polygalactorunase PG11 [Medicago truncatula]
 ref|XP_003595664.1| Polygalactorunase PG11 [Medicago truncatula]
 gb|AES65910.1| polygalacturonase 11c, putative [Medicago truncatula]
 gb|AFK38160.1| unknown [Medicago truncatula]
Length=419

 Score =   375 bits (963),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 189/388 (49%), Positives = 254/388 (65%), Gaps = 11/388 (3%)
 Frame = +2

Query  35    LKMATISYCAFTFIL-FMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVI  211
             +K +T+   +F F+  F  A  G         K N D+G AL  AWKE CA+TTA+ +VI
Sbjct  1     MKFSTVIIVSFLFLADFCAAQSGVLDIAKFGGKPNSDIGMALTAAWKEACASTTAAKIVI  60

Query  212   PKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTL  391
             P GT+ +  +EL GPCKAPIEL++   ++AP +P  + G ++W    Y+DH TLSG G  
Sbjct  61    PAGTYQLNGIELKGPCKAPIELQVDGTIQAPADPSVIKGTEQWFKFLYMDHLTLSGKGVF  120

Query  392   DGQGNVQVY----PSKEKGFKGDKLPN--NLSLNFLTNSVIRDLTTLNSKLFHVNVLGGK  553
             DGQG   VY    P+     KG    N  N   NF+ NS++  +T+ +SK FHV V G  
Sbjct  121   DGQG-ASVYKKAQPAAAWSGKGGNSKNFMNFGFNFVNNSLVHGVTSKDSKNFHVMVFGCN  179

Query  554   NLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCG  733
             N+TFD FT+ APG+SPNTDGIH+ +  G+ + ++ IGTGDDC+S+GDG + + + GV CG
Sbjct  180   NITFDSFTITAPGDSPNTDGIHMGKSTGVKILNTNIGTGDDCVSIGDGSKQITVEGVKCG  239

Query  734   PGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--DIHFENID  907
             PGHG+S+GSLG+   E  V+GI + N     TDNGVRIKTWP++ PG +T  DIHFE+I 
Sbjct  240   PGHGLSIGSLGKFTTEENVEGITIKNCTLTATDNGVRIKTWPDA-PGTITVSDIHFEDIT  298

Query  908   MQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEE  1087
             M NVKNP++IDQEYCP N CSK+ PS +KLSKI++K + GTS T   V L CSS VPC+ 
Sbjct  299   MTNVKNPVIIDQEYCPWNACSKKNPSKIKLSKITFKNVKGTSGTAEGVVLICSSAVPCDG  358

Query  1088  VEIGDINLTIKGGAAKSICKNVKPKLTG  1171
             VE+ +++L   G    + C NVKP +TG
Sbjct  359   VELNNVDLKFNGAPTTAKCTNVKPIVTG  386



>ref|XP_008245681.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Prunus mume]
Length=402

 Score =   374 bits (961),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 194/389 (50%), Positives = 260/389 (67%), Gaps = 12/389 (3%)
 Frame = +2

Query  68    TFILFMLAHF--GESATINV---AAKAN--VDVGPALLKAWKEGCAATTASTVVIPKGTF  226
             TF LF+++      +A  ++    AKA+   D   A+ +AWKE CA+TT STV+I KG +
Sbjct  10    TFFLFLISFSIKARAADFDIKKYGAKADGKTDDSQAINRAWKEACASTTPSTVLIAKGNY  69

Query  227   PMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGN  406
                 V+  GPCKAP+ +++   L+AP  P+ +  +  W+  + ID  T+SGGGT DGQG+
Sbjct  70    MAGPVKFQGPCKAPVSIRVEGTLQAPAEPEKLKSQDGWVVFRNIDGLTVSGGGTFDGQGS  129

Query  407   VQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVK  583
             +    +   K  K + LP N+  + LTNS I+++T+ NSKLFH+NVL  KN+T  H  + 
Sbjct  130   IAWSKNDCAKTGKCNSLPINIRFSGLTNSHIQNITSSNSKLFHINVLNCKNVTLQHVIIT  189

Query  584   APGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSL  763
             APG S NTDGIHI R   I +  + I TGDDCISLGDG + + I  V CGPGHGIS+GSL
Sbjct  190   APGESLNTDGIHIGRSSNINITGAEIKTGDDCISLGDGSQQINIEKVKCGPGHGISIGSL  249

Query  764   GRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVK-NPIVID  940
             GR   E+PV G+ V N     T NGVR+KTWP S  GV +D+HFE+I M+NVK +P++ID
Sbjct  250   GRYHDEQPVTGVTVRNCTISNTSNGVRVKTWPASPNGVASDLHFEDIIMENVKTSPVLID  309

Query  941   QEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIK  1120
             QEYCPN +C  + PS VK+S +S+K I GTSA PV V+LACS G+PC+ V+I DI+LT  
Sbjct  310   QEYCPNGQCQAKIPSKVKISNVSFKNIRGTSADPVVVKLACSKGIPCQNVQISDIHLTYN  369

Query  1121  G--GAAKSICKNVKPKLTGKVVPPLACGK  1201
             G  GAA S+C NVKP +TG++ PP AC K
Sbjct  370   GKNGAATSVCTNVKPTMTGQIFPP-ACAK  397



>ref|XP_007152047.1| hypothetical protein PHAVU_004G097300g [Phaseolus vulgaris]
 gb|ESW24041.1| hypothetical protein PHAVU_004G097300g [Phaseolus vulgaris]
Length=398

 Score =   374 bits (961),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 189/385 (49%), Positives = 250/385 (65%), Gaps = 4/385 (1%)
 Frame = +2

Query  32    NLKMATISYCAFTFILF--MLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTV  205
             +L++  I+   F  ++     A FG        A  N D+  AL  AW + CA+TT S V
Sbjct  2     DLQLKMITNALFLLLVSSSATAQFGVFDISKYGAVPNGDITEALTNAWSDACASTTPSKV  61

Query  206   VIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGG  385
             VI +G + + Q+E  GPC APIE+++   +KAP +P  ++G  +W+   YI+  TLSG G
Sbjct  62    VIARGIYNLKQIEFKGPCMAPIEVQVDGTIKAPQDPNQLNGDAQWIKFTYINFLTLSGAG  121

Query  386   TLDGQG-NVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLT  562
             T DGQG N     +  K     KL  N    FL N+++RD+T+ +SK FHVNVLG  N+T
Sbjct  122   TFDGQGANAWTQNNCAKNKSCKKLSMNFGFGFLNNTIVRDITSKDSKYFHVNVLGCNNIT  181

Query  563   FDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGH  742
             F +F + AP  SPNTDGIHI R   + + ++ I TGDDCISLGDG + + +  VTCGPGH
Sbjct  182   FTNFNIVAPATSPNTDGIHIGRSTLVNIDNTNIATGDDCISLGDGSKQITVLNVTCGPGH  241

Query  743   GISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHFENIDMQNV  919
             GISVGSLG+ P E+PV+  FVSN     TDNGVRIKTWP++   + VT +HFE+I M NV
Sbjct  242   GISVGSLGKYPNEKPVEDFFVSNCILNNTDNGVRIKTWPDTPATITVTGMHFEDIKMINV  301

Query  920   KNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIG  1099
             KNPI+IDQEYCP N+C+KQ PS +K+S +S+K I GTS T   V L CSSGVPCE+V + 
Sbjct  302   KNPIIIDQEYCPWNQCTKQNPSKIKISNVSFKNIIGTSGTKEGVVLICSSGVPCEDVMLT  361

Query  1100  DINLTIKGGAAKSICKNVKPKLTGK  1174
             DI+LT  G +A +   NVKP + GK
Sbjct  362   DIDLTFNGTSAAAKLSNVKPIIQGK  386



>gb|AES65915.2| polygalacturonase 11c, putative [Medicago truncatula]
Length=417

 Score =   374 bits (961),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 185/386 (48%), Positives = 251/386 (65%), Gaps = 9/386 (2%)
 Frame = +2

Query  35    LKMATISYCAFTFIL-FMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVI  211
             +K +T+   +F F+  F  A  G         K N D+G AL  AWKE CA+TTA+ +VI
Sbjct  1     MKFSTVIIVSFLFLADFCAAQSGVLDIAKFGGKPNSDIGMALTAAWKEACASTTAAKIVI  60

Query  212   PKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTL  391
             P GT+ +  +EL GPCKAPIEL++   ++AP +P  + G ++W    Y+DH TLSG G  
Sbjct  61    PAGTYQLNGIELKGPCKAPIELQVDGTIQAPADPSVIKGTEQWFKFLYMDHLTLSGKGVF  120

Query  392   DGQGNVQVYPSKEKGFKGD----KLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNL  559
             DGQG   VY   +          +   N   NF+ NS++  +T+ +SK FHV V G  N+
Sbjct  121   DGQG-ASVYKKAQPAAAWSVFLVQFQQNFGFNFVNNSLVHGVTSKDSKNFHVMVFGCNNI  179

Query  560   TFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPG  739
             TFD FT+ APG+SPNTDGIH+ +  G+ + ++ IGTGDDC+S+GDG + + + GV CGPG
Sbjct  180   TFDSFTITAPGDSPNTDGIHMGKSTGVKILNTNIGTGDDCVSIGDGSKQITVEGVKCGPG  239

Query  740   HGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--DIHFENIDMQ  913
             HG+S+GSLG+   E  V+GI + N     TDNGVRIKTWP++ PG +T  DIHFE+I M 
Sbjct  240   HGLSIGSLGKFTTEENVEGITIKNCTLTATDNGVRIKTWPDA-PGTITVSDIHFEDITMT  298

Query  914   NVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVE  1093
             NVKNP++IDQEYCP N CSK+ PS +KLSKI++K + GTS T   V L CSS VPC+ VE
Sbjct  299   NVKNPVIIDQEYCPWNACSKKNPSKIKLSKITFKNVKGTSGTAEGVVLICSSAVPCDGVE  358

Query  1094  IGDINLTIKGGAAKSICKNVKPKLTG  1171
             + +++L   G    + C NVKP +TG
Sbjct  359   LNNVDLKFNGAPTTAKCTNVKPIVTG  384



>ref|XP_010038561.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=501

 Score =   377 bits (968),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 188/359 (52%), Positives = 249/359 (69%), Gaps = 9/359 (3%)
 Frame = +2

Query  140   DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKN  319
             D+  +LL AWK+ CA+TT + V I  GTF +++V L GPCKA +E +I   L+AP +P  
Sbjct  73    DITQSLLGAWKKACASTTRAKVFIAGGTFALSEVVLEGPCKAHVEFEIRGRLQAPADPSR  132

Query  320   M--DGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNS  490
                DG   W+  + ID  T+SGGGT DGQG +    +  +K      LP NL  NF++N+
Sbjct  133   FKTDG---WVVFQRIDGLTVSGGGTFDGQGKIAWGQNDCDKNTNCRTLPTNLRFNFVSNA  189

Query  491   VIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  670
             +I ++TTL+SK FHVNVLG KNLTF++F V APG+S NTDGIHI R +G+ + D+ I TG
Sbjct  190   IIHNVTTLDSKNFHVNVLGAKNLTFENFHVNAPGDSVNTDGIHIGRSLGVNILDTNIKTG  249

Query  671   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  850
             DDC+SLGDG   + + GVTCGPGHGISVGSLG+   E PV G+FV+N    G  NG RIK
Sbjct  250   DDCVSLGDGSRQITVRGVTCGPGHGISVGSLGKYDNEEPVSGVFVTNCTITGATNGARIK  309

Query  851   TWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGT  1030
             TW  S  G+ TD+HF+++ M +V NP++IDQ YCP N+C  Q PSLVK+S +S+++I GT
Sbjct  310   TWLASKIGIATDMHFQDVQMNDVANPVLIDQGYCPFNQCQAQIPSLVKISNVSFERIRGT  369

Query  1031  SATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLACGK  1201
             S+T VAV++ACS  +PCE VEI DINL  KG  G A S C NV+P ++G +  PLAC +
Sbjct  370   SSTKVAVKIACSKRIPCEGVEIADINLVYKGPDGPATSECSNVRPLISG-MQNPLACAE  427


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 14/94 (15%)
 Frame = +2

Query  959   NECSKQKP------------SLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGD  1102
             +ECS  +P             +VK+S +S++ I GTSATP+A +L C  GVPC+++E+ D
Sbjct  407   SECSNVRPLISGMQNPLACAEIVKISDVSFRDIRGTSATPLAEKLGCGRGVPCQKLELAD  466

Query  1103  INLTIKG--GAAKSICKNVKPKLTGKVVPPLACG  1198
             INL   G  GA+ S   N+KP +TGK   P+  G
Sbjct  467   INLRYNGRNGASTSQSANMKPTITGKSSLPICAG  500



>sp|Q40312.1|PGLR_MEDSA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Medicago sativa]
 gb|AAA62286.1| polygalacturonase [Medicago sativa]
Length=421

 Score =   373 bits (958),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 189/387 (49%), Positives = 252/387 (65%), Gaps = 9/387 (2%)
 Frame = +2

Query  35    LKMATISYCAFTFIL-FMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVI  211
             +K +T    +F FI  F  A  G         K N D+G AL  AW E CA+TTA+ +VI
Sbjct  1     MKFSTAIIVSFLFIADFCAAQSGVLDISKFGGKPNSDIGQALTSAWNEACASTTAAKIVI  60

Query  212   PKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTL  391
             P GT+ +  +EL GPCKAPIEL++   ++AP +P  + G ++W    Y+DH TLSG G  
Sbjct  61    PAGTYQLNGIELKGPCKAPIELQVDGTIQAPADPSVIKGTEQWFKFLYMDHLTLSGKGVF  120

Query  392   DGQG-NVQVYPSKEKGFKG----DKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKN  556
             DGQG  V    +    + G     K+  N   NF+ NS++R +T+ +SK FHV V G KN
Sbjct  121   DGQGATVYKKAAPASAWSGKNSNSKVFMNFGFNFVNNSIVRGVTSKDSKNFHVMVFGCKN  180

Query  557   LTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGP  736
             +TFD FT+ APG+SPNTDGIH+ +   + + ++ IGTGDDC+S+GDG + + + GV CGP
Sbjct  181   ITFDGFTITAPGDSPNTDGIHMGKSTDVKILNTNIGTGDDCVSIGDGSKQITVQGVNCGP  240

Query  737   GHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--DIHFENIDM  910
             GHG+SVGSLG+   E  V+GI V N     TDNGVRIKTWP++ PG +T  DIHFE+I M
Sbjct  241   GHGLSVGSLGKFTTEENVEGITVKNCTLTATDNGVRIKTWPDA-PGTITVSDIHFEDITM  299

Query  911   QNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEV  1090
              NVKNP++IDQEY P N+CSK+ PS +KLSKIS+K + GTS T   V L CSS VPC+ V
Sbjct  300   TNVKNPVIIDQEYYPWNQCSKKNPSKIKLSKISFKNVKGTSGTAEGVVLICSSAVPCDGV  359

Query  1091  EIGDINLTIKGGAAKSICKNVKPKLTG  1171
             E+ +++L   G    + C NVKP +TG
Sbjct  360   ELNNVDLKFNGAPTTAKCTNVKPLVTG  386



>gb|ADC53480.1| polygalacturonase [Gossypium hirsutum]
Length=412

 Score =   372 bits (956),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 197/380 (52%), Positives = 250/380 (66%), Gaps = 17/380 (4%)
 Frame = +2

Query  74    ILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAG  253
             ++ ++A FG        A    D+   LL AWKE CA+T+ S +VIPKG + ++   L G
Sbjct  32    VIDVVAKFG------AKADEKTDLSKPLLDAWKEACASTSPSKIVIPKGIYFLSTATLDG  85

Query  254   PCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEK  433
             PCKAPIEL++   +KAP +P      K W+    I++F LSGGG  DGQG       K +
Sbjct  86    PCKAPIELQVQGTVKAPADPGAFKEPK-WIAFNRIENFKLSGGGVFDGQGTTAY---KRE  141

Query  434   GFKGD----KLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  601
             G KG      LP NL  +FLTN++I+D+TT +SK F  NVLG KN+TF+HFTV AP  SP
Sbjct  142   GCKGHDYCGSLPINLRFDFLTNAMIQDITTKDSKQFQANVLGCKNITFEHFTVSAPDESP  201

Query  602   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  781
             NTDGIHI R  G+ V +S I TGDDC+S+GDG +NL I GVTCGPGHGIS+GSLG    E
Sbjct  202   NTDGIHIGRSDGVNVLNSEIKTGDDCVSIGDGSKNLVINGVTCGPGHGISIGSLGLFKNE  261

Query  782   RPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNN  961
              PV G+ V N     T NGVRIKTWP + PG  ++IHFE+I + NV +PI+IDQ+YCP N
Sbjct  262   EPVDGVTVKNCTMTNTSNGVRIKTWPGAEPGTCSNIHFEDITVTNVSSPIIIDQKYCPWN  321

Query  962   ECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAK  1135
             +C   + S VKLS IS+K I GTSA P AV++ CS+ +PCE VE+ DI +T  G  G A 
Sbjct  322   KCKINEESKVKLSNISFKNIHGTSARPEAVKIICSATLPCENVELADIEITHSGPTGPAV  381

Query  1136  SICKNVKPKLTGKVVPPLAC  1195
             S C NVKPK++GK   P AC
Sbjct  382   SQCSNVKPKVSGK-QNPAAC  400



>ref|XP_006595658.1| PREDICTED: polygalacturonase-like isoform X2 [Glycine max]
Length=386

 Score =   370 bits (951),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 184/352 (52%), Positives = 238/352 (68%), Gaps = 7/352 (2%)
 Frame = +2

Query  152   ALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGK  331
             AL KAW+E CAAT+AS +VIP G++ M  V+L GPC APIE++    L+AP +P  +DG 
Sbjct  36    ALTKAWEEACAATSASKIVIPGGSYKMEAVDLKGPCMAPIEIQFDGTLQAPADPNALDGA  95

Query  332   KEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDL  505
              EWL +++++ FTLSG G  DGQG    +   + G   +  K   N   NFL NS++RD+
Sbjct  96    DEWLKVQHVNFFTLSGKGVFDGQG-ATAWKQNDCGTNKNCKKRSKNFGFNFLNNSMVRDI  154

Query  506   TTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCIS  685
             T+ +SK FHVNVLG  N TFD F V AP  S NTDGIHI R   + + ++ I TGDDC+S
Sbjct  155   TSKDSKNFHVNVLGCNNFTFDGFHVSAPNTSINTDGIHIGRSTDVKILNTNIATGDDCVS  214

Query  686   LGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS  865
             LGDG + + +  V CGPGHGISVGSLG+ P E PV+ + V N     TDNGVRIKTWP+S
Sbjct  215   LGDGSKKITVQNVNCGPGHGISVGSLGKYPEEEPVEQLLVKNCTLTNTDNGVRIKTWPSS  274

Query  866   HPGV--VTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSAT  1039
              PG   +TD+HFE+I M +V NP++IDQEYCP N+CSKQ PS +K+SK+++K I GTS T
Sbjct  275   -PGASPITDMHFEDITMVDVMNPVIIDQEYCPWNQCSKQAPSKIKISKVTFKNIQGTSKT  333

Query  1040  PVAVQLACSSGVPCEEVEIGDINLTIKGGAAKSICKNVKPKLTGKVVPPLAC  1195
                V L CS GVPCE+VE+ ++ LT  G    + C NVKP +TGK  P   C
Sbjct  334   KEGVTLICSKGVPCEDVELNNVALTFNGAPIVAKCANVKPIVTGK-APACTC  384



>ref|XP_010038563.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=395

 Score =   370 bits (951),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 196/385 (51%), Positives = 253/385 (66%), Gaps = 14/385 (4%)
 Frame = +2

Query  68    TFILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVEL  247
             +F   ++A   +    NV      D+  +LL AWK+ CA+TT   V+IP GTF +++V L
Sbjct  15    SFSSTIIAQVFQIENYNVTGGGIPDITQSLLDAWKKACASTTRPKVLIPGGTFTLSEVVL  74

Query  248   AGPCKAPIELKIMAILKAPPNPKNM--DGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYP  421
              GPCKA +E ++ A L APP       DG   W+    ID  T+ GG T DGQG +    
Sbjct  75    EGPCKAHVEFEVHARLLAPPELSRFKTDG---WVVFHNIDGLTMLGG-TFDGQGKMAWAQ  130

Query  422   S---KEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPG  592
             +   K K  +   LP NL  N ++N++I D+T+++SK FHV VLG KN+TF HF V APG
Sbjct  131   NDCIKNKNCR--MLPMNLRFNVVSNAIIHDVTSVDSKYFHVTVLGCKNVTFQHFHVNAPG  188

Query  593   NSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRT  772
             NS NTDGIHI R +G+ + D+ I TGDDC+SLGDG   + + G+TCGPGHGISVGSLG+ 
Sbjct  189   NSVNTDGIHIGRSLGVNILDTDIKTGDDCVSLGDGSRQVTVKGLTCGPGHGISVGSLGKY  248

Query  773   PGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYC  952
               E PV G+FV+N    G  NGVRIKTWP S  G+ TD+HFE+I M NV NP++IDQ YC
Sbjct  249   DNEEPVSGVFVTNCTINGATNGVRIKTWPASKIGIATDMHFEDIQMNNVFNPVLIDQGYC  308

Query  953   PNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--G  1126
             P N+C  Q PSLVK+S +S+K+I GTSAT VAV++ACS  +PCE VEI DINL  KG  G
Sbjct  309   PWNQCQAQIPSLVKISNVSFKRIRGTSATKVAVKIACSKRIPCEGVEIADINLVYKGPDG  368

Query  1127  AAKSICKNVKPKLTGKVVPPLACGK  1201
              A S C NV+P ++G +  P AC K
Sbjct  369   PATSECSNVRPLISG-MQNPRACAK  392



>ref|XP_011097018.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=373

 Score =   369 bits (946),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 187/354 (53%), Positives = 244/354 (69%), Gaps = 9/354 (3%)
 Frame = +2

Query  152   ALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGK  331
             AL+ AWKE C +T+ ST+VIP+GT+ ++QV+L  P KAP+EL++   L+A PNP  +  K
Sbjct  15    ALMDAWKEACNSTSPSTIVIPRGTWSLSQVKLLAPNKAPVELQVQGTLQANPNPGQLPNK  74

Query  332   K-EWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKE--KGFKGDKLPNNLSLNFLTNSVIRD  502
             + EW+TI Y+++FTLSGGG  D QG  + +   +  K     KLP NLS NF+ NS+IRD
Sbjct  75    EGEWITINYVNYFTLSGGGVFDDQGQ-EAWKQNDCHKNRNCAKLPMNLSFNFVNNSIIRD  133

Query  503   LTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCI  682
             +TT +SK FHV  +   N+TF  FTV APG+SPNTDGIH+ R   I +KDS+I TGDDC+
Sbjct  134   VTTKDSKNFHVICILSHNVTFLRFTVSAPGDSPNTDGIHLGRDTMINIKDSIIKTGDDCV  193

Query  683   SLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPN  862
             S+GD  + + I  VTCGPGHGISVGS G    E+ V+ I+V+N  FIGT NGVR+KTWP 
Sbjct  194   SIGDESKEIHIQNVTCGPGHGISVGSFGGYAVEKDVQEIYVTNCTFIGTQNGVRVKTWP-  252

Query  863   SHPGVVT--DIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSA  1036
             S P  +T  D+HFE++ M NV +PI+IDQEYCP+N C K +PS +K+S +S K I GT+ 
Sbjct  253   SAPATLTVSDLHFEDLIMDNVSSPIIIDQEYCPHNLCKKDRPSSIKISNVSIKNIRGTTN  312

Query  1037  TPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLA  1192
             T  AV   CS   PCE VE+GDI+LT  G  G   + C NVKPK  GK  PP+ 
Sbjct  313   TAEAVTFICSGLKPCENVEVGDIDLTYNGNQGPITTNCANVKPKFVGKQNPPVC  366



>ref|XP_009365183.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=401

 Score =   369 bits (948),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 192/390 (49%), Positives = 248/390 (64%), Gaps = 17/390 (4%)
 Frame = +2

Query  71    FILFMLAHFGESAT-------INVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFP  229
             F+  +LA    + +        N   KAN D+  AL KAW + CA+T+AS +V+P GT+ 
Sbjct  12    FVYLLLASTSNAQSGVYDVTGANYGGKANSDITQALSKAWTDACASTSASKIVVPSGTYK  71

Query  230   MTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV  409
                    GPCKAPIE ++   ++AP + K +  +  W+  + ID  TLSGGG  DGQG  
Sbjct  72    FVGATFKGPCKAPIEFQLQGTVQAPEHIKELPKEDTWVAFERIDGLTLSGGGIFDGQGTT  131

Query  410   ---QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTV  580
                Q    K K  K   +  NL  NF+TNS++R++TT +SK FHVN+LG  NL F HFTV
Sbjct  132   AWKQNDCHKNKNCKSKAV--NLRFNFVTNSIVREITTKDSKNFHVNLLGCNNLAFQHFTV  189

Query  581   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  760
              AP  S NTDGIH+ R   I + D+ IGTGDDCIS+G G + L +T VTCGPGHGIS+GS
Sbjct  190   SAPKESVNTDGIHMGRSTEINITDTTIGTGDDCISIGHGTKQLHVTNVTCGPGHGISIGS  249

Query  761   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS--HPGVVTDIHFENIDMQNVKNPIV  934
             LGRT  E PV GIF+ N     TDNGVRIKTWP S      V+D+HFE+I M NVKNP+V
Sbjct  250   LGRTEDEEPVSGIFIKNCTISNTDNGVRIKTWPASPAKGTAVSDVHFEDIIMDNVKNPVV  309

Query  935   IDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLT  1114
             IDQEYCP+  C+ +  S VK+S +S+K I G+S+ PV V+L CS  +PCE VE+ +I+LT
Sbjct  310   IDQEYCPHKLCTPEVSSKVKISNVSFKNIKGSSSGPVGVKLLCSGKLPCENVELSNIDLT  369

Query  1115  IKG--GAAKSICKNVKPKLTGKVVPPLACG  1198
               G  G+  S CK+VKP +   V  PLAC 
Sbjct  370   YTGDKGSLTSECKHVKPTI-NNVAKPLACA  398



>ref|XP_004173029.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=423

 Score =   370 bits (950),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 192/364 (53%), Positives = 254/364 (70%), Gaps = 11/364 (3%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK N D+  AL  AWKE CA+TT S V+IPKG++ ++Q  L GPCK+PIEL+I   L+AP
Sbjct  56    AKPNADITAALTSAWKEACASTTPSKVLIPKGSYGLSQSNLKGPCKSPIELQIEGTLQAP  115

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNF  478
              +P+     +  L ++  D  T+SG G LDGQG    +   +   K +  KLP NL LNF
Sbjct  116   AHPEG----EGLLILENTDLLTVSGTGVLDGQGKAG-WEKNDCHLKKECTKLPMNLKLNF  170

Query  479   LTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSV  658
             +TNS++  +T+L+SK FH+N+LG KNLTFDH T+ APGNSPNTDGIH++    I + ++ 
Sbjct  171   ITNSIVTGITSLDSKNFHINLLGCKNLTFDHVTITAPGNSPNTDGIHVSSSEQINILNTN  230

Query  659   IGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNG  838
             I TGDDCIS+GD  + + I+ VTCGPGHGIS+GSLG+   E+ V G+ V   K  GT NG
Sbjct  231   IATGDDCISVGDSNKQVAISDVTCGPGHGISIGSLGKYTKEKEVVGVTVKKCKLTGTTNG  290

Query  839   VRIKTWPNSHPGV-VTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYK  1015
             VRIKTWP+S      TD+HFE+I+M NV NPI+IDQEYCP N+C+++  S +K+S +S+K
Sbjct  291   VRIKTWPDSAVAFPATDMHFEDIEMDNVSNPIIIDQEYCPWNQCNRKVASKIKISNVSFK  350

Query  1016  KISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPL  1189
              I GTSAT +AV++ CS  +PCE VEI DI+LT  G  G  KS C NVKP +TGK  PP+
Sbjct  351   NIRGTSATAIAVKIVCSKSIPCEGVEIADIDLTYSGPEGPIKSQCANVKPVITGKQNPPI  410

Query  1190  ACGK  1201
              CG+
Sbjct  411   -CGE  413



>ref|XP_008460220.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=393

 Score =   368 bits (945),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 189/360 (53%), Positives = 251/360 (70%), Gaps = 8/360 (2%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK N D+  ALL AWK  CA+T+ S V+IPKG + ++Q  L GPCK+ IE+++   L+AP
Sbjct  37    AKPNTDITHALLNAWKGACASTSRSKVLIPKGVYLLSQSNLKGPCKSSIEIQVDGTLQAP  96

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFL  481
             P+PK  DG    + ++YID  TLSG G  DGQG V    +   K     KLP  L  NF+
Sbjct  97    PDPKG-DG---LVILEYIDKLTLSGTGVFDGQGKVGWEKNDCHKKKICTKLPMTLKFNFV  152

Query  482   TNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVI  661
             TNS++RD+T+L+SK FH+N+LG KNLTF H T+ AP +SPNTDGIHI+    IT+ ++ I
Sbjct  153   TNSIVRDITSLDSKNFHINILGCKNLTFQHVTISAPEDSPNTDGIHISSSEQITILNTKI  212

Query  662   GTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGV  841
              TGDDC+S+GD  + + I  VTCGPGHGIS+GSLG+   E+ V+G++V+  K   T NGV
Sbjct  213   STGDDCVSVGDSNKQITIRDVTCGPGHGISIGSLGKYSKEKAVEGVWVTKCKLTSTTNGV  272

Query  842   RIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKK  1018
             RIKTWP+S      +D+HFE+I+M NV NPI+IDQEYCP N+C+ + PS +K+SK+S+K 
Sbjct  273   RIKTWPDSAGEYSASDMHFEDIEMNNVSNPIIIDQEYCPWNQCNPKIPSSIKISKVSFKN  332

Query  1019  ISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLA  1192
             I GTSATPVAV+L CS  +PCE VE+ DI+L   G  G  KS C NVKP ++GK  P + 
Sbjct  333   IRGTSATPVAVKLVCSKKIPCEAVEVVDIDLKYNGNKGPIKSQCANVKPIISGKQNPRIC  392



>ref|XP_004170151.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=404

 Score =   368 bits (945),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 196/402 (49%), Positives = 262/402 (65%), Gaps = 18/402 (4%)
 Frame = +2

Query  26    VTNLKMATISYC--AFTFI-LFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTA  196
             VT   M+ +S+   A + + +F L  +G     N+ + A  DV  AL  AW + CA+   
Sbjct  11    VTTFLMSLLSFTIEARSHVDIFSLRKYG-----NIVSGA--DVTEALKDAWNDACASDRP  63

Query  197   STVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLS  376
             S VVIPKGTF + + E  GPCK+PIE ++   L+AP +P        W+T  Y+D   LS
Sbjct  64    SAVVIPKGTFKVREGEFKGPCKSPIEFRVHGTLQAPKHPHG----DSWITFAYVDRLRLS  119

Query  377   GGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGK  553
             GGG  DGQG      +   K     KLP +L  +F+TNS++R +T+L+SK FHVN+LG  
Sbjct  120   GGGVFDGQGKAGWEKNDCHKRIDCAKLPISLRFDFITNSIVRRITSLDSKNFHVNILGCN  179

Query  554   NLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCG  733
             NLTF    + AP NSPNTDGIHI R IGI++  S I TGDDCISLGDG + +K+  V CG
Sbjct  180   NLTFQGVNIIAPENSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRIKVNNVICG  239

Query  734   PGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDM  910
             PGHGIS+GSLG+   E PV+G+ V+N   I T NGVRIKTWP S   G+ T++HF +I M
Sbjct  240   PGHGISIGSLGKYNNEEPVEGVIVNNCTIINTTNGVRIKTWPASPVAGIATNMHFSDITM  299

Query  911   QNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEV  1090
              NV NPI+IDQEYCP N+C+++ PS +K++K+S+K I G+SATPVAV+L CSS +PCEEV
Sbjct  300   VNVSNPILIDQEYCPWNQCNREIPSNIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEV  359

Query  1091  EIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLACGK*TT  1210
             ++ +I+L   G  G+  S C NVKP ++G   PP+     TT
Sbjct  360   KVANIDLVYNGIKGSITSECMNVKPIISGIQNPPICSSSYTT  401



>gb|KGN43464.1| hypothetical protein Csa_7G037910 [Cucumis sativus]
Length=404

 Score =   368 bits (945),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 196/402 (49%), Positives = 262/402 (65%), Gaps = 18/402 (4%)
 Frame = +2

Query  26    VTNLKMATISYC--AFTFI-LFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTA  196
             VT   M+ +S+   A + + +F L  +G     N+ + A  DV  AL  AW + CA+   
Sbjct  11    VTTFLMSLLSFTIEARSHVDIFSLRKYG-----NIVSGA--DVTEALKDAWNDACASDRP  63

Query  197   STVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLS  376
             S VVIPKGTF + + E  GPCK+PIE ++   L+AP +P        W+T  Y+D   LS
Sbjct  64    SAVVIPKGTFKVREGEFKGPCKSPIEFRVHGTLQAPKHPHG----DSWITFAYVDRMRLS  119

Query  377   GGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGK  553
             GGG  DGQG      +   K     KLP +L  +F+TNS++R +T+L+SK FHVN+LG  
Sbjct  120   GGGVFDGQGKAGWEKNDCHKRIDCAKLPISLRFDFITNSIVRRITSLDSKNFHVNILGCN  179

Query  554   NLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCG  733
             NLTF    + AP NSPNTDGIHI R IGI++  S I TGDDCISLGDG + +K+  V CG
Sbjct  180   NLTFQGVNIIAPENSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRIKVNNVICG  239

Query  734   PGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDM  910
             PGHGIS+GSLG+   E PV+G+ V+N   I T NGVRIKTWP S   G+ T++HF +I M
Sbjct  240   PGHGISIGSLGKYNNEEPVEGVIVNNCTIINTTNGVRIKTWPASPVAGIATNMHFSDITM  299

Query  911   QNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEV  1090
              NV NPI+IDQEYCP N+C+++ PS +K++K+S+K I G+SATPVAV+L CSS +PCEEV
Sbjct  300   VNVSNPILIDQEYCPWNQCNREIPSNIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEV  359

Query  1091  EIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLACGK*TT  1210
             ++ +I+L   G  G+  S C NVKP ++G   PP+     TT
Sbjct  360   KVANIDLVYNGIKGSITSECMNVKPIISGIQNPPICSSSYTT  401



>gb|KCW46859.1| hypothetical protein EUGRSUZ_K00664 [Eucalyptus grandis]
Length=392

 Score =   368 bits (944),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 193/379 (51%), Positives = 249/379 (66%), Gaps = 13/379 (3%)
 Frame = +2

Query  68    TFILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVEL  247
             +F   ++A   +    NV      D+  +LL AWK+ CA+TT   V+IP GTF +++V L
Sbjct  15    SFSSTIIAQVFQIENYNVTGGGIPDITQSLLDAWKKACASTTRPKVLIPGGTFTLSEVVL  74

Query  248   AGPCKAPIELKIMAILKAPPNPKNM--DGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYP  421
              GPCKA +E ++ A L APP       DG   W+    ID  T+ GG T DGQG +    
Sbjct  75    EGPCKAHVEFEVHARLLAPPELSRFKTDG---WVVFHNIDGLTMLGG-TFDGQGKMAWAQ  130

Query  422   S---KEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPG  592
             +   K K  +   LP NL  N ++N++I D+T+++SK FHV VLG KN+TF HF V APG
Sbjct  131   NDCIKNKNCR--MLPMNLRFNVVSNAIIHDVTSVDSKYFHVTVLGCKNVTFQHFHVNAPG  188

Query  593   NSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRT  772
             NS NTDGIHI R +G+ + D+ I TGDDC+SLGDG   + + G+TCGPGHGISVGSLG+ 
Sbjct  189   NSVNTDGIHIGRSLGVNILDTDIKTGDDCVSLGDGSRQVTVKGLTCGPGHGISVGSLGKY  248

Query  773   PGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYC  952
               E PV G+FV+N    G  NGVRIKTWP S  G+ TD+HFE+I M NV NP++IDQ YC
Sbjct  249   DNEEPVSGVFVTNCTINGATNGVRIKTWPASKIGIATDMHFEDIQMNNVFNPVLIDQGYC  308

Query  953   PNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--G  1126
             P N+C  Q PSLVK+S +S+K+I GTSAT VAV++ACS  +PCE VEI DINL  KG  G
Sbjct  309   PWNQCQAQIPSLVKISNVSFKRIRGTSATKVAVKIACSKRIPCEGVEIADINLVYKGPDG  368

Query  1127  AAKSICKNVKPKLTGKVVP  1183
              A S C NV+P ++G   P
Sbjct  369   PATSECSNVRPLISGMQNP  387



>ref|XP_002310765.1| hypothetical protein POPTR_0007s11860g [Populus trichocarpa]
 gb|EEE91215.1| hypothetical protein POPTR_0007s11860g [Populus trichocarpa]
Length=391

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 182/351 (52%), Positives = 236/351 (67%), Gaps = 3/351 (1%)
 Frame = +2

Query  140   DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKN  319
             D+  A   AW++ CA+T+ S V+IP+GT+ +  V ++GPCKA IEL++   L+AP + + 
Sbjct  38    DISKAFKSAWEDACASTSPSKVLIPRGTYLLGPVIISGPCKAAIELQVKGKLQAPVDMRE  97

Query  320   MDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPN-NLSLNFLTNSVI  496
              +G   W+T+ Y+D FTL+GGGT DGQG      +     K  KLP  +L  NF+TN ++
Sbjct  98    FEGFSSWITLNYVDQFTLTGGGTFDGQGKSASNQNNCGKDKHCKLPPVSLKFNFITNGIV  157

Query  497   RDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDD  676
              D+T+ +SK FH ++LG KNLTF HFT+ A   S NTDGIHI R   I + DS IGTGDD
Sbjct  158   HDITSTDSKYFHAHLLGCKNLTFQHFTITAHDESLNTDGIHIGRSKDIKIIDSDIGTGDD  217

Query  677   CISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTW  856
             CISLG G   + I GVTC PGHGIS+GSLG++  E  V GIFV N     T NGVRIK+W
Sbjct  218   CISLGHGSRQITIEGVTCAPGHGISIGSLGKSQNEESVSGIFVKNCTISNTQNGVRIKSW  277

Query  857   PNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSA  1036
             P    G  +DIHFE+I M+NV NPIVIDQ YCP NEC+++  S V +  +S+K I GTS 
Sbjct  278   PALFGGSASDIHFEDIIMKNVSNPIVIDQVYCPWNECNRKSASKVSIKNVSFKNIRGTSR  337

Query  1037  TPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVP  1183
             TPVAVQL+CS  +PC+EVE+ DI+L   G  G AK  C NV+PK  GK+ P
Sbjct  338   TPVAVQLSCSKDIPCDEVEVADIDLKYTGSEGPAKFQCSNVQPKFHGKINP  388



>ref|XP_011039263.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=391

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 182/351 (52%), Positives = 236/351 (67%), Gaps = 3/351 (1%)
 Frame = +2

Query  140   DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKN  319
             D+  A   AW++ CA+T+ S V+IP+GT+ +  V ++GPCKA IEL++   L+AP + + 
Sbjct  38    DISKAFKSAWEDACASTSPSKVLIPRGTYLLGPVIISGPCKAAIELQVKGKLQAPVDMRE  97

Query  320   MDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPN-NLSLNFLTNSVI  496
              +G   W+T+ Y+D FTL+GGGT DGQG      +     K  KLP  +L  NF+TN ++
Sbjct  98    FEGFSSWITLNYVDQFTLTGGGTFDGQGKSASNQNNCGKDKHCKLPPVSLKFNFITNGIV  157

Query  497   RDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDD  676
              D+T+ +SK FH ++LG KNLTF HFT+ A   S NTDGIHI R   I + DS IGTGDD
Sbjct  158   HDITSTDSKYFHAHLLGCKNLTFQHFTITAHDESLNTDGIHIGRSKDIKIIDSDIGTGDD  217

Query  677   CISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTW  856
             CISLG G   + I GVTC PGHGIS+GSLG++  E  V GIFV N     T NGVRIK+W
Sbjct  218   CISLGHGSRQITIEGVTCAPGHGISIGSLGKSQNEESVSGIFVKNCTISNTQNGVRIKSW  277

Query  857   PNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSA  1036
             P    G  +DIHFE+I M+NV NPIVIDQ YCP NEC+++  S V +  +S+K I GTS 
Sbjct  278   PALFGGSASDIHFEDIIMKNVSNPIVIDQVYCPWNECNRKSASKVSIKNVSFKNIRGTSR  337

Query  1037  TPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVP  1183
             TPVAVQL+CS  +PC+EVE+ DI+L   G  G AK  C NV+PK  GK+ P
Sbjct  338   TPVAVQLSCSKDIPCDEVEVADIDLKYTGSEGPAKFQCSNVQPKFHGKINP  388



>gb|KFK38253.1| hypothetical protein AALP_AA3G089200 [Arabis alpina]
Length=394

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 195/386 (51%), Positives = 255/386 (66%), Gaps = 9/386 (2%)
 Frame = +2

Query  56    YCAFTFIL--FMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFP  229
             Y  F+ IL  F+L+    +    V++ +  D+  ALLKA+K  C + +AS VVIPKG F 
Sbjct  4     YIGFSTILVIFLLSLSANAEVFKVSSSSGSDITQALLKAFKSACQSPSASHVVIPKGEFK  63

Query  230   MTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV  409
             + ++EL GPCKAPIE+ +   +KA  N K+  G++ W+    I+ F L+GGG  DG+GN 
Sbjct  64    LGEIELMGPCKAPIEITLQGTVKADGNTKH--GRERWVVFSRINGFKLNGGGIFDGEGNA  121

Query  410   QVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKA  586
                 +   K F+  KLP ++  +F+T + IRD+TTL+SK FH+NVLG KN+TF +  V A
Sbjct  122   AWRVNNCHKTFECKKLPISIRFDFVTEAEIRDITTLDSKNFHINVLGAKNMTFTNVKVIA  181

Query  587   PGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLG  766
             P  SPNTDGIH+ R  G+ + +S I TGDDCIS+GDG++NL + GV CGPGHGISVGSLG
Sbjct  182   PAESPNTDGIHLGRSDGVKILNSRISTGDDCISVGDGMKNLHVEGVVCGPGHGISVGSLG  241

Query  767   RTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPG-VVTDIHFENIDMQNVKNPIVIDQ  943
             R   E+ V GI V N     TDNG+RIKTWP++      + IHFENI ++NV NPI+IDQ
Sbjct  242   RYGHEQDVSGITVVNCTLQETDNGLRIKTWPSAACATTASGIHFENIILKNVSNPILIDQ  301

Query  944   EYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG  1123
             EYCP N+C+K KPS +KL  I +K I GTS    AV+L CS G PC+ VEIG+IN+  KG
Sbjct  302   EYCPWNQCNKNKPSTIKLVDIKFKNIRGTSGNKDAVKLLCSKGHPCQNVEIGNINIAYKG  361

Query  1124  --GAAKSICKNVKPKLTGKVVPPLAC  1195
               G A   C NVKPKL G    P AC
Sbjct  362   ADGPATFQCSNVKPKLVG-TQNPKAC  386



>ref|XP_010112809.1| hypothetical protein L484_020041 [Morus notabilis]
 gb|EXC34924.1| hypothetical protein L484_020041 [Morus notabilis]
Length=399

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 185/358 (52%), Positives = 240/358 (67%), Gaps = 11/358 (3%)
 Frame = +2

Query  140   DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKN  319
             D+  ALLKAW   CA+T  S VV+PKG F ++   L GPC APIE  +  IL+APP   N
Sbjct  42    DITDALLKAWNNACASTIPSKVVVPKGIFKLSGATLEGPCNAPIEFDLQGILQAPPEDGN  101

Query  320   MDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDK----LPNNLSLNFLTN  487
               G   W+  +Y+D  T+SGGG  DGQG     P+  K    D+    LP N+  N++TN
Sbjct  102   FTGGDTWVAFEYVDLLTISGGGIFDGQGK----PTWGKDCANDEYCGDLPINIRFNYVTN  157

Query  488   SVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGT  667
             S+I+++T+L+SK FH+NVLG +N+TF H  + A  NSP+TDGIHI R   I V DS I T
Sbjct  158   SIIQEITSLDSKQFHINVLGCQNVTFQHVKIIAAENSPHTDGIHIGRSTDIKVLDSNIQT  217

Query  668   GDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRI  847
             GDDCISLGDG + + I  VTCGPGHGIS+GSLG+   E  VKG+ V +     T NGVRI
Sbjct  218   GDDCISLGDGSKQITIAKVTCGPGHGISIGSLGKYLNEEAVKGVDVKSCTLKNTQNGVRI  277

Query  848   KTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISG  1027
             KTWP+S  G  +D+HFE+I M+NV NP++IDQEYCP N+C  Q PS V++S + +K I G
Sbjct  278   KTWPDSQEGKASDLHFEDIIMENVGNPVMIDQEYCPWNQCVSQLPSRVQISGVRFKNIRG  337

Query  1028  TSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLAC  1195
             TS+T +AV+L CS G+PC++VE+ DI+L   G  G   S CKNVKP ++G   PP AC
Sbjct  338   TSSTALAVKLVCSGGLPCQDVEMTDIDLKYSGDEGQITSECKNVKPTVSGIQNPP-AC  394



>ref|XP_004162875.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=397

 Score =   367 bits (942),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 194/380 (51%), Positives = 255/380 (67%), Gaps = 18/380 (5%)
 Frame = +2

Query  77    LFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGP  256
             LF +  +G        AK N D+  AL  AWKE C +TT S ++IPKG + ++Q  L GP
Sbjct  21    LFDVTRYG--------AKPNTDITQALANAWKEACMSTTPSKLLIPKGVYQLSQSYLKGP  72

Query  257   CKA-PIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-E  430
             CK+ PI++++   LKAP +P N DG    +   YID   LSG G  DGQG      +   
Sbjct  73    CKSVPIQVQVDGTLKAPLHP-NGDG---LVLFAYIDQLMLSGTGVFDGQGKAGWDKNDCH  128

Query  431   KGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTD  610
             K     KLP NL  +F+TNS+++D+T+L+SK FH+N+LG KN+TF H T+ AP NSPNTD
Sbjct  129   KKKICTKLPMNLKFSFITNSIVKDITSLDSKNFHINLLGCKNVTFQHVTISAPENSPNTD  188

Query  611   GIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPV  790
             GIHI+    I + DS I TGDDC+S+GD  + + IT VTCGPGHGISVGSLG+   E+ V
Sbjct  189   GIHISSSEQINILDSKISTGDDCVSVGDSNKQVTITNVTCGPGHGISVGSLGKYTKEKDV  248

Query  791   KGIFVSNSKFIGTDNGVRIKTWPNSHPG-VVTDIHFENIDMQNVKNPIVIDQEYCPNNEC  967
              G+ V   K I T NGVRIKTWP+S    + +D+HFE+I+MQNV NP++IDQEYCP N+C
Sbjct  249   VGVTVKTCKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVIIDQEYCPWNQC  308

Query  968   SKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSI  1141
             +++ PS +K+SK+S+K I GTSATP+AV+L CS  +PCE VE+ DINLT  G  G   S 
Sbjct  309   NRKVPSKIKISKVSFKNIRGTSATPIAVKLVCSKSIPCEGVEVADINLTYSGIRGPILSE  368

Query  1142  CKNVKPKLTGKVVPPLACGK  1201
             C NV+P +TGK  P + C K
Sbjct  369   CANVQPLITGKQSPQI-CAK  387



>emb|CBI22052.3| unnamed protein product [Vitis vinifera]
Length=1080

 Score =   386 bits (992),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 185/357 (52%), Positives = 243/357 (68%), Gaps = 2/357 (1%)
 Frame = +2

Query  134   NVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNP  313
             N D+  ALLKAW + C++  ASTV+IP GT+ + Q+ +AGPCKAPI   +   + AP + 
Sbjct  40    NSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAGPCKAPINFVVQGTVMAPVDT  99

Query  314   KNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSV  493
                  +  W+T + ID FTLSG G  DGQG +            ++LP NL  NF+TNS+
Sbjct  100   SRFRAEAGWITFQQIDQFTLSGDGVFDGQGKIVWGTKCLSSAYCNQLPINLRFNFITNSM  159

Query  494   IRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGD  673
             ++D+T+ +SK FH+N+LG KNLTF +  + AP  S NTDGIHI R  GI + DS I TGD
Sbjct  160   VKDITSRDSKQFHINLLGCKNLTFYNIVISAPQESLNTDGIHIGRSSGINITDSTIETGD  219

Query  674   DCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKT  853
             DC+S+GDG E + I  VTCGPGHGISVGSLG+ P E PV GI V N     T NGVR+KT
Sbjct  220   DCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGISVKNCTLTNTQNGVRVKT  279

Query  854   WPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTS  1033
             WP SH G  +++HFE+I M NV NPI+IDQEYCP+N+C+ + PS +K+S +S++ I GT+
Sbjct  280   WPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSPSRIKISNVSFRNIRGTT  339

Query  1034  ATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLACG  1198
             +T VAV+L CS GVPC +VE+GDINL   G  G A S CKN+KP L G  +P ++ G
Sbjct  340   STQVAVKLICSQGVPCHDVELGDINLEYNGNEGPAMSQCKNIKPNLLGVQLPRISMG  396



>ref|XP_008459709.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=428

 Score =   368 bits (944),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 245/362 (68%), Gaps = 11/362 (3%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK N D+  AL  AWKE CA+T+   +VIP GT+ +  +EL G CK+PIE+++   L+AP
Sbjct  62    AKPNADITQALADAWKEACASTSPCKIVIPTGTYKLGTIELKGECKSPIEIQVQGTLQAP  121

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKE--KGFKGDKLPNNLSLNF  478
             P+    D    W+  KYID+ +++ GG  DGQG  Q + S +  K  K  ++P NL  +F
Sbjct  122   PDLTGED----WVHFKYIDYLSVTSGGVFDGQGK-QAWESNDCDKNPKCARIPMNLKFSF  176

Query  479   LTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSV  658
             + N+++ D+T+ +SK FH+ VLG  NLTF H  V AP  S NTDGIHI R +GI + ++ 
Sbjct  177   IKNAIVSDITSKDSKNFHIQVLGCNNLTFQHVNVNAPETSINTDGIHIGRSLGINILNTN  236

Query  659   IGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNG  838
             IGTGDDCISLGDG + + IT VTCGPGHGISVGSLGR   E PV+G+ V N    GT NG
Sbjct  237   IGTGDDCISLGDGSKQVTITNVTCGPGHGISVGSLGRYNLEEPVEGLQVKNCTLTGTTNG  296

Query  839   VRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYK  1015
             +RIKTWP S   GV +D+H+E++ M NV NPI+IDQEYCP N+C+KQ PS VK+SK+S+K
Sbjct  297   LRIKTWPASPAAGVASDMHYEDVVMNNVMNPILIDQEYCPYNQCNKQVPSKVKISKVSFK  356

Query  1016  KISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPL  1189
              I GTS    AV L CSS  PC+ VE+ DI+LT  G  G   S C NVKP ++GK  PP 
Sbjct  357   NIRGTSGNAAAVTLVCSSSNPCDGVELADIDLTYSGSEGPITSRCANVKPTVSGKQNPP-  415

Query  1190  AC  1195
             AC
Sbjct  416   AC  417



>ref|XP_009334235.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=399

 Score =   367 bits (941),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 190/388 (49%), Positives = 250/388 (64%), Gaps = 10/388 (3%)
 Frame = +2

Query  62    AFTFILFMLAHFGESATINVA-----AKANVDVGPALLKAWKEGCAATTASTVVIPKGTF  226
             AF F+L       E    +V      AK   D+  AL KAW + CA+ T S VV+P GT+
Sbjct  10    AFLFLLSASKTQAEPGVFDVTSATYGAKPGSDITQALAKAWTDACASPTPSKVVVPSGTY  69

Query  227   PMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGN  406
              +T+    GPCKAPIE+++   L AP +   +     W+  ++++  T+SGGGT DGQG 
Sbjct  70    MLTEASFKGPCKAPIEIQVQGKLTAPADGGKLTKPDTWVCFEHVNKLTVSGGGTFDGQGA  129

Query  407   VQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVK  583
             +    +   K      +  N+  +F+TNS I+D+T+L+SK FHVNVLG  N+TF    V 
Sbjct  130   LAWKKNDCNKNKDCKSMAINMRFDFVTNSTIQDITSLDSKNFHVNVLGCHNVTFQRVNVT  189

Query  584   APGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSL  763
             APG S NTDGIHI R  GI + D+ IGTGDDC+S+GDG + + +T VTCGPGHGISVGSL
Sbjct  190   APGESINTDGIHIGRSTGINITDAHIGTGDDCVSIGDGNKEITVTRVTCGPGHGISVGSL  249

Query  764   GRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVID  940
             GR P E PV GI V N     T NGVRIKTWP S   G+ +D+HFE+I M NV NP++ID
Sbjct  250   GRYPNEEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVLID  309

Query  941   QEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIK  1120
             Q+YCP N+C +  PS +K+S +S+K I G+SATP+AVQ+ CSSG+ CE+VE+ DI+LT  
Sbjct  310   QQYCPWNQCKQNVPSKIKISNVSFKNIKGSSATPLAVQIVCSSGIACEKVELDDIDLTYN  369

Query  1121  G--GAAKSICKNVKPKLTGKVVPPLACG  1198
             G  G   S C NVKP +T +V   LAC 
Sbjct  370   GNKGPLTSQCSNVKPTIT-RVPNALACA  396



>ref|XP_004153076.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
 ref|XP_004172630.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=397

 Score =   367 bits (941),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 194/380 (51%), Positives = 255/380 (67%), Gaps = 18/380 (5%)
 Frame = +2

Query  77    LFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGP  256
             LF +  +G        AK N D+  AL  AWKE C +TT S ++IPKG + ++Q  L GP
Sbjct  21    LFDVTRYG--------AKPNTDITQALANAWKEACMSTTPSKLLIPKGVYQLSQSYLKGP  72

Query  257   CKA-PIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-E  430
             CK+ PI++++   LKAP +P N DG    +   YID   LSG G  DGQG      +   
Sbjct  73    CKSVPIQVQVDGTLKAPLHP-NGDG---LVLFAYIDQLMLSGTGVFDGQGKAGWDKNDCH  128

Query  431   KGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTD  610
             K     KLP NL  +F+TNS+++D+T+L+SK FH+N+LG KN+TF H T+ AP NSPNTD
Sbjct  129   KKKICTKLPMNLKFSFITNSIVKDITSLDSKNFHINLLGCKNVTFQHVTISAPENSPNTD  188

Query  611   GIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPV  790
             GIHI+    I + DS I TGDDC+S+GD  + + IT VTCGPGHGISVGSLG+   E+ V
Sbjct  189   GIHISSSEQINILDSKISTGDDCVSVGDSNKQVTITNVTCGPGHGISVGSLGKYTKEKDV  248

Query  791   KGIFVSNSKFIGTDNGVRIKTWPNSHPG-VVTDIHFENIDMQNVKNPIVIDQEYCPNNEC  967
              G+ V   K I T NGVRIKTWP+S    + +D+HFE+I+MQNV NP++IDQEYCP N+C
Sbjct  249   VGVTVKACKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVIIDQEYCPWNQC  308

Query  968   SKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSI  1141
             +++ PS +K+SK+S+K I GTSATP+AV+L CS  +PCE VE+ DINLT  G  G   S 
Sbjct  309   NRKVPSKIKISKVSFKNIRGTSATPIAVKLVCSKSIPCEGVEVADINLTYSGIRGPILSE  368

Query  1142  CKNVKPKLTGKVVPPLACGK  1201
             C NV+P +TGK  P + C K
Sbjct  369   CANVQPLITGKQSPQI-CAK  387



>ref|XP_011099769.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=402

 Score =   367 bits (941),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 182/361 (50%), Positives = 244/361 (68%), Gaps = 5/361 (1%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             A +  D+  ALLKAWKE   +   S ++IP+GTF ++QV+L GP KAPIEL++   LKA 
Sbjct  35    ANSGADISQALLKAWKEAIVSVVPSKILIPQGTFTVSQVKLEGPNKAPIELEVQGTLKAF  94

Query  305   PNPKNM-DGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNF  478
             P+P  + D K EW+TI Y+++FTLSGGG  DGQG +    +   K     KLP NLS NF
Sbjct  95    PDPNQLPDKKAEWITINYVNYFTLSGGGVFDGQGQIAWKMNDCHKNKNCPKLPYNLSFNF  154

Query  479   LTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSV  658
             + NS+I D+TT +SK FH+N +   N+TF HFT+ AP  SPNTDGIH+ R   I + DSV
Sbjct  155   INNSIIHDVTTKDSKNFHLNCISSHNVTFRHFTISAPDESPNTDGIHLGRSTRINIIDSV  214

Query  659   IGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNG  838
             I TGDDC+S+GD  + + I  VTCGPGHGIS+GSLG    E+ V+GI+V N  FIGT NG
Sbjct  215   IRTGDDCVSIGDDTKEVHIENVTCGPGHGISIGSLGGYATEKDVEGIYVKNYTFIGTGNG  274

Query  839   VRIKTWPNSHPGV-VTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYK  1015
             VR+KTWP +   + +T+++FE++ M NV NPI+IDQEYCP+N C + +PS +K++K++ K
Sbjct  275   VRVKTWPTTPAQLSITNLNFEDLIMDNVSNPIIIDQEYCPHNLCKRDRPSFIKINKVNLK  334

Query  1016  KISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPL  1189
              I GT+ +  AV L CS   PCE V +GDI+L   G  G   + C NV+P   GK  PP+
Sbjct  335   NIRGTTNSEEAVTLLCSKLKPCENVVVGDIDLKYNGNRGPVTTKCVNVQPTFVGKQNPPI  394

Query  1190  A  1192
              
Sbjct  395   C  395



>ref|XP_004295347.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=412

 Score =   367 bits (941),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 181/361 (50%), Positives = 243/361 (67%), Gaps = 7/361 (2%)
 Frame = +2

Query  128   KANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPP  307
             KA  D+  AL  AWK+ CA+T+ S ++IPKGT+P+ + E +GPCKAPIE+++   L+AP 
Sbjct  41    KAGSDISQALTNAWKDACASTSPSKIIIPKGTYPLKEAEFSGPCKAPIEMQLQGTLQAPE  100

Query  308   NPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNF--L  481
             +   +     W+   YI  FTLSGGG  DGQG  + + + +   K  K  + +++ F  +
Sbjct  101   DSTQLTKPDTWIGFLYISDFTLSGGGVFDGQG-AKAWKANDCQ-KNPKCSSTINIRFHQM  158

Query  482   TNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVI  661
               S+++D+T+LNSK FH N++G + LTFDH TV APG+SPNTDGIHI R  G+ + + VI
Sbjct  159   KKSLVKDITSLNSKNFHFNIIGAEQLTFDHVTVTAPGDSPNTDGIHIGRSNGVNITNCVI  218

Query  662   GTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGV  841
             GTGDDCIS+GDG + L I  VTCGPGHGISVGSLG+   E PV GIFV N     T NGV
Sbjct  219   GTGDDCISIGDGTKQLTIEKVTCGPGHGISVGSLGKYDNEEPVAGIFVKNCTISKTQNGV  278

Query  842   RIKTWPNSHPGV-VTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKK  1018
             R+KTWPN    +  +DIHFE+I M NV+NPIV+DQEYCP ++C K   S +K+S +S+K 
Sbjct  279   RVKTWPNGPSAITASDIHFEDIIMDNVQNPIVLDQEYCPYDQCDKSASSKIKISNVSFKN  338

Query  1019  ISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG-GAAKSICKNVKPKLTGKVVPPLAC  1195
             I GTSAT + V++ACS   PC++V + DI+L + G G   S C N KP +T  V   LAC
Sbjct  339   IRGTSATALGVKVACSKSNPCDQVVMSDIDLKLSGAGELTSQCTNTKPTIT-NVAKALAC  397

Query  1196  G  1198
              
Sbjct  398   A  398



>ref|XP_008381794.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=401

 Score =   366 bits (940),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 193/403 (48%), Positives = 253/403 (63%), Gaps = 20/403 (5%)
 Frame = +2

Query  32    NLKMATISYCAFTFILFMLAHFGESATINV-----AAKANVDVGPALLKAWKEGCAATTA  196
             +LK+  I    F F+L + +   +S   +V       KAN D+  AL KAW + CA+T+A
Sbjct  2     DLKLKNI-LSMFVFLLLVSSSNAQSGVYDVTGANYGGKANSDITQALSKAWTDACASTSA  60

Query  197   STVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLS  376
             S +V+P GT+        GPCK PIE ++   L+AP + K +  +  W+  + ID  TLS
Sbjct  61    SKIVVPSGTYKFVGATFKGPCKGPIEFQLQGTLQAPEHIKELPKEDTWVAFERIDGLTLS  120

Query  377   GGGTLDGQGNV-----QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNV  541
             GGGT DGQG         + +K+  FK      NL  NF+TNS++R +TT +SK FHVN+
Sbjct  121   GGGTFDGQGATAWKQNDCHKNKDCKFKA----VNLRFNFITNSIVRGITTKDSKNFHVNL  176

Query  542   LGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITG  721
             LG   L F  FTV AP  S NTDGIH+ R   I + D+ IGTGDDCIS+G G + L +T 
Sbjct  177   LGCNKLAFQDFTVSAPKESVNTDGIHMGRSTEINITDTTIGTGDDCISIGHGTKQLHVTN  236

Query  722   VTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS--HPGVVTDIHF  895
             VTCGPGHGIS+GSLGRT  E PV GIF+ N     TDNGVRIKTWP S      V+D+HF
Sbjct  237   VTCGPGHGISIGSLGRTEDEEPVSGIFIKNCTITNTDNGVRIKTWPASPAKGTAVSDVHF  296

Query  896   ENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGV  1075
             ++I M NVKNP+VIDQEYCP+  C+ +  S VK+S +S+K I G+S+ PV V+L CS  +
Sbjct  297   ZDIIMDNVKNPVVIDQEYCPHKLCTPEVSSKVKISNVSFKNIKGSSSGPVGVKLLCSGKL  356

Query  1076  PCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLACG  1198
             PCE VE+ +I+LT  G  G+  S CK+VKP +   V  PLAC 
Sbjct  357   PCENVELSNIDLTYTGDKGSITSECKHVKPTIN-NVAKPLACA  398



>ref|XP_009134996.1| PREDICTED: polygalacturonase-like [Brassica rapa]
 emb|CDX74029.1| BnaA03g30180D [Brassica napus]
Length=395

 Score =   365 bits (937),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 189/391 (48%), Positives = 254/391 (65%), Gaps = 7/391 (2%)
 Frame = +2

Query  56    YCAFTFILFMLAHFGESAT-INVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPM  232
             + AFT  +F L  F  +A  I + +    D+  ALLKA+   C + T S VVIPKG F +
Sbjct  5     FGAFTVFIFCLLGFSANAVYITIGSSPGSDITQALLKAFTTACQSPTPSRVVIPKGEFKL  64

Query  233   TQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQ  412
              ++++ GPCKAP+E+ I   +KA  N   + GK  W+    I+ F L+GGG  DG+GN  
Sbjct  65    GEIQMRGPCKAPVEITIQGTVKADGNA--IQGKDTWIVFGNINGFKLNGGGAFDGEGNAA  122

Query  413   VYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAP  589
                +   + F   KLP ++  +F+ N+ IRD++++++K FH+NVLG KN+T DH  + AP
Sbjct  123   WRVNNCHQTFNCKKLPISIRFDFVENAEIRDISSIDAKNFHINVLGAKNMTMDHINIIAP  182

Query  590   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  769
              +SPNTDGIH+ R  G+ + ++ I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR
Sbjct  183   KDSPNTDGIHLGRSDGVKILNTFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGR  242

Query  770   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQE  946
                E+ V GI V N     TDNG+RIKTWP++      +DIHFENI ++NV NPI+IDQE
Sbjct  243   YGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIILKNVMNPILIDQE  302

Query  947   YCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG-  1123
             YCP N+C+KQKPS +KL+ IS+K+I GTS    AV+L CS G PC+ VEIGDI++   G 
Sbjct  303   YCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSGA  362

Query  1124  -GAAKSICKNVKPKLTGKVVPPLACGK*TTL  1213
              G A   C NV PKL G   P    G  T L
Sbjct  363   DGPATFQCSNVSPKLMGTQSPKACSGPVTNL  393



>ref|XP_011097019.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=399

 Score =   365 bits (937),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/363 (52%), Positives = 249/363 (69%), Gaps = 11/363 (3%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK+  D+  AL+ AWKE C +T+ ST+VIP GT+ ++QV+L GP KAPIEL++   L+A 
Sbjct  34    AKSGGDISQALMDAWKEACNSTSPSTIVIPGGTWSLSQVKLLGPNKAPIELQVQGTLQA-  92

Query  305   PNPKNMDGKK-EWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKE--KGFKGDKLPNNLSLN  475
              NP  +  K+ EW+TI Y+++FTLSGGG  DG+G  + +   +  K     KLP NLS N
Sbjct  93    -NPGQLPNKEGEWITINYVNYFTLSGGGVFDGRGQ-EAWKQNDCHKNKNCAKLPMNLSFN  150

Query  476   FLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDS  655
             F+ NS+IRD+TT +SK FHVN +   N+TF  FTV APG+SPNTDGIH+ R   I +KDS
Sbjct  151   FVNNSIIRDVTTKDSKNFHVNCISSHNVTFLRFTVSAPGDSPNTDGIHLGRDTMINIKDS  210

Query  656   VIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDN  835
             +I TGDDC+S+GD  + + I  VTCGPGHGISVGSLG    E+ V+GI+V+N  FIGT N
Sbjct  211   IIKTGDDCVSIGDESKEIHIQNVTCGPGHGISVGSLGGYAEEKDVQGIYVTNCTFIGTTN  270

Query  836   GVRIKTWPNSHPGVVT--DIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKIS  1009
             GVR+KTWP S P  +T  D+HFE++ M NV +PI+IDQEYCP+N C K +PS +K++ + 
Sbjct  271   GVRVKTWP-SAPATLTVSDLHFEDLIMDNVSSPIIIDQEYCPHNLCKKDRPSSIKITNVR  329

Query  1010  YKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVP  1183
              + + GT+ T  AV   CS   PCE   +GDI+LT  G  G   + C NVKPK  GK  P
Sbjct  330   ERNVRGTTNTAEAVTFICSGLKPCERGGVGDIDLTYNGNQGPITTKCANVKPKFVGKQNP  389

Query  1184  PLA  1192
             P+ 
Sbjct  390   PVC  392



>ref|XP_006407791.1| hypothetical protein EUTSA_v10020866mg [Eutrema salsugineum]
 gb|ESQ49244.1| hypothetical protein EUTSA_v10020866mg [Eutrema salsugineum]
Length=398

 Score =   365 bits (937),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/380 (48%), Positives = 247/380 (65%), Gaps = 7/380 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
              +L +L +   +    V      D+  ALLKA+   C A   S V+IPKG + + ++ + 
Sbjct  11    LVLCLLGYSANAEVFRVPGAPGSDITQALLKAFTSACQAPAPSQVLIPKGEYKLGEIAMT  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCK+P+E+ +   +KA     NM GK+ W+  + I+ F L+GGG  DG+GN     +  
Sbjct  71    GPCKSPVEITLQGTVKAD---GNMQGKERWVVFEKINGFKLNGGGIFDGEGNAAWRTNNC  127

Query  428   EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  607
              K F+  KLP +L  +F+ N+ IRD+T+++SK FH+NV+ GKN+TFD+  + AP  SPNT
Sbjct  128   HKTFECKKLPISLRFDFVDNADIRDITSMDSKNFHINVISGKNMTFDNIKISAPAESPNT  187

Query  608   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  787
             DGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  V CGPGHGISVGSLGR   E  
Sbjct  188   DGIHLGRCDGVKILNSKIATGDDCISVGDGMKNLLVEKVVCGPGHGISVGSLGRYGFEED  247

Query  788   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNE  964
             V G+ V N   +GTDNG+RIKTWP++      + IHFE+I +QNV NPI+IDQEYCP N+
Sbjct  248   VAGVRVVNCTLVGTDNGLRIKTWPSAKCTTTASGIHFEDIILQNVSNPILIDQEYCPWNQ  307

Query  965   CSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKS  1138
             C+KQKPS +KL  IS++KI GTS    AV+L CS G+PCE VEIGDIN+  KG  G    
Sbjct  308   CNKQKPSTIKLVDISFRKIRGTSGNKDAVKLLCSKGIPCENVEIGDINIEYKGADGPPTF  367

Query  1139  ICKNVKPKLTGKVVPPLACG  1198
              C NV PKL G  VP    G
Sbjct  368   QCSNVNPKLVGTQVPKACSG  387



>ref|XP_004140444.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
 ref|XP_004157869.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=401

 Score =   365 bits (937),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/359 (51%), Positives = 252/359 (70%), Gaps = 8/359 (2%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK N D+  ALL AWK  CA+T+ S V+IPKG + ++Q  L GPCK+ IE+++   L+AP
Sbjct  34    AKPNTDITHALLNAWKGACASTSRSKVLIPKGIYLLSQSNLKGPCKSSIEIQVQGTLQAP  93

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFL  481
             P+PK  DG    + ++YID  TLSG G  DGQG      +   K     KLP  L  NF+
Sbjct  94    PDPKG-DG---LVILEYIDQLTLSGTGVFDGQGKAGWEKNDCHKKKICTKLPMTLKFNFV  149

Query  482   TNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVI  661
             TNS+++D+T+L+SK FH+N+LG KN+TF+H T+ AP NSPNTDGIHI+    I + ++ I
Sbjct  150   TNSIVKDITSLDSKNFHINLLGCKNITFEHVTISAPENSPNTDGIHISSSEQIRILNTKI  209

Query  662   GTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGV  841
              TGDDC+S+GD  +++ I  VTCGPGHGIS+GSLG+   E+ V+G++V+  K I T NGV
Sbjct  210   STGDDCVSVGDSNKDITIRDVTCGPGHGISIGSLGKYTKEKAVEGVWVTKCKLIKTTNGV  269

Query  842   RIKTWPNSHPGV-VTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKK  1018
             RIKTWP+S      +D+HFE+I+M +V NPI+IDQEYCP N+C+++ PS +K+SK+S+K 
Sbjct  270   RIKTWPDSAVKYSASDMHFEDIEMIDVSNPILIDQEYCPWNQCNRKIPSSIKISKVSFKN  329

Query  1019  ISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPL  1189
             I GT+ TPVAV+L CS  +PCE VE+ DI+L   G  G+  S C NVKP ++GK  P +
Sbjct  330   IRGTTVTPVAVKLVCSKSIPCEAVEVADIDLKYNGNKGSITSQCANVKPIISGKQNPRI  388



>gb|AAO62938.1| polygalactorunase PG11 precursor [Medicago sativa]
Length=407

 Score =   365 bits (936),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 190/381 (50%), Positives = 246/381 (65%), Gaps = 18/381 (5%)
 Frame = +2

Query  53    SYCAFTFILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPM  232
             ++CA   ++  ++ FG           N D+  A+  AWKE C +TTA+ ++IP GT+ M
Sbjct  16    NFCAVQSVVLDISKFG--------GAPNSDITQAIGNAWKEACLSTTAAKIMIPGGTYRM  67

Query  233   TQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQ  412
               VEL GPCKAPIE+++   ++AP +P  M    +W+   Y++H TLSG G  DGQG   
Sbjct  68    NGVELKGPCKAPIEVQVDGTIQAPADPSQMKAADQWIKFLYMEHLTLSGKGVFDGQG-AT  126

Query  413   VY----PSKEKGFKGD--KLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHF  574
             VY    P+     K    K+  NL   F+ NS++  LT+ +SK FHV VLG  N TFD F
Sbjct  127   VYKKAAPAAAWSGKNSNVKIFMNLGFMFVNNSMVHGLTSKDSKNFHVMVLGCNNFTFDGF  186

Query  575   TVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISV  754
             TV APG+SPNTDGIH+ R   I + ++ I TGDDCISLGDG   + +  V CGPGHGISV
Sbjct  187   TVTAPGDSPNTDGIHMGRSTDIKILNTNIATGDDCISLGDGSRKITVQNVKCGPGHGISV  246

Query  755   GSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--DIHFENIDMQNVKNP  928
             GSLG+   E  V+G+ V N     T NGVRIKTWP++ PG +T  DIHFE+I M NV NP
Sbjct  247   GSLGKYTTEDNVEGVIVKNCTLTATQNGVRIKTWPDA-PGTITVSDIHFEDIIMNNVMNP  305

Query  929   IVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDIN  1108
             ++IDQEYCP N+CSK+ PS +KLSKIS+K I GTS TP  V L CSSGVPC+ VE+ ++ 
Sbjct  306   VIIDQEYCPWNQCSKKNPSKIKLSKISFKNIQGTSGTPEGVVLICSSGVPCDGVELNNVG  365

Query  1109  LTIKGGAAKSICKNVKPKLTG  1171
             LT  G  A + C NVKP +TG
Sbjct  366   LTFNGKPAIAKCSNVKPLVTG  386



>ref|XP_004165943.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=405

 Score =   365 bits (936),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 193/402 (48%), Positives = 257/402 (64%), Gaps = 14/402 (3%)
 Frame = +2

Query  29    TNLKMATISYCAFTFILFMLAH----FGESATINVAAKANVDVGPALLKAWKEGCAATTA  196
             +NL + T      +FI+   +H    F      N+ + A  DV  AL  AW + CA+   
Sbjct  7     SNLLVTTFLMSLLSFIIESRSHVDVIFPLRKYGNIVSGA--DVTEALKDAWNDACASVRP  64

Query  197   STVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLS  376
             S VVIPKG F + + E  GPCK+PIE+++   L+AP +P        W+T  Y+D  TLS
Sbjct  65    SAVVIPKGIFKVREGEFKGPCKSPIEIRVRGTLQAPKHPHG----DSWITFAYVDRMTLS  120

Query  377   GGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGK  553
             GGG  DGQG      +   K      LP +L  +F+TNS+++ +T+L+SK FHVN+LG  
Sbjct  121   GGGVFDGQGKAGWEKNDCHKRIDCANLPISLRFDFITNSIVKRITSLDSKNFHVNILGCN  180

Query  554   NLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCG  733
             NLTF    + AP +SPNTDGIHI R IGI++  S I TGDDCISLGDG + +KIT VTCG
Sbjct  181   NLTFKGVNIIAPEDSPNTDGIHIGRSIGISILKSQIATGDDCISLGDGSKRVKITNVTCG  240

Query  734   PGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHFENIDM  910
             PGHGIS+GSLG+   E PV+G+ V N   + T NGVRIKTWP S + G+ TD+HF +I M
Sbjct  241   PGHGISIGSLGKYTNEEPVEGVIVKNCTIMNTTNGVRIKTWPASPNAGIATDMHFSDITM  300

Query  911   QNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEV  1090
              NV NPI+IDQEYCP N+C+++ PS +K++ +S+K I G+SATPVAV+L CSS  PCEEV
Sbjct  301   VNVSNPILIDQEYCPWNQCNREIPSNIKINNVSFKNIRGSSATPVAVKLICSSNQPCEEV  360

Query  1091  EIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLACGK*TT  1210
             ++ +I+L   G  G   S C NVKP ++G   P +     TT
Sbjct  361   KVANIDLVYNGINGPITSQCMNVKPIVSGIQNPSICSSSYTT  402



>ref|XP_008449697.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=403

 Score =   364 bits (934),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 187/360 (52%), Positives = 249/360 (69%), Gaps = 10/360 (3%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK N D+  AL  AWKE CA+TT S V+IPKGT+ +TQ  L GPCK+ IEL++   ++A 
Sbjct  36    AKPNADITAALASAWKEACASTTPSKVLIPKGTYGLTQSNLKGPCKSSIELQLEGTVQAS  95

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKG--DKLPNNLSLNF  478
              + K  DG    L ++Y+D  T+SG G +DGQG    +   +   K    KLP NL  NF
Sbjct  96    SDVKG-DG---LLLLEYVDQLTVSGTGVVDGQGKT-AWGKNDCHLKKICTKLPMNLKFNF  150

Query  479   LTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSV  658
             +TNS+++D+T+L+SK +H N+L  KNLTFDH T+ APGNSPNTDGIH+     I + ++ 
Sbjct  151   VTNSIVKDITSLDSKNYHFNLLACKNLTFDHVTITAPGNSPNTDGIHVGDSEQINILNTN  210

Query  659   IGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNG  838
             I TGDDCIS+G   + + I+ VTCGPGHGIS+GSLG+   E+ + G+ V   K  GT NG
Sbjct  211   IATGDDCISVGSSNKQIVISDVTCGPGHGISIGSLGKYTNEKELVGVTVKKCKLTGTTNG  270

Query  839   VRIKTWPNSHPGV-VTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYK  1015
             VRIKTWP+S      +D+HFE+I+M NV NP++IDQEYCP N+C+++ PS +K+SK+S+K
Sbjct  271   VRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVLIDQEYCPWNQCNRKVPSKIKISKVSFK  330

Query  1016  KISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPL  1189
              I GTSATPVAV+L CS   PCE VE+ DI+LT  G  G  KS C NVKP ++GK  PP+
Sbjct  331   NIRGTSATPVAVKLVCSQSNPCEGVEVADIDLTYSGSEGPIKSQCANVKPVISGKQNPPI  390



>gb|ABN13878.1| polygalacturonase [Brassica rapa subsp. oleifera]
Length=395

 Score =   363 bits (933),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 188/391 (48%), Positives = 254/391 (65%), Gaps = 7/391 (2%)
 Frame = +2

Query  56    YCAFTFILFMLAHFGESAT-INVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPM  232
             + AFT  +F L  F  +A  I + +    D+  ALLKA+   C + T S VVIPKG F +
Sbjct  5     FGAFTVFIFCLLGFSANAVYITIGSSPGSDITQALLKAFTTACQSPTPSRVVIPKGEFKL  64

Query  233   TQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQ  412
              ++++ GPCKAP+E+ I   +KA  N   + GK  W+    I+ F L+GGG  DG+GN  
Sbjct  65    GEIQMRGPCKAPVEITIQGTVKADGNA--IQGKDTWIVFGNINGFKLNGGGAFDGEGNAA  122

Query  413   VYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAP  589
                +   + F   KLP ++  +F+ N+ I+D++++++K FH+NVLG KN+T DH  + AP
Sbjct  123   WRVNNCHQTFNCKKLPISIRFDFVENAEIKDISSIDAKNFHINVLGAKNMTMDHINIIAP  182

Query  590   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  769
              +SPNTDGIH+ R  G+ + ++ I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR
Sbjct  183   KDSPNTDGIHLGRSDGVKILNTFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGR  242

Query  770   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQE  946
                E+ V GI V N     TDNG+RIKTWP++      +DIHFENI ++NV NPI+IDQE
Sbjct  243   YGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIILKNVMNPILIDQE  302

Query  947   YCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG-  1123
             YCP N+C+KQKPS +KL+ IS+K+I GTS    AV+L CS G PC+ VEIGDI++   G 
Sbjct  303   YCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSGA  362

Query  1124  -GAAKSICKNVKPKLTGKVVPPLACGK*TTL  1213
              G A   C NV PKL G   P    G  T L
Sbjct  363   DGPATFQCSNVSPKLMGTQSPKACSGPVTNL  393



>ref|XP_008349086.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score =   363 bits (933),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 190/388 (49%), Positives = 246/388 (63%), Gaps = 10/388 (3%)
 Frame = +2

Query  62    AFTFILFMLAHFGESATINV-----AAKANVDVGPALLKAWKEGCAATTASTVVIPKGTF  226
             AF F+L       E    +V      AK   D+  AL KAW + CA+   S VV+P GT+
Sbjct  10    AFLFLLSASKTQAEPGVFDVTSATYGAKPGSDITHALAKAWIDACASPAPSKVVVPSGTY  69

Query  227   PMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGN  406
              +T+    GPCKAPIE+++   L AP +   +     W+   +++  T+SGGG  DGQG 
Sbjct  70    MLTEASFKGPCKAPIEIQVQGKLTAPADGGKLTRPDTWVGFDHVNKLTVSGGGXFDGQGA  129

Query  407   VQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVK  583
             +    +   K      +  N+  NF+TNS I+D+T+L+SK FHVNVLG  N+TF    V 
Sbjct  130   LAWKKNDCNKNKDCKSIAINMRFNFVTNSTIQDITSLDSKNFHVNVLGCHNVTFQRVNVT  189

Query  584   APGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSL  763
             APG S NTDGIHI R  GI + D+ IGTGDDC+S+GDG + + +T VTCGPGHGISVGSL
Sbjct  190   APGESINTDGIHIGRSTGINITDAHIGTGDDCVSIGDGNKEITVTRVTCGPGHGISVGSL  249

Query  764   GRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVID  940
             GR P E PV GI V N     T NGVRIKTWP S   G+ +D+HFE+I M NV NP++ID
Sbjct  250   GRYPNEEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVLID  309

Query  941   QEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIK  1120
             Q+YCP N+C +  PS VK+S +S+K I G+SATP+AVQ+ CS G+PCE VE+ DI+LT  
Sbjct  310   QQYCPWNQCKQNVPSKVKISNVSFKNIKGSSATPLAVQIVCSGGIPCENVELADIDLTYN  369

Query  1121  G--GAAKSICKNVKPKLTGKVVPPLACG  1198
             G  G   S C NVKP +T +V   LAC 
Sbjct  370   GNKGPLTSQCSNVKPTIT-RVPNALACA  396



>ref|XP_004167279.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=404

 Score =   363 bits (932),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 192/403 (48%), Positives = 261/403 (65%), Gaps = 20/403 (5%)
 Frame = +2

Query  26    VTNLKMATISYC----AFTFILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATT  193
             VT   M+ +S+     +   ++F L  +G     N+ + A  DV  AL  AW + CA+  
Sbjct  11    VTTFLMSLLSFTIESRSHIDVIFPLEKYG-----NIVSGA--DVTEALKNAWNDACASVH  63

Query  194   ASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTL  373
              S VVIPKG F + + +  GPCK+PIE+++   L+AP +P        W+T  Y+D  TL
Sbjct  64    PSAVVIPKGIFKVREGKFKGPCKSPIEIRVRGTLQAPKHPYG----DSWITFAYVDRMTL  119

Query  374   SGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGG  550
             SGGG  DGQG      +   K      LP +L  +F+TNS++R +T+LNSK FHVN+LG 
Sbjct  120   SGGGVFDGQGKTGWEKNDCHKRIDCANLPISLRFDFITNSIVRRITSLNSKNFHVNILGC  179

Query  551   KNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTC  730
              NLTF    + AP +SPNTDGIHI R IGI++  S I TGDDCISLGDG + +K+  VTC
Sbjct  180   NNLTFQGVNIIAPEDSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKQVKVANVTC  239

Query  731   GPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHFENID  907
             GPGHGIS+GSLG+   E PV+G+ V N   I T NGVRIKTWP S   G+ T++HF +I 
Sbjct  240   GPGHGISIGSLGKYTNEEPVEGVIVKNCTIINTTNGVRIKTWPTSPAAGIATNMHFSDIT  299

Query  908   MQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEE  1087
             M NV NPI+IDQEYCP N+C+++ PS +K++K+S++ I G+SATPVAV+L CSS +PC+E
Sbjct  300   MVNVSNPILIDQEYCPWNQCNREIPSNIKINKVSFENIRGSSATPVAVKLICSSNLPCDE  359

Query  1088  VEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLACGK*TT  1210
             V++ +I+L   G  G+  S C NVKP ++G +  P  C   TT
Sbjct  360   VKVANIDLIYNGINGSITSQCMNVKPIISG-IQNPSICSSYTT  401



>gb|ADK92878.1| polygalacturonase [Hypericum perforatum]
Length=398

 Score =   363 bits (932),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 181/365 (50%), Positives = 239/365 (65%), Gaps = 8/365 (2%)
 Frame = +2

Query  92    HFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPI  271
             H+G      V      D   A+ KAWK+ CAAT A+T+ I KG + ++++   GPCK+P+
Sbjct  31    HYG------VKVDGKTDDSQAINKAWKDACAATNATTLRIGKGNYMVSKMAFQGPCKSPL  84

Query  272   ELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGD  448
              +      KAP N KN    +EW++   ++  TL GGGT DGQG V    +   K  K  
Sbjct  85    TVDFQGTFKAPSNAKNYK-NQEWVSFTNLNGLTLFGGGTFDGQGAVAWSINNCAKTGKCG  143

Query  449   KLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIAR  628
              LPNNL +  LTNS+IRD+T+L+SKLFH+N++  KNLT +  T+ AP +S NTDGIHI R
Sbjct  144   SLPNNLRMTGLTNSIIRDITSLDSKLFHINIINCKNLTLERITITAPESSLNTDGIHIGR  203

Query  629   IIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVS  808
               G+ +  + I TGDDC+S+GDG + + I  VTCGPGHGIS+GSLGR   E+PV GI V 
Sbjct  204   STGVNITSATIKTGDDCVSIGDGAQQINIEKVTCGPGHGISIGSLGRYHDEQPVVGITVK  263

Query  809   NSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSL  988
             N     T NGVRIKTWP S  G+ +++ FENI M NV NPI+IDQ+YCP ++C  + PS 
Sbjct  264   NCTLTSTMNGVRIKTWPASPSGLASNMRFENIIMNNVSNPIMIDQQYCPYSQCEAKIPSR  323

Query  989   VKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKGGAAKSICKNVKPKLT  1168
             VK+S +S+  I GTSAT +AV+L CS G+PC+ V +GDINL    G A S C NVKP++ 
Sbjct  324   VKISDVSFSGIRGTSATQLAVKLVCSKGIPCQNVAVGDINLAYNKGQATSQCANVKPQVR  383

Query  1169  GKVVP  1183
             G VVP
Sbjct  384   GSVVP  388



>ref|XP_010657416.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/355 (49%), Positives = 229/355 (65%), Gaps = 2/355 (1%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             A  N D+  ALLKAW + C++  ASTV+ P G   + Q+ + GPCK PI   +   +KA 
Sbjct  37    ADGNTDISQALLKAWGDACSSPVASTVMTPDGXHALGQITIGGPCKDPINFIVQGSVKAL  96

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLT  484
              +         W+  + ID FTLSGGG  DGQG              ++LP NL  NF+T
Sbjct  97    MDTSRFKAXAGWIAFRQIDQFTLSGGGVFDGQGKTVWGTKCPSSAYCNQLPINLRFNFIT  156

Query  485   NSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIG  664
             NS+++++T+ +S  FH+N+LG KNLTF +  + AP    NTDGIHI R +GI +  S I 
Sbjct  157   NSMVKNITSRDSNQFHINLLGCKNLTFYNVAISAPEERLNTDGIHIGRSLGINITYSTIE  216

Query  665   TGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVR  844
             TGDDC+S+GDG E + +  VTCGPGHG SVGSLG+ P E PV GI V N     T NGVR
Sbjct  217   TGDDCVSIGDGSEQINMQRVTCGPGHGTSVGSLGKYPNEEPVVGISVKNCTRTNTQNGVR  276

Query  845   IKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKIS  1024
             +KTWP SH G  + +HFE+I M NV NPI+IDQEYCP+N+C+ + PS + LS +S++ I 
Sbjct  277   VKTWPASHQGTASXMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKIPSRIMLSNVSFRNIR  336

Query  1025  GTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVP  1183
             GT++T VAV+L CS GVPCE+ E+GDINL   G  G A S CKN+KP L G  +P
Sbjct  337   GTTSTQVAVKLVCSQGVPCEDAELGDINLKYNGKVGHAMSQCKNIKPNLLGTQLP  391



>ref|XP_008391258.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 190/388 (49%), Positives = 246/388 (63%), Gaps = 10/388 (3%)
 Frame = +2

Query  62    AFTFILFMLAHFGESATINVA-----AKANVDVGPALLKAWKEGCAATTASTVVIPKGTF  226
             AF F+L       E    +V      AK   D+  AL KAW + CA+   S VV+P GT+
Sbjct  10    AFLFLLSASKTQAEPGVFDVTSATYGAKPGSDITHALAKAWIDACASPAPSKVVVPSGTY  69

Query  227   PMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGN  406
              +T+    GPCKAPIE+++   L AP +   +     W+   +++  T+SGGGT DGQG 
Sbjct  70    MLTEASFKGPCKAPIEIQVQGKLTAPADGGKLTRPDTWVGFDHVNKLTVSGGGTFDGQGA  129

Query  407   VQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVK  583
             +    +   K      +  N+  NF+TNS I+D+T+L+SK FHVNVLG  N+TF    V 
Sbjct  130   LAWKKNDCNKNKDCKSIAINMRFNFVTNSTIQDITSLDSKNFHVNVLGCHNVTFXRVNVT  189

Query  584   APGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSL  763
             AP  S NTDGIHI R  GI + D+ IGTGDDC+S+GDG + + +T VTCGPGHGISVGSL
Sbjct  190   APXESINTDGIHIGRSTGINITDAHIGTGDDCVSIGDGNKEITVTRVTCGPGHGISVGSL  249

Query  764   GRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVID  940
             GR P E PV GI V N     T NGVRIKTWP S   G+ +D+HFE+I M NV NP++ID
Sbjct  250   GRYPNEEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVLID  309

Query  941   QEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIK  1120
             Q+YCP N+C +  PS VK+S +S+K I G+SATP+AVQ+ CS G+PCE VE+ DI+LT  
Sbjct  310   QQYCPWNQCKQNVPSKVKISNVSFKNIKGSSATPLAVQIVCSGGIPCENVELADIDLTYN  369

Query  1121  G--GAAKSICKNVKPKLTGKVVPPLACG  1198
             G  G   S C NVKP +T +V   LAC 
Sbjct  370   GNKGPLTSQCSNVKPTIT-RVPNALACA  396



>ref|NP_187441.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21194.1|AC013483_18 putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE74610.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=401

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 193/388 (50%), Positives = 252/388 (65%), Gaps = 10/388 (3%)
 Frame = +2

Query  53    SYCAFTFILFMLAHFGESA---TINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGT  223
             SY   + +LF+++  G SA     NV      D+  ALLKA+   C A TAS VVI KG 
Sbjct  3     SYLGISAVLFVISLLGFSANAEVFNVGGSPGSDITQALLKAFTSACQAPTASKVVITKGE  62

Query  224   FPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQG  403
             F + ++E+ GPCKAP+E+ +   LKA  + K + GK+ W+    I+ F L+GGG  DG+G
Sbjct  63    FKLGEIEMTGPCKAPVEINLQGTLKA--DGKAIQGKERWVVFLRINGFKLNGGGIFDGEG  120

Query  404   NVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTV  580
             N     +   K F+  KLP ++  +F+ N+ IRD++++++K FH+NVLG KN+TFD+  V
Sbjct  121   NAAWRVNNCHKTFECKKLPISIRFDFVENAEIRDISSIDAKNFHINVLGAKNMTFDNVKV  180

Query  581   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  760
              AP  SPNTDGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  V CGPGHGISVGS
Sbjct  181   IAPAESPNTDGIHLGRSEGVKILNSKIATGDDCISVGDGMKNLHVENVMCGPGHGISVGS  240

Query  761   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPG-VVTDIHFENIDMQNVKNPIVI  937
             LGR   E+ V GI V N    GTDNG+RIKTWP++      + IHFENI + NV NPI+I
Sbjct  241   LGRYVHEQDVTGITVVNCTLQGTDNGLRIKTWPSAACATTASGIHFENIILNNVSNPILI  300

Query  938   DQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTI  1117
             DQEYCP N+C+KQKPS +KL  IS+K I GTS    AV+L CS   PC  VEIG+INL  
Sbjct  301   DQEYCPWNQCNKQKPSTIKLVDISFKNIRGTSGNKDAVKLLCSKAHPCANVEIGNINLEY  360

Query  1118  KG--GAAKSICKNVKPKLTGKVVPPLAC  1195
             KG  G    +C NV PKL G    P AC
Sbjct  361   KGADGPPTFMCSNVSPKLVG-TQNPKAC  387



>ref|XP_008449696.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Cucumis 
melo]
Length=404

 Score =   362 bits (929),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 187/360 (52%), Positives = 249/360 (69%), Gaps = 10/360 (3%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK N D+  AL  AWKE CA+TT S V+IPKGT+ +TQ  L GPCK+ IEL++   ++A 
Sbjct  37    AKPNADITAALASAWKEACASTTPSKVLIPKGTYGLTQSNLKGPCKSSIELQLEGTVQAS  96

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKG--DKLPNNLSLNF  478
              + K  DG    L ++Y+D  T+SG G +DGQG    +   +   K    KLP NL  NF
Sbjct  97    VDVKG-DG---LLLLEYVDQLTVSGTGVVDGQGKT-AWGKNDCHLKKICTKLPMNLKFNF  151

Query  479   LTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSV  658
             +TNS+++D+T+L+SK +H N+L  KNLTFDH T+ APGNSPNTDGIH+     I + ++ 
Sbjct  152   VTNSIVKDITSLDSKNYHFNLLACKNLTFDHVTITAPGNSPNTDGIHVGDSEQINILNTN  211

Query  659   IGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNG  838
             I TGDDCIS+G   + + I+ VTCGPGHGIS+GSLG+   E+ + G+ V   K  GT NG
Sbjct  212   IATGDDCISVGISNKQIVISDVTCGPGHGISIGSLGKYTNEKELVGVTVKKCKLTGTTNG  271

Query  839   VRIKTWPNSHPGV-VTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYK  1015
             VRIKTWP+S      +D+HFE+I+M NV NP++IDQEYCP N+C+++ PS +K+SK+S+K
Sbjct  272   VRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVLIDQEYCPWNQCNRKVPSKIKISKVSFK  331

Query  1016  KISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPL  1189
              I GTSATPVAV+L CS   PCE VE+ DI+LT  G  G  KS C NVKP ++GK  PP+
Sbjct  332   NIRGTSATPVAVKLVCSQSNPCEGVEVADIDLTYSGSEGPIKSQCANVKPVISGKQNPPI  391



>ref|XP_004490643.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=394

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/350 (51%), Positives = 233/350 (67%), Gaps = 4/350 (1%)
 Frame = +2

Query  134   NVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNP  313
             N D+  AL  AWKE C + + S VV+P G + + Q++L GPCKAPIE+K+  I++AP NP
Sbjct  37    NGDITNALKNAWKEACESRSRSKVVVPSGRYKLQQIDLEGPCKAPIEVKVNGIIQAPKNP  96

Query  314   KNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTN  487
              +++G+ +W+  +YI+ FTLSG GT DGQG +  +   + G   +  +L  N    FL N
Sbjct  97    FHLNGQDQWIRFQYINFFTLSGKGTFDGQGEM-AWKQNDCGRNTNCKRLAMNFGFAFLNN  155

Query  488   SVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGT  667
             SVI+D+ + +SK FH NV G  N+TF +F + AP +SPNTDGIHI +   + + +S IG+
Sbjct  156   SVIKDINSKDSKYFHANVFGCNNVTFTNFNINAPESSPNTDGIHIGKSSRVKISNSKIGS  215

Query  668   GDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRI  847
             GDDCISLGDG   + I  VTCGPGHGISVGSLG+ P E PV  + V N     TDNGVRI
Sbjct  216   GDDCISLGDGSTQITIQNVTCGPGHGISVGSLGKYPNEDPVVDLIVKNCTLNNTDNGVRI  275

Query  848   KTWP-NSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKIS  1024
             KTWP  S   + + +HFE+I M NV NPI+IDQ+YCP N+CSKQ PS +K+ K+ +K I 
Sbjct  276   KTWPGTSVISIASHLHFEDIVMVNVSNPIIIDQQYCPWNQCSKQSPSKIKIRKVIFKNIR  335

Query  1025  GTSATPVAVQLACSSGVPCEEVEIGDINLTIKGGAAKSICKNVKPKLTGK  1174
             GTSAT   V L CS GVPCE V + DINL+  G    + C NV PK+  K
Sbjct  336   GTSATQEGVSLICSRGVPCEAVVLSDINLSFNGSEVTAKCANVNPKIRRK  385



>ref|XP_007142511.1| hypothetical protein PHAVU_008G286900g [Phaseolus vulgaris]
 gb|ESW14505.1| hypothetical protein PHAVU_008G286900g [Phaseolus vulgaris]
Length=383

 Score =   361 bits (926),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 178/371 (48%), Positives = 243/371 (65%), Gaps = 3/371 (1%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAA-KANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVEL  247
             F+L  ++   +S  I++     N D+  A  KAWKE CA+T+AS ++I  G + M  V +
Sbjct  7     FLLLTISCTAQSTVIDIKKFGRNKDITQAFTKAWKEACASTSASKILISSGEYKMNAVNV  66

Query  248   AGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK  427
              GPCKA +E+++   ++AP +P  +    EW+ I+Y+D FTLSG GT DG+G +    + 
Sbjct  67    KGPCKASVEIQVDGTIQAPADPYALKDAYEWIKIEYVDSFTLSGKGTFDGKGAIAWKHNN  126

Query  428   EKGFKGDKLPN-NLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPN  604
              +  +  K  + N   NFL NS++R +T+ +SK FHVNVLG  N TFD+F + AP  S N
Sbjct  127   CRTHQNCKRNSMNFGFNFLNNSIVRGVTSKDSKNFHVNVLGCNNFTFDNFHISAPETSIN  186

Query  605   TDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGER  784
             TDGIHI R   + V +S I TGDDC+SLGDG   + I  V CGPGHGISVGSLG+  GE 
Sbjct  187   TDGIHIGRSTNVKVLNSNIATGDDCVSLGDGSREVIIKNVKCGPGHGISVGSLGKYAGEE  246

Query  785   PVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNN  961
             PV+ + V N    GTDNGVRIKTWPN+     VT++HFE+  M NV +P++IDQEYCP N
Sbjct  247   PVENLLVKNCTMTGTDNGVRIKTWPNTAVVTTVTNMHFEDFTMVNVLHPVIIDQEYCPWN  306

Query  962   ECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKGGAAKSI  1141
             +CSK+ PS +K+SK+++K I GTS +   V L CS  VPCE VE+ +++LT  G    + 
Sbjct  307   QCSKENPSKIKISKVTFKNIKGTSRSKEGVTLICSRSVPCEGVELSEVSLTYNGAPIVAK  366

Query  1142  CKNVKPKLTGK  1174
             C NVKPK+TGK
Sbjct  367   CVNVKPKITGK  377



>ref|XP_003595656.1| Polygalactorunase PG11 [Medicago truncatula]
 gb|AES65907.1| polygalacturonase 11c, putative [Medicago truncatula]
Length=407

 Score =   361 bits (927),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 187/379 (49%), Positives = 243/379 (64%), Gaps = 16/379 (4%)
 Frame = +2

Query  56    YCAFTFILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMT  235
             +CA   ++  ++ FG           N D+  AL  AWKE CA+TTAS +VIP GT+ M 
Sbjct  17    FCAVQSLVLDISKFG--------GAPNSDITLALGNAWKEACASTTASKIVIPGGTYKMG  68

Query  236   QVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV--  409
              +EL GPCKAPIE+++   ++AP +P  +    +W+   Y++H TLSG G  DGQG    
Sbjct  69    GIELKGPCKAPIEVQVDGTIQAPADPSQIKAADQWVKFLYMEHLTLSGKGVFDGQGATAY  128

Query  410   -QVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTV  580
              Q  P+     K    K+  NL   F+ NS++  +T+ +SK FHV VLG  N TFD FTV
Sbjct  129   KQAQPAAAWSGKKSNVKILMNLGFMFVNNSMVTGVTSKDSKNFHVMVLGCNNFTFDGFTV  188

Query  581   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  760
              AP +SPNTDGIH+ R   + + ++ IGTGDDC+SLGDG   + + GV CGPGHGISVGS
Sbjct  189   TAPSDSPNTDGIHMGRSTDVKILNTNIGTGDDCVSLGDGSRKITVQGVKCGPGHGISVGS  248

Query  761   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--DIHFENIDMQNVKNPIV  934
             LGR   E  V+G+ V N     T NGVRIKTWP++ PG +T  DIHFE+I M NV NPI+
Sbjct  249   LGRYTTEDNVEGVTVKNCTLTATQNGVRIKTWPDA-PGTITVSDIHFEDITMNNVTNPII  307

Query  935   IDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLT  1114
             IDQEYCP N C+K+ PS VKLSKIS+K I GTS  P  V L CSS VPC+ VE+ ++++ 
Sbjct  308   IDQEYCPWNACNKKVPSKVKLSKISFKNIQGTSGAPEGVVLVCSSAVPCDGVELNNVDVK  367

Query  1115  IKGGAAKSICKNVKPKLTG  1171
               G  A + C NVKP +TG
Sbjct  368   FNGKPAIAKCSNVKPTVTG  386



>gb|ABL63521.1| pollen-specific protein MF9l [Brassica oleracea var. alboglabra]
Length=395

 Score =   361 bits (926),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 188/391 (48%), Positives = 253/391 (65%), Gaps = 7/391 (2%)
 Frame = +2

Query  56    YCAFTFILFMLAHFGESATINVAAKANV-DVGPALLKAWKEGCAATTASTVVIPKGTFPM  232
             + AFT  +F L  F  +A       ++  D+  ALLKA+   C + T S VVIPKG F +
Sbjct  5     FGAFTVFIFCLLGFSANAVYISIGSSSGSDITQALLKAFTTACQSPTPSRVVIPKGEFKL  64

Query  233   TQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQ  412
              ++++ GPCKAP+E+ I   +KA  N   + GK  W+    I+ F L+GGG  DG+GN  
Sbjct  65    GEIQMRGPCKAPVEITIQGTVKADGNA--IQGKDTWIVFGNINGFKLNGGGAFDGEGNAA  122

Query  413   VYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAP  589
                +   + F   KLP ++  +F+ N+ IRD++++++K FH+NVLG KN+T DH  + AP
Sbjct  123   WRVNNCHQTFNCKKLPISIRFDFVENAEIRDISSIDAKNFHINVLGAKNMTMDHINIIAP  182

Query  590   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  769
              +SPNTDGIH+ R  G+ + ++ I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR
Sbjct  183   KDSPNTDGIHLGRSDGVKILNTFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGR  242

Query  770   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQE  946
                E+ V GI V N     TDNG+RIKTWP++      +DIHFENI ++NV NPI+IDQE
Sbjct  243   YGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIIVKNVMNPILIDQE  302

Query  947   YCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG-  1123
             YCP N+C+KQKPS +KL+ IS+K+I GTS    AV+L CS G PC+ VEIGDI++   G 
Sbjct  303   YCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYNGA  362

Query  1124  -GAAKSICKNVKPKLTGKVVPPLACGK*TTL  1213
              G A   C NV PKL G   P    G  T L
Sbjct  363   DGPATFQCSNVSPKLMGTQSPKACSGPVTNL  393



>ref|XP_002865611.1| hypothetical protein ARALYDRAFT_494865 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41870.1| hypothetical protein ARALYDRAFT_494865 [Arabidopsis lyrata subsp. 
lyrata]
Length=395

 Score =   360 bits (925),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 185/386 (48%), Positives = 252/386 (65%), Gaps = 8/386 (2%)
 Frame = +2

Query  41    MATISYCAFTFILFMLAHFGESATI-NVAAKANVDVGPALLKAWKEGCAATTASTVVIPK  217
             M  + +    F +F L     +A + N+ +    D+  ALLKA+ E C   T STV+IPK
Sbjct  1     MGRVHFGVSAFFVFCLLGLSANAKVFNIGSPPGSDITNALLKAFNEACQFPTKSTVLIPK  60

Query  218   GTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDG  397
             G + + ++ + GPCKAPI + +   +KA     N +GK++W+  + ID F L+GGG  DG
Sbjct  61    GEYKLGEIVMMGPCKAPIRIALQGTVKAD---GNANGKEKWVAFRNIDGFKLNGGGVFDG  117

Query  398   QGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHF  574
             +GN     +   K F   KLP ++  +F+TN+ IR +T+L++K FH+NV+G KN+TF+  
Sbjct  118   EGNAAWRVNNCHKTFNCKKLPISIRFDFVTNAKIRGITSLDAKNFHINVIGAKNMTFEDV  177

Query  575   TVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISV  754
              + AP  SPNTDGIH+ R  GI + +S I TGDDC+S+GDG++NL +  VTCGPGHGIS+
Sbjct  178   KIIAPAESPNTDGIHVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISI  237

Query  755   GSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPI  931
             GSLGR   E  V GI + N     TDNG+RIKTWP++      +DIHFENI ++NV NPI
Sbjct  238   GSLGRYSHEENVSGIKIINCTLQETDNGLRIKTWPSAACTTTASDIHFENILLKNVSNPI  297

Query  932   VIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINL  1111
             +IDQEYCP N+C+KQKPS +KL+ IS+KKI GTS    AV+L CS G PC+ VE+GDIN+
Sbjct  298   LIDQEYCPWNQCNKQKPSTIKLANISFKKIRGTSGNKDAVKLLCSKGHPCQNVEVGDINI  357

Query  1112  TIKG--GAAKSICKNVKPKLTGKVVP  1183
                G  G A   C NV PKL G  +P
Sbjct  358   KYTGADGPATFQCSNVSPKLVGTQIP  383



>sp|Q6H9K0.1|PGLR2_PLAAC RecName: Full=Exopolygalacturonase; AltName: Full=Pollen allergen 
Pla a 2; AltName: Allergen=Pla a 2; Flags: Precursor, partial 
[Platanus x acerifolia]
 emb|CAE52833.1| polygalacturonase [Platanus x acerifolia]
Length=377

 Score =   360 bits (923),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 183/369 (50%), Positives = 247/369 (67%), Gaps = 15/369 (4%)
 Frame = +2

Query  116   NVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCK-APIELKIMAI  292
             +  AK   D+  A++KAWK  CA+   STV+IPKG + M +V + GPCK + I  +I  +
Sbjct  14    DYGAKGAGDISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGPCKGSKIGFQIDGV  73

Query  293   LKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPN----  460
             +KAP +P        W++   ID  T+SG GTLDGQG  Q   +K      DK PN    
Sbjct  74    VKAPADPSKFK-SDGWVSFYRIDGLTVSGTGTLDGQG--QTAWAKNNC---DKNPNCKHA  127

Query  461   --NLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARII  634
               NL  +FL ++++RD+T+LNSK+FH+NVL  +++TF H TV APG S NTDGIH+    
Sbjct  128   AMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDGIHVGISK  187

Query  635   GITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNS  814
             G+T+ ++ I TGDDCIS+G G +N+ IT V CGPGHGIS+GSLGR   E+ V+GI V   
Sbjct  188   GVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVRGITVKGC  247

Query  815   KFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVK  994
              F GT NGVR+KTWPNS PG  TD+ F+++ M NV+NP+++DQEYCP  +CS+Q PS +K
Sbjct  248   TFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCSRQAPSRIK  307

Query  995   LSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIK--GGAAKSICKNVKPKLT  1168
             LS I++  I GTS   VAV +ACS G+PC  ++IG+INL+ +  GG A S C NVKP  +
Sbjct  308   LSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCSNVKPTFS  367

Query  1169  GKVVPPLAC  1195
             GK VP + C
Sbjct  368   GKQVPAIKC  376



>gb|EYU42735.1| hypothetical protein MIMGU_mgv1a007533mg [Erythranthe guttata]
Length=404

 Score =   360 bits (924),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 183/385 (48%), Positives = 255/385 (66%), Gaps = 13/385 (3%)
 Frame = +2

Query  74    ILFMLAHFGESATINVAAKANV-----DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQ  238
              L  LA+  ES T+   +K        D+ P L K WKE C AT AS V+IPKGT+ ++Q
Sbjct  14    FLPFLAYHAESVTVFDISKYGAKPGGEDISPVLAKVWKEACEATNASKVLIPKGTWYLSQ  73

Query  239   VELAGPCKAPIELKIMAILKAPPNPKNMDGKK-EWLTIKYIDHFTLSGGGTLDGQGNVQV  415
             + L GP KAP+EL++   ++A P+   +  K  +W+TI Y+D FT+SGGG  DG+G  Q 
Sbjct  74    IRLVGPNKAPLELEVQGTVEANPDYTKLPQKDGQWITINYLDGFTISGGGVFDGKGE-QA  132

Query  416   YPSKE--KGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAP  589
             + + +  K     KLP NLSLNF+ N++I+D+TT +SK FH N +  +N+TF  FT+ AP
Sbjct  133   WKANDCHKNPNCPKLPINLSLNFIKNAIIKDVTTKDSKNFHCNCISSQNVTFQRFTISAP  192

Query  590   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  769
             G S NTDGIHIAR+  + V DS IGTGDDCIS+GD   +L I  V CGPGHGISVGS+G+
Sbjct  193   GESINTDGIHIARVSNVKVLDSNIGTGDDCISIGDETTDLHIENVKCGPGHGISVGSMGK  252

Query  770   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHFENIDMQNVKNPIVIDQE  946
              P E+ V GI V    F GT NGVR+KTWPN+   + ++++HFE++ M NV  P+VIDQ+
Sbjct  253   NPAEKDVTGITVKKCTFTGTSNGVRVKTWPNAPATLKISNLHFEDLTMNNVSYPVVIDQQ  312

Query  947   YCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKGG  1126
             YCP N C+K KPSL+++S ++ K + GT+ T  A+  +CSS  PC+ V+I DI+L     
Sbjct  313   YCPWNLCTKDKPSLIQISGLTVKNVRGTANTKEALLFSCSSSKPCQNVQISDIDLKYVNS  372

Query  1127  AAK---SICKNVKPKLTGKVVPPLA  1192
                   ++C+NVKP ++GK +PP+ 
Sbjct  373   IPANFTTVCENVKPTVSGKQIPPIC  397



>emb|CDY07974.1| BnaC03g35490D [Brassica napus]
Length=395

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 187/391 (48%), Positives = 253/391 (65%), Gaps = 7/391 (2%)
 Frame = +2

Query  56    YCAFTFILFMLAHFGESATINVAAKANV-DVGPALLKAWKEGCAATTASTVVIPKGTFPM  232
             + AFT  +F L  F  +A       ++  D+  AL+KA+   C + T S VVIPKG F +
Sbjct  5     FGAFTVFIFCLLGFSANAVYISIGSSSGSDITQALVKAFTTACQSPTPSRVVIPKGEFKL  64

Query  233   TQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQ  412
              ++++ GPCKAP+E+ I   +KA  N   + GK  W+    I+ F L+GGG  DG+GN  
Sbjct  65    GEIQMRGPCKAPVEITIQGTVKADGNA--IQGKDTWIVFGNINGFKLNGGGAFDGEGNAA  122

Query  413   VYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAP  589
                +   + F   KLP ++  +F+ N+ IRD++++++K FH+NVLG KN+T DH  + AP
Sbjct  123   WRVNNCHQTFNCKKLPISIRFDFVENAEIRDISSIDAKNFHINVLGAKNMTMDHINIIAP  182

Query  590   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  769
              +SPNTDGIH+ R  G+ + ++ I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR
Sbjct  183   KDSPNTDGIHLGRSDGVKILNTFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGR  242

Query  770   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQE  946
                E+ V GI V N     TDNG+RIKTWP++      +DIHFENI ++NV NPI+IDQE
Sbjct  243   YGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIIVKNVMNPILIDQE  302

Query  947   YCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG-  1123
             YCP N+C+KQKPS +KL+ IS+K+I GTS    AV+L CS G PC+ VEIGDI++   G 
Sbjct  303   YCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYNGA  362

Query  1124  -GAAKSICKNVKPKLTGKVVPPLACGK*TTL  1213
              G A   C NV PKL G   P    G  T L
Sbjct  363   DGPATFQCSNVSPKLMGTQSPKACSGPVTNL  393



>gb|ABG38468.1| pollen-expressed protein MF9c [Brassica oleracea]
Length=395

 Score =   359 bits (922),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 187/391 (48%), Positives = 253/391 (65%), Gaps = 7/391 (2%)
 Frame = +2

Query  56    YCAFTFILFMLAHFGESATINVAAKANV-DVGPALLKAWKEGCAATTASTVVIPKGTFPM  232
             + AFT  +F L  F  +A       ++  D+  AL+KA+   C + T S VVIPKG F +
Sbjct  5     FGAFTVFIFCLLGFSANAVYISIGSSSGSDITQALVKAFTTACQSPTPSRVVIPKGEFKL  64

Query  233   TQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQ  412
              ++++ GPCKAP+E+ I   +KA  N   + GK  W+    I+ F L+GGG  DG+GN  
Sbjct  65    GEIQMRGPCKAPVEITIQGTVKADGNA--IQGKDTWIVFGNINGFKLNGGGAFDGEGNAA  122

Query  413   VYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAP  589
                +   + F   KLP ++  +F+ N+ IRD++++++K FH+NVLG KN+T DH  + AP
Sbjct  123   WRVNNCHQTFNCKKLPISVRFDFVENAEIRDISSIDAKNFHINVLGAKNMTMDHINIIAP  182

Query  590   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  769
              +SPNTDGIH+ R  G+ + ++ I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR
Sbjct  183   KDSPNTDGIHLGRSDGVKILNTFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGR  242

Query  770   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQE  946
                E+ V GI V N     TDNG+RIKTWP++      +DIHFENI ++NV NPI+IDQE
Sbjct  243   YGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIIVKNVMNPILIDQE  302

Query  947   YCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG-  1123
             YCP N+C+KQKPS +KL+ IS+K+I GTS    AV+L CS G PC+ VEIGDI++   G 
Sbjct  303   YCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSGA  362

Query  1124  -GAAKSICKNVKPKLTGKVVPPLACGK*TTL  1213
              G A   C NV PKL G   P    G  T L
Sbjct  363   DGPATFQCSNVSPKLMGTQSPKACSGPVTNL  393



>gb|EYU42734.1| hypothetical protein MIMGU_mgv1a007528mg [Erythranthe guttata]
Length=404

 Score =   359 bits (921),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 185/398 (46%), Positives = 258/398 (65%), Gaps = 13/398 (3%)
 Frame = +2

Query  35    LKMATISYCAFTFILFMLAHFGESATINVAAKANV-----DVGPALLKAWKEGCAATTAS  199
             +++  I        L  LA+  ES TI   +K        D+ P L K WKE C AT AS
Sbjct  1     MEIKLIFSAVLLVFLPFLAYHAESVTIFDISKYGAKPGGDDISPVLAKVWKEACEATNAS  60

Query  200   TVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKK-EWLTIKYIDHFTLS  376
              V+IPKGT+ ++Q+ L GP KAP+EL++   ++A P+   +  K  +W+TI Y+D FT+S
Sbjct  61    KVLIPKGTWYLSQIRLVGPNKAPLELEVQGTVEANPDYTKLPQKDGQWITINYLDGFTIS  120

Query  377   GGGTLDGQGNVQVYPSKE--KGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGG  550
             GGG  DG+G  Q + + +  K     KLP NLSLNF+ N++I+D+TT +SK FH N +  
Sbjct  121   GGGVFDGKGE-QAWKANDCHKNPNCPKLPINLSLNFIKNAIIKDVTTKDSKNFHCNCISS  179

Query  551   KNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTC  730
             +N+TF  FT+ APG S NTDGIHIAR+  + V DS IGTGDDCIS+GD   +L I  V C
Sbjct  180   QNVTFQRFTISAPGESINTDGIHIARVSNVKVLDSDIGTGDDCISIGDETTDLHIENVKC  239

Query  731   GPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHFENID  907
             GPGHGISVGS+G+ P E+ V GI V    F GT NGVR+KTWPN+   + ++++HFE++ 
Sbjct  240   GPGHGISVGSMGKNPAEKDVTGITVKKCTFTGTSNGVRVKTWPNAPATLKISNLHFEDLT  299

Query  908   MQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEE  1087
             M NV  P+VIDQ+YCP N C+K KPSL+++S ++ K + GT+ T  A+  +CSS  PC+ 
Sbjct  300   MNNVSYPVVIDQQYCPWNLCTKDKPSLIQISGLTVKNVRGTANTKEALLFSCSSSKPCQN  359

Query  1088  VEIGDINLTIKGGAAK---SICKNVKPKLTGKVVPPLA  1192
             V+I DI+L           ++C+NVKP ++GK  PP+ 
Sbjct  360   VQISDIDLKYVNSIPANFTTVCENVKPTVSGKQNPPIC  397



>ref|XP_003633345.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28394.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   358 bits (920),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 178/355 (50%), Positives = 229/355 (65%), Gaps = 2/355 (1%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             A    D+  ALL AW+  CA+  AS VVIP G + + QV + GPCKAPI L +   ++AP
Sbjct  35    ADGKTDISQALLTAWEAACASPIASRVVIPAGIYALGQVTIEGPCKAPINLIVKGTVRAP  94

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLT  484
              +      +  W+  +++D FTLSG G  DGQG         +     +LP NL  NFLT
Sbjct  95    VDTSRFKPQAGWVAFQHLDQFTLSGYGVFDGQGQSVWRQKCSRTKYCHQLPINLRFNFLT  154

Query  485   NSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIG  664
             NS+I+D+T+ +SK FH+NVL  +N+TF    + AP +S NTDGIHI R  G+ +  S I 
Sbjct  155   NSIIKDITSKDSKQFHINVLRCRNITFFQVAITAPEDSQNTDGIHIGRSRGVNITHSTIQ  214

Query  665   TGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVR  844
             TGDDC+S+GDG E + IT V CGPGHGISVGSLG    E PV GI V N     T NGVR
Sbjct  215   TGDDCVSIGDGSEQIDITKVNCGPGHGISVGSLGLYKNEAPVIGIRVKNCTLSDTTNGVR  274

Query  845   IKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKIS  1024
             +KTWP+S  G  T++HF +I M NV NPI+IDQEYCP+N+C+ Q PS VKLS IS+K I 
Sbjct  275   VKTWPSSPQGTATEMHFHDIVMNNVSNPIIIDQEYCPHNQCNLQIPSRVKLSNISFKNIR  334

Query  1025  GTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVP  1183
             GT++T +AV L CS G PC++VE+G+I+L   G  G A S CKNV+  L G   P
Sbjct  335   GTTSTELAVNLVCSKGAPCQKVELGNIDLKYTGPEGTASSQCKNVEATLWGTQQP  389



>ref|NP_199625.1| putative polygalacturonase / pectinase [Arabidopsis thaliana]
 dbj|BAA96994.1| polygalacturonase [Arabidopsis thaliana]
 dbj|BAC43278.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAP81805.1| At5g48140 [Arabidopsis thaliana]
 gb|AED95623.1| putative polygalacturonase / pectinase [Arabidopsis thaliana]
Length=395

 Score =   358 bits (919),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 253/386 (66%), Gaps = 8/386 (2%)
 Frame = +2

Query  41    MATISYCAFTFILFMLAHFGESATI-NVAAKANVDVGPALLKAWKEGCAATTASTVVIPK  217
             M  + +    F +F L     +A I N+ +    D+  ALLKA+ E C   T STV+IPK
Sbjct  1     MGRVHFGVSAFFVFCLLGLSANAKIFNINSPPGSDITNALLKAFNEACQFPTKSTVMIPK  60

Query  218   GTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDG  397
             G + + ++ + GPCKAPI + ++  +KA     N +GK++W+  + I+ F L+GGG  DG
Sbjct  61    GEYKLGEIVMMGPCKAPIRIALLGTVKAD---GNANGKEKWVAFRNINGFKLNGGGVFDG  117

Query  398   QGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHF  574
             +GN     +   K F   KLP ++  +F+T++ IR +T+L++K FH+NV+G KN+TF+  
Sbjct  118   EGNAAWRVNNCHKTFNCKKLPISIRFDFVTDAKIRGITSLDAKHFHINVIGAKNVTFEDV  177

Query  575   TVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISV  754
              + AP  SPNTDGIH+ R  GI + +S I TGDDC+S+GDG++NL +  VTCGPGHGIS+
Sbjct  178   KIIAPAESPNTDGIHVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISI  237

Query  755   GSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPI  931
             GSLGR   E  V GI + N     TDNG+RIKTWP++      +DIHFENI ++NV NPI
Sbjct  238   GSLGRYSHEENVSGIKIINCTLQETDNGLRIKTWPSAACTTTASDIHFENILLKNVSNPI  297

Query  932   VIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINL  1111
             +IDQEYCP N+C+KQKPS +KL+ IS+KKI GTS    AV+L CS G PC+ VE+GD+N+
Sbjct  298   LIDQEYCPWNQCNKQKPSTIKLANISFKKIRGTSGNKDAVKLLCSKGYPCQNVEVGDVNI  357

Query  1112  TIKG--GAAKSICKNVKPKLTGKVVP  1183
                G  G A   C NV PKL G  +P
Sbjct  358   QYTGADGPATFQCSNVSPKLVGTQIP  383



>gb|EYU42739.1| hypothetical protein MIMGU_mgv1a007536mg [Erythranthe guttata]
Length=404

 Score =   358 bits (920),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 184/385 (48%), Positives = 254/385 (66%), Gaps = 13/385 (3%)
 Frame = +2

Query  74    ILFMLAHFGESATINVAAKANV-----DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQ  238
              L  LA+  ES TI   +K        D+ P L K WKE C AT AS V+IPKGT+ ++Q
Sbjct  14    FLPFLAYHAESVTIFDISKYGAKPGGEDISPVLAKVWKEACEATNASKVLIPKGTWYLSQ  73

Query  239   VELAGPCKAPIELKIMAILKAPPNPKNMDGKK-EWLTIKYIDHFTLSGGGTLDGQGNVQV  415
             + L GP KAP+EL++   ++A P+   +  K  +W+TI Y+D FT+SGGG  DG+G  Q 
Sbjct  74    IRLVGPNKAPLELEVQGTVEANPDYTKLPQKDGQWITINYLDGFTISGGGVFDGKGE-QA  132

Query  416   YPSKE--KGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAP  589
             + + +  K     KLP NLSLNF+ N++I+D+TT +SK FH N +  +N+TF  FT+ AP
Sbjct  133   WKANDCHKNPNCPKLPINLSLNFIKNAIIKDVTTKDSKNFHCNCISSQNVTFQRFTISAP  192

Query  590   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  769
             G S NTDGIHIAR+  + V DS IGTGDDCIS+GD   +L I  V CGPGHGISVGS+G+
Sbjct  193   GESINTDGIHIARVSNVKVLDSNIGTGDDCISIGDETTDLHIENVKCGPGHGISVGSMGK  252

Query  770   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHFENIDMQNVKNPIVIDQE  946
              P E+ V GI V    F GT NGVR+KTWPN+   + ++++HFE++ M NV  P+VIDQ+
Sbjct  253   NPAEKDVTGITVKKCTFTGTSNGVRVKTWPNAPATLKISNLHFEDLTMNNVSYPVVIDQQ  312

Query  947   YCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKGG  1126
             YCP N C+K KPSL+++S ++ K + GT+ T  A+  +CSS  PC+ V+I DI+L     
Sbjct  313   YCPWNLCTKDKPSLIQISGLTVKNVRGTANTKEALLFSCSSSKPCQNVQISDIDLKYVNS  372

Query  1127  AAK---SICKNVKPKLTGKVVPPLA  1192
                   ++C+NVKP ++GK  PP+ 
Sbjct  373   IPANFTTVCENVKPTVSGKQNPPIC  397



>gb|EYU42736.1| hypothetical protein MIMGU_mgv1a007545mg [Erythranthe guttata]
Length=404

 Score =   358 bits (919),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 182/385 (47%), Positives = 255/385 (66%), Gaps = 13/385 (3%)
 Frame = +2

Query  74    ILFMLAHFGESATINVAAKANV-----DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQ  238
              L  LA+  ES T+   +K        D+ P L K WKE C AT AS V+IPKGT+ ++Q
Sbjct  14    FLPFLAYHAESVTVFDISKYGAKPGGEDISPVLAKVWKEACEATNASKVLIPKGTWYLSQ  73

Query  239   VELAGPCKAPIELKIMAILKAPPNPKNMDGKK-EWLTIKYIDHFTLSGGGTLDGQGNVQV  415
             + L GP KAP+EL++   ++A P+   +  K  +W+TI Y+D FT+SGGG  DG+G  Q 
Sbjct  74    IRLVGPNKAPLELEVQGTVEANPDYTKLPQKDGQWITINYLDGFTISGGGVFDGKGE-QA  132

Query  416   YPSKE--KGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAP  589
             + + +  K     KLP NLSLNF+ N++I+D+TT +SK FH N +  +N+TF  FT+ AP
Sbjct  133   WKANDCHKNPNCPKLPINLSLNFIKNAIIKDVTTKDSKNFHCNCISSQNVTFQRFTISAP  192

Query  590   GNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGR  769
             G S NTDGIHIAR+  + V DS IGTGDDCIS+GD   +L I  V CGPGHGISVGS+G+
Sbjct  193   GESINTDGIHIARVSNVKVLDSNIGTGDDCISIGDETTDLHIENVKCGPGHGISVGSMGK  252

Query  770   TPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHFENIDMQNVKNPIVIDQE  946
              P E+ V GI V    F GT NGVR+KTWP++   + ++++HFE++ M NV  P+VIDQ+
Sbjct  253   NPAEKDVTGITVKKCTFTGTSNGVRVKTWPSAPATLKISNLHFEDLTMNNVSYPVVIDQQ  312

Query  947   YCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKGG  1126
             YCP N C+K KPSL+++S ++ K + GT+ T  A+  +CSS  PC+ V+I DI+L     
Sbjct  313   YCPWNLCTKDKPSLIQISGLTVKNVRGTANTKEALLFSCSSSKPCQNVQISDIDLKYVNS  372

Query  1127  AAK---SICKNVKPKLTGKVVPPLA  1192
                   ++C+NVKP ++GK +PP+ 
Sbjct  373   IPANFTTVCENVKPTVSGKQIPPIC  397



>ref|XP_008229862.1| PREDICTED: polygalacturonase-like [Prunus mume]
Length=726

 Score =   368 bits (945),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 188/389 (48%), Positives = 255/389 (66%), Gaps = 18/389 (5%)
 Frame = +2

Query  65    FTFILFMLAHFG--ESATINVAAKA-----NVDVGPALLKAWKEGCAATTASTVVIPKGT  223
             + F+  +LA     +S+  +V + A     N D+  AL  AW++ CA+T  + VVIPKGT
Sbjct  5     WIFVFLLLASIAKVQSSVFDVTSAAYGGKPNSDITQALANAWRDACASTWPTKVVIPKGT  64

Query  224   FPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQG  403
             + +    L GPCKAPIE+++   LKAP + K +  +  W+  +Y+D  TL GGG+ DGQ 
Sbjct  65    YNLRGAILQGPCKAPIEVQVQGNLKAPLDSKYLTKQDTWVGFQYVDRLTLYGGGSFDGQN  124

Query  404   NVQVYPSKEKGFKG-DKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTV  580
             N      K K  K  D +  NL L+F+TN++IRD+T+L+SK FH+NV G +N+TF + T+
Sbjct  125   NCY----KNKYCKATDAI--NLRLDFVTNAMIRDITSLDSKHFHINVFGCRNVTFQYVTI  178

Query  581   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  760
              AP +S NTDGIHI R  GIT+  + IGTGDDCISLGDG + + +T VTCGPGHGIS+GS
Sbjct  179   TAPEDSANTDGIHIGRSYGITIDHTTIGTGDDCISLGDGSQRIIVTNVTCGPGHGISIGS  238

Query  761   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHP-GVVTDIHFENIDMQNVKNPIVI  937
             LG+   E PV G+ V N     T NG+RIKTWP S   G  T IHF++I M NV NPI I
Sbjct  239   LGKYQSEVPVAGVLVKNCTLTNTQNGLRIKTWPGSPAFGTATHIHFQDIAMVNVGNPIFI  298

Query  938   DQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTI  1117
             DQ+YCP ++C+++ PS V++S +S+  I GTSATPVAVQL CS  +PC+ V + DI++T 
Sbjct  299   DQQYCPYSQCAQKAPSTVQISSVSFVNIKGTSATPVAVQLMCSRKLPCQNVGLEDIDITY  358

Query  1118  KG--GAAKSICKNVKPKLTGKVVPPLACG  1198
              G  G   S C  VKP+ T +V  PL+C 
Sbjct  359   SGDKGPLTSQCAYVKPQFT-RVANPLSCA  386



>ref|XP_006395214.1| hypothetical protein EUTSA_v10004361mg [Eutrema salsugineum]
 gb|ESQ32500.1| hypothetical protein EUTSA_v10004361mg [Eutrema salsugineum]
Length=396

 Score =   357 bits (917),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 186/375 (50%), Positives = 243/375 (65%), Gaps = 7/375 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
             F+  +L     +    + +    D+  ALLK + E C   T +TV+IPKG + + ++E+ 
Sbjct  11    FVFCLLGLSANAKVFKITSPTGSDITSALLKTFNEACQFPTKATVMIPKGEYKLGEIEMV  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCKAPI + +   +KA  N K   GK  W+  K I+ F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIRIALQGTVKADGNIK---GKDFWVAFKKINGFKLNGGGVFDGEGNAAWRVNNC  127

Query  428   EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  607
              K F+  KLP ++  +F+T++ IR +T+L+SK FH+NV+G KN+TF+   + AP  SPNT
Sbjct  128   HKTFECKKLPISVRFDFVTDAKIRGITSLDSKNFHINVIGAKNMTFEDIKIVAPAGSPNT  187

Query  608   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  787
             DGIH+ R  GI + +S I TGDDCIS+GDG+ NL +  VTCGPGHGISVGSLGR   E  
Sbjct  188   DGIHVGRSDGIKIINSFISTGDDCISVGDGMRNLLVERVTCGPGHGISVGSLGRYGHEED  247

Query  788   VKGIFVSNSKFIGTDNGVRIKTWPNSHPG-VVTDIHFENIDMQNVKNPIVIDQEYCPNNE  964
             V GI V N     TDNGVRIKTWP++      ++IHFENI ++NV NPI+IDQEYCP N+
Sbjct  248   VTGIRVVNCTLQNTDNGVRIKTWPSAKCATTASEIHFENILLKNVSNPILIDQEYCPWNQ  307

Query  965   CSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKS  1138
             C+KQKPS +KL  IS+KKI GTS    AV+L CS G PC+ VEIGDIN+   G  G A  
Sbjct  308   CNKQKPSTIKLVNISFKKIRGTSGNKDAVKLLCSKGYPCKNVEIGDINIKYTGADGPATF  367

Query  1139  ICKNVKPKLTGKVVP  1183
              C NV PKL G  VP
Sbjct  368   SCSNVSPKLKGTQVP  382



>ref|XP_010547226.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   357 bits (917),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 184/389 (47%), Positives = 253/389 (65%), Gaps = 10/389 (3%)
 Frame = +2

Query  41    MATISYCAFTFILFMLAHFGESATINVAAKANVDVGP----ALLKAWKEGCAATTASTVV  208
             M   +  +  F L++L+    +   ++    +V VG     A  +A++  C +   S+VV
Sbjct  1     MVAKTLASVLFALYLLSFSANAEVFDIRKFGHVSVGSDITQAFRQAFQAACQSPRPSSVV  60

Query  209   IPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGT  388
             IPKGT+ + ++ + GPCKAP+E+ +   L+A  N   + G ++W+  +YI+ F L+GGG 
Sbjct  61    IPKGTYKLGEINMIGPCKAPVEVTVNGHLQA--NGNALAGHEKWVVFRYINGFKLNGGGI  118

Query  389   LDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTF  565
              DGQGN     +   K     KLP ++  +F+ N  +RD+T+L++K FHVNVLG KN TF
Sbjct  119   FDGQGNAAWKSNDCHKNNNCKKLPISIRFDFVLNGEVRDITSLDAKNFHVNVLGCKNFTF  178

Query  566   DHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHG  745
             D+  +KAP  SPNTDGIH+ R  G+ +  S I TGDDCIS+GDG++NL +  VTCGPGHG
Sbjct  179   DNVKIKAPAESPNTDGIHLGRSDGVNILRSFISTGDDCISIGDGMKNLHVERVTCGPGHG  238

Query  746   ISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHFENIDMQNVK  922
             IS+GSLGR   E PV GI++ N     TDNG+RIKT+P+S   + V+DIHFE+I ++NV 
Sbjct  239   ISIGSLGRYTIEEPVAGIWIKNCTLQETDNGLRIKTYPSSASSITVSDIHFEDIIVKNVS  298

Query  923   NPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGD  1102
             NPI+IDQEYCP N+C+K KPS VKL  IS+K+I GTS    AV+L CS GVPC  VE+GD
Sbjct  299   NPILIDQEYCPWNKCNKAKPSTVKLVNISFKRIRGTSGNKDAVRLLCSKGVPCTNVEVGD  358

Query  1103  INLTIKG--GAAKSICKNVKPKLTGKVVP  1183
             I+L   G  G A   C NV PKL+G   P
Sbjct  359   IDLRYGGADGPATFECSNVTPKLSGTQFP  387



>ref|XP_010439352.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   357 bits (915),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 251/386 (65%), Gaps = 8/386 (2%)
 Frame = +2

Query  41    MATISYCAFTFILFMLAHFGESATI-NVAAKANVDVGPALLKAWKEGCAATTASTVVIPK  217
             M  +++    F +F L     +A + N+ +K   D+  ALLKA+ E C   T STV+IPK
Sbjct  1     MGRVNFGVSAFFIFCLLGLSANAKVFNIGSKPGCDITKALLKAFNEACQFPTKSTVLIPK  60

Query  218   GTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDG  397
             G + + ++E+ GPCKAPI + +   +KA  N  + +   +W+  + ID F L+GGG  DG
Sbjct  61    GEYKLGEIEMTGPCKAPIRIALQGTVKADGNAVHSE---KWIAFRNIDGFKLNGGGVFDG  117

Query  398   QGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHF  574
             +GN     +     +K  KLP ++  +F+TN+ IR +T+L++K FH+NV+G KN+TF+  
Sbjct  118   EGNAAWRVNNCHHTWKCKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEEV  177

Query  575   TVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISV  754
              + AP  SPNTDGIH+ R  GI + +S I TGDDC+S+GDG++NL +  VTCGPGHGIS+
Sbjct  178   KIVAPAESPNTDGIHVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISI  237

Query  755   GSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHFENIDMQNVKNPI  931
             GSLGR   E+ V GI + N     TDNG+RIKTWP +      +DIHFENI ++NV NPI
Sbjct  238   GSLGRYGHEQDVMGIKIVNCTLQETDNGLRIKTWPTAACSTSASDIHFENILLKNVSNPI  297

Query  932   VIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINL  1111
             +IDQEYCP N+C K+K S +KLSKIS+K I GTS    AV+L CS G PC+ VE+G+IN+
Sbjct  298   LIDQEYCPWNQCDKKKASTIKLSKISFKNIRGTSGNKDAVKLLCSKGHPCQNVELGNINI  357

Query  1112  TIKG--GAAKSICKNVKPKLTGKVVP  1183
                G  G A   C NV PKL G  VP
Sbjct  358   KYTGADGPATFQCSNVSPKLMGTQVP  383



>sp|P24548.1|PGLR_OENOR RecName: Full=Exopolygalacturonase; Short=ExoPG; AltName: Full=Galacturan 
1,4-alpha-galacturonidase; AltName: Full=Pectinase, 
partial [Oenothera organensis]
 gb|AAB23476.1| polygalacturonase homolog {clone P22} [Oenothera organensis]
Length=362

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/357 (51%), Positives = 236/357 (66%), Gaps = 5/357 (1%)
 Frame = +2

Query  140   DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKN  319
             D   AL  AWKE CA+ + ST+++PKG F +  + L GPCK+ I L++   LKAP +P  
Sbjct  1     DSTQALTTAWKEACASASPSTILVPKGNFAVGLITLEGPCKSSIGLQLQGTLKAPADPSK  60

Query  320   MDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPS--KEKGFKGDKLPNNLSLNFLTNSV  493
             + G   W+ +  ID  T+ GGG  DGQG      +   + G     L  NL L  +TNS+
Sbjct  61    IKGLG-WINLNKIDLLTIFGGGVFDGQGKSAWVQNDCHKNGPICKTLSMNLRLYAVTNSI  119

Query  494   IRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGD  673
             +RD+TTL+SK FHVNV+G KNLTF+ F + A   S NTDGIHI R  G+ + ++ I TGD
Sbjct  120   LRDVTTLDSKNFHVNVIGCKNLTFERFKISAAETSINTDGIHIGRSDGVNIINTEIKTGD  179

Query  674   DCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKT  853
             DCISLGDG +N+ IT +TCGPGHGISVGSLGR   E  V GI+V N    G+ NGVRIKT
Sbjct  180   DCISLGDGSKNINITNITCGPGHGISVGSLGRYKNEESVVGIYVKNCTITGSQNGVRIKT  239

Query  854   WPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTS  1033
             WP S PG  +++HF++I M +V  PI+IDQ YCP N+C+ + PS VKLSKIS+K I GTS
Sbjct  240   WPKSEPGEASEMHFQDITMNSVGTPILIDQGYCPYNQCTAEVPSSVKLSKISFKNIKGTS  299

Query  1034  ATPVAVQLACSSGVPCEEVEIGDINLTI--KGGAAKSICKNVKPKLTGKVVPPLACG  1198
              T  AV+L CS   PC  VE+ DI+LT   KGG A S+C+N+KP + GK +P +  G
Sbjct  300   TTKEAVKLVCSKSFPCNGVELADIDLTYSGKGGPATSVCENIKPTIKGKQIPAICSG  356



>ref|XP_010548798.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   357 bits (916),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/389 (47%), Positives = 253/389 (65%), Gaps = 10/389 (3%)
 Frame = +2

Query  41    MATISYCAFTFILFMLAHFGESATINV----AAKANVDVGPALLKAWKEGCAATTASTVV  208
             MA  +  +  F L++ + +  +   ++     A    D+  AL +A++  C     S+VV
Sbjct  1     MAAKTLASVLFALYLFSFWANAEVFDIRKFGTASVGSDITQALRQAFQAACQNPRPSSVV  60

Query  209   IPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGT  388
             IPKGT+ + ++++ GPCKAP+E+ +   L+A  N   + G+++W+  +YI+ F L+G G 
Sbjct  61    IPKGTYKLGEIDMVGPCKAPVEVTVNGHLQA--NGNALVGREKWVVFRYINGFKLNGAGI  118

Query  389   LDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTF  565
              DGQGN     +   K     KLP ++  +F+ N  +RD+T+L++K FHVNVLG KN TF
Sbjct  119   FDGQGNAAWKSNDCHKNNNCKKLPISIRFDFVLNGEVRDITSLDAKNFHVNVLGCKNFTF  178

Query  566   DHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHG  745
             D+  +KAP  SPNTDGIH+ R  G+ +  S I TGDDCIS+GDG++NL +  VTCGPGHG
Sbjct  179   DNVKIKAPAESPNTDGIHLGRSDGVNILRSFISTGDDCISVGDGMKNLHVERVTCGPGHG  238

Query  746   ISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHFENIDMQNVK  922
             IS+GSLGR   E PV GI++ N     TDNG+RIKT+P+S   + V+DIHFE+I ++NV 
Sbjct  239   ISIGSLGRYTNEGPVAGIWIKNCTLQETDNGLRIKTYPSSASSITVSDIHFEDIIVKNVF  298

Query  923   NPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGD  1102
             NPI+IDQEYCP N+C+K KPS VKL  IS+K+I GTS    AV+L CS  VPC  VE+GD
Sbjct  299   NPILIDQEYCPWNKCNKAKPSTVKLVNISFKRIRGTSGNKDAVRLLCSKAVPCTNVEVGD  358

Query  1103  INLTIKG--GAAKSICKNVKPKLTGKVVP  1183
             I+L   G  G A   C NV PKL+G   P
Sbjct  359   IDLRYGGADGPATFQCSNVTPKLSGTQFP  387



>gb|KFK31316.1| hypothetical protein AALP_AA6G096900 [Arabis alpina]
Length=395

 Score =   357 bits (915),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/376 (48%), Positives = 248/376 (66%), Gaps = 7/376 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATI-NVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVEL  247
             F +F L     +A + N+ +    D+  ALLKA+ E C A T STV+IPKG + + ++E+
Sbjct  10    FFVFCLVGLSANAKVFNIGSPPGSDITKALLKAFTEACQAPTKSTVMIPKGEYKLGEIEM  69

Query  248   AGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK  427
              GPCKAPI + +   +KA  N   ++GK++W+  + ID F L+GGG  DG+GN     + 
Sbjct  70    TGPCKAPIRIALQGTVKADGNL--INGKEKWVAFRNIDGFKLNGGGVFDGEGNNAWRSNN  127

Query  428   -EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPN  604
               K F   KLP ++  +F+TN+ IR +T+L++K FH+NV+G KN+TF+   + AP  SPN
Sbjct  128   CHKTFNCKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEDVKIVAPAESPN  187

Query  605   TDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGER  784
             TDGIH+ R  GI + +S I TGDDC+S+GDG++NL +  VTCGPGHGIS+GSLGR   E 
Sbjct  188   TDGIHVGRSDGIRIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISIGSLGRYSHEE  247

Query  785   PVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNN  961
              V GI + N     TDNG+RIKTWP++      +DIHF+NI ++NV NPI+IDQEYCP N
Sbjct  248   DVSGIKIVNCTLQETDNGIRIKTWPSAACSTTASDIHFQNIILKNVTNPILIDQEYCPWN  307

Query  962   ECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAK  1135
             +C+KQK S +KL  IS+K I GTS    AV+L C+ G+PC  VE+GDIN+   G  G A 
Sbjct  308   QCNKQKSSTIKLVNISFKNIRGTSGNKDAVKLLCAKGLPCTNVELGDINIKYNGADGPAT  367

Query  1136  SICKNVKPKLTGKVVP  1183
               C NV PKL G   P
Sbjct  368   FQCANVSPKLMGTQTP  383



>gb|AFK35534.1| unknown [Medicago truncatula]
Length=407

 Score =   357 bits (915),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 185/379 (49%), Positives = 242/379 (64%), Gaps = 16/379 (4%)
 Frame = +2

Query  56    YCAFTFILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMT  235
             +CA   ++  ++ FG           N D+  AL  AWKE CA+TTAS +VIP GT+ M 
Sbjct  17    FCAVQSLVLDISKFG--------GAPNSDITLALGNAWKEACASTTASKIVIPGGTYKMG  68

Query  236   QVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV--  409
              +EL GPCKAPIE+++   ++AP +P  +    +W+   Y++H TLSG G  DGQG    
Sbjct  69    GIELKGPCKAPIEVQVDGTIQAPADPSQIKAADQWVKFLYMEHLTLSGKGVFDGQGATAY  128

Query  410   -QVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTV  580
              Q  P+     K    K+  NL   F+ NS++  +T+ +SK FHV VLG  N TFD FTV
Sbjct  129   KQAQPAAAWSGKKSNVKILMNLGFMFVNNSMVTGVTSKDSKNFHVMVLGCNNFTFDGFTV  188

Query  581   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  760
              AP +SPNTDGIH+ R   + + ++ IGTGDDC+SLGDG   + + GV CGPGHGISVGS
Sbjct  189   TAPSDSPNTDGIHMGRSTDVKILNTNIGTGDDCVSLGDGSRKITVQGVKCGPGHGISVGS  248

Query  761   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--DIHFENIDMQNVKNPIV  934
             LGR   E  V+G+ V +     T NGVRIKTWP++ PG +T  DIHFE+I M NV NPI+
Sbjct  249   LGRYTTEDNVEGVTVKSCTLTATQNGVRIKTWPDA-PGTITVSDIHFEDITMNNVTNPII  307

Query  935   IDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLT  1114
             IDQEYCP N C+K+ PS VKLSK S+K I GTS  P  V L CSS VPC+ VE+ ++++ 
Sbjct  308   IDQEYCPWNACNKKVPSKVKLSKTSFKNIQGTSGAPEGVVLVCSSTVPCDGVELNNVDVK  367

Query  1115  IKGGAAKSICKNVKPKLTG  1171
               G  A + C NVKP +TG
Sbjct  368   FNGKPAIAKCSNVKPTVTG  386



>ref|XP_010548800.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   356 bits (914),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 183/389 (47%), Positives = 253/389 (65%), Gaps = 10/389 (3%)
 Frame = +2

Query  41    MATISYCAFTFILFMLAHFGESATINV----AAKANVDVGPALLKAWKEGCAATTASTVV  208
             MA  +  +  F L++L+    +   ++     A    D+  AL +A++  C     S+VV
Sbjct  1     MAAKTLASVLFALYLLSFSANAEVFDIRKFGTASVGSDITQALRQAFQAACQNPRPSSVV  60

Query  209   IPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGT  388
             IPKGT+ + ++++ GPCKAP+E+ +   L+A  N   + G+++W+  +YI+ F L+G G 
Sbjct  61    IPKGTYKLGEIDMVGPCKAPVEVTVNGHLQA--NGNALVGREKWVVFRYINGFKLNGAGI  118

Query  389   LDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTF  565
              DGQGN     +   K     KLP ++  +F+ N  +RD+T+L++K FHVNVLG KN TF
Sbjct  119   FDGQGNAAWKSNDCHKNNNCKKLPISIRFDFVLNGEVRDITSLDAKNFHVNVLGCKNFTF  178

Query  566   DHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHG  745
             D+  +KAP  SPNTDGIH+ R  G+ +  S I TGDDCIS+GDG++NL +  VTCGPGHG
Sbjct  179   DNVKIKAPAESPNTDGIHLGRSDGVNILRSFISTGDDCISVGDGMKNLHVERVTCGPGHG  238

Query  746   ISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHFENIDMQNVK  922
             IS+GSLGR   E PV GI++ N     TDNG+RIKT+P+S   + V+DIHFE+I ++NV 
Sbjct  239   ISIGSLGRYTNEGPVAGIWIKNCTLQETDNGLRIKTYPSSASSITVSDIHFEDIIVKNVF  298

Query  923   NPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGD  1102
             NPI+IDQEYCP N+C+K KPS VKL  IS+K+I GTS    AV+L CS  VPC  VE+GD
Sbjct  299   NPILIDQEYCPWNKCNKAKPSTVKLVNISFKRIRGTSGNKDAVRLLCSKAVPCTNVEVGD  358

Query  1103  INLTIKG--GAAKSICKNVKPKLTGKVVP  1183
             I+L   G  G A   C NV PKL+G   P
Sbjct  359   IDLRYGGADGPATFQCSNVTPKLSGTQFP  387



>ref|XP_010248093.1| PREDICTED: exopolygalacturonase-like, partial [Nelumbo nucifera]
Length=370

 Score =   355 bits (910),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 184/353 (52%), Positives = 239/353 (68%), Gaps = 6/353 (2%)
 Frame = +2

Query  140   DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCK-APIELKIMAILKAPPNPK  316
             D+  A++ AWK  CAAT A+TV+IPKGT+ M  V LAGPCK A +  ++  I++AP +P 
Sbjct  21    DITQAVMDAWKAACAATGAATVLIPKGTYTMNLVNLAGPCKQAQMNFQLEGIVQAPADPA  80

Query  317   NMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKE--KGFKGDKLPNNLSLNFLTNS  490
              MD  + WL   ++D  T+ GGGTLDGQG  + + S E  K  K  ++P NL LNF+ N 
Sbjct  81    AMD-SESWLLFDHVDDLTVFGGGTLDGQGQ-KAWESNECSKNSKCPQMPANLRLNFVNNG  138

Query  491   VIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  670
             V+ D+T+LNSK+ H+ +L   NLT  H T+ AP  S NTDGIHI R  G+ + D+ IGTG
Sbjct  139   VVHDITSLNSKMIHIMILSANNLTIQHVTITAPSTSINTDGIHIGRSTGVKILDTTIGTG  198

Query  671   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  850
             DDC+S+ DG +++ ++ VTCGPGHG+S+GSLG+   E PV G+ +S+     TDNGVRIK
Sbjct  199   DDCVSVSDGNKDITVSKVTCGPGHGLSIGSLGKYDNEGPVVGVHISDCTLTKTDNGVRIK  258

Query  851   TWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGT  1030
             +WP+S PG  +DI FENI M +V NP++IDQ YCP   CS Q PS VKLS I    I GT
Sbjct  259   SWPDSKPGSASDISFENIVMNDVGNPVIIDQAYCPYGGCS-QAPSRVKLSNIKIAGIKGT  317

Query  1031  SATPVAVQLACSSGVPCEEVEIGDINLTIKGGAAKSICKNVKPKLTGKVVPPL  1189
             S+T  AV++ CS  +PCE VEIGDINL   GGAA   C N KP LTG  VPP+
Sbjct  318   SSTQEAVKIFCSPALPCENVEIGDINLAFSGGAATCTCANTKPTLTGTQVPPV  370



>ref|XP_004292143.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=498

 Score =   359 bits (921),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 188/396 (47%), Positives = 246/396 (62%), Gaps = 11/396 (3%)
 Frame = +2

Query  38    KMATISYCAFTFIL-FMLAH---FGESATINVAAKANVDVGPALLKAWKEGCAATTASTV  205
             K+  +   +F  +L F   H   F +  +     K N D+  ALL AW + CA+   ST+
Sbjct  4     KLMNVLTISFLLVLAFTPVHSSVFFDVTSAKYGGKPNTDITKALLNAWTDACASPWESTI  63

Query  206   VIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGG  385
              +PKGT+ +      G CKAPIEL++   L+AP     +     W+  +Y++  TLSGGG
Sbjct  64    YVPKGTYGLKGAIFVGHCKAPIELQVEGTLQAPEETGQVTSPDTWVGFRYLNRLTLSGGG  123

Query  386   TLDGQGNV---QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKN  556
             T DG+G +   Q   +  K  K   +  N+  +F+ +++I+D+T+L+SK FH NV    N
Sbjct  124   TFDGRGALSWKQNDCNTNKNCKSRVV--NIRFDFVNDTIIKDITSLDSKNFHFNVFACNN  181

Query  557   LTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGP  736
             +TF H T+ APG+S NTDGIHIAR   +TV ++ IGTGDDCISLGDG   LK T VTCGP
Sbjct  182   ITFQHATITAPGDSVNTDGIHIARSTMVTVANTSIGTGDDCISLGDGTSQLKFTNVTCGP  241

Query  737   GHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQN  916
             GHGIS+GSLG    E+PV G+ + N  F  T NG RIKTWP S+ G+V+DIH+E+I M N
Sbjct  242   GHGISIGSLGGHRDEQPVTGVIIKNVTFNSTQNGARIKTWPGSYGGLVSDIHYEDIIMVN  301

Query  917   VKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEI  1096
             V NPI+IDQEYCP N C+K+ PS VK+S +S+K I GTS TP+AV   CS  VPCE VEI
Sbjct  302   VSNPIIIDQEYCPWNLCNKKIPSKVKISNVSFKNIKGTSTTPLAVNFICSWSVPCENVEI  361

Query  1097  GDINLTIKG--GAAKSICKNVKPKLTGKVVPPLACG  1198
               I+LT  G  G   S C NVK      V   LACG
Sbjct  362   SGIDLTYTGHKGFISSQCSNVKLATIANVTKALACG  397



>sp|Q39786.1|PGLR_GOSHI RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium hirsutum]
 gb|AAA82167.1| polygalacturonase [Gossypium hirsutum]
Length=407

 Score =   356 bits (913),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 179/380 (47%), Positives = 247/380 (65%), Gaps = 11/380 (3%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAK------ANVDVGPALLKAWKEGCAATTASTVVIPKGTFPM  232
              +LF+ A   +S   +V AK         D+    L AWKE CA+ T STVVIPKGT+ +
Sbjct  15    LLLFISASKVQSDAFDVVAKFGAKADGKTDLSKPFLDAWKEACASVTPSTVVIPKGTYLL  74

Query  233   TQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQ  412
             ++V L GPCKAPIE+ +   ++AP +P        W+    +++F + GGG  DGQG++ 
Sbjct  75    SKVNLEGPCKAPIEINVQGTIQAPADPSAFK-DPNWVRFYSVENFKMFGGGIFDGQGSIA  133

Query  413   VYPS--KEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKA  586
                +  + + F+  KLP N+  +FLTN++I+D+T+ +SKLFH+NV   KN+T +   ++A
Sbjct  134   YEKNTCENREFRS-KLPVNIRFDFLTNALIQDITSKDSKLFHINVFACKNITLERLKIEA  192

Query  587   PGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLG  766
             P  SPNTDGIH+ +  G+ +  S I TGDDCIS+GDG +N+ I  +TCGPGHGIS+GSLG
Sbjct  193   PDESPNTDGIHMGKSEGVNIIASDIKTGDDCISIGDGTKNMVIKEITCGPGHGISIGSLG  252

Query  767   RTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQE  946
             +   E PV+GI +SN     T NG RIKTWP  H G V++IHFE+I M NV +PI+IDQ+
Sbjct  253   KFQNEEPVEGIKISNCTITNTSNGARIKTWPGEHGGAVSEIHFEDITMNNVSSPILIDQQ  312

Query  947   YCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKGG  1126
             YCP N+C K + S VKLS IS+K I GTSA P A++  CS   PC+ VE+ DI++   G 
Sbjct  313   YCPWNKCKKNEESKVKLSNISFKNIRGTSALPEAIKFICSGSSPCQNVELADIDIKHNGA  372

Query  1127  A-AKSICKNVKPKLTGKVVP  1183
               A S C NVKP  +GK+ P
Sbjct  373   EPATSQCLNVKPITSGKLNP  392



>ref|NP_187440.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21193.1|AC013483_17 putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE74609.1| polygalacturonase-like protein [Arabidopsis thaliana]
Length=397

 Score =   355 bits (911),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 175/377 (46%), Positives = 255/377 (68%), Gaps = 10/377 (3%)
 Frame = +2

Query  77    LFMLAHFGESA----TINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVE  244
             +F++   G SA     + + +    D+  ALL+A+   C + T   VVIPKG F + ++ 
Sbjct  10    IFVICLLGFSANAHEVLRLTSSPGSDITQALLRAFTTACQSPTPRKVVIPKGQFKLGEIM  69

Query  245   LAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPS  424
             ++GPCK+P+E+ ++  + A  N  ++ GK++W+  + +D F L+GGGT DG+GN     +
Sbjct  70    MSGPCKSPVEITLLGTVLADGN--SIHGKEKWVVFQRMDGFRLNGGGTFDGEGNAAWRVN  127

Query  425   K-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  601
                K F+  KLP ++  +F+TN+ IRD++++++K FH+NV+G KN+TFD+  + AP  SP
Sbjct  128   NCHKTFECKKLPISIRFDFVTNAEIRDISSIDAKNFHINVIGAKNMTFDNVKIMAPAESP  187

Query  602   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  781
             NTDGIH+ R +G+++ +S I TGDDC+S+GDG+ NL +  V CGPGHGISVGSLGR   E
Sbjct  188   NTDGIHLGRSVGVSIINSRISTGDDCVSVGDGMVNLLVKNVVCGPGHGISVGSLGRYGHE  247

Query  782   RPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPN  958
             + V GI V N     TDNG+RIKTWP++      ++IHFENI ++NV NPI+IDQEYCP 
Sbjct  248   QDVSGIRVINCTLQETDNGLRIKTWPSAACSTTASNIHFENIILRNVSNPILIDQEYCPW  307

Query  959   NECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAA  1132
             N+C+KQK S +KL+ IS+++I GTS    AV+L CS G PCE V++GDIN+   G  G A
Sbjct  308   NQCNKQKSSSIKLANISFRRIRGTSGNKDAVKLLCSKGYPCENVQVGDINIQYTGADGPA  367

Query  1133  KSICKNVKPKLTGKVVP  1183
               +C NV+PKL G   P
Sbjct  368   TFMCSNVRPKLVGTQFP  384



>ref|XP_008229852.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=403

 Score =   355 bits (911),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 188/389 (48%), Positives = 243/389 (62%), Gaps = 14/389 (4%)
 Frame = +2

Query  65    FTFILFMLAHFGESATINVAA-----KANVDVGPALLKAWKEGCAATTASTVVIPKGTFP  229
             F F+L       +SA ++V +     K + D+  AL KAW + CA+T  S +V+PKGTF 
Sbjct  12    FVFLLLASTAKAQSAALDVTSAKYGGKPDSDITQALEKAWTDACASTAPSKIVVPKGTFK  71

Query  230   MTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV  409
                    GPCKA IE ++   L+AP +   +     W+   ++D  TLSGGGT DGQG +
Sbjct  72    FVGTTFKGPCKAAIEFQLQGTLQAPADGSQLPKDDTWIGFDHVDGLTLSGGGTFDGQGAL  131

Query  410   QVYPS---KEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTV  580
                 +   K +  K   +  NL  +FLTNS I D+T+ +SK FHVN+L  + +  + FTV
Sbjct  132   SWKNNDCNKNRQCKSKHI--NLRFHFLTNSKILDVTSKDSKNFHVNLLKCEKVEINGFTV  189

Query  581   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  760
              AP  S NTDGIHI R  GI + D+ IGTGDDCIS+GDG ++L +T VTCGPGHGI++GS
Sbjct  190   SAPKESMNTDGIHIGRSTGINITDTTIGTGDDCISIGDGTKDLTVTNVTCGPGHGIAIGS  249

Query  761   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVI  937
             LGR P E PV GI +       T NGVRIKTWP S   G  +DIHFE+I M NV NPI+I
Sbjct  250   LGRYPEEEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPILI  309

Query  938   DQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTI  1117
             DQEYCP NEC K  PS VK+S +S+K I GT   PVAV+LAC+ G+PCE VE+ DI++  
Sbjct  310   DQEYCPWNECKKGVPSKVKISNVSFKNIKGTCTDPVAVKLACAPGLPCENVELSDIDIKY  369

Query  1118  KG--GAAKSICKNVKPKLTGKVVPPLACG  1198
              G  G   S+C NVKP +  +V   LAC 
Sbjct  370   TGDKGPITSVCSNVKPTIN-RVAQALACA  397



>ref|XP_002884669.1| hypothetical protein ARALYDRAFT_478121 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60928.1| hypothetical protein ARALYDRAFT_478121 [Arabidopsis lyrata subsp. 
lyrata]
Length=397

 Score =   355 bits (911),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/376 (47%), Positives = 254/376 (68%), Gaps = 7/376 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
             F++ +L     +    + +    D+  ALL+A+   C A T S VVIPKG F + ++ ++
Sbjct  11    FVICLLGFSANAEVFRIGSPPGSDITQALLRAFTSACQAPTPSKVVIPKGQFRLGEIMMS  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCK+P+E+ ++  + A  N  ++ GK++W+  + +D F L+GGGT DG+GN     +  
Sbjct  71    GPCKSPVEITLLGTVLADGN--SIHGKEKWVVFQRMDGFRLNGGGTFDGEGNAAWRVNNC  128

Query  428   EKGFKGDKLP-NNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPN  604
              K F+  KLP  ++  +F+TN+ IRD++++++K FH+NV+G KN+TF++  + AP  SPN
Sbjct  129   HKTFECKKLPIVSIRFDFVTNAEIRDISSIDAKNFHINVIGAKNMTFNNVKIMAPAESPN  188

Query  605   TDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGER  784
             TDGIH+ R +G+++ +S I TGDDC+S+GDG+ NL +  V CGPGHGISVGSLGR   E+
Sbjct  189   TDGIHLGRSVGVSIINSRIATGDDCVSVGDGMVNLLVKNVVCGPGHGISVGSLGRYGHEQ  248

Query  785   PVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNN  961
              V GI V N     TDNG+RIKTWP++      ++IHFENI ++NV NPI+IDQEYCP N
Sbjct  249   DVSGIRVINCTLQETDNGLRIKTWPSAACSTTASNIHFENIILRNVSNPILIDQEYCPWN  308

Query  962   ECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAK  1135
             +C+KQK S +KL+ IS+K+I GTS    AV+L CS G PCE V++GDIN+   G  G A 
Sbjct  309   QCNKQKSSSIKLANISFKRIRGTSGNKDAVKLLCSKGYPCENVQVGDINIQYTGADGPAT  368

Query  1136  SICKNVKPKLTGKVVP  1183
              +C NV+PKL G   P
Sbjct  369   FMCSNVRPKLVGTQFP  384



>ref|XP_010482057.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   355 bits (910),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 249/386 (65%), Gaps = 8/386 (2%)
 Frame = +2

Query  41    MATISYCAFTFILFMLAHFGESATI-NVAAKANVDVGPALLKAWKEGCAATTASTVVIPK  217
             M  I +    F +F L     +A + N+ +K   D+  ALLKA+ E C   T STV+IPK
Sbjct  1     MGRIHFGVSAFFVFCLLGLSANAKVFNIGSKPGCDITKALLKAFNEACQFPTKSTVLIPK  60

Query  218   GTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDG  397
             G + + ++E+ GPCKAPI + +   +KA  N  + +   +W+  + ID F L+GGG  DG
Sbjct  61    GEYKLGEIEMMGPCKAPIRIALQGTVKADGNAVHSE---KWIAFRNIDGFKLNGGGVFDG  117

Query  398   QGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHF  574
             +GN     +     +K  KLP ++  +F+TN+ IR +T+L++K FH+NV+G KN+TF+  
Sbjct  118   EGNAAWRVNNCHHTWKCKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEEV  177

Query  575   TVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISV  754
              + AP  SPNTDGIH+ R  GI + +S I TGDDC+S+GDG++NL +  VTCGPGHGIS+
Sbjct  178   KIVAPAESPNTDGIHVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISI  237

Query  755   GSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHFENIDMQNVKNPI  931
             GSLGR   E+ V GI + N     TDNG+RIKTWP +      +DIHFENI ++NV NPI
Sbjct  238   GSLGRYGHEQDVMGIKIVNCTLQETDNGLRIKTWPTAACSTSASDIHFENILLKNVSNPI  297

Query  932   VIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINL  1111
             +IDQEYCP N+C K+K S +KLSKIS+K I GTS    AV+L CS   PC+ VE+G+IN+
Sbjct  298   LIDQEYCPWNQCDKKKASTIKLSKISFKNIRGTSGNKDAVKLLCSKAHPCQNVELGNINI  357

Query  1112  TIKG--GAAKSICKNVKPKLTGKVVP  1183
                G  G A   C NV PKL G  VP
Sbjct  358   KYTGADGPATFQCSNVSPKLMGTQVP  383



>ref|XP_009334234.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=406

 Score =   355 bits (910),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 187/390 (48%), Positives = 247/390 (63%), Gaps = 16/390 (4%)
 Frame = +2

Query  65    FTFILFMLA-HFGESATINV-----AAKANVDVGPALLKAWKEGCAATTASTVVIPKGTF  226
             F F+L   A    ES+  +V      AK   D+  AL KAW + CA+ +AS VV+P GT+
Sbjct  11    FVFLLLASATKAHESSVFDVTSAEYGAKPGSDITFALAKAWNDSCASPSASKVVVPSGTY  70

Query  227   PMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGN  406
              ++     GPCKAPIEL++   L+AP    ++  +  W+  +++D  T+SGGGT DGQG 
Sbjct  71    KLSGASFRGPCKAPIELQVQGTLQAPEKDSDLTMEGTWVGFQHVDMITVSGGGTFDGQGA  130

Query  407   V---QVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFT  577
                 Q   SK K   G     NL  +F+TNS+I+D+T+LNSK FHV+V G  N+TF H  
Sbjct  131   FVWSQNNSSKSKHCSGSV---NLRFDFVTNSIIQDVTSLNSKNFHVHVYGCNNVTFQHVH  187

Query  578   VKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVG  757
             + APG+S NTDGIHI +  GI +  + IGTGDDC+S+GDG   + +T V+CGPGHGIS+G
Sbjct  188   ITAPGDSKNTDGIHIGKSTGINITHTFIGTGDDCVSIGDGNNQIAVTNVSCGPGHGISIG  247

Query  758   SLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPG-VVTDIHFENIDMQNVKNPIV  934
             SLGR   E  + GI V N     T NGVRIKTWPNS      +DIHFE+I M NV NPIV
Sbjct  248   SLGRYDNEESLAGIIVKNCTLTNTQNGVRIKTWPNSPVATAASDIHFEDIIMVNVSNPIV  307

Query  935   IDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLT  1114
             IDQ YCP  +C    PS VK+S +S+K I G+SAT +++++ CSSG PCE +E+ DI+LT
Sbjct  308   IDQLYCPYKKCDNLPPSKVKISDVSFKNIQGSSATALSLKIVCSSGSPCENMELADIDLT  367

Query  1115  IKG--GAAKSICKNVKPKLTGKVVPPLACG  1198
               G  G   S C NVKP ++G +   LAC 
Sbjct  368   YSGAKGTLTSQCLNVKPTISG-LTGALACA  396



>ref|XP_008465833.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=384

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 182/360 (51%), Positives = 240/360 (67%), Gaps = 10/360 (3%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             A  N D+  AL  AWK  C +T+ S V+IP+ T+ ++++EL GPCK  I++++  IL+AP
Sbjct  18    AMPNTDIFQALTNAWKAACGSTSQSQVLIPEETYKLSKIELTGPCKNRIQIQLQGILQAP  77

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGF--KGDKLPNNLSLNF  478
              +      +  W++ KYID FTL+G G  DGQG V  +   +     K  K   N+  +F
Sbjct  78    ADL----AEDNWISFKYIDQFTLTGKGVFDGQGKV-AWGKNDCAINPKCAKFAINVRFDF  132

Query  479   LTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSV  658
             + N+++ D+T+ +SK FH NVLG KNLTF +  + AP +SPNTDGIHI R IGI V ++ 
Sbjct  133   IKNAIVSDITSKDSKSFHFNVLGCKNLTFQNVNINAPEDSPNTDGIHIGRSIGINVINTN  192

Query  659   IGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNG  838
             IGTGDDCISLGDG + + IT VTCGPGHGISVGSLGR  GE PV+GI   N   I T NG
Sbjct  193   IGTGDDCISLGDGSQQVAITNVTCGPGHGISVGSLGRYVGEAPVQGIRAKNCTLINTTNG  252

Query  839   VRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYK  1015
             VRIKT P+S   GV +DIHFE+I M NV NP+VIDQEYCP+N+C K+ PS VK+S +S+ 
Sbjct  253   VRIKTRPSSPSLGVASDIHFEDIIMVNVINPMVIDQEYCPSNQCDKKNPSKVKISNVSFT  312

Query  1016  KISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKGGA--AKSICKNVKPKLTGKVVPPL  1189
              I GT+A  +AV   CSS  PCE++++ DINLT  G      S CK VKP ++G   P +
Sbjct  313   NIRGTAANALAVSFVCSSQFPCEDIKVTDINLTYNGSGDPISSTCKYVKPIVSGIQNPQI  372



>ref|XP_008245680.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=403

 Score =   354 bits (908),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 188/389 (48%), Positives = 243/389 (62%), Gaps = 14/389 (4%)
 Frame = +2

Query  65    FTFILFMLAHFGESATINVAA-----KANVDVGPALLKAWKEGCAATTASTVVIPKGTFP  229
             F F+L       +SA ++V +     K + D+  AL KAW + CA+T  S +V+PKGTF 
Sbjct  12    FVFLLLASTAKAQSAALDVTSAKYGGKPDSDITQALEKAWTDACASTAPSKIVVPKGTFK  71

Query  230   MTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV  409
                    GPCKA IE ++   L+AP +   +     W+   ++D  TLSGGGT DGQG +
Sbjct  72    FVGTTFKGPCKAAIEFQLQGTLQAPADGSQLPKDDTWIGFDHVDGLTLSGGGTFDGQGAL  131

Query  410   QVYPS---KEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTV  580
                 +   K +  K   +  NL  +FLTNS I D+T+ +SK FHVN+   + +  + FT+
Sbjct  132   SWKNNDCNKNRQCKSKHI--NLRFHFLTNSKILDVTSKDSKNFHVNLQKCEKVEINGFTI  189

Query  581   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  760
              AP  S NTDGIHI R  GI + D+ IGTGDDCIS+GDG ++L +T VTCGPGHGI++GS
Sbjct  190   SAPKESMNTDGIHIGRSTGIDIIDTTIGTGDDCISIGDGTKDLTVTNVTCGPGHGIAIGS  249

Query  761   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVI  937
             LGR P E PV GI +       T NGVRIKTWP S   G  +DIHFE+I M NV NPI+I
Sbjct  250   LGRYPEEEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPILI  309

Query  938   DQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTI  1117
             DQEYCP NEC K  PS VK+S +S+K I GT   PVAV+LAC+ G+PCE VE+ DI+L  
Sbjct  310   DQEYCPWNECKKGVPSKVKISNVSFKNIKGTCTDPVAVKLACAPGLPCENVELSDIDLKY  369

Query  1118  KG--GAAKSICKNVKPKLTGKVVPPLACG  1198
              G  G   S+C NVKP +  +V  PLAC 
Sbjct  370   IGDKGPITSVCSNVKPTIN-RVAQPLACA  397



>emb|CDP04342.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   350 bits (898),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 170/288 (59%), Positives = 212/288 (74%), Gaps = 5/288 (2%)
 Frame = +2

Query  341   LTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTNSVIRDLTTL  514
             +TI Y+D  TLSGGGTL+GQG  + +   E   K +  KLPN LSLNF+ N+VIRDLT+L
Sbjct  1     MTIMYVDQLTLSGGGTLEGQG-AKAWTQNECRVKTECSKLPNTLSLNFVNNTVIRDLTSL  59

Query  515   NSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGD  694
             NSKLFHVN+ G  N+TF HFT+ APG+SPNTDGIHI    G+ + DS IGTGDDCIS+GD
Sbjct  60    NSKLFHVNLFGCNNVTFQHFTITAPGDSPNTDGIHIGHSTGVVITDSNIGTGDDCISIGD  119

Query  695   GLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPG  874
             G + + I+ VTCGPGHGISVGSLGR   E PV+GIFV++    GT NGVR+K+WP S  G
Sbjct  120   GAKQVNISKVTCGPGHGISVGSLGRYDNELPVEGIFVTDCIISGTLNGVRVKSWPASKSG  179

Query  875   VVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQ  1054
               T++HFE I MQNV NP++IDQEYCPNN+C+   PS VK++++S+K I+GTSATP  V 
Sbjct  180   CATNMHFEGIIMQNVSNPMIIDQEYCPNNQCTNTAPSSVKIAQVSFKNITGTSATPAVVT  239

Query  1055  LACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLA  1192
             L CS  +PCE VE+ DI+L   G  G   S C NVKP L+GK+ PP+ 
Sbjct  240   LLCSKSIPCESVEVADIDLAYNGNQGNVSSNCANVKPALSGKLNPPIC  287



>gb|EYU42733.1| hypothetical protein MIMGU_mgv1a007538mg [Erythranthe guttata]
Length=404

 Score =   354 bits (908),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 180/387 (47%), Positives = 255/387 (66%), Gaps = 15/387 (4%)
 Frame = +2

Query  50    ISYCAFTFILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFP  229
             ++Y A    +F ++ +G       A     D+ P L K WKE C AT AS V+IPKGT+ 
Sbjct  18    LAYHAQAVTVFDISKYG-------AKPGGEDISPVLAKVWKEACEATNASKVLIPKGTWY  70

Query  230   MTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKK-EWLTIKYIDHFTLSGGGTLDGQGN  406
             ++Q+ L GP KAP+EL++   ++A P+   +  K  +W+TI Y+D FT+SGGG  DG+G 
Sbjct  71    LSQIRLVGPNKAPLELEVQGTVEANPDYTKLPQKDGQWITINYLDGFTISGGGVFDGKGE  130

Query  407   VQVYPSKE--KGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTV  580
              Q + + +  K     KLP NLSLNF+ N++I+D+TT +SK FH N +  +N+TF  FT+
Sbjct  131   -QAWKANDCHKNPNCPKLPINLSLNFIKNAIIKDVTTKDSKNFHCNCISSQNVTFQRFTI  189

Query  581   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  760
              APG S NTDGIHIAR+  + V DS IGTGDDCIS+GD   +L I  V CGPGHGISVGS
Sbjct  190   SAPGESINTDGIHIARVSNVKVLDSNIGTGDDCISIGDETTDLHIENVKCGPGHGISVGS  249

Query  761   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHFENIDMQNVKNPIVI  937
             +G+ P E+ V GI V    F GT NGVR+KTWP++   + ++++HFE++ M NV  P+VI
Sbjct  250   MGKNPAEKDVTGITVKKCTFTGTSNGVRVKTWPSAPATLKISNLHFEDLTMNNVSYPVVI  309

Query  938   DQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTI  1117
             DQ+YCP N C+K KPSL+++S ++ K + GT+ T  A+  +CSS  PC+ V+I DI+L  
Sbjct  310   DQQYCPWNLCTKDKPSLIQISGLTVKNVRGTANTKEALLFSCSSSKPCQNVQISDIDLKY  369

Query  1118  KGGAAK---SICKNVKPKLTGKVVPPL  1189
                      ++C+NVKP ++GK  PP+
Sbjct  370   VNSIPANFTTVCENVKPTVSGKQNPPI  396



>ref|XP_003544285.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=386

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 180/358 (50%), Positives = 236/358 (66%), Gaps = 8/358 (2%)
 Frame = +2

Query  134   NVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNP  313
             N D+  AL KAW++ C +TT S VVIP   + + Q++  GPCKAPIE+ +  I+KAP NP
Sbjct  31    NGDITMALQKAWRDACVSTTPSKVVIPSNKYKLRQIDFMGPCKAPIEILVNGIIKAPKNP  90

Query  314   KNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNLSLNFLT  484
              ++ G+ +W+   YI+  TLSG GT  G+G +   Q   S  K  K  KL  N    F+ 
Sbjct  91    FDVSGQNQWVRFGYINFLTLSGNGTFHGRGKMAWKQNNCSTNKNCK--KLAMNFGFGFVN  148

Query  485   NSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIG  664
             NSVI D+T+ +SK FHVNV G KN++F +F V +P  SPNTDGIHI +   + + +S I 
Sbjct  149   NSVIHDITSKDSKYFHVNVFGCKNISFTNFRVSSPAYSPNTDGIHIGKSTQVKITNSKID  208

Query  665   TGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVR  844
             TGDDCISLGDG + + I  VTCGPGHGISVGSLG+   E  V+ + V N     T+NG+R
Sbjct  209   TGDDCISLGDGSKEVTILNVTCGPGHGISVGSLGKYSNEDSVEDVIVKNCTLKNTNNGLR  268

Query  845   IKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKI  1021
             IKTWP +    + +D+HFE+I M NV NPI+IDQEYCP N+CSKQ PS +K+SK+++K I
Sbjct  269   IKTWPGTAIISLASDLHFEDITMINVSNPIIIDQEYCPWNQCSKQSPSKIKISKVTFKNI  328

Query  1022  SGTSATPVAVQLACSSGVPCEEVEIGDINLTIKGGA-AKSICKNVKPKLTGKVVPPLA  1192
              GTSAT   + L CSSG+PCE VE+ DINL   G     + C NVKPK+ G+  P  A
Sbjct  329   RGTSATQEGITLVCSSGIPCETVELSDINLRFNGTTLVTAKCANVKPKI-GRKAPICA  385



>emb|CAA05892.1| polygalacturonase [Arabidopsis thaliana]
 emb|CAA06610.1| polygalacturonase [Arabidopsis thaliana]
Length=391

 Score =   353 bits (906),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 180/375 (48%), Positives = 248/375 (66%), Gaps = 6/375 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
             FI+ +L     +    + + +  D+  ALLKA+   C +++ S VVIPKG F + ++E+ 
Sbjct  11    FIICLLGISANAEVFTIGSSSGSDITQALLKAFTSACQSSSPSKVVIPKGEFKLGEIEMR  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCKAPIE+ +   +KA  N   + GK++W+    ID F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIEVTLQGTVKADGNA--IQGKEKWVVFGNIDGFKLNGGGAFDGEGNAAWRVNNC  128

Query  428   EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  607
              K F+  KLP ++  +F+ NS IRD++++++K FH+NVLG KN+T ++  + AP +SPNT
Sbjct  129   HKTFECKKLPISIRFDFILNSEIRDISSIDAKNFHINVLGAKNMTMNNIKIVAPEDSPNT  188

Query  608   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  787
             DGIH+ R  GI + +S I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRSDGIKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGHEQD  248

Query  788   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNE  964
             V GI V N     TDNG+RIKTWP++      +DIHFE+I +++V NPI+IDQEYCP N+
Sbjct  249   VSGIKVINCTLQETDNGLRIKTWPSAACSTTASDIHFEDIILKDVSNPILIDQEYCPWNQ  308

Query  965   CSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKS  1138
             C+KQK S +KL  IS+K I GTS    AV+L CS G PC+ VEIGDI++   G  G A  
Sbjct  309   CNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIKYNGADGPATF  368

Query  1139  ICKNVKPKLTGKVVP  1183
              C NV PK+ G   P
Sbjct  369   HCSNVSPKILGSQSP  383



>ref|XP_008229849.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   353 bits (907),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 188/386 (49%), Positives = 242/386 (63%), Gaps = 14/386 (4%)
 Frame = +2

Query  65    FTFILFMLAHFGESATINVAA-----KANVDVGPALLKAWKEGCAATTASTVVIPKGTFP  229
             F F+L       +SA ++V +     K + D+  AL KAW + CA+T  S +V+PKGTF 
Sbjct  12    FVFLLLASTAKAQSAALDVTSAKYGGKPDSDITQALEKAWTDACASTAPSKIVVPKGTFK  71

Query  230   MTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV  409
                    GPCKA IE ++   L+AP +   +     W+   ++D  TLSGGGT DGQG +
Sbjct  72    FVGTTFKGPCKAAIEFQLQGTLQAPADGSQLPKDDTWIGFDHVDGLTLSGGGTFDGQGAL  131

Query  410   QVYPS---KEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTV  580
                 +   K +  K   +  NL  +FLTNS I D+T+ +SK FHVN+L  + +  + FTV
Sbjct  132   SWKNNDCNKNRQCKSKHI--NLRFHFLTNSKILDVTSKDSKNFHVNLLKCEKVEINGFTV  189

Query  581   KAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGS  760
              AP  S NTDGIHI R  GI + D+ IGTGDDCIS+GDG ++L +T VTCGPGHGI++GS
Sbjct  190   SAPKESMNTDGIHIGRSTGIDIIDTTIGTGDDCISIGDGTKDLTVTNVTCGPGHGIAIGS  249

Query  761   LGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVI  937
             LGR P E PV GI +       T NGVRIKTWP S   G  +DIHFE+I M NV NPI+I
Sbjct  250   LGRYPEEEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPILI  309

Query  938   DQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTI  1117
             DQEYCP NEC K  PS +K+S +S+K I GT   PVAV+LACS G+PCE VE+ DI+L  
Sbjct  310   DQEYCPWNECKKGAPSKIKISNVSFKNIKGTCTDPVAVKLACSPGLPCENVELSDIDLKY  369

Query  1118  KG--GAAKSICKNVKPKLTGKVVPPL  1189
              G  G   S+C NVKP +  +V  PL
Sbjct  370   TGDKGPITSVCSNVKPTIN-RVAQPL  394



>ref|NP_187439.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21192.1|AC013483_16 polygalacturonase (PGA3) [Arabidopsis thaliana]
 gb|AAL38715.1| putative polygalacturonase(PGA3 [Arabidopsis thaliana]
 gb|AAM20184.1| putative polygalacturonase (PGA3) [Arabidopsis thaliana]
 gb|AAM65120.1| polygalacturonase PGA3 [Arabidopsis thaliana]
 gb|AEE74608.1| polygalacturonase [Arabidopsis thaliana]
Length=391

 Score =   352 bits (904),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 179/375 (48%), Positives = 248/375 (66%), Gaps = 6/375 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
             FI+ +L     +    + + +  D+  ALLKA+   C +++ S VVIPKG F + ++E+ 
Sbjct  11    FIICLLGISANAEVFTIGSSSGSDITQALLKAFTSACQSSSPSKVVIPKGEFKLGEIEMR  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCKAPIE+ +   +KA  N   + GK++W+    ID F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIEVTLQGTVKADGNA--IQGKEKWVVFGNIDGFKLNGGGAFDGEGNAAWRVNNC  128

Query  428   EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  607
              K F+  KLP ++  +F+ NS IRD++++++K FH+NVLG KN+T ++  + AP +SPNT
Sbjct  129   HKTFECKKLPISIRFDFILNSEIRDISSIDAKNFHINVLGAKNMTMNNIKIVAPEDSPNT  188

Query  608   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  787
             DGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGHEQD  248

Query  788   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNE  964
             V GI V N     TDNG+RIKTWP++      +DIHFE+I +++V NPI+IDQEYCP N+
Sbjct  249   VSGIKVINCTLQETDNGLRIKTWPSAACSTTASDIHFEDIILKDVSNPILIDQEYCPWNQ  308

Query  965   CSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKS  1138
             C+KQK S +KL  IS+K I GTS    AV+L CS G PC+ VEIGDI++   G  G A  
Sbjct  309   CNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIKYNGADGPATF  368

Query  1139  ICKNVKPKLTGKVVP  1183
              C NV PK+ G   P
Sbjct  369   HCSNVSPKILGSQSP  383



>ref|XP_008222765.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   353 bits (905),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 182/365 (50%), Positives = 235/365 (64%), Gaps = 9/365 (2%)
 Frame = +2

Query  122   AAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKA  301
             +AK   DV  AL KAW + CA+ +AS VV+P GT+ + +    GPCKAPIE+++   L+A
Sbjct  35    SAKPGSDVTKALAKAWSDACASPSASKVVVPSGTYKLKEATFRGPCKAPIEMQVRGTLQA  94

Query  302   PPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNLSL  472
             P N         W+  +YID FTLSGGGT DGQG +   Q    K K  K   +P NL  
Sbjct  95    PANAGQFTRPDTWVGFQYIDKFTLSGGGTFDGQGALVWGQNDCHKNKNCK--PIPINLRF  152

Query  473   NFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKD  652
              F+TNS ++D+T+LNSK FH++V   K+ TF H T+ AP  S NTDGIHI    GI +  
Sbjct  153   EFITNSRVQDITSLNSKNFHMHVFRCKHTTFQHLTITAPEESRNTDGIHIGASTGINITH  212

Query  653   SVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTD  832
             + I TGDDC+S+GD    + +T VTCGPGHGIS+GSLGR   E+ V GI V N     T 
Sbjct  213   AKIRTGDDCVSIGDDSHQITVTDVTCGPGHGISIGSLGRYKEEKAVTGIIVKNCTLTNTQ  272

Query  833   NGVRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKIS  1009
             NGVRIKTWP+S      +DIH+ENI M NV NPI+IDQ YCP   C ++ PS VK++ +S
Sbjct  273   NGVRIKTWPDSPSSSTASDIHYENIIMVNVSNPILIDQLYCPYTRCDQKPPSKVKINNVS  332

Query  1010  YKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVP  1183
             +K I G+S TP+AV+L CS G+PCE V++ DI+LT  G  G   S+C NVKP +TG +  
Sbjct  333   FKNIKGSSFTPLAVKLVCSRGLPCENVKLTDIDLTYGGDQGPLTSLCSNVKPTITG-MKK  391

Query  1184  PLACG  1198
              LAC 
Sbjct  392   ALACA  396



>ref|XP_002884668.1| polygalacturonase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60927.1| polygalacturonase 3 [Arabidopsis lyrata subsp. lyrata]
Length=391

 Score =   352 bits (904),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 182/379 (48%), Positives = 247/379 (65%), Gaps = 7/379 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
              I+ +L     +    + + +  D+  ALLKA+   C +++ S VVIPKG F + ++E+ 
Sbjct  11    LIICLLGISANAEVFTIGSSSGSDITQALLKAFTSACQSSSPSKVVIPKGEFKLGEIEMR  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCKAPIE+ +   +KA  N   + GK++W+    ID F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIEVTLQGTVKADGNA--IQGKEKWVVFGNIDGFKLNGGGAFDGEGNSAWRVNNC  128

Query  428   EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  607
              K F   KLP ++  +F+ NS IRD++++++K FH+NVLG KN+T D+  + AP  SPNT
Sbjct  129   HKTFNCKKLPISIRFDFVLNSEIRDISSIDAKNFHINVLGAKNMTMDNIKIIAPEESPNT  188

Query  608   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  787
             DGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGHEQD  248

Query  788   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNE  964
             V GI + N     TDNG+RIKTWP++      +DIHFE+I ++NV NPI+IDQEYCP N+
Sbjct  249   VSGIKIINCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVSNPILIDQEYCPWNQ  308

Query  965   CSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKS  1138
             C+KQK S +KL  IS+K I GTS    AV+L CS G PC+ VEIGDI++   G  G A  
Sbjct  309   CNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIKYNGADGPATF  368

Query  1139  ICKNVKPKLTGKVVPPLAC  1195
              C NV PKL G   P  AC
Sbjct  369   QCSNVSPKLLGSQSPK-AC  386



>ref|XP_006299274.1| hypothetical protein CARUB_v10015428mg [Capsella rubella]
 gb|EOA32172.1| hypothetical protein CARUB_v10015428mg [Capsella rubella]
Length=396

 Score =   352 bits (904),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 182/382 (48%), Positives = 246/382 (64%), Gaps = 7/382 (2%)
 Frame = +2

Query  62    AFTFILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQV  241
             +  FI+ +      +    + + +  D+  ALLKA+   C + + S VVIPKG F + ++
Sbjct  8     SIIFIICLSGFSANAEVFTIRSSSGSDITQALLKAFTSACQSPSPSKVVIPKGEFKLREI  67

Query  242   ELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYP  421
             E+ GPCKAPIE+ I   +KA  N   + GK +W+    I+ F L+GGG  DG+GN     
Sbjct  68    EMRGPCKAPIEITIQGTVKADGNA--IQGKDKWVVFGNINGFKLNGGGAFDGEGNASWRV  125

Query  422   SK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNS  598
             +   K F+  KLP ++  +F+ NS IRD+++++SK FH+NVLG KN+T D+  + AP  S
Sbjct  126   NNCHKTFQCKKLPISIRFDFVLNSEIRDISSIDSKNFHINVLGAKNMTMDNIKIIAPEES  185

Query  599   PNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPG  778
             PNTDGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR   
Sbjct  186   PNTDGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGH  245

Query  779   ERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT-DIHFENIDMQNVKNPIVIDQEYCP  955
             E+ V GI + N     TDNG+RIKTWP++       DIHFE+I ++NV NPI+IDQEYCP
Sbjct  246   EQDVSGIRIINCTLQQTDNGLRIKTWPSAACSTTAFDIHFEDIIVKNVSNPILIDQEYCP  305

Query  956   NNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GA  1129
              N+C+KQKPS +KL   S+K I GTS    AV+L CS G PC+ VEIGD+++   G  G 
Sbjct  306   WNQCNKQKPSTIKLVNTSFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGDVDIKYNGADGP  365

Query  1130  AKSICKNVKPKLTGKVVPPLAC  1195
             A   C NV PKL G    P AC
Sbjct  366   ATFQCSNVSPKLLG-TQNPKAC  386



>gb|ABY21306.1| pollen allergen Pla o 2 [Platanus orientalis]
Length=378

 Score =   351 bits (901),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 173/364 (48%), Positives = 242/364 (66%), Gaps = 5/364 (1%)
 Frame = +2

Query  116   NVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCK-APIELKIMAI  292
             +  AK + D+  A++KAW+  CA+   STV+IP G + M +V L GPCK + I  ++  +
Sbjct  15    DYGAKGSGDISQAVMKAWEAACASPGPSTVLIPTGNYIMGEVLLEGPCKGSKIGFQLDGV  74

Query  293   LKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGN-VQVYPSKEKGFKGDKLPNNLS  469
             +KAP +       + W+   ++D  T+SG GT DGQG       + +K    ++ P N+ 
Sbjct  75    VKAPADVSAFK-SEGWVVFNHVDGLTVSGKGTFDGQGQKAWAANNCDKDENCNRPPMNIR  133

Query  470   LNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVK  649
              NFL N+V+RD+T++NSK+FH+NVL   N++F H T+ APG S NTDGIHI    G+T+ 
Sbjct  134   FNFLKNAVVRDITSMNSKMFHINVLECDNISFQHVTISAPGTSINTDGIHIGLSRGVTIT  193

Query  650   DSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGT  829
             D+ I TGDDC+S+G G +N+ +T V CGPGHGISVGSLG+   E+ V+GI V+   F GT
Sbjct  194   DTNIATGDDCVSIGPGSQNVTVTKVNCGPGHGISVGSLGKYKDEKDVRGITVTGCTFTGT  253

Query  830   DNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKIS  1009
              NGVR+KTWP+S PGV TD+ FE++ M+NV+NP+++DQEYCP  +CS + PS VKLS I 
Sbjct  254   SNGVRVKTWPDSPPGVATDMAFEDLTMKNVQNPVILDQEYCPYGQCSLKAPSRVKLSNIK  313

Query  1010  YKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIK--GGAAKSICKNVKPKLTGKVVP  1183
             +  I GTS+ P A+ +ACS G PC  +EIG+INL +   G  A S C N KP  +GK VP
Sbjct  314   FNNIRGTSSGPDAIVIACSHGFPCSNLEIGEINLALHAAGAPANSTCTNAKPIFSGKQVP  373

Query  1184  PLAC  1195
              + C
Sbjct  374   AIKC  377



>ref|XP_004161033.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=405

 Score =   352 bits (903),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 187/408 (46%), Positives = 251/408 (62%), Gaps = 24/408 (6%)
 Frame = +2

Query  41    MATISYCAFTFILFMLAHFGESATINVAAKANV--------------DVGPALLKAWKEG  178
             M  I Y   +   F+++    S TI   +  +V              DV  AL  AW + 
Sbjct  1     MGMIKYSNLSITTFLMSLL--SFTIESQSHVDVIFPLRKYGNIVSGDDVTEALKDAWNDA  58

Query  179   CAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYI  358
             CA+   S VVIP G F + + E  GPCK+PIE+++   L+AP +P        W+T  Y+
Sbjct  59    CASVRPSAVVIPDGIFKVREGEFKGPCKSPIEIRVRGTLQAPKHPHG----DSWITFAYV  114

Query  359   DHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHV  535
             D  T+SG G  DGQG      +   K      LP +L  +F+TNS++R +T+L+SK FHV
Sbjct  115   DRMTISGKGVFDGQGKAGWEKNDCHKRIDCVNLPISLRFDFITNSIVRGITSLDSKNFHV  174

Query  536   NVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKI  715
             N+LG  NLTF    + AP +SPNTDGIHI R IGI++  S I TGDDCISLGDG + +KI
Sbjct  175   NILGCNNLTFQGVNIIAPEDSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRVKI  234

Query  716   TGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIH  892
             T VTCGPGHGIS+GSLG+   E PV  + V N   + T NG+RIKTWP+S   G+ T++H
Sbjct  235   TNVTCGPGHGISIGSLGKYTNEEPVDDVVVKNCTIMNTTNGIRIKTWPSSPVAGIATNMH  294

Query  893   FENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSG  1072
             F +I M NV NPI+IDQEYCP N+C+++ PS +K++ +S+K I G+SATPVAV+L CSS 
Sbjct  295   FSDITMVNVSNPILIDQEYCPWNQCNREIPSNIKINNVSFKNIKGSSATPVAVKLICSSN  354

Query  1073  VPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLACGK*TT  1210
              PCEEV++ +I+L   G  G   S C NVKP ++G   P +     TT
Sbjct  355   KPCEEVKVANIDLVYNGINGPVTSQCMNVKPIISGIQNPSICSSSYTT  402



>ref|XP_004491599.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=393

 Score =   351 bits (901),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 235/372 (63%), Gaps = 8/372 (2%)
 Frame = +2

Query  80    FMLAHFG--ESATINVA--AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVEL  247
             F+L  FG  +SA  ++      + D+  A    WK  C +T AS V IP G++ M  + +
Sbjct  13    FLLTTFGIAQSAVFDIRKYGAPSGDITTAFGDVWKAACNSTGASKVWIPSGSYKMGAIVV  72

Query  248   AGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK  427
              GPC  PIE+++   + AP NP  +    EW+  +Y+D FTLSG G  DGQG +    + 
Sbjct  73    KGPCNGPIEVQVDGTIIAPANPAALHDAYEWIKFEYVDFFTLSGKGVFDGQGAIAWNQND  132

Query  428   -EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPN  604
               K    D    N   NFL ++ +RD+T+ +SK FHVNVLG  N TFDHFTV AP  S N
Sbjct  133   CGKNKNCDMASMNFGFNFLKHATVRDITSKDSKNFHVNVLGCTNFTFDHFTVTAPATSLN  192

Query  605   TDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGER  784
             TDGIHI R   + + ++ IGTGDDC+SLGDG + + +  V CGPGHGISVGSLG+ P E 
Sbjct  193   TDGIHIGRSTDVKILNTNIGTGDDCVSLGDGCKQITVQNVNCGPGHGISVGSLGKYPKEE  252

Query  785   PVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV--VTDIHFENIDMQNVKNPIVIDQEYCPN  958
             PV+ + V N     TDNGVRIKTWP S PG   +TD+HFE+I M +V NP++IDQEYCP 
Sbjct  253   PVEQLLVKNCTLTNTDNGVRIKTWP-STPGTNPITDMHFEDITMVDVLNPVIIDQEYCPW  311

Query  959   NECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKGGAAKS  1138
             N+CSKQ PS +K+SK+++K I GTS T   V L CS  VPCE VE+ ++ LT  G    +
Sbjct  312   NQCSKQSPSKIKISKVTFKNIKGTSKTKDGVILICSKSVPCEGVELNNVALTFNGTEVDA  371

Query  1139  ICKNVKPKLTGK  1174
              C NVKP +TGK
Sbjct  372   KCVNVKPIVTGK  383



>sp|Q39766.1|PGLR_GOSBA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium barbadense]
 gb|AAA58322.1| polygalacturonase [Gossypium barbadense]
Length=407

 Score =   352 bits (902),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/380 (47%), Positives = 245/380 (64%), Gaps = 11/380 (3%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAK------ANVDVGPALLKAWKEGCAATTASTVVIPKGTFPM  232
              +LF+ A   +    +V AK         D+    L AWKE CA+ T STVVIPKGT+ +
Sbjct  15    LLLFISASKVQPDAFDVVAKFGAKADGKTDLSKPFLDAWKEACASVTPSTVVIPKGTYLL  74

Query  233   TQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQ  412
             ++V L GPCKAPIE+ +   ++AP +P        W+    +++F + GGG  DGQG++ 
Sbjct  75    SKVNLEGPCKAPIEINVQGTIQAPADPSAFK-DPNWVRFYSVENFKMFGGGIFDGQGSIA  133

Query  413   VYPS--KEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKA  586
                +  + + F+  KLP N+  +F+TN++I+D+T+ +SKLFH+NV   KN+T +   ++A
Sbjct  134   YEKNTCENREFRS-KLPVNIRFDFVTNALIQDITSKDSKLFHINVFACKNITLERLKIEA  192

Query  587   PGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLG  766
             P  SPNTDGIH+ +  G+ +  S I TGDDCIS+GDG +N+ I  +TCGPGHGIS+GSLG
Sbjct  193   PDESPNTDGIHMGKSEGVNIIASDIKTGDDCISIGDGTKNMVIKEITCGPGHGISIGSLG  252

Query  767   RTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQE  946
             +   E PV+GI +SN     T NG RIKTWP  H G V++IHFE+I M NV +PI+IDQ+
Sbjct  253   KFQNEEPVEGIKISNCTITNTSNGARIKTWPGEHGGAVSEIHFEDITMNNVSSPILIDQQ  312

Query  947   YCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKGG  1126
             YCP N+C K + S VKLS IS+K I GTSA P A++  CS   PC+ VE+ DI++   G 
Sbjct  313   YCPWNKCKKNEESKVKLSNISFKNIRGTSALPEAIKFICSGSSPCQNVELADIDIQHNGA  372

Query  1127  A-AKSICKNVKPKLTGKVVP  1183
               A S C NVKP   GK+ P
Sbjct  373   EPATSQCLNVKPITIGKLNP  392



>ref|XP_011003515.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Populus euphratica]
Length=397

 Score =   351 bits (900),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 182/389 (47%), Positives = 250/389 (64%), Gaps = 9/389 (2%)
 Frame = +2

Query  35    LKMATISYCAFTFILFMLAHFGESATINV-AAKAN--VDVGPALLKAWKEGCAATTASTV  205
             +  A ++Y    F+L +    G +  +    AKAN   D   A+  AWK+ CAA  ASTV
Sbjct  5     MMAAGVAY-HLCFLLLVTQVQGSNFDVKAYGAKANGMTDDSKAINSAWKDACAAKEASTV  63

Query  206   VIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGG  385
             VI KG + +  ++  GPC AP+ +K+   LKAP +PK +  + +W+  + ++  T+SGGG
Sbjct  64    VIAKGNYMVGPLKFEGPCTAPVTVKVQGTLKAPADPKRL--RDDWVAFRNVEGLTVSGGG  121

Query  386   TLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLT  562
               DGQG +    +   K  K + LP NL    LTNS I  +T+LNSKLFH+N+L   N+T
Sbjct  122   IFDGQGAIAWSVNNCAKTGKCNSLPTNLQFTKLTNSKIEGITSLNSKLFHMNILNCNNVT  181

Query  563   FDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGH  742
             F +  + AP NS NTDGIHI R   + +  + I TGDDC+SLGDG + + +  VTCGPGH
Sbjct  182   FQNIVINAPKNSLNTDGIHIGRSTMVNITGATIKTGDDCVSLGDGCQQINVEKVTCGPGH  241

Query  743   GISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVK  922
             GIS+GSLGR   E+PV G+ V N     T+NGVRIKTWP S  GV ++++FE+I M NV 
Sbjct  242   GISIGSLGRYHDEQPVIGVTVRNCTLTNTENGVRIKTWPASPSGVASNVNFEDIIMNNVS  301

Query  923   NPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGD  1102
             NPI+IDQEYCP N C  + PS VK+S + ++ I GTSAT VAV++ CS G+PC+ V + D
Sbjct  302   NPILIDQEYCPYNNCLAKVPSRVKISDVRFEGIRGTSATQVAVKIVCSRGLPCQNVFVED  361

Query  1103  INLTIKG--GAAKSICKNVKPKLTGKVVP  1183
             INL   G  G++ S+C NVKP+++GKV P
Sbjct  362   INLVYNGKEGSSTSLCANVKPQVSGKVFP  390



>gb|KHN40047.1| Polygalacturonase [Glycine soja]
Length=392

 Score =   350 bits (899),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 179/358 (50%), Positives = 235/358 (66%), Gaps = 8/358 (2%)
 Frame = +2

Query  134   NVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNP  313
             N D+  AL KAW++ C +TT S VVIP   + + Q++   PCKAPIE+ +  I+KAP NP
Sbjct  37    NGDITMALQKAWRDACVSTTPSKVVIPSNKYKLRQIDFMRPCKAPIEILVNGIIKAPKNP  96

Query  314   KNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNLSLNFLT  484
              ++ G+ +W+   YI+  TLSG GT  G+G +   Q   S  K  K  KL  N    F+ 
Sbjct  97    FDVSGQNQWVRFGYINFLTLSGNGTFHGRGKMAWKQNNCSTNKNCK--KLAMNFGFGFVN  154

Query  485   NSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIG  664
             NSVI D+T+ +SK FHVNV G KN++F +F V +P  SPNTDGIHI +   + + +S IG
Sbjct  155   NSVIHDITSKDSKYFHVNVFGCKNISFTNFRVSSPAYSPNTDGIHIGKSTQVKITNSKIG  214

Query  665   TGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVR  844
             TGDDCISLGDG + + I  VTCGP HGISVGSLG+   E  V+ + V N     T+NG+R
Sbjct  215   TGDDCISLGDGSKEVTILNVTCGPEHGISVGSLGKYSNEDSVEDVIVKNCTLKNTNNGLR  274

Query  845   IKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKI  1021
             IKTWP +    + +D+HFE+I M NV NPI+IDQEYCP N+CSKQ PS +K+SK+++K I
Sbjct  275   IKTWPGTAIISLASDLHFEDITMINVSNPIIIDQEYCPWNQCSKQSPSKIKISKVTFKNI  334

Query  1022  SGTSATPVAVQLACSSGVPCEEVEIGDINLTIKGGA-AKSICKNVKPKLTGKVVPPLA  1192
              GTSAT   + L CSSG+PCE VE+ DINL   G     + C NVKPK+ G+  P  A
Sbjct  335   RGTSATQEGITLVCSSGIPCETVELSDINLRFNGTTLVTAKCANVKPKI-GRKAPICA  391



>ref|XP_008231346.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231347.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231348.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231349.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   351 bits (901),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 179/364 (49%), Positives = 237/364 (65%), Gaps = 9/364 (2%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK   DV  AL KAW + CA+ +AS VV+P GT+ + +    GPCKAPIE+++   L+AP
Sbjct  36    AKPGSDVSTALAKAWSDACASPSASKVVVPSGTYKLKEANFRGPCKAPIEMQVQGTLQAP  95

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNLSLN  475
              +   +     W+  +YID  TLSGGGT DGQG +   Q    K K  K   +P NL   
Sbjct  96    ADASQLTRPDTWVGFQYIDMLTLSGGGTFDGQGALSWNQNDCHKNKNCK--PIPVNLRFE  153

Query  476   FLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDS  655
             FLTNS ++D+T+LNSK FH++V    + TF   T+ AP +S NTDGIHI    GI +  +
Sbjct  154   FLTNSKVQDITSLNSKFFHMHVFRCNHTTFQQLTITAPDDSRNTDGIHIGASTGINITHA  213

Query  656   VIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDN  835
              IGTGDDCIS+GD    + +T VTCGPGHGIS+GSLG+   E+ V GI V N     TDN
Sbjct  214   KIGTGDDCISIGDDSHEITVTDVTCGPGHGISIGSLGKYKDEKDVTGIIVKNCTLTNTDN  273

Query  836   GVRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISY  1012
             GVRIKT+P+S  P   + IH+E+I M NV NPI++DQ YCP  +C ++ PS VK+S +S+
Sbjct  274   GVRIKTFPDSPSPSTASGIHYEDIIMVNVSNPILVDQLYCPYTQCEQKPPSKVKISNVSF  333

Query  1013  KKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPP  1186
             K I G+S TP+AV+L C++G+PCE VE+ DI+LT  G  G   S+C NVKP +TG V+  
Sbjct  334   KNIKGSSFTPLAVKLVCTTGIPCENVELTDIDLTYGGDKGPLTSMCSNVKPTITG-VIKG  392

Query  1187  LACG  1198
             L C 
Sbjct  393   LGCA  396



>ref|XP_010442229.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   350 bits (899),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 181/386 (47%), Positives = 249/386 (65%), Gaps = 8/386 (2%)
 Frame = +2

Query  41    MATISYCAFTFILFMLAHFGESATI-NVAAKANVDVGPALLKAWKEGCAATTASTVVIPK  217
             M  +++    F +F L     +A + N+ +K   D+  ALLKA+ + C   T STV+IPK
Sbjct  1     MGRVNFGVSAFFIFCLLGLSANAKVFNIGSKPGCDITKALLKAFNQACQFPTKSTVLIPK  60

Query  218   GTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDG  397
             G + + ++E+ GPCKAPI + +   +KA  N  + +   +W+    ID F L+GGG  DG
Sbjct  61    GEYKLGEIEMMGPCKAPIRIALQGTVKADGNAVHSE---KWIAFHNIDGFKLNGGGVFDG  117

Query  398   QGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHF  574
             +GN     +     +K  KLP ++  +F+TN+ IR +T+L++K FH+NV+G KN+TF+  
Sbjct  118   EGNAAWRVNNCHHTWKCKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEEV  177

Query  575   TVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISV  754
              + AP  SPNTDGI + R  GI + +S I TGDDC+S+GDG++NL +  VTCGPGHGIS+
Sbjct  178   KIVAPAESPNTDGILVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISI  237

Query  755   GSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHFENIDMQNVKNPI  931
             GSLGR   E+ V GI + N     TDNG+RIKTWP +      +DIHFENI ++NV NPI
Sbjct  238   GSLGRYGHEQDVMGIKIVNCTLQETDNGLRIKTWPTAACSTSASDIHFENILLKNVSNPI  297

Query  932   VIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINL  1111
             +IDQEYCP N+C K+K S +KLSKIS+K I GTS    AV+L CS G PC+ VE+G+IN+
Sbjct  298   LIDQEYCPWNQCDKKKASTIKLSKISFKNIRGTSGNKDAVKLLCSKGHPCQNVELGNINI  357

Query  1112  TIKG--GAAKSICKNVKPKLTGKVVP  1183
                G  G A   C NV PKL G  VP
Sbjct  358   KYTGSDGPATFQCSNVSPKLMGTQVP  383



>gb|KFK38252.1| hypothetical protein AALP_AA3G089100 [Arabis alpina]
Length=394

 Score =   350 bits (898),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 178/379 (47%), Positives = 246/379 (65%), Gaps = 7/379 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
             F+  +L     +    + + +  D+   LLKA+   C + + S VVIPKG F + ++EL 
Sbjct  11    FVFCLLGFSANAEEFTIGSSSGSDITQELLKAFTSACQSPSRSRVVIPKGEFKLGEIELR  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCKAPI++ +   +KA  N     GK +W+    I+ F L GGG  DG+GN     +  
Sbjct  71    GPCKAPIDIVLRGTVKADGNTAY--GKDKWVVFGNINGFKLHGGGAFDGEGNAAWRVNNC  128

Query  428   EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  607
              K F+  KLP ++  +F+ N++I+D++++++K FH+NVLG KN+T  +  + AP +SPNT
Sbjct  129   HKTFECKKLPISIRFDFIENAIIKDISSIDAKNFHINVLGAKNMTMSNIKIIAPEDSPNT  188

Query  608   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  787
             DGIH+ R  G+ + +S I TGDDCIS+GDG++NL + GV CGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEGVVCGPGHGISVGSLGRYGMEQD  248

Query  788   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNE  964
             V GI V N     TDNG+RIKTWP+S      +DIHFE+I +++V NPI+IDQEYCP N+
Sbjct  249   VSGITVKNCTLQSTDNGLRIKTWPSSACSTTASDIHFEDIILKDVSNPILIDQEYCPWNQ  308

Query  965   CSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKS  1138
             C+KQK S +KL  IS+KKI GTS    AV+L CS G PC+ VEIGDI++   G  G A  
Sbjct  309   CNKQKSSTIKLVNISFKKIRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIRYNGADGPATF  368

Query  1139  ICKNVKPKLTGKVVPPLAC  1195
              C NV PK+ G  +P  AC
Sbjct  369   QCSNVSPKIMGTQIPK-AC  386



>ref|XP_006407793.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
 gb|ESQ49246.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
Length=396

 Score =   350 bits (897),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 180/388 (46%), Positives = 249/388 (64%), Gaps = 6/388 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
              +L +L     +    + + +  D+  ALLKA+   C +T+ S VVIPKG F + ++E+ 
Sbjct  11    LVLCLLGISANAEVFTIGSSSGSDITQALLKAFTSACQSTSPSKVVIPKGEFKLGEIEMR  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCKAP+E+ +   +KA  N  +  GK +W+    I+ F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPVEITLQGTVKADGNTNH--GKDKWVVFGNINGFKLNGGGAFDGEGNAAWRVNNC  128

Query  428   EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  607
              K F+  KLP ++  +F+ N+ I+D++++++K FH+NVLG KN+T D+  + AP +SPNT
Sbjct  129   HKTFECKKLPISVRFDFVENAEIKDISSIDAKNFHINVLGAKNMTMDNIKITAPEDSPNT  188

Query  608   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  787
             DGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  V CGPGHGISVGSLGR   E  
Sbjct  189   DGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVVCGPGHGISVGSLGRYGHEED  248

Query  788   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNE  964
             V GI V N     TDNG+RIKTWP++      +DIHFE+I ++NV NPI+IDQEYCP N+
Sbjct  249   VSGIRVVNCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVSNPILIDQEYCPWNQ  308

Query  965   CSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKS  1138
             C+KQK S +KL  IS+K I GTS    AV+L CS G PC++VEIGDI++   G  G A  
Sbjct  309   CNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQKVEIGDIDIAYSGADGPATF  368

Query  1139  ICKNVKPKLTGKVVPPLACGK*TTL*DQ  1222
              C NV P+L G   P    G  TT   Q
Sbjct  369   QCSNVSPQLLGSQSPKACSGPVTTTPQQ  396



>emb|CAN65676.1| hypothetical protein VITISV_002011 [Vitis vinifera]
Length=587

 Score =   356 bits (913),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 230/355 (65%), Gaps = 2/355 (1%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             A    D+  ALL AW+  CA+   S VVIP G + + QV + GPCKAPI L +   ++AP
Sbjct  226   ADGKTDISQALLTAWEAACASPIVSRVVIPAGIYALGQVTIEGPCKAPINLIVKGTVRAP  285

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLT  484
              +      +  W+  +++D FTLSG G  DGQG         +    ++LP NL  NFLT
Sbjct  286   VDTSRFKPQAGWVAFQHLDQFTLSGYGVFDGQGQSVWGQKCSRTKYCNQLPINLRFNFLT  345

Query  485   NSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIG  664
             NS+I+D+T+ +SK FH+NVLG +N+TF    + AP +S NTDGIHI R  G+ +  S I 
Sbjct  346   NSIIKDITSKDSKQFHINVLGCRNITFFQVAITAPEDSQNTDGIHIGRSRGVNITHSTIQ  405

Query  665   TGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVR  844
             TGDDC+S+GDG E + IT V CGPGHGISVGSLG    E PV GI V N     T NGVR
Sbjct  406   TGDDCVSIGDGSEQIDITKVNCGPGHGISVGSLGLYKNEAPVIGIRVKNCTLSDTTNGVR  465

Query  845   IKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKIS  1024
             +KT+P+S  G  T++HF +I M NV NPI+IDQEYCP+N+C+ Q PS VKLS IS+K I 
Sbjct  466   VKTYPSSPQGTATEMHFHDIVMNNVSNPIIIDQEYCPHNQCNLQVPSRVKLSNISFKNIR  525

Query  1025  GTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVP  1183
             GT++T +AV L CS G PC++VE+G+I+L   G  G A S CKNV+  L G   P
Sbjct  526   GTTSTELAVNLVCSKGAPCQKVELGNIDLKYTGPEGTASSQCKNVEATLWGTQQP  580


 Score =   179 bits (453),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 113/161 (70%), Gaps = 0/161 (0%)
 Frame = +2

Query  557   LTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGP  736
             +T  + T+ A  +S NTDGIH+ R  G+ + D++I TGDD +S+GDG +++ +  VTCGP
Sbjct  1     MTLQYVTINATRDSLNTDGIHMGRSTGVNISDAIIKTGDDSLSIGDGSQHINVEKVTCGP  60

Query  737   GHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQN  916
             GHGISVGSLG+   E PV G+ V N   I T NG+R+KTWP+S   V TD+HFE+I M N
Sbjct  61    GHGISVGSLGKYHNEEPVVGVTVKNCTLINTMNGIRVKTWPDSPASVATDLHFEDIIMNN  120

Query  917   VKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSAT  1039
             V NPI+I+QEYCP ++C  + PS VK+S +S++ I   S T
Sbjct  121   VGNPILINQEYCPYDQCQAKVPSQVKISDVSFQGICSMSGT  161



>ref|XP_010667847.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=400

 Score =   349 bits (896),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 185/394 (47%), Positives = 245/394 (62%), Gaps = 7/394 (2%)
 Frame = +2

Query  35    LKMATISYCAFTFILFMLAHFGESAT--INVAAKANVDVGPALLKAWKEGCAATTASTVV  208
             +K   + +    F LF+     ++      + AK N D    L+ AWK+ CAA   + +V
Sbjct  1     MKTPNLPFFISLFYLFVCVVRSQNVIDITKLGAKPNGDATQGLMAAWKQACAAPAPTKIV  60

Query  209   IPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFT---LSG  379
             +P G+F +  ++  GPCKA + ++I    KAPPNP  M G   W+ I+ I   T   L  
Sbjct  61    VPPGSFLLNVIKFTGPCKAAVTIEIAGNFKAPPNPAQMKGSDTWVKIENIQGLTINCLPT  120

Query  380   GGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKN  556
             GGT DGQG +    +   K    + LP N   N LTNS I  + +LNSKL+H+ VLG KN
Sbjct  121   GGTFDGQGQMAWKQNNCAKTGSCNNLPYNFRFNSLTNSKISGIKSLNSKLYHMGVLGCKN  180

Query  557   LTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGP  736
              T    T++AP +S NTDGIHI R  GI V  + IGTGDDCIS+GDG  ++ I  +TCGP
Sbjct  181   FTLFDTTIQAPKDSLNTDGIHIGRSAGIFVTKAKIGTGDDCISMGDGAVDVHIEDITCGP  240

Query  737   GHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQN  916
             GHGIS+GSLGR   E PV G+ V       TDNGVRIK+W NS   + +++HFE+I ++N
Sbjct  241   GHGISIGSLGRYQKEAPVTGVTVKKCTISDTDNGVRIKSWLNSFEAIASNLHFEDITVKN  300

Query  917   VKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEI  1096
             V NPI+IDQEYCP N C  + PS VKLS IS+K I GT+ +  AV++ CSSG PC++VE+
Sbjct  301   VLNPILIDQEYCPYNHCKAKTPSKVKLSNISFKNIRGTAGSKEAVKILCSSGAPCDKVEL  360

Query  1097  GDINLTIKGGAAKSICKNVKPKLTGKVVPPLACG  1198
              DI+LT  GG A S+CKNVKP  +GK   P+ACG
Sbjct  361   ADIDLTFNGGHAVSMCKNVKPITSGK-QNPVACG  393



>ref|XP_010418169.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=410

 Score =   349 bits (896),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 185/381 (49%), Positives = 251/381 (66%), Gaps = 11/381 (3%)
 Frame = +2

Query  77    LFMLAHFGESA----TINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVE  244
             +F+L   G SA      N+ +    D+  ALLKA+   C  TT S VVIPKG F + ++ 
Sbjct  23    IFVLCLVGFSANAHEVFNINSPPGSDITQALLKAFTAACQCTTPSRVVIPKGEFKLCEII  82

Query  245   LAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPS  424
             + GPCKAP+E+ ++  L A  +  N+ GK +W+  + I+ F L+GGGT DG+G+     +
Sbjct  83    MTGPCKAPVEITLLGTLLA--DGSNIHGKDKWVVFRKINGFKLNGGGTFDGEGSAAWRVN  140

Query  425   K-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  601
                K     KLP +L  +F+TN+ IRD+++++SK FHVNV+G  N+TFD+  + AP  SP
Sbjct  141   NCHKTSNCKKLPISLRFDFVTNAEIRDISSVDSKNFHVNVIGAMNMTFDNVKILAPAESP  200

Query  602   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  781
             NTDGIH+ R  G+++ +S I TGDDCIS+GDG+ NL +  V CGPGHGIS+GSLGR P E
Sbjct  201   NTDGIHLGRSDGVSIINSRISTGDDCISVGDGMVNLLVKNVVCGPGHGISIGSLGRYPHE  260

Query  782   RPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTD-IHFENIDMQNVKNPIVIDQEYCPN  958
             + V+GI V N     TDNG+RIKTWP +   +V   IHFE+I ++NV NPI+IDQEYCP 
Sbjct  261   QNVRGIRVINCTVQETDNGLRIKTWPTAACSIVASGIHFEDIILKNVSNPILIDQEYCPW  320

Query  959   NECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAA  1132
             N+C+KQK S +KL  +S+  I GTSA   AV+L CS G PCE V +G+IN+   G  G A
Sbjct  321   NQCNKQKSSSIKLVDVSFTNIRGTSANKDAVKLLCSKGYPCENVVVGNINIEYTGRDGPA  380

Query  1133  KSICKNVKPKLTGKVVPPLAC  1195
               +C NVKPKL G +  P AC
Sbjct  381   TFMCSNVKPKLVG-IQNPKAC  400



>ref|XP_010458152.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   348 bits (892),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 179/379 (47%), Positives = 249/379 (66%), Gaps = 7/379 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
             FI+ +L     +    + + +  D+  ALLKA+   C + + S VVIPKG F + ++E+ 
Sbjct  11    FIICLLGISANAEVFTIGSSSGSDITQALLKAFTAACQSPSPSKVVIPKGEFKLGEIEMK  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCKAPIE+ I   +KA  N   + GK +W+    I+ F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIEVTIQGTVKADGNA--IQGKDKWVVFGNINGFKLNGGGAFDGEGNASWRVNNC  128

Query  428   EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  607
              K F+  KLP ++  +F+ NS I+D++++++K FH+NVLG KN+T ++  + AP +SPNT
Sbjct  129   HKTFQCKKLPISIRFDFVLNSEIKDISSIDAKNFHINVLGAKNMTMNNIKIIAPEDSPNT  188

Query  608   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  787
             DGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGHEQD  248

Query  788   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNE  964
             V GI + N     TDNG+RIKTWP++      +DIHF++I ++NV NPI+IDQEYCP N+
Sbjct  249   VSGIRIINCTLQQTDNGLRIKTWPSAACSTTASDIHFQDIIVKNVSNPILIDQEYCPWNQ  308

Query  965   CSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKS  1138
             C+KQKPS +KL  IS+K I GTS    AV+L CS G PC+ VEIG++++   G  G A  
Sbjct  309   CNKQKPSTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGNVDIKYTGADGPATF  368

Query  1139  ICKNVKPKLTGKVVPPLAC  1195
              C NV PKL G    P AC
Sbjct  369   QCSNVSPKLLG-TQNPKAC  386



>ref|XP_006279754.1| hypothetical protein CARUB_v10027711mg [Capsella rubella]
 gb|EOA12652.1| hypothetical protein CARUB_v10027711mg [Capsella rubella]
Length=395

 Score =   347 bits (891),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 180/386 (47%), Positives = 250/386 (65%), Gaps = 8/386 (2%)
 Frame = +2

Query  41    MATISYCAFTFILFMLAHFGESATI-NVAAKANVDVGPALLKAWKEGCAATTASTVVIPK  217
             M  +++    F +F L     +A + N+ +    D+  ALLK + E C   T STV+IPK
Sbjct  1     MGRVNFGVSAFFVFCLLGLSANAKVFNIGSPPGSDITKALLKTFNEACQFPTKSTVLIPK  60

Query  218   GTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDG  397
             G + + ++E+ GPCKAPI + +   LKA  N  +    ++W+  + I+ F L+GGG  DG
Sbjct  61    GEYKLGEIEMLGPCKAPIRIALQGTLKADGNAVH---NQKWVAFRNINGFKLNGGGVFDG  117

Query  398   QGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHF  574
             +GN     +   K  +  KLP ++  +++T+  +R +T+L++K FH+NV+G KNLTF+  
Sbjct  118   EGNAAWRVNNCHKTEQCKKLPISIRFDYITDGKVRGITSLDAKNFHINVIGAKNLTFEEV  177

Query  575   TVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISV  754
              + AP  SPNTDGIH+ R  GI + +SVI TGDDC+S+GDG++NL +  VTCGPGHGISV
Sbjct  178   RIIAPAESPNTDGIHVGRSDGIKIINSVITTGDDCVSVGDGMKNLLVERVTCGPGHGISV  237

Query  755   GSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHFENIDMQNVKNPI  931
             GSLGR   E+ VKGI + N     TDNG+RIKTWP++      +DIHFENI ++NV NPI
Sbjct  238   GSLGRYGHEQDVKGIKIINCTLQETDNGIRIKTWPSAACSTSASDIHFENIVLKNVTNPI  297

Query  932   VIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINL  1111
             +IDQEYCP N C+K KPS +KLS IS+K I GTS    AV+L CS G PC+ VE+G+I++
Sbjct  298   LIDQEYCPWNHCNKAKPSTIKLSNISFKNIRGTSGNKDAVKLLCSKGFPCQNVELGNIDI  357

Query  1112  TIKG--GAAKSICKNVKPKLTGKVVP  1183
                G  G A   C NV PK+ G  VP
Sbjct  358   KYTGADGPATFQCANVSPKIMGTQVP  383



>ref|XP_010464425.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   347 bits (891),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 180/379 (47%), Positives = 249/379 (66%), Gaps = 7/379 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
              I+ +L     +A   + + +  D+  ALLKA+   C   + S VVIPKG F + ++E+ 
Sbjct  11    LIICLLGISANAAVFPIGSPSGSDITQALLKAFTAACQCPSPSKVVIPKGEFKLGEIEMR  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCKAPIE+ I   +KA  N   + GK +W+    I+ F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIEITIQGTVKADGNA--IQGKDKWVVFGNINGFKLNGGGAFDGEGNASWRVNNC  128

Query  428   EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  607
              K F   KLP ++  +F+ NS IRD++++++K FH+NVLG KN+T ++  + AP +SPNT
Sbjct  129   HKTFLCKKLPISIRFDFVLNSEIRDISSIDAKNFHINVLGAKNMTMNNIKIIAPEDSPNT  188

Query  608   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  787
             DGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGHEQD  248

Query  788   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNE  964
             V GI + N     TDNG+RIKTWP++      +DIHF++I ++NV NPI+IDQEYCP N+
Sbjct  249   VSGIRIINCTLQQTDNGLRIKTWPSAACSTTASDIHFQDIILKNVNNPILIDQEYCPWNQ  308

Query  965   CSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKS  1138
             C+KQKPS +KL  IS+K I GTS    AV+L CS G PC+ VEIG++++   G  G A  
Sbjct  309   CNKQKPSTIKLVNISFKNIRGTSGNKDAVKLLCSRGYPCQNVEIGNVDIKYTGADGPATF  368

Query  1139  ICKNVKPKLTGKVVPPLAC  1195
              C NV PKL+G +  P AC
Sbjct  369   QCSNVSPKLSG-IQNPKAC  386



>ref|XP_010486355.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 179/379 (47%), Positives = 249/379 (66%), Gaps = 7/379 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
             FI+ +L     +    + + +  D+  ALLKA+   C + + S VVIPKG F + ++E+ 
Sbjct  11    FIICLLRISANAEVFTIGSSSGSDITQALLKAFTAACQSPSPSKVVIPKGEFKLGEIEMR  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCKAPIE+ I   +KA  N   + GK +W+    I+ F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIEVTIQGTVKA--NGNAIQGKDKWVVFGNINGFKLNGGGAFDGEGNASWRVNNC  128

Query  428   EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  607
              K F+  KLP ++  +F+ NS I+D++++++K FH+NVLG KN+T ++  + AP +SPNT
Sbjct  129   HKTFQCKKLPISIRFDFVLNSEIKDISSIDAKNFHINVLGAKNMTMNNIKIIAPEDSPNT  188

Query  608   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  787
             DGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  VTCGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGHEQD  248

Query  788   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNE  964
             V GI + N     TDNG+RIKTWP++      +DIHF++I ++NV NPI+IDQEYCP N+
Sbjct  249   VSGIRIINCTLQQTDNGLRIKTWPSAACSTTASDIHFQDIIVKNVSNPILIDQEYCPWNQ  308

Query  965   CSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKS  1138
             C+KQKPS +KL  IS+K I GTS    AV+L CS G PC+ VEIG++++   G  G A  
Sbjct  309   CNKQKPSTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGNVDIKYTGADGPATF  368

Query  1139  ICKNVKPKLTGKVVPPLAC  1195
              C NV PKL G    P AC
Sbjct  369   QCSNVSPKLLG-TQNPKAC  386



>ref|XP_006407792.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
 gb|ESQ49245.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
Length=382

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 182/384 (47%), Positives = 246/384 (64%), Gaps = 6/384 (2%)
 Frame = +2

Query  83    MLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCK  262
             M AHF  S  + +          ALLKA+   C +T+ S VVIPKG F + ++E+ GPCK
Sbjct  1     MGAHFAVSTILVLCLLGISANAEALLKAFTSACQSTSPSKVVIPKGEFKLGEIEMRGPCK  60

Query  263   APIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGF  439
             AP+E+ +   +KA  N  +  GK +W+    I+ F L+GGG  DG+GN     +   K F
Sbjct  61    APVEITLQGTVKADGNTNH--GKDKWVVFGNINGFKLNGGGAFDGEGNAAWRVNNCHKTF  118

Query  440   KGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIH  619
             +  KLP ++  +F+ N+ I+D++++++K FH+NVLG KN+T D+  + AP +SPNTDGIH
Sbjct  119   ECKKLPISVRFDFVENAEIKDISSIDAKNFHINVLGAKNMTMDNIKITAPEDSPNTDGIH  178

Query  620   IARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGI  799
             + R  G+ + +S I TGDDCIS+GDG++NL +  V CGPGHGISVGSLGR   E  V GI
Sbjct  179   LGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVVCGPGHGISVGSLGRYGHEEDVSGI  238

Query  800   FVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQ  976
              V N     TDNG+RIKTWP++      +DIHFE+I ++NV NPI+IDQEYCP N+C+KQ
Sbjct  239   RVVNCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVSNPILIDQEYCPWNQCNKQ  298

Query  977   KPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKN  1150
             K S +KL  IS+K I GTS    AV+L CS G PC++VEIGDI++   G  G A   C N
Sbjct  299   KASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQKVEIGDIDIAYSGADGPATFQCSN  358

Query  1151  VKPKLTGKVVPPLACGK*TTL*DQ  1222
             V P+L G   P    G  TT   Q
Sbjct  359   VSPQLLGSQSPKACSGPVTTTPQQ  382



>ref|XP_008245812.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   347 bits (890),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 178/364 (49%), Positives = 235/364 (65%), Gaps = 9/364 (2%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK   DV  AL KAW + CA+ +AS VV+P GT+ + +    GPCKAPIE+++   L+AP
Sbjct  36    AKPGSDVSTALAKAWSDACASPSASKVVVPSGTYNLKEANFRGPCKAPIEMQVQGTLQAP  95

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV---QVYPSKEKGFKGDKLPNNLSLN  475
              +   +     W+  +YID  TLSGGGT DGQG +   Q    K K  K   +P NL   
Sbjct  96    ADAGQLTRPDTWVGFQYIDMLTLSGGGTFDGQGALSWNQNDCHKNKNCK--PIPVNLRFE  153

Query  476   FLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDS  655
             FLTNS ++D+T+LNSK FH++V    + TF   T+ AP +S NTDGIHI    GI +  +
Sbjct  154   FLTNSKVQDITSLNSKFFHMHVFRCNHTTFQQLTITAPDDSRNTDGIHIGASTGINITHA  213

Query  656   VIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDN  835
              IGTGDDCIS+GD    + +T VTCGPGHGIS+GSLG+   E+ V GI V N     TDN
Sbjct  214   KIGTGDDCISIGDDSHEITVTDVTCGPGHGISIGSLGKYKDEKDVTGIIVKNCTLTNTDN  273

Query  836   GVRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISY  1012
             GVRIKT+P+S  P   + IH+E+I M NV NPI++DQ YCP  +C ++ PS VK+S +S+
Sbjct  274   GVRIKTFPDSPSPSTASGIHYEDIIMVNVSNPILVDQLYCPYTQCEQKPPSKVKISNVSF  333

Query  1013  KKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPP  1186
             K I G+S TP+AV+L C++G+PCE VE+ DI+LT  G  G   S+C NVKP + G V   
Sbjct  334   KNIKGSSFTPLAVKLVCTTGIPCENVELIDIDLTYGGDKGPLTSMCSNVKPTIAG-VTKA  392

Query  1187  LACG  1198
             L C 
Sbjct  393   LGCA  396



>ref|XP_004305963.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=394

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 182/381 (48%), Positives = 242/381 (64%), Gaps = 7/381 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATIN-VAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVEL  247
             F+L  +A+     T +    K N D+   L KAW + CA+T+ S +++PKGTF +     
Sbjct  13    FLLLSIAYADFDVTSSKYGGKPNSDISQPLAKAWSDACASTSPSRIIVPKGTFQLKGASF  72

Query  248   AGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK  427
              GPCK PIE ++   L+AP +   +     W+    ++  TL G GT DGQG  + +   
Sbjct  73    KGPCKGPIEFQVDGTLQAPQDGAQLIKADTWIEFANLERLTLMGTGTFDGQGQ-KAWKEN  131

Query  428   E--KGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  601
             +  K  K   +  NL  N + +S+++D+T+LNSK FHVNVLG + LTF HFTVKAPG+S 
Sbjct  132   DCNKNPKCSSIAINLRFNSVKHSLVKDVTSLNSKNFHVNVLGCEQLTFQHFTVKAPGDSI  191

Query  602   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  781
             NTDGIHI R  GI + D+ IGTGDDCIS+GDG + L I  VTCGPGHGIS+GSLGR   E
Sbjct  192   NTDGIHIGRSTGINITDTNIGTGDDCISIGDGTKQLTINKVTCGPGHGISIGSLGRYNNE  251

Query  782   RPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPN  958
               V GI V +     T NGVRIKTWPNS      +DIHFE+I M NV NPI+IDQEYCP 
Sbjct  252   DHVTGINVKDCTISNTMNGVRIKTWPNSPIATTASDIHFEHITMNNVGNPILIDQEYCPY  311

Query  959   NECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG-GAAK  1135
              +C+ Q PS VK+S +S+K I GT+ T  AV++ C+ G+PC++V + DI+L + G G   
Sbjct  312   GQCNTQTPSKVKISNVSFKNIRGTTTTAEAVKIVCAKGLPCDKVVLSDIDLKLTGKGTLT  371

Query  1136  SICKNVKPKLTGKVVPPLACG  1198
             S C NV+P +T +V   LAC 
Sbjct  372   SQCANVQPTIT-QVPQALACA  391



>ref|XP_010038560.1| PREDICTED: exopolygalacturonase [Eucalyptus grandis]
Length=407

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 176/399 (44%), Positives = 246/399 (62%), Gaps = 16/399 (4%)
 Frame = +2

Query  50    ISYCAFTFILFMLAHFGESATINVAAKANVDV-------------GPALLKAWKEGCAAT  190
             ++  A    L  LA    +  +++  +A +DV                ++ AW + C + 
Sbjct  6     MARAAIFLYLLSLAAAMRTGGVSMIGQAEIDVRKFGAKADGRSDDSQIIVNAWNKACTSP  65

Query  191   TASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFT  370
             + STVVI KG++    ++  GPCKA + LK+   +KAP +      +  W+  + ID  T
Sbjct  66    SPSTVVISKGSYLAGPLKFQGPCKADVNLKVEGAVKAPADLNKFKSQGSWVLFQNIDGLT  125

Query  371   LSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLG  547
             LSGGG+ DGQG      +   +  K + LP NL    + NS ++D+T+LNSKLFHV +L 
Sbjct  126   LSGGGSFDGQGAAAWKENNCAQTGKCNSLPTNLQFTSINNSHVQDITSLNSKLFHVELLN  185

Query  548   GKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVT  727
               N+T  H T+ AP +S NTDGIH+ R +G+ +  + I TGDDC+SLGDG + + I GVT
Sbjct  186   CNNVTLQHVTIDAPEDSLNTDGIHVGRSMGVNIIGADIRTGDDCVSLGDGSQQVHIEGVT  245

Query  728   CGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENID  907
             CGPGHGISVGSLG+   E+PV G+ V N     T NG+R+KTWPNS  GV + +HFE+I 
Sbjct  246   CGPGHGISVGSLGKYHDEQPVVGVTVRNCTLTNTMNGIRVKTWPNSPSGVASGMHFEDIT  305

Query  908   MQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEE  1087
             + NV  PI+IDQ YCP N C ++ PS VK+S +S++ I GTSATP+AV+L CS GVPC++
Sbjct  306   VNNVSTPILIDQNYCPYNNCQQKIPSKVKISDVSFRNIRGTSATPLAVKLVCSRGVPCQK  365

Query  1088  VEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLACG  1198
             VE+ DINL   G  G A S C+NVKP + GK+  P+  G
Sbjct  366   VELADINLRYNGRNGTATSQCENVKPTIAGKLSLPICAG  404



>ref|XP_004154764.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=406

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 187/404 (46%), Positives = 253/404 (63%), Gaps = 20/404 (5%)
 Frame = +2

Query  26    VTNLKMATISYC----AFTFILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATT  193
             +T   M+ +S+     +   ++F L  +G     N+ +    DV  AL  AW + CA+  
Sbjct  11    ITTFLMSLLSFTIESQSHVDVIFPLRKYG-----NIVSGD--DVTEALKDAWNDACASVR  63

Query  194   ASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTL  373
              S VVIP G F + + E  GPCK+PIE+++   L+AP +P        W+T  Y+D  T+
Sbjct  64    PSAVVIPDGIFKLREGEFKGPCKSPIEIRVRGTLQAPKHPHG----DSWITFAYVDRMTI  119

Query  374   SGGGTLDGQGNVQVYPSK-EKGFKGDKLPNN-LSLNFLTNSVIRDLTTLNSKLFHVNVLG  547
             SG G  DGQG      +   K      LP   L  +F+TNS++R +T+L+SK FHVN+LG
Sbjct  120   SGKGVFDGQGKAGWEKNDCHKRIDCVNLPIVILRFDFITNSIVRGITSLDSKNFHVNILG  179

Query  548   GKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVT  727
               NLTF    + AP +SPNTDGIHI R IGI++  S I TGDDCISLGDG + +KIT VT
Sbjct  180   CNNLTFQGVNIIAPEDSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRVKITNVT  239

Query  728   CGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENI  904
             CGPGHGIS+GSLG+   E PV  + V N   + T NGVRIKTWP+S   G+ T++HF +I
Sbjct  240   CGPGHGISIGSLGKYTNEEPVDDVVVKNCTIMNTTNGVRIKTWPSSPVAGIATNMHFSDI  299

Query  905   DMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCE  1084
              M NV NPI+IDQEYCP N+C+++ PS +K++ +S+K I G+SATPVAV+L CSS  PCE
Sbjct  300   TMINVSNPILIDQEYCPWNQCNREIPSNIKINNVSFKNIKGSSATPVAVKLICSSNQPCE  359

Query  1085  EVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLACGK*TT  1210
             EV++ +I+L   G  G   S C NVKP ++G   P +     TT
Sbjct  360   EVKVANIDLVYNGINGPVTSQCMNVKPIISGIQNPSICSSSYTT  403



>ref|XP_004158053.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=2882

 Score =   373 bits (957),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 196/366 (54%), Positives = 257/366 (70%), Gaps = 15/366 (4%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK N D+   LL AWK+ CA+TT S V+IPKG++ ++Q  L GPCK+PIEL+I   L+A 
Sbjct  638   AKPNGDITGPLLVAWKDACASTTPSKVLIPKGSYGLSQSNLKGPCKSPIELQIEGTLQAS  697

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKG--DKLPNNLSLNF  478
             P+PK  DG    L ++YID  T+SG G LDGQG    +   +   K    KLP  L LNF
Sbjct  698   PDPKG-DGL---LLLEYIDQLTVSGTGVLDGQGKAG-WEKNDCHLKKICTKLPMTLKLNF  752

Query  479   LTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSV  658
             +TNS+++D+T+L+SK +H+N+LG KNLT DH T+ AP NSPNTDGIH++    I + ++ 
Sbjct  753   ITNSIVKDITSLDSKNYHINLLGCKNLTIDHVTITAPENSPNTDGIHVSSSEQINILNTN  812

Query  659   IGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNG  838
             I TGDDCIS+GD  + + I+ VTCGPGHGIS+GSLG+   E+ V G+ V   K   T NG
Sbjct  813   IATGDDCISVGDTNKQIVISDVTCGPGHGISIGSLGKYSKEKEVVGVTVKKCKLTSTTNG  872

Query  839   VRIKTWPNS---HPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKIS  1009
             VRIKTWP+S    P   TD+HFE+I+M NV NPI+IDQEYCP N+C+++ PS +K+SK+S
Sbjct  873   VRIKTWPDSVGTFPA--TDMHFEDIEMVNVSNPIIIDQEYCPWNQCNRKVPSKIKISKVS  930

Query  1010  YKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVP  1183
             +K I GTSAT VAV++ CS   PCEEVE+ DI+LT  G  G  KS C NVKP +TGK  P
Sbjct  931   FKNIRGTSATAVAVKIVCSQSNPCEEVEVADIDLTYSGSEGPIKSQCANVKPVITGKQNP  990

Query  1184  PLACGK  1201
             P+ CG+
Sbjct  991   PI-CGE  995



>ref|XP_006299382.1| hypothetical protein CARUB_v10015541mg [Capsella rubella]
 gb|EOA32280.1| hypothetical protein CARUB_v10015541mg [Capsella rubella]
Length=400

 Score =   345 bits (885),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 187/382 (49%), Positives = 242/382 (63%), Gaps = 7/382 (2%)
 Frame = +2

Query  53    SYCAFTFILFMLAHFGESATI-NVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFP  229
             SY     ILF+L     +A +  V      D+  ALLKA+   C A TAS VVIPKG F 
Sbjct  3     SYLGIFAILFVLLGVSANAEVFPVGGSPGSDITQALLKAFTSACQAPTASKVVIPKGEFK  62

Query  230   MTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNV  409
             + ++E+AGPCKAPIE+ +   +KA  +   + GK+ W+    I  F L+GGGT DG+GN 
Sbjct  63    LGEIEMAGPCKAPIEINLQGTVKA--DGTAIHGKERWVVFTKIVGFKLNGGGTFDGEGNA  120

Query  410   QVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKA  586
                 +   +     KLP ++  +F+  + IRD++T+++K FH+NV+G K + FD+  V A
Sbjct  121   AWRVNNCHQTEACKKLPISIRFDFVEKAEIRDISTIDAKNFHINVIGAKEMVFDNVKVIA  180

Query  587   PGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLG  766
             P  SPNTDGIH+ R  G+ + +S I TGDDCIS+GDG++NL +  V CGPGHGISVGSLG
Sbjct  181   PAESPNTDGIHLGRSDGVKILNSKIATGDDCISVGDGMKNLHVEKVVCGPGHGISVGSLG  240

Query  767   RTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQ  943
             R   E+ V GI V N   IGTDNG+RIKTWP++      + IHFE+I + NV NPI+IDQ
Sbjct  241   RYGHEQDVAGITVKNCTLIGTDNGLRIKTWPSAACSTTASGIHFEDIILNNVSNPILIDQ  300

Query  944   EYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG  1123
             EYCP N C+KQKPS +KL  IS+K I GTS    AV+L CS   PC  VEIG+INL  KG
Sbjct  301   EYCPWNHCNKQKPSTIKLVDISFKNIRGTSGNKDAVKLLCSKAHPCVNVEIGNINLEYKG  360

Query  1124  --GAAKSICKNVKPKLTGKVVP  1183
               G     C NV PKL G   P
Sbjct  361   ADGPPTFTCSNVTPKLVGTQNP  382



>emb|CAA72003.1| polygalacturonase [Medicago sativa]
Length=395

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/350 (49%), Positives = 225/350 (64%), Gaps = 4/350 (1%)
 Frame = +2

Query  131   ANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPN  310
             ++ D+  A   AWK  C +TTAS V+IP+G + M  V++ GPCKAPIE+++   ++AP N
Sbjct  36    SHADITMAFTNAWKAACGSTTASKVMIPRGVYKMHAVDVKGPCKAPIEVQVDGTIQAPQN  95

Query  311   PKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTN  487
             P  ++   +W+   Y+D+FTLSG G  DG G      +   K     +   N   NFL +
Sbjct  96    PDELNDAYQWIKFGYVDYFTLSGKGVFDGNGETAWRQNDCGKNSTCKRRSMNFGFNFLKH  155

Query  488   SVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGT  667
             S++RD+T+ +SK FHVNVLG  N TFD  T+ AP  S NTDGIHI R   + V ++ I T
Sbjct  156   SIVRDITSKDSKNFHVNVLGCTNFTFDSVTITAPVTSINTDGIHIGRSTDVKVLNTNIAT  215

Query  668   GDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRI  847
             GDDC+SLGDG   + +  V CGPGHGISVGSLG+ P E  V+ + V N     TDNGVRI
Sbjct  216   GDDCVSLGDGSRQITVQNVNCGPGHGISVGSLGKYPKEEAVEHVLVKNCTITNTDNGVRI  275

Query  848   KTWPNSHPGV--VTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKI  1021
             KTWP+S PG   +TD+HFE+I M NV NP++IDQEYCP N+CSK  PS +K+SK+ +K I
Sbjct  276   KTWPSS-PGTSPITDMHFEDIIMVNVLNPVIIDQEYCPWNQCSKLVPSKIKISKVIFKNI  334

Query  1022  SGTSATPVAVQLACSSGVPCEEVEIGDINLTIKGGAAKSICKNVKPKLTG  1171
              GTS T   V L CS   PC+ VE+ ++ LT  G    + C NVKP LTG
Sbjct  335   RGTSKTKDGVVLICSKSFPCDAVELNNVALTFNGAPVNAKCVNVKPILTG  384



>gb|AAO24261.1| putative pollen polygalacturonase [Turnera subulata]
Length=382

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 234/348 (67%), Gaps = 7/348 (2%)
 Frame = +2

Query  140   DVGPALLKAW-KEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPK  316
             D+  AL  A+ K+ CA+ T S VV+P G + M  V++ GPCK+ +E+++   LKAP  PK
Sbjct  37    DIAEALSAAFQKDACASATPSKVVVPAGEYTMGPVDMKGPCKSTVEVQVDGNLKAPAEPK  96

Query  317   NMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQ-VYPSKEKGFKGDKLPNNLSLNFLTNSV  493
                G+  W++ +YID  T SG G  DGQG++     +  K       P N     L +++
Sbjct  97    ---GEPGWVSFEYIDGLTFSGKGVFDGQGHIAWANNNCNKNPNCKSFPLNFRFTSLKHAL  153

Query  494   IRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGD  673
             I+DLT+ +SK FHVNV+  +N+TF +F + AP  S NTDGIH+ R  GI + DS IGTGD
Sbjct  154   IKDLTSKDSKNFHVNVINCENVTFQNFVIDAPAESLNTDGIHMGRSKGIKIIDSKIGTGD  213

Query  674   DCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKT  853
             DCIS+GDG E + +TGVTCGPGHGIS+GSLGR   E+PV+G+ V N     TDNGVRIK+
Sbjct  214   DCISIGDGTEQVTVTGVTCGPGHGISIGSLGRYDNEQPVRGVLVKNCILKNTDNGVRIKS  273

Query  854   WPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTS  1033
             WP    G  +DIHFE+I M+NV NP++IDQEYCP N+C+K  PS VK+S +S+K I GT+
Sbjct  274   WPAMKGGEASDIHFEDITMENVTNPVIIDQEYCPWNQCTKDAPSKVKISNVSFKNIKGTT  333

Query  1034  ATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTG  1171
              TP AV++ CSS +PCE+V++  I+L   G  G AKS CKN K  +TG
Sbjct  334   NTPEAVKIICSSALPCEQVQLNGIDLKYTGTQGPAKSECKNAKLTVTG  381



>ref|XP_009350286.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=408

 Score =   344 bits (882),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 180/393 (46%), Positives = 241/393 (61%), Gaps = 18/393 (5%)
 Frame = +2

Query  50    ISYCAFTFILFMLAHFGESATINVAAKANV------DVGPALLKAWKEGCAATTASTVVI  211
             + Y  F F LF+ +     A +     +        D+  AL  AW++ C++   + VVI
Sbjct  2     VGYWIFVF-LFLASVANAKAEVFYVTNSTYGGNPSGDITLALADAWRDACSSPWPAKVVI  60

Query  212   PKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTL  391
             P+G + +    L GPCK+PIE+++   L+AP     +  +  W+  +Y+D  TL GGGT 
Sbjct  61    PEGEYYLRGAILRGPCKSPIEIQVQGYLRAPQESSQLLQQNTWIGFQYVDRLTLFGGGTF  120

Query  392   DGQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDH  571
             DGQ N   Y S +          NL  +F+TNSVI  +T+L+SK FH+NV   +N+TF +
Sbjct  121   DGQSNCHKYKSCQS-----NRVFNLRFDFVTNSVIEGITSLDSKNFHINVFACRNVTFQY  175

Query  572   FTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGIS  751
              T+ APG+S NTDGIHI R  G+++  + IGTGDDC+SLGDG +N+ +T VTCGPGHGIS
Sbjct  176   VTITAPGDSVNTDGIHIGRSFGVSIDHTTIGTGDDCVSLGDGSQNIVVTNVTCGPGHGIS  235

Query  752   VGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--DIHFENIDMQNVKN  925
             +GSLG+ P E PV G+ V+N     T NGVRIKTWP S P   T   IHF++I M NV N
Sbjct  236   IGSLGKYPNEEPVVGVRVTNCTLTNTQNGVRIKTWPGS-PTFTTASHIHFQDITMVNVSN  294

Query  926   PIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDI  1105
             PI IDQEYCP   C K  PS VK+S IS+  I G+SATPVAV+L CS  +PC+ V + D+
Sbjct  295   PISIDQEYCPYTYCGKDDPSKVKISDISFTNIKGSSATPVAVKLMCSRKIPCDGVGLTDV  354

Query  1106  NLTIKG--GAAKSICKNVKPKLTGKVVPPLACG  1198
             +LT  G  G   S C  VKP +T +V   LAC 
Sbjct  355   DLTNIGSKGPLTSQCAYVKPYIT-RVANALACA  386



>ref|XP_008366919.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Malus 
domestica]
Length=447

 Score =   345 bits (884),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 181/405 (45%), Positives = 245/405 (60%), Gaps = 14/405 (3%)
 Frame = +2

Query  5     NNNIKI*VTNLKMATISYCAFTFILFMLAHFGESATIN---VAAKANVDVGPALLKAWKE  175
             N + ++    +K+  +S+  F F+  +     E   +         + D+  AL  AW++
Sbjct  21    NYDCRLSEQGIKVVILSFSVFLFLASIANAKAEVFYVTNSTYGGNPSGDITLALADAWRD  80

Query  176   GCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKY  355
              C++   + VVIP+G + +    L GPCK+PIE+++   L+AP     +  +  W+  +Y
Sbjct  81    ACSSPWPAKVVIPEGEYYLRGAILHGPCKSPIEVQVQGYLRAPQESSQLLQQNTWVGFQY  140

Query  356   IDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHV  535
             +D  TL GGGT DGQ N   Y S +          NL  +F+TNSVI  +T+L+SK FH+
Sbjct  141   VDRLTLFGGGTFDGQSNCHKYKSCQS-----NRVFNLRFDFVTNSVIEGITSLDSKNFHI  195

Query  536   NVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKI  715
             NV   +N+TF + T+ AP +S NTDGIHI R  G+T+  ++IGTGDDCISLGDG +N+ +
Sbjct  196   NVFACRNVTFQYVTITAPEDSVNTDGIHIGRSFGVTIDHTIIGTGDDCISLGDGSQNIVV  255

Query  716   TGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVT--DI  889
             T VTCGPGHGIS+GSLG+ P E PV G+ V N     T NGVRIKTWP S P   T   I
Sbjct  256   TBVTCGPGHGISIGSLGKYPDEEPVVGVRVKNCTLTNTQNGVRIKTWPGS-PTFTTASHI  314

Query  890   HFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSS  1069
             HF+ I M NV NPI IDQEYCP   C K  PS VK+S IS+  I G+SATPVAV+L CS 
Sbjct  315   HFQXIXMVNVSNPISIDQEYCPYTYCGKDDPSKVKISDISFTNIKGSSATPVAVKLMCSR  374

Query  1070  GVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLACG  1198
              +PC+ V + D++LT  G  G   S C  VKP +T +V   LAC 
Sbjct  375   KIPCDGVGLTDVDLTYIGSKGPLTSQCAYVKPYIT-RVANALACA  418



>ref|XP_004514023.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=390

 Score =   342 bits (878),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 175/347 (50%), Positives = 231/347 (67%), Gaps = 4/347 (1%)
 Frame = +2

Query  134   NVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNP  313
             N D+  AL  AWKE C + + S VV+P G + + Q++L GPCKAPIE+K+  I++AP NP
Sbjct  37    NGDITNALKNAWKEACESRSRSKVVVPSGRYKLQQIDLEGPCKAPIEVKVNGIIQAPKNP  96

Query  314   KNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD--KLPNNLSLNFLTN  487
              +++G+ +W+  +YI+ FTLSG GT DGQG +  +   + G   +  +L  N    FL N
Sbjct  97    FHLNGQDQWIRFQYINFFTLSGKGTFDGQGEM-AWKQNDCGRNTNCKRLAMNFGFAFLNN  155

Query  488   SVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGT  667
             SVI+D+ + +SK FH NV G  N+TF +F + AP +SPNTDGIHI +   + + +S IG+
Sbjct  156   SVIKDINSKDSKYFHANVFGCNNVTFTNFNINAPESSPNTDGIHIGKSSRVKISNSKIGS  215

Query  668   GDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRI  847
             GDDCISLGDG   + I  VTCGPGHGISVGSLG+ P E PV  + V N     TDNGVRI
Sbjct  216   GDDCISLGDGSTQITIQNVTCGPGHGISVGSLGKYPNEDPVVDLIVKNCTLNNTDNGVRI  275

Query  848   KTWP-NSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKIS  1024
             KTWP  S   + + +HFE+I M NV NPI+IDQ+YCP N+CSKQ PS +K+ K+ +K I 
Sbjct  276   KTWPGTSVISIASHLHFEDIVMVNVSNPIIIDQQYCPWNQCSKQSPSKIKIKKVIFKNIR  335

Query  1025  GTSATPVAVQLACSSGVPCEEVEIGDINLTIKGGAAKSICKNVKPKL  1165
             GTSAT   V L  S GVPCE V + DINL+  G    + C NVKP +
Sbjct  336   GTSATQEGVSLIRSRGVPCEAVVLSDINLSFNGSKVTAKCANVKPTI  382



>ref|XP_010675930.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   343 bits (879),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 170/364 (47%), Positives = 231/364 (63%), Gaps = 8/364 (2%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK + DV  A L +W   CA+   S V++P G + +  ++L GPC+ P  ++I+   KAP
Sbjct  43    AKPDADVTQAFLDSWTAACASVKPSKVLVPAGNYILGAIKLKGPCQTPTVIEILGNFKAP  102

Query  305   PNPKNMDGKKEWLTIKYIDHFTL---SGGGTLDGQGNV--QVYPSKEKGFKGDKLPNNLS  469
             P+    + +  W  ++Y+D   L    GGG  DGQG    ++    +    G  LP N  
Sbjct  103   PDVAAFNKEDTWFKVEYVDSLILITGKGGGVFDGQGQAAWKLNECTKNANCGFDLPYNFR  162

Query  470   LNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVK  649
              NF+TNS +  LT++NSKL+H  +LG K L     T+ AP +SPNTDGIHI R  G+ V+
Sbjct  163   FNFVTNSKVSGLTSINSKLYHFALLGCKQLEMSDITITAPADSPNTDGIHIGRSDGVIVR  222

Query  650   DSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGT  829
                IGTGDDC+S GDG +N+ + GVTCGPGHG+SVGSLG+ P E PV  I + N     T
Sbjct  223   GFTIGTGDDCVSFGDGAKNVLVEGVTCGPGHGLSVGSLGKYPNEEPVSNITIRNCTIKNT  282

Query  830   DNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKIS  1009
             DNGVR+KTW NS+   VT ++FE+I ++NV+NP+++DQEYCP N C  + PS VK+S I 
Sbjct  283   DNGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPWNHCKAKTPSKVKISDIR  342

Query  1010  YKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVP  1183
             +K + G S+   AV+L CS GVPC++VE+ DI+L   G  G A S+CK VKP LTGK  P
Sbjct  343   FKNVKGKSSGKEAVKLICSEGVPCDKVELADIDLQYTGTDGPAVSMCKFVKPLLTGKQSP  402

Query  1184  PLAC  1195
             P AC
Sbjct  403   P-AC  405



>ref|XP_006299755.1| hypothetical protein CARUB_v10015950mg [Capsella rubella]
 gb|EOA32653.1| hypothetical protein CARUB_v10015950mg [Capsella rubella]
Length=447

 Score =   343 bits (881),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 180/381 (47%), Positives = 247/381 (65%), Gaps = 11/381 (3%)
 Frame = +2

Query  77    LFMLAHFGESA----TINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVE  244
             +F++   G SA       + +    D+  A  KA+K  C A T S V+IPKG F + ++ 
Sbjct  10    IFVVCLLGLSANGHEVFRIGSPPGSDITQAFFKAFKAACQAPTPSKVLIPKGQFRLGEII  69

Query  245   LAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPS  424
             + GPCK PIE  ++  ++A  N     GK +W+  + ++ F L+GGGT DGQG      +
Sbjct  70    MEGPCKFPIEFTLLGTVQADGNAGQ--GKDKWVVFRKMNGFKLNGGGTFDGQGTAAWRVN  127

Query  425   KEKGFKG-DKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  601
                  K   KLP +L  +F+TN+VIRD+++++SK FHVNV+G +N+TFD+  + AP  SP
Sbjct  128   NCHQTKSCKKLPISLRFDFVTNAVIRDISSVDSKNFHVNVIGARNMTFDNVKILAPAESP  187

Query  602   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  781
             NTDGIH+ R  G+++ +S I TGDDC+S+GDG+ NL +  V CGPGHGISVGSLGR   E
Sbjct  188   NTDGIHLGRSDGVSIINSRISTGDDCVSVGDGMVNLLVKNVLCGPGHGISVGSLGRYGHE  247

Query  782   RPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPN  958
               V+GI V N     TDNG+RIKTWP++      +DIHFE+I ++NV NPI+IDQEYCP 
Sbjct  248   ENVRGIRVINCTVQETDNGLRIKTWPSAACSTTASDIHFEDIILRNVSNPILIDQEYCPW  307

Query  959   NECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAA  1132
             N C+KQK S +KL+ IS++KI GTS    AV+L CS G PCE V +GDI++   G  G A
Sbjct  308   NHCNKQKSSSIKLANISFRKIRGTSGNKDAVKLLCSKGYPCENVVVGDIDIQYTGADGPA  367

Query  1133  KSICKNVKPKLTGKVVPPLAC  1195
               +C NV+PKL G +  P AC
Sbjct  368   TFMCSNVRPKLVG-IQNPKAC  387



>ref|XP_006489998.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=402

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 176/395 (45%), Positives = 240/395 (61%), Gaps = 18/395 (5%)
 Frame = +2

Query  53    SYCAFTFILFMLAHFGESATINVAAKANV--------------DVGPALLKAWKEGCAAT  190
             S C+   +L +L  F  +  I  AA   V              D   A   AW+E C   
Sbjct  4     SSCSQLLVLAILVLFSLAQNIINAASNGVFNVIDFGAIADGIRDNSRAFENAWREACYWN  63

Query  191   TASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFT  370
             T STV++P G + +T V   GPCKAPI  ++  ++ APP    +  K+ W+T + +  FT
Sbjct  64    TYSTVLVPPGKYLVTSVVFKGPCKAPISFQLQGLILAPPGLSKLADKESWITFESLRSFT  123

Query  371   LSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGG  550
             L+GGGT  GQG      ++       +LP ++  N L +S I  + +++SK FH+N+LG 
Sbjct  124   LTGGGTFHGQGRTAWPENQCHKNSNCQLPISIRFNKLNDSTITGVQSVDSKFFHINILGC  183

Query  551   KNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTC  730
              NL  +   + AP +SPNTDGIHI R  GI + +S+I TGDDC+SLGDG +N+ ++ V+C
Sbjct  184   YNLKLNKINISAPDDSPNTDGIHIGRSNGIEISNSIIATGDDCVSLGDGSQNVLVSDVSC  243

Query  731   GPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDM  910
             GPGHGISVGSLG+   E  V G+ V N  F GT NGVRIKTWP+S  G  ++  FE++ M
Sbjct  244   GPGHGISVGSLGKYKKEEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFM  303

Query  911   QNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEV  1090
              NV+NPIVIDQEYCP+N+C+ + PS VK+S + ++ I GTS T  AV++ CS  +PC+ V
Sbjct  304   NNVENPIVIDQEYCPHNQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNV  363

Query  1091  EIGDINLTIKG----GAAKSICKNVKPKLTGKVVP  1183
             EIGDINL   G    G A S C NVKP L GK +P
Sbjct  364   EIGDINLVYNGIDDKGPAISSCSNVKPTLVGKQIP  398



>ref|XP_006371365.1| hypothetical protein POPTR_0019s09490g [Populus trichocarpa]
 gb|ERP49162.1| hypothetical protein POPTR_0019s09490g [Populus trichocarpa]
Length=326

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 217/320 (68%), Gaps = 11/320 (3%)
 Frame = +2

Query  35   LKMATISYCAFTFILFMLAHFGESATIN-----VAAKANVDVGPALLKAWKEGCAATTAS  199
            + +  +S    +F LF+L      A  N         A  D+  AL  AWK  CA+T  S
Sbjct  1    MGLEVVSSAIISFSLFLLLASTTQAQSNGVFDVTKYGAGKDITEALTNAWKSACASTKPS  60

Query  200  TVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSG  379
             V+IP GT+ + +V LAGPCKA I+L++  ILKAP +P  + G   W+  +Y+D FTLSG
Sbjct  61   KVLIPSGTYWLRKVTLAGPCKAAIKLQVDGILKAPVDPNKLSGG-HWVNFRYVDQFTLSG  119

Query  380  GGTLDGQGNVQVYPS---KEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGG  550
             GT DGQG V    S   K+K  KG  LP NL  +F+TN+++RD+TTL+SK FHVNVLG 
Sbjct  120  RGTFDGQGKVAWSKSTCHKDKNCKG--LPMNLRFDFITNALVRDITTLDSKNFHVNVLGC  177

Query  551  KNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTC  730
            KNLTF HFTV+APG S NTDGIHI R  GI + DS I TGDDCIS+GDG E L ITGVTC
Sbjct  178  KNLTFQHFTVRAPGESVNTDGIHIGRSTGIYIIDSKISTGDDCISVGDGTEELHITGVTC  237

Query  731  GPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDM  910
            GPGHGISVGSLG+ P E+PV GIFV N     T NGVRIK+WP  + GV +++HFE+I M
Sbjct  238  GPGHGISVGSLGKYPNEKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVM  297

Query  911  QNVKNPIVIDQEYCPNNECS  970
             NV+NP++IDQ YCP N+C+
Sbjct  298  NNVQNPVIIDQGYCPWNQCT  317



>ref|XP_004144612.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
 ref|XP_004162886.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
Length=402

 Score =   341 bits (875),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 175/388 (45%), Positives = 245/388 (63%), Gaps = 12/388 (3%)
 Frame = +2

Query  71    FILFMLAHF---GESATINV-----AAKANVDVGPALLKAWKEGCAATTASTVVIPKGTF  226
             FILF+        ++A  +V      A  N D   A++KAWK+ C++T  S +VIP G +
Sbjct  12    FILFLFIGLITNAQAADFHVKRYGARANGNSDDSQAIMKAWKDACSSTKPSKIVIPGGRY  71

Query  227   PMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGN  406
              +  ++  GPC API +++   L+AP N K M     W+  +YI+  TLSG GT DG+G+
Sbjct  72    VVDSMKFQGPCLAPIHVQVEGRLQAPTNIKKMRNDASWIVFQYINGLTLSGKGTFDGRGS  131

Query  407   VQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVK  583
             +    ++     K   LP +L    L NS+I+D+T+ +SK FHVNV   +NLT  +  + 
Sbjct  132   LAWKQNQCASSGKCGSLPISLRFYSLNNSLIKDITSTDSKFFHVNVHNCRNLTLQNINID  191

Query  584   APGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSL  763
             APG+SPNTDGIHI    G+T+ ++ I TGDDC+S+GDG + +K+  VTCGPGHGIS+GSL
Sbjct  192   APGDSPNTDGIHIGGSSGVTIHNARIKTGDDCVSIGDGSQQIKVEKVTCGPGHGISIGSL  251

Query  764   GRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQ  943
             G+   E+PV GI V +     T  GVRIK+WP S  G+ +++ FE+I M NV  PI+IDQ
Sbjct  252   GKYKNEKPVSGITVRDCTITNTMFGVRIKSWPASTKGIASNMQFESIVMNNVGTPILIDQ  311

Query  944   EYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG  1123
             +YCP   C++Q PS V++S + +K I GTS T VAV+L CS G PC+ V++ +INL   G
Sbjct  312   QYCPYGTCNRQIPSRVQISNVGFKNIRGTSTTQVAVKLVCSRGYPCKNVKLSNINLKYSG  371

Query  1124  --GAAKSICKNVKPKLTGKVVPPLACGK  1201
               G A S C NVKP + G VVPP AC +
Sbjct  372   TNGTAISECSNVKPAIAGSVVPP-ACTR  398



>ref|XP_009124109.1| PREDICTED: polygalacturonase-like [Brassica rapa]
Length=396

 Score =   341 bits (874),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 179/379 (47%), Positives = 246/379 (65%), Gaps = 7/379 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
             FIL +L     +   ++ + +  D+  ALLKA+   C + + S VVIPKG F + ++E+ 
Sbjct  11    FILCLLGFSANAEVFSIGSSSGSDITQALLKAFTSACQSPSPSKVVIPKGEFKLGEIEMR  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCKAP+E+ +   +KA  N   + GK++W+    I+ F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPVEITLQGTVKADGNA--IQGKEKWVVFGNINGFKLNGGGAFDGEGNAAWRVNNC  128

Query  428   EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  607
              K F   KLP ++  +F+ N+ I+D++++++K FH+NVLG KN+T  +  + AP +SPNT
Sbjct  129   HKTFNCKKLPISIRFDFVENAEIKDISSIDAKNFHINVLGAKNMTMSNIKITAPEDSPNT  188

Query  608   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  787
             DGIH+ R  G+ + DS I TGDDCIS+GDG  NL +  VTCGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRSDGVKILDSFISTGDDCISVGDGTSNLHVEKVTCGPGHGISVGSLGRYGKEQD  248

Query  788   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNE  964
             V GI V N     TDNG+RIKTWP++      +DIHFE+I ++NV NPI+IDQEYCP N+
Sbjct  249   VSGIRVVNCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVTNPILIDQEYCPWNQ  308

Query  965   CSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKS  1138
             C+K+K S +KL  IS+K + GTS    AV+L CS G PC+ VEIGDI++   G  G A  
Sbjct  309   CNKKKASTIKLVNISFKNVRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIKYSGEDGPATF  368

Query  1139  ICKNVKPKLTGKVVPPLAC  1195
              C NV PKL G    P AC
Sbjct  369   QCSNVSPKLLG-AQSPEAC  386



>gb|KHN43962.1| Polygalacturonase [Glycine soja]
Length=389

 Score =   340 bits (873),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 167/355 (47%), Positives = 228/355 (64%), Gaps = 2/355 (1%)
 Frame = +2

Query  134   NVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNP  313
             + D+  A   AWK  CA+T+AS ++IP GT+ M  V++ GPC APIE++I   ++AP +P
Sbjct  35    DADITQAFTDAWKVACASTSASKILIPNGTYKMKAVDVKGPCMAPIEIQIDGTIQAPADP  94

Query  314   KNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPN-NLSLNFLTNS  490
               +DG K+W+ I Y +  TLSG G  DGQG +    +  +     K+P+ N   NF+ +S
Sbjct  95    NALDGAKQWVKIGYANFITLSGKGIFDGQGAIAWKQNDCRTNTNCKIPSMNFGFNFVNHS  154

Query  491   VIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  670
             ++R +T+ +SK FHV + G  N TFD F + AP  S NTDGIHI +   + + ++ I TG
Sbjct  155   MVRGITSKDSKSFHVILFGCYNFTFDGFHISAPETSINTDGIHIGKSTDVKILNTNIATG  214

Query  671   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  850
             DDC+SLGDG  ++ +  V CGPGHGISVGSLG+   E PVK + V N     T+NGVRIK
Sbjct  215   DDCVSLGDGSIHVTVQNVNCGPGHGISVGSLGKYTNEEPVKDLLVKNCTLTNTENGVRIK  274

Query  851   TWPN-SHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISG  1027
             TWPN S   +VTD+HFE+I M +V NP++IDQEYCP N C KQ PS +K+ K+S+  I G
Sbjct  275   TWPNSSQTYLVTDMHFEDITMVDVLNPVIIDQEYCPWNHCPKQSPSKIKIRKVSFSDIKG  334

Query  1028  TSATPVAVQLACSSGVPCEEVEIGDINLTIKGGAAKSICKNVKPKLTGKVVPPLA  1192
             TS +   V   CS  VPCE+VE+ ++ LT KG    + C NV+PK  GK  P  A
Sbjct  335   TSKSKEGVIFICSKAVPCEDVELNNVALTFKGDPIVAKCANVRPKFAGKAPPCTA  389



>ref|XP_004293444.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=405

 Score =   341 bits (874),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 175/365 (48%), Positives = 238/365 (65%), Gaps = 14/365 (4%)
 Frame = +2

Query  128   KANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPP  307
             K N D+   L  AWK+ CAATT S V++PKGTF +      GPCKAPI +++  IL+APP
Sbjct  44    KPNTDISQPLANAWKDACAATTPSRVIVPKGTFQLKGAVFKGPCKAPITVQVDGILQAPP  103

Query  308   NPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPN------NLS  469
                 +  K+ W+    ++  T+SG GT DGQG      +  K    +K PN      N+ 
Sbjct  104   IEAQLANKEFWVQFLEVERLTVSGTGTFDGQGQ-----NSWKDNDCNKNPNCGGLAINVR  158

Query  470   LNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVK  649
              + + NS++RD+T+LNSK FH N+LG ++LTF H T+KAPG+SPNTDGIH+ R  GI + 
Sbjct  159   FDKVKNSLVRDVTSLNSKNFHFNILGCEHLTFQHVTIKAPGDSPNTDGIHMGRSTGINIT  218

Query  650   DSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGT  829
             D  IGTGDDCIS+GDG   L ++ V+CGPGHGIS+GSLGR   E  V G+ + +     T
Sbjct  219   DMNIGTGDDCISVGDGTRQLTVSKVSCGPGHGISIGSLGRYDNEDDVSGLNIRDCTLSNT  278

Query  830   DNGVRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKI  1006
              NGVRIKT+P S      +DIHFE I M NV NP++IDQEYCP  +C+KQ PS VK+S +
Sbjct  279   LNGVRIKTFPASPKATTASDIHFEKITMNNVANPVLIDQEYCPWGQCNKQIPSKVKISNV  338

Query  1007  SYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG-GAAKSICKNVKPKLTGKVVP  1183
             S+K I GT++T  A+++ C+ G+ C++V + DI+L + G G   S C NV+P +  +V P
Sbjct  339   SFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDIDLKLSGKGTLTSHCANVQPTI-ARVPP  397

Query  1184  PLACG  1198
             PLAC 
Sbjct  398   PLACA  402



>ref|XP_010999531.1| PREDICTED: polygalacturonase-like [Populus euphratica]
Length=326

 Score =   338 bits (866),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 171/320 (53%), Positives = 219/320 (68%), Gaps = 11/320 (3%)
 Frame = +2

Query  35   LKMATISYCAFTFILFMLAHFGESATIN-----VAAKANVDVGPALLKAWKEGCAATTAS  199
            + +  +S    +F LF+L      A  N         A  D+  AL  AWK+ CA+T  S
Sbjct  1    MGLEVVSSAIISFSLFLLLASTTQAQSNGVFDVTKYGAGKDITEALANAWKDACASTKPS  60

Query  200  TVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSG  379
             V+IP+GT+ + +V +AGPCKA I+L++  IL+AP +P  + G  +W+  +Y+D FTLSG
Sbjct  61   KVLIPRGTYWLRKVTIAGPCKAAIKLQVDGILQAPVDPNKLSGG-DWVNFRYVDQFTLSG  119

Query  380  GGTLDGQGNVQVYPS---KEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGG  550
             GT DGQG V    S   K+K  KG  LP N+  +F+TN+++RD+TTL+SK FHVNVLG 
Sbjct  120  SGTFDGQGKVAWSKSTCHKDKNCKG--LPMNMRFDFITNALVRDITTLDSKNFHVNVLGC  177

Query  551  KNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTC  730
            KNLTF HFTV+AP  S NTDGIHI R  GI + DS I TGDDCIS+GDG E L ITGVTC
Sbjct  178  KNLTFQHFTVRAPRESVNTDGIHIGRSTGIYIIDSKISTGDDCISVGDGTEELHITGVTC  237

Query  731  GPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDM  910
            GPGHGISVGSLG+ P E+PV GIFV N     T NGVRIK+WP  + GV +++HFE+I M
Sbjct  238  GPGHGISVGSLGKYPNEKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVM  297

Query  911  QNVKNPIVIDQEYCPNNECS  970
             NV+NP++IDQ YCP N+CS
Sbjct  298  NNVQNPVIIDQVYCPWNQCS  317



>ref|XP_010464426.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=398

 Score =   340 bits (873),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 184/382 (48%), Positives = 249/382 (65%), Gaps = 12/382 (3%)
 Frame = +2

Query  77    LFMLAHFGESA----TINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVE  244
             +F+L   G SA      NV A    D+  ALLKA+   C  T  S VVIPKG F + ++ 
Sbjct  10    IFVLCLVGFSANAHEVFNVNAPPGSDITQALLKAFTAACQCTAPSRVVIPKGEFKLCEII  69

Query  245   LAGPCKAPIELKIMAILKAPPNPKNMD-GKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYP  421
             + GPCKAPIE+ ++  L A  +  N+  GK +W+  + I+ F L+GGGT DG+G+     
Sbjct  70    MTGPCKAPIEINLLGTLLA--DGSNIHHGKDKWVVFRKINGFKLNGGGTFDGEGSAAWRV  127

Query  422   SK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNS  598
             +   K     KLP ++  +F+TN+ IRD+++++SK FHVNV+G  N+TFD+  + AP  S
Sbjct  128   NNCHKTSNCKKLPISIRFDFVTNAEIRDISSVDSKNFHVNVIGAMNMTFDNVKILAPAES  187

Query  599   PNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPG  778
             PNTDGIH+ R  G+++ +S I TGDDCIS+GDG+ NL +  V CGPGHGIS+GSLGR P 
Sbjct  188   PNTDGIHLGRSDGVSIINSRISTGDDCISVGDGMVNLLVKNVVCGPGHGISIGSLGRYPH  247

Query  779   ERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCP  955
             E+ V+GI V N     TDNG+RIKTWP +    V + IHFE+I ++NV NPI+IDQEYCP
Sbjct  248   EQNVRGIKVINCTVQETDNGLRIKTWPTAACSTVASGIHFEDIILKNVSNPILIDQEYCP  307

Query  956   NNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GA  1129
              N+C+KQK S +KL  +S+  I GTS    AV+L CS G PCE V +G+IN+   G  G 
Sbjct  308   WNQCNKQKSSSIKLIDVSFTNIRGTSGNKDAVKLLCSKGYPCENVVVGNINIEYTGRDGP  367

Query  1130  AKSICKNVKPKLTGKVVPPLAC  1195
             A  +C NVKP+L G +  P AC
Sbjct  368   ATFMCSNVKPRLVG-IQNPKAC  388



>ref|XP_003518573.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=391

 Score =   340 bits (872),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 167/355 (47%), Positives = 228/355 (64%), Gaps = 2/355 (1%)
 Frame = +2

Query  134   NVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNP  313
             + D+  A   AWK  CA+T+AS ++IP GT+ M  V++ GPC APIE++I   ++AP +P
Sbjct  37    DADITQAFTDAWKVACASTSASKILIPNGTYKMKAVDVKGPCMAPIEIQIDGTIQAPADP  96

Query  314   KNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPN-NLSLNFLTNS  490
               +DG K+W+ I Y +  TLSG G  DGQG +    +  +     K+P+ N   NF+ +S
Sbjct  97    NALDGAKQWVKIGYANFITLSGKGIFDGQGAIAWKQNDCRTNTNCKIPSMNFGFNFVNHS  156

Query  491   VIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTG  670
             ++R +T+ +SK FHV + G  N TFD F + AP  S NTDGIHI +   + + ++ I TG
Sbjct  157   MVRGITSKDSKSFHVILFGCYNFTFDGFHISAPETSINTDGIHIGKSTDVKILNTNIATG  216

Query  671   DDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIK  850
             DDC+SLGDG  ++ +  V CGPGHGISVGSLG+   E PVK + V N     T+NGVRIK
Sbjct  217   DDCVSLGDGSIHVTVQNVNCGPGHGISVGSLGKYTNEEPVKDLLVKNCTLTNTENGVRIK  276

Query  851   TWPN-SHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISG  1027
             TWPN S   +VTD+HFE+I M +V NP++IDQEYCP N C KQ PS +K+ K+S+  I G
Sbjct  277   TWPNSSQTYLVTDMHFEDITMVDVLNPVIIDQEYCPWNHCPKQSPSKIKIRKVSFSDIKG  336

Query  1028  TSATPVAVQLACSSGVPCEEVEIGDINLTIKGGAAKSICKNVKPKLTGKVVPPLA  1192
             TS +   V   CS  VPCE+VE+ ++ LT KG    + C NV+PK  GK  P  A
Sbjct  337   TSKSKEGVIFICSKAVPCEDVELNNVALTFKGDPIVAKCANVRPKFAGKAPPCTA  391



>emb|CDX86325.1| BnaA06g30420D [Brassica napus]
Length=397

 Score =   340 bits (872),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 180/379 (47%), Positives = 241/379 (64%), Gaps = 12/379 (3%)
 Frame = +2

Query  74    ILFMLAHFGESAT---INVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVE  244
             +LF++   G SA      + A    D+   LLKA+ E C   T S+V+IPKG + + Q+E
Sbjct  9     VLFVVCLLGLSANAKDFTITAPPGSDITSLLLKAFNEACQFPTRSSVLIPKGEYKLRQIE  68

Query  245   LAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPS  424
             + GPCKAPI + +   +KA     N++G   W+  + I+ F L+GGG  DG+GN     +
Sbjct  69    MMGPCKAPIRITLQGTVKAD---GNVNGNDYWVAFRRINGFKLNGGGIFDGEGNAAWRAN  125

Query  425   ---KEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGN  595
                K    +  KLP ++  +F+T++ IR +T+L+SK FH+NVLG +N+T +  T+ AP  
Sbjct  126   NCHKMALTQCKKLPISIRFDFVTDAKIRGITSLDSKNFHINVLGARNMTLEEITIIAPEE  185

Query  596   SPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTP  775
             SPNTDGIH+ R +G+ + +S I TGDDCIS+GDG  +L +  VTCGPGHGIS+GSLG   
Sbjct  186   SPNTDGIHVGRSVGVQIINSNIKTGDDCISIGDGTRDLLVERVTCGPGHGISIGSLGLYV  245

Query  776   GERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYC  952
              E  V GI V NS  I TDNGVRIKTWP++      + IHFENI ++NV NPI+IDQEYC
Sbjct  246   KEEDVTGIRVVNSTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILIDQEYC  305

Query  953   PNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--G  1126
             P N C+K KPS +KL  IS+K I GTS    AV+L CS G PC+ V+IGDI++   G  G
Sbjct  306   PWNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVQIGDIDIKYTGADG  365

Query  1127  AAKSICKNVKPKLTGKVVP  1183
              A   C NV P L G  VP
Sbjct  366   PATFQCSNVSPTLMGTQVP  384



>ref|XP_002526193.1| hypothetical protein RCOM_0764760 [Ricinus communis]
 gb|EEF36197.1| hypothetical protein RCOM_0764760 [Ricinus communis]
Length=392

 Score =   340 bits (871),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 168/345 (49%), Positives = 225/345 (65%), Gaps = 5/345 (1%)
 Frame = +2

Query  140   DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKN  319
             D+  ALL AWK  C+   AS ++IP   + +  V L GPCK  + L+I   L AP +P  
Sbjct  40    DISKALLDAWKAACSTPGASRILIPHAKYALRDVLLEGPCKGSMVLQIKGTLMAPSDPSE  99

Query  320   MDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVI  496
                +  W+T +++DH T+SGG  LDG+G +    +          LP NL  +F+TN++I
Sbjct  100   HHSQG-WITFQHVDHLTISGG-NLDGRGKIAWGKNTCRTNVNCKNLPMNLRFDFVTNTII  157

Query  497   RDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDD  676
              DLT+ +SK FH+N++G +N T     + APG+S NTDGIHI R  G+ + DS IGTGDD
Sbjct  158   EDLTSRDSKNFHMNLIGCQNFTLQRIKIIAPGDSANTDGIHIGRSNGVNIIDSKIGTGDD  217

Query  677   CISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTW  856
             CIS+GDG  N+KITGV CGPGHGIS+GSLG+   E PV G++V     I T NG+RIK+W
Sbjct  218   CISIGDGSRNIKITGVRCGPGHGISIGSLGKYKNEEPVSGVYVKKCDLINTTNGIRIKSW  277

Query  857   PNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSA  1036
             P  + G  TD+HFE+I M NV N I+IDQ YCP N C+ +  S VK+SK+++  I GTS+
Sbjct  278   PGLYSGTATDLHFEDISMNNVSNAILIDQMYCPWNHCNSKASSNVKISKVTFSNIKGTSS  337

Query  1037  TPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKL  1165
              P  V+L CS G+PCE VE+ +IN+  KG  G AKS C NVKPK+
Sbjct  338   IPTIVKLLCSKGLPCEGVELNNINVVYKGPEGPAKSECTNVKPKI  382



>ref|XP_008462107.1| PREDICTED: exopolygalacturonase clone GBGA483 [Cucumis melo]
Length=403

 Score =   340 bits (871),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 177/400 (44%), Positives = 245/400 (61%), Gaps = 12/400 (3%)
 Frame = +2

Query  35    LKMATISYCAFTFILFML--------AHFGESATINVAAKANVDVGPALLKAWKEGCAAT  190
             +  +TI   + TFILF+         A           A  N D   A++KAWK+ C++T
Sbjct  1     MSSSTIFSRSTTFILFLFIGLITNVQAVDFHVKRYGARANGNSDDSQAIMKAWKDACSST  60

Query  191   TASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFT  370
               S +VIP G + +  ++  GPC API +++   L+AP N K M     W+  +YI+  T
Sbjct  61    KPSKIVIPGGRYVVDSMKFQGPCLAPIHVQVEGRLQAPTNIKKMRNDASWIVFQYINGLT  120

Query  371   LSGGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLG  547
             +SG GT DG+G++    ++     K   LP +L    L NS+I+D+T+ +SK FH+NV  
Sbjct  121   VSGKGTFDGRGSLAWKQNQCASSGKCGSLPISLRFFSLNNSLIKDITSTDSKFFHMNVHN  180

Query  548   GKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVT  727
              +N+T  +  + APG+SPNTDGIHI    GIT+ D+ I TGDDC+S+GDG + + +  VT
Sbjct  181   CRNVTLRNINIDAPGDSPNTDGIHIGGSSGITIHDARIKTGDDCVSIGDGSQQINVEKVT  240

Query  728   CGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENID  907
             CGPGHGIS+GSLG+   E+PV GI V +     T  GVRIKTWP S  G+ +++ FENI 
Sbjct  241   CGPGHGISIGSLGKYKNEKPVSGITVRDCTITNTMFGVRIKTWPASTKGIASNMQFENIV  300

Query  908   MQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEE  1087
             M NV  PI+IDQ+YCP   C  Q PS V++S + +K I GTS T VAV+L CS G PC+ 
Sbjct  301   MDNVGTPILIDQQYCPYGTCHHQVPSRVQISDVGFKNIRGTSTTQVAVKLVCSRGYPCKN  360

Query  1088  VEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLACGK  1201
             V++ +INL   G  G A S C NVKP + G+VVPP AC +
Sbjct  361   VKLSNINLKYSGTNGTAISECSNVKPAVVGRVVPP-ACTR  399



>gb|ACP74159.1| putative polygalacturonase [Brassica rapa subsp. oleifera]
Length=397

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 178/379 (47%), Positives = 239/379 (63%), Gaps = 12/379 (3%)
 Frame = +2

Query  74    ILFMLAHFGESAT---INVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVE  244
             +LF++   G SA      + A    D+   LLK + E C   T S+V+IPKG + + Q+E
Sbjct  9     VLFVVCLLGLSANAKDFTITAPPGSDITSLLLKTFNEACQFPTRSSVLIPKGEYKLRQIE  68

Query  245   LAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPS  424
             + GPCKAPI + +   +KA     N++G   W+  + I+ F L+GGG  DG+GN     +
Sbjct  69    MMGPCKAPIRITLQGTVKAD---GNVNGNDYWVAFRRINGFKLNGGGIFDGEGNAAWRAN  125

Query  425   KEKGF---KGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGN  595
                     +  KLP ++  +F+T++ IR +T+L+SK FH+NVLG +N+T +  T+ AP  
Sbjct  126   NRHKMALTQCKKLPISIRFDFVTDAKIRGITSLDSKNFHINVLGARNMTLEEITIIAPEE  185

Query  596   SPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTP  775
             SPNTDGIH+ R +G+ + +S I TGDDCIS+GDG  +L +  VTCGPGHGIS+GSLG   
Sbjct  186   SPNTDGIHVGRSVGVQIINSNIKTGDDCISIGDGTRDLLVERVTCGPGHGISIGSLGLYV  245

Query  776   GERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYC  952
              E  V GI V NS  I TDNGVRIKTWP++      + IHFENI ++NV NPI+IDQEYC
Sbjct  246   KEEDVTGIRVVNSTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILIDQEYC  305

Query  953   PNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--G  1126
             P N C+K KPS +KL  IS+K I GTS    AV+L CS G PC+ V+IGDI++   G  G
Sbjct  306   PWNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVQIGDIDIKYTGADG  365

Query  1127  AAKSICKNVKPKLTGKVVP  1183
              A   C NV P L G  VP
Sbjct  366   PATFQCSNVSPTLMGTQVP  384



>gb|ABE77145.1| putative polygalacturonase [Fragaria x ananassa]
Length=405

 Score =   340 bits (871),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 175/365 (48%), Positives = 238/365 (65%), Gaps = 14/365 (4%)
 Frame = +2

Query  128   KANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPP  307
             K N D+   L  AWK+ CAATT S V++PKGTF +      GPCKAPI +++  IL+APP
Sbjct  44    KPNTDISQPLANAWKDACAATTPSRVIVPKGTFQLKGAVFKGPCKAPITVQVDGILQAPP  103

Query  308   NPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPN------NLS  469
                 +  K+ W+    ++  T+SG GT DGQG      +  K    +K PN      N+ 
Sbjct  104   IEAQLANKEFWVQFLEVERLTVSGTGTFDGQGQ-----NSWKDNDCNKNPNCGGLAINVR  158

Query  470   LNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVK  649
              + + NS++RD+T+LNSK FH N+LG ++LTF H  VKAPG+SPNTDGIH+ R   I + 
Sbjct  159   FDRVKNSLVRDVTSLNSKNFHFNILGCEHLTFQHVIVKAPGDSPNTDGIHMGRSTRINIT  218

Query  650   DSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGT  829
             D+ IGTGDDCIS+GDG   L ++ V+CGPGHGIS+GSLGR   E  V G+ + +     T
Sbjct  219   DTNIGTGDDCISVGDGTRQLTVSKVSCGPGHGISIGSLGRYDNEDDVSGLNIRDCTLSNT  278

Query  830   DNGVRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKI  1006
              NGVRIKT+P S      +DIHFE I M NV NP++IDQEYCP  +C+KQ PS VK+S +
Sbjct  279   LNGVRIKTFPASPKATTASDIHFEKITMNNVANPVLIDQEYCPWGQCNKQIPSKVKISNV  338

Query  1007  SYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG-GAAKSICKNVKPKLTGKVVP  1183
             S+K I GT++T  A+++ C+ G+ C++V + DI+L + G G   S C NV+P +T +V P
Sbjct  339   SFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDIDLKLSGKGTLTSHCANVQPTIT-RVPP  397

Query  1184  PLACG  1198
             PLAC 
Sbjct  398   PLACA  402



>gb|ABR26683.1| polygalacturonase [Fragaria chiloensis]
Length=405

 Score =   339 bits (870),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 179/384 (47%), Positives = 245/384 (64%), Gaps = 19/384 (5%)
 Frame = +2

Query  86    LAHFGESATINVAA-----KANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
             +A F  S   +V +     K N D+   L  AWK+ CAATT S V++PKGTF +      
Sbjct  25    VAQFLASGDFDVTSPKYGGKPNTDISQPLANAWKDACAATTPSRVIVPKGTFQLKGAVFK  84

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKE  430
             GPCKAPI +++  IL+APP    +  K+ W+    ++  T+SG GT DGQG      +  
Sbjct  85    GPCKAPITVQVDGILQAPPIEAQLANKEFWVQFLEVERLTVSGTGTFDGQGQ-----NSW  139

Query  431   KGFKGDKLPN------NLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPG  592
             K    +K PN      N+  + + NS++RD+T+LNSK FH N+LG ++LTF H TVKAPG
Sbjct  140   KDNDCNKNPNCGGLAINVRFDKVKNSLVRDVTSLNSKNFHFNILGCEHLTFQHVTVKAPG  199

Query  593   NSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRT  772
             +S NTDGIH+ R   I + D+ IGTGDDCIS+GDG   L ++ V+CGPGHGIS+GSLGR 
Sbjct  200   DSSNTDGIHMGRSTEINITDTNIGTGDDCISVGDGTRQLTVSKVSCGPGHGISIGSLGRY  259

Query  773   PGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGV-VTDIHFENIDMQNVKNPIVIDQEY  949
               E  V G+ + +     T NGVRIKT+P S      +DIHFE I M NV NP++IDQEY
Sbjct  260   DNEDDVSGLNIRDCTLSNTLNGVRIKTFPASPKATPASDIHFEKITMNNVANPVLIDQEY  319

Query  950   CPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG-G  1126
             CP  +C+KQ PS VK+S +S+K I GT++T  A+++ C+ G+ C++V + DI+L + G G
Sbjct  320   CPWGQCNKQIPSKVKISNVSFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDIDLKLSGKG  379

Query  1127  AAKSICKNVKPKLTGKVVPPLACG  1198
                S C NV+P +T +V PPLAC 
Sbjct  380   TLTSHCANVQPTIT-RVPPPLACA  402



>ref|XP_004144529.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=412

 Score =   339 bits (870),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 179/369 (49%), Positives = 245/369 (66%), Gaps = 25/369 (7%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK N D+  AL  AWK+ CA+T +S ++IP G + + Q  L GPCK+ IE+++   L+A 
Sbjct  45    AKPNTDITQALANAWKDACASTYSSKLLIPMGVYHLNQSILHGPCKSTIEVRMEGTLQAH  104

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD---------KLP  457
             P+P   DG    +  +YID  TLSG G  DGQG        EKG++ +         KLP
Sbjct  105   PDPIG-DG---LVLFQYIDQLTLSGTGAFDGQG--------EKGWEKNDCHLKKICTKLP  152

Query  458   NNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIG  637
              N+  +F+TNS+++D+T+L+SK FH N+LG KN+TF + T+ AP NSPNTDGIH++    
Sbjct  153   MNVKFSFVTNSMVKDITSLDSKNFHFNLLGCKNVTFQNVTIIAPENSPNTDGIHVSSSEV  212

Query  638   ITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSK  817
             I + ++ I TGDDCIS+GD  + + IT VTCGPGHGIS+GSLG+   E+ V G+ V + K
Sbjct  213   INIFNTRISTGDDCISVGDSNKQITITNVTCGPGHGISIGSLGKYTKEKEVAGVTVKSCK  272

Query  818   FIGTDNGVRIKTWPNSHPG-VVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVK  994
              I T NGVRIKTWP+       +D+HFE+I+M NV NP++IDQEYCP+N+C+K+ PS +K
Sbjct  273   LINTSNGVRIKTWPDCAVAYTASDLHFEDIEMVNVSNPVIIDQEYCPSNQCNKKIPSKIK  332

Query  995   LSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLT  1168
             +S +S+K I GTSAT VAV+  CS+   CE VE+ DI+L   G  G   S C+NV P +T
Sbjct  333   ISNVSFKNIRGTSATFVAVKFICSTVFSCEGVEVTDIDLAYIGTQGRITSQCRNVIPIIT  392

Query  1169  GKVVPPLAC  1195
             GK   P AC
Sbjct  393   GK-QNPRAC  400



>emb|CDY54512.1| BnaC07g49180D [Brassica napus]
Length=397

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 179/379 (47%), Positives = 239/379 (63%), Gaps = 12/379 (3%)
 Frame = +2

Query  74    ILFMLAHFGESAT---INVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVE  244
             +LF++   G SA      + A    D+   LLK + E C   T S+V+IPKG + + Q+E
Sbjct  9     VLFVVCLLGLSANAKDFTITAPPGSDITSLLLKTFNEACQFPTKSSVLIPKGEYKLRQIE  68

Query  245   LAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPS  424
             + GPCKAPI + +   +KA     N++G   W+  + I+ F L+GGG  DG+GN     +
Sbjct  69    MMGPCKAPIRITLQGTVKAD---GNVNGNDFWVAFRRINGFKLNGGGVFDGEGNAAWRAN  125

Query  425   ---KEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGN  595
                K    +  KLP ++  +F+T++ IR +T+++SK FH+NVLG +N+T +  T+ AP  
Sbjct  126   NCHKMALTQCKKLPISIRFDFVTDAKIRGITSMDSKNFHINVLGARNMTLEEITIIAPEE  185

Query  596   SPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTP  775
             SPNTDGIH+ R +G+ + +S I TGDDCIS+GDG  +L +  VTCGPGHGIS+GSLG   
Sbjct  186   SPNTDGIHVGRSVGVQIINSNIKTGDDCISIGDGTRDLLVERVTCGPGHGISIGSLGLYV  245

Query  776   GERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYC  952
              E  V GI V N   I TDNGVRIKTWP++      + IHFENI ++NV NPI+IDQEYC
Sbjct  246   KEEDVTGIRVVNCTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILIDQEYC  305

Query  953   PNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--G  1126
             P N C+K KPS +KL  IS+K I GTS    AV+L CS G PC+ VEIGDIN+   G  G
Sbjct  306   PWNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVEIGDINIQYTGADG  365

Query  1127  AAKSICKNVKPKLTGKVVP  1183
              A   C NV P L G  VP
Sbjct  366   PATFQCSNVSPTLMGTQVP  384



>ref|XP_010675884.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=388

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/345 (49%), Positives = 229/345 (66%), Gaps = 4/345 (1%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK N D   A L AWK  CA+TT S V++P+G++ +  ++L GPCK+ + ++I+   KAP
Sbjct  41    AKPNGDATQAFLHAWKVACASTTPSKVLVPRGSYILHAIKLQGPCKSRVTIEILGNFKAP  100

Query  305   PNPKNMDGKKEWLTIKYIDHFTLS---GGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSL  472
              +P    G+  W+ I+ ID  T++   G G  DG G +    +   K  K + LP N   
Sbjct  101   ADPAQFKGEDTWVKIERIDGLTITAPKGAGVFDGAGQIAWKQNDCSKTGKCNSLPYNFRF  160

Query  473   NFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKD  652
             NFLTNSVI  +T+LNSKLFH+ +LG K L     TV AP +S NTDGIHI R  G+ +  
Sbjct  161   NFLTNSVINGITSLNSKLFHMAILGCKQLRIHDITVTAPADSLNTDGIHIGRSDGVNITA  220

Query  653   SVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTD  832
             + IGTGDDC+S+GDG +N+ I  +TCGPGHGISVGSLGR P E PV+GI V       T 
Sbjct  221   AHIGTGDDCVSIGDGAKNVHIEQITCGPGHGISVGSLGRYPNEEPVQGITVKGCTIKNTH  280

Query  833   NGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISY  1012
             NGVR+KTW NS+ GVVT +HFE+I ++NV NPI++DQEYCP N C ++ PS VKLS I +
Sbjct  281   NGVRVKTWHNSYEGVVTGLHFEDIIVENVLNPIIVDQEYCPYNHCKQKTPSKVKLSDIKF  340

Query  1013  KKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKGGAAKSICK  1147
             + + GTS++  AV++ CSSGVPCE+V++ +I+L   G    ++ K
Sbjct  341   QNVRGTSSSKEAVKVVCSSGVPCEKVQLVNIDLKYTGKDGPAVWK  385



>ref|XP_009151612.1| PREDICTED: polygalacturonase [Brassica rapa]
 gb|ABG38467.1| pollen-expressed protein MF6t [Brassica juncea]
Length=397

 Score =   338 bits (868),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 179/379 (47%), Positives = 240/379 (63%), Gaps = 12/379 (3%)
 Frame = +2

Query  74    ILFMLAHFGESAT---INVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVE  244
             +LF++   G SA      + A    D+   LLK + E C   T S+V+IPKG + + Q+E
Sbjct  9     VLFVVCLLGLSANAKDFTITAPPGSDITSLLLKTFNEACQFPTRSSVLIPKGEYKLRQIE  68

Query  245   LAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPS  424
             + GPCKAPI + +   +KA     N++G   W+  + I+ F L+GGG  DG+GN     +
Sbjct  69    MMGPCKAPIRITLQGTVKAD---GNVNGNDYWVAFRRINGFKLNGGGIFDGEGNAAWRAN  125

Query  425   ---KEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGN  595
                K    +  KLP ++  +F+T++ IR +T+L+SK FH+NVLG +N+T +  T+ AP  
Sbjct  126   NCHKMALTQCKKLPISIRFDFVTDAKIRGITSLDSKNFHINVLGARNMTLEEITIIAPEE  185

Query  596   SPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTP  775
             SPNTDGIH+ R +G+ + +S I TGDDCIS+GDG  +L +  VTCGPGHGIS+GSLG   
Sbjct  186   SPNTDGIHVGRSVGVQIINSNIKTGDDCISIGDGTRDLLVERVTCGPGHGISIGSLGLYV  245

Query  776   GERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYC  952
              E  V GI V NS  I TDNGVRIKTWP++      + IHFENI ++NV NPI+IDQEYC
Sbjct  246   KEEDVTGIRVVNSTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILIDQEYC  305

Query  953   PNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--G  1126
             P N C+K KPS +KL  IS+K I GTS    AV+L CS G PC+ V+IGDI++   G  G
Sbjct  306   PWNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVQIGDIDIKYTGADG  365

Query  1127  AAKSICKNVKPKLTGKVVP  1183
              A   C NV P L G  VP
Sbjct  366   PATFQCSNVSPTLMGTQVP  384



>emb|CDY05701.1| BnaC02g38360D [Brassica napus]
Length=397

 Score =   338 bits (867),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 175/377 (46%), Positives = 238/377 (63%), Gaps = 9/377 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
             F+  +LA    +    + A+   D+   L K +KE C     STV+IPKG F + ++E+ 
Sbjct  11    FVFCLLALSANAREFRITARPGSDITGELSKLFKEACQCVDKSTVLIPKGEFKLGEIEMM  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPS--  424
             GPCKAPI   +   ++A     N++GK  W+  + I +F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIIFVLQGTVRAD---GNVNGKDFWVAFRRITNFRLNGGGIFDGEGNASWRANNC  127

Query  425   -KEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  601
              K    +  +LP ++  +++T+  +RD+T+L++K FH+NV+G KNLTF+   + AP  SP
Sbjct  128   HKTSLTQCKRLPISIRFDYITDGKVRDITSLDAKNFHINVIGAKNLTFEDIRIVAPDESP  187

Query  602   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  781
             NTDGIH+ R  GI + ++ I TGDDCIS+GDG++NL +  VTCGPGHGIS+GSLG    E
Sbjct  188   NTDGIHVGRSDGIKIINTNIKTGDDCISVGDGMKNLLVERVTCGPGHGISIGSLGLYGHE  247

Query  782   RPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPN  958
               V G+ V N     TDNGVRIKTWP++      + IHFENI +QNV NPI+IDQEYCP 
Sbjct  248   EDVTGVKVVNCTLRNTDNGVRIKTWPSAACSTTASGIHFENIILQNVSNPILIDQEYCPW  307

Query  959   NECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAA  1132
             N C+K KPS +KL  I +K I G+S    AV+L CS G PC+ VEIGDI++T  G  G A
Sbjct  308   NRCNKNKPSSIKLVDIKFKNIKGSSGNKDAVKLLCSKGFPCKNVEIGDIDITYNGKDGPA  367

Query  1133  KSICKNVKPKLTGKVVP  1183
                C NV PKL GK  P
Sbjct  368   TFQCSNVSPKLVGKQCP  384



>ref|XP_004295350.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase clone GBGA483-like 
[Fragaria vesca subsp. vesca]
Length=400

 Score =   338 bits (866),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 184/393 (47%), Positives = 244/393 (62%), Gaps = 19/393 (5%)
 Frame = +2

Query  68    TFILFMLAHFGESATINVA--------AKAN--VDVGPALLKAWKEGCAATTASTVVIPK  217
             T  LF++A    S T N A        AKA+   D   A+ KAW + C AT+ STVVI K
Sbjct  9     TCFLFLVAF---SLTANAADFDVRKYGAKADGKTDDSQAINKAWTDACTATSQSTVVIEK  65

Query  218   GTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDG  397
               + +  V   GPCKAPI +K+   L AP  P+ +  +  W+  + +D+ ++ GG   DG
Sbjct  66    RNYLVGPVRFGGPCKAPISIKVAGTLVAPAEPEKLKSQDGWVVFQNVDNLSVFGGXVFDG  125

Query  398   QGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHF  574
             QG +    +   K  K + LP N+ +  +TNS I+D T+LNSKLFH+NV+  K+LT    
Sbjct  126   QGKLAWSRNDFAKTGKCNSLPINIRITGVTNSHIQDKTSLNSKLFHINVINSKHLTLQRI  185

Query  575   TVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISV  754
             T+ AP  S NTDGIHI R   I V D+ I TGDDC+SLGDG +N+ +  VTCG GHGIS+
Sbjct  186   TIDAPQESLNTDGIHIGRSSYINVTDANIKTGDDCVSLGDGSQNINVEKVTCGSGHGISI  245

Query  755   GSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVK-NPI  931
             GSLGR   E+PV+G+ V   +   T NGVRIKTWP S  GV +D+HFE+I M NVK NP+
Sbjct  246   GSLGRYHDEQPVQGVTVRYCQISNTTNGVRIKTWPASPNGVASDLHFEDISMDNVKTNPV  305

Query  932   VIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINL  1111
             ++DQEYCP  +C  + PS VK+S +S+K I GT+   VAV+L CS G+PC+ V++ DINL
Sbjct  306   LVDQEYCPYGQCQAKLPSKVKISNVSFKNIRGTTQDLVAVKLVCSRGIPCQNVQVADINL  365

Query  1112  TIKG---GAAKSICKNVKPKLTGKVVPPLACGK  1201
             T  G   G A S C NVKP ++G    P  C K
Sbjct  366   TYNGNKNGTAISECANVKPTVSG-FNHPQVCAK  397



>ref|XP_008455507.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=402

 Score =   337 bits (865),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 170/369 (46%), Positives = 243/369 (66%), Gaps = 25/369 (7%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK N D+   L  AWK+ CA+T  S ++IP G + + Q  L GPC + IE+++   L+A 
Sbjct  35    AKPNTDITQVLANAWKDACASTNPSQLLIPTGVYQLNQSLLIGPCNSTIEVRMEGTLQAH  94

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD---------KLP  457
             P+P  +      +  ++ID  T+SG G  DGQG        EKG++ +         +LP
Sbjct  95    PDPIGIG----LVLFRHIDQLTISGTGAFDGQG--------EKGWEKNDCHLKKACTRLP  142

Query  458   NNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIG  637
              N+  NF+TNS+++D+T+L+SK FH+N+L  KN+TF + T+ AP  SPNTDGIH++    
Sbjct  143   MNVRFNFITNSIVKDITSLDSKNFHINLLSCKNVTFQNVTIIAPEKSPNTDGIHVSNSEE  202

Query  638   ITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSK  817
             I + ++ I TGDDC+S+GDG + + IT VTCGPGHGIS+GSLG+   E+ V G+ V +  
Sbjct  203   INILNTKISTGDDCVSVGDGNKQITITNVTCGPGHGISIGSLGKYTTEKEVAGVTVKSCN  262

Query  818   FIGTDNGVRIKTWPNSHPG-VVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVK  994
              I T NGVRIK+WP+S      +D+HFE+I+M NV NPI+IDQEYCP+N+C+K+ PS +K
Sbjct  263   LINTSNGVRIKSWPDSAVAYTASDLHFEDIEMVNVSNPIIIDQEYCPSNQCNKKIPSKIK  322

Query  995   LSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLT  1168
             +  +S+K I GTSAT VA++  CS  +PC++VE+ DINL+  G  G   S C+NV P +T
Sbjct  323   IRNVSFKNIRGTSATFVAIKFICSKDLPCDDVEVADINLSYTGTQGRITSQCRNVIPIIT  382

Query  1169  GKVVPPLAC  1195
             GK   P AC
Sbjct  383   GK-QNPRAC  390



>ref|XP_004163433.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=412

 Score =   338 bits (866),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 178/369 (48%), Positives = 245/369 (66%), Gaps = 25/369 (7%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK N D+  AL  AWK+ CA+T +S ++IP G + + Q  L GPCK+ IE+++   L+A 
Sbjct  45    AKPNTDITQALANAWKDACASTYSSKLLIPMGVYHLNQSILHGPCKSTIEVRMEGTLQAH  104

Query  305   PNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGD---------KLP  457
             P+P   DG    +  +YID  TLSG G  DGQG        EKG++ +         KLP
Sbjct  105   PDPIG-DG---LVLFQYIDQLTLSGTGAFDGQG--------EKGWEKNDCHLKKICTKLP  152

Query  458   NNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIG  637
              N+  +F+TNS+++D+T+L+SK FH N+LG KN+TF + T+ AP NSPNTDGIH++    
Sbjct  153   MNVKFSFVTNSMVKDITSLDSKNFHFNLLGCKNVTFQNVTIIAPENSPNTDGIHVSSSEV  212

Query  638   ITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSK  817
             I + ++ I TGDDCIS+GD  + + IT VTCGPGHGIS+GSLG+   E+ V G+ V + K
Sbjct  213   INIFNTRISTGDDCISVGDSNKQITITNVTCGPGHGISIGSLGKYTKEKEVAGVTVKSCK  272

Query  818   FIGTDNGVRIKTWPNSHPG-VVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVK  994
              I T NGVRIKTWP+       +D+HFE+I+M NV NP++IDQEYCP+N+C+K+ PS +K
Sbjct  273   LINTSNGVRIKTWPDCAVAYTASDLHFEDIEMVNVSNPVIIDQEYCPSNQCNKKIPSKIK  332

Query  995   LSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLT  1168
             ++ +S+K I GTSAT VAV+  CS+   CE VE+ DI+L   G  G   S C+NV P +T
Sbjct  333   INNVSFKNIRGTSATFVAVKFICSTVFSCEGVEVTDIDLAYIGTQGRITSQCRNVIPIIT  392

Query  1169  GKVVPPLAC  1195
             GK   P AC
Sbjct  393   GK-QNPRAC  400



>gb|AAP37458.1| polygalacturonase [Fragaria x ananassa]
Length=405

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 174/365 (48%), Positives = 237/365 (65%), Gaps = 14/365 (4%)
 Frame = +2

Query  128   KANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPP  307
             K N D+   L  AWK+ CAATT S V++PKGTF +      GPCKAPI +++  IL+APP
Sbjct  44    KPNTDISQPLANAWKDACAATTPSRVIVPKGTFQLKGAVFKGPCKAPITVQVDGILQAPP  103

Query  308   NPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPN------NLS  469
                 +  K+ W+    ++  T+SG GT DGQG      +  K    +K PN      N+ 
Sbjct  104   IEAQLANKEFWVQFLEVERLTVSGTGTFDGQGQ-----NSWKDNDCNKNPNCGGLAINVR  158

Query  470   LNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVK  649
              + + NS++RD+T+LNSK FH N+LG ++LTF H  VKAPG+SPNTDGIH+ R   I + 
Sbjct  159   FDRVKNSLVRDVTSLNSKNFHFNILGCEHLTFQHVIVKAPGDSPNTDGIHMGRSTRINIT  218

Query  650   DSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGT  829
             D+ IGTGDDCIS+GDG   L ++ V+CGPGHGIS+GSLGR   E  V G+ + +     T
Sbjct  219   DTNIGTGDDCISVGDGTRQLTVSKVSCGPGHGISIGSLGRYDNEDDVSGLNIRDCTLSNT  278

Query  830   DNGVRIKTWPNS-HPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKI  1006
              NGVRIKT+P S      +DIHFE I M  V NP++IDQEYCP  +C+KQ PS VK+S +
Sbjct  279   LNGVRIKTFPASPKATTASDIHFEKITMNYVANPVLIDQEYCPWGQCNKQIPSKVKISNV  338

Query  1007  SYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG-GAAKSICKNVKPKLTGKVVP  1183
             S+K I GT++T  A+++ C+ G+ C++V + DI+L + G G   S C NV+P +T +V P
Sbjct  339   SFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDIDLKLSGKGTLTSHCANVQPTIT-RVPP  397

Query  1184  PLACG  1198
             PLAC 
Sbjct  398   PLACA  402



>ref|XP_006492955.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 176/400 (44%), Positives = 241/400 (60%), Gaps = 23/400 (6%)
 Frame = +2

Query  53    SYCAFTFILFMLAHFGESATINVAAKANV--------------DVGPALLKAWKEGCAAT  190
             S C+   +L +L  F  +  I  AA   V              D   A   AW+E C   
Sbjct  4     SSCSQLLVLAILVLFSLAQNIINAASNGVFNVIDFGAIADGIRDNSRAFENAWREACYWN  63

Query  191   TASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFT  370
             T STV++P G + +T V   GPCKAPI  ++  ++ APP    +  K+ W+T + +  FT
Sbjct  64    TYSTVLVPPGKYLVTSVVFKGPCKAPISFQLQGLILAPPGLSKLADKESWITFESLRSFT  123

Query  371   LSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGG  550
             L+GGGT  GQG      ++       +LP ++  N L +S I  + +++SK FH+N+LG 
Sbjct  124   LTGGGTFHGQGRTAWPENQCHKNSNCQLPISIRFNKLNDSTITGVQSVDSKFFHINILGC  183

Query  551   KNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDG-----LENLKI  715
              NL  +   + AP +SPNTDGIHI R  GI + +S+I TGDDC+SLGDG     ++N+ +
Sbjct  184   YNLKLNKINISAPDDSPNTDGIHIGRSNGIEISNSIIATGDDCVSLGDGSQNVLVQNVLV  243

Query  716   TGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHF  895
             + V+CGPGHGISVGSLG+   E  V G+ V N  F GT NGVRIKTWP+S  G  ++  F
Sbjct  244   SDVSCGPGHGISVGSLGKYKKEEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTF  303

Query  896   ENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGV  1075
             E++ M NV+NPIVIDQEYCP+N+C+ + PS VK+S + ++ I GTS T  AV++ CS  +
Sbjct  304   EDLFMNNVENPIVIDQEYCPHNQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEI  363

Query  1076  PCEEVEIGDINLTIKG----GAAKSICKNVKPKLTGKVVP  1183
             PC+ VEIGDINL   G    G A S C NVKP L GK +P
Sbjct  364   PCQNVEIGDINLVYNGIDDKGPAISSCSNVKPTLVGKQIP  403



>gb|AHL24657.1| Sal k 6.01 allergen, partial [Salsola kali]
Length=381

 Score =   336 bits (861),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 180/362 (50%), Positives = 237/362 (65%), Gaps = 5/362 (1%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK N D   ALL AWKE CAA   + +V+P G F +  V+L GPCKAP+ ++I    KAP
Sbjct  11    AKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAPLTIEIAGNFKAP  70

Query  305   PNPKNMDGKKEWLTIKYIDHFTLS---GGGTLDGQGNVQVYPSK-EKGFKGDKLPNNLSL  472
              +   M G+  W+ I+ +   T++    GGT DGQG      +K  +    + LP N   
Sbjct  71    ADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGMCNSLPYNFRF  130

Query  473   NFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKD  652
             N LTN+ I  + +LNSKL+H+ V+G KN+T    T+ AP +S NTDG+HI R  G+   +
Sbjct  131   NTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHIGRSNGVHATN  190

Query  653   SVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTD  832
             S IGTGDDCIS+GDG  ++ + G+TCGPGHGIS+GS+G+   E P  GIFV N  F  TD
Sbjct  191   SKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIFVKNCSFTDTD  250

Query  833   NGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISY  1012
             NGVRIK+W NS     +D+HFE+I + NV NP++IDQEYCP N C ++ PS VKLSKIS+
Sbjct  251   NGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTPSKVKLSKISF  310

Query  1013  KKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKGGAAKSICKNVKPKLTGKVVPPLA  1192
             K + G + +   V+L CSS VPC+ VE+ DI+LT  GGAA S CKNVKP +TGK   P+A
Sbjct  311   KNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQCKNVKPIVTGK-QNPVA  369

Query  1193  CG  1198
             CG
Sbjct  370   CG  371



>emb|CDY22137.1| BnaC01g39640D [Brassica napus]
Length=396

 Score =   336 bits (862),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 176/379 (46%), Positives = 245/379 (65%), Gaps = 7/379 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
             FI  +L     +   ++ + +  D+  ALLKA+   C + + S VVIP+G F + ++E+ 
Sbjct  11    FIFCLLGFSANAEVFSIDSSSGSDITQALLKAFTSACQSPSPSKVVIPEGEFKLGEIEMR  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCKAP+E+ +   +KA  N   + GK++W+    I+ F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPVEITLQGTVKADGNA--IQGKEKWVVFGNINGFKLNGGGAFDGEGNAAWRVNNC  128

Query  428   EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  607
              K F   KLP ++  +F+ N+ I+D++++++K FH+NVLG KN+T  +  + AP +SPNT
Sbjct  129   HKTFNCKKLPISIRFDFVENAEIKDISSIDAKNFHINVLGAKNMTMSNIKITAPEDSPNT  188

Query  608   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  787
             DGIH+ R  G+ + +S I TGDDCIS+GDG  NL +  VTCGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRSDGVKILNSFISTGDDCISVGDGTNNLHVEKVTCGPGHGISVGSLGRYGKEQD  248

Query  788   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNE  964
             V GI V N     TDNG+RIKTWP++      +DIHFE+I ++NV NPI+IDQEYCP N+
Sbjct  249   VSGIRVVNCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVTNPILIDQEYCPWNQ  308

Query  965   CSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKS  1138
             C+K+K S +KL  IS+K + GTS    AV+L CS G PC+ VEIGDI++   G  G A  
Sbjct  309   CNKKKASTIKLVNISFKNVRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIKYSGADGPATF  368

Query  1139  ICKNVKPKLTGKVVPPLAC  1195
              C NV PKL G    P AC
Sbjct  369   QCSNVSPKLLG-AQSPEAC  386



>ref|XP_009134997.1| PREDICTED: polygalacturonase [Brassica rapa]
Length=397

 Score =   335 bits (858),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 176/380 (46%), Positives = 236/380 (62%), Gaps = 6/380 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
              +L +L +   +    V      D+  ALLKA+   C A   S V+IPKG F + ++ + 
Sbjct  11    LVLCLLGYSANAEVFTVGGPPGSDITAALLKAFTSACQAPAPSQVLIPKGDFKLGEIAMT  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCK+P+E  +   +KA  +  +  GK  W+  + I+ F L+GGGT DG+GN     +  
Sbjct  71    GPCKSPVEFTLQGNVKA--DGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKANNC  128

Query  428   EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  607
              K F+  KLP ++  +F+ N+ I+D+T+L++K FH NV+ GKN+TFD+  + AP  SPNT
Sbjct  129   HKTFECKKLPISVRFDFVDNAEIKDITSLDAKNFHFNVISGKNMTFDNIKIIAPAESPNT  188

Query  608   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  787
             DGIH+ R  G+ + ++ I TGDDCIS+GDG++NL I  V CGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRCEGVKILNTKISTGDDCISVGDGMKNLLIEKVVCGPGHGISVGSLGRYGWEQD  248

Query  788   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNE  964
             V  I V N    GTDNG+RIKTWP++        IHFENI +  V NPI+IDQEYCP N+
Sbjct  249   VNDIKVINCTLEGTDNGLRIKTWPSAACTTTAAGIHFENIILNKVSNPILIDQEYCPWNQ  308

Query  965   CSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKS  1138
             C+K KPS +KL  I+++ I GTS    AV+L CS G PCE VEIGDIN+   G  G    
Sbjct  309   CNKSKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGPDGPPTF  368

Query  1139  ICKNVKPKLTGKVVPPLACG  1198
              C NV PKL G   P    G
Sbjct  369   ECTNVTPKLVGTQNPKACVG  388



>ref|XP_006495222.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score =   335 bits (859),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 175/400 (44%), Positives = 240/400 (60%), Gaps = 23/400 (6%)
 Frame = +2

Query  53    SYCAFTFILFMLAHFGESATINVAAKANV--------------DVGPALLKAWKEGCAAT  190
             S C+   +L +L  F  +  I  AA   V              D   A   AW+E C   
Sbjct  4     SSCSQLLVLAILVLFSLAQNIINAASNGVFNVIDFGAMADGIRDNSKAFENAWREACNWN  63

Query  191   TASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFT  370
             T STV++P G + +T     GPCKAPI  ++  ++ APP    +  K+ W+T + +  FT
Sbjct  64    TYSTVLVPPGKYFVTSAVFKGPCKAPISFQLQGLILAPPGLSKLADKESWITFESLRSFT  123

Query  371   LSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGG  550
             L+GGGT  GQG      ++       +LP ++  N L +S I  + +++SK FH+N+LG 
Sbjct  124   LTGGGTFHGQGRTAWPENQCHKNSNCQLPISIRFNKLNDSTITGVQSVDSKFFHINILGC  183

Query  551   KNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDG-----LENLKI  715
              NL  +   + AP +SPNTDGIHI R  GI + +S+I TGDDC+SLGDG     ++N+ +
Sbjct  184   YNLKLNKINISAPDDSPNTDGIHIGRSNGIEISNSIIATGDDCVSLGDGSQNVLVQNVLV  243

Query  716   TGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHF  895
             + V+CGPGHGISVGSLG+   E  V G+ V N  F GT NGVRIKTWP+S  G  ++  F
Sbjct  244   SDVSCGPGHGISVGSLGKYKKEEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTF  303

Query  896   ENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGV  1075
             E++ M NV+NPIVIDQEYCP+N+C+ + PS VK+S + ++ I GTS T  AV++ CS  +
Sbjct  304   EDLFMNNVENPIVIDQEYCPHNQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEI  363

Query  1076  PCEEVEIGDINLTIKG----GAAKSICKNVKPKLTGKVVP  1183
             PC+ VEIGDINL   G    G A S C NVKP L GK +P
Sbjct  364   PCQNVEIGDINLVYNGIDDKGPAISSCSNVKPTLVGKQIP  403



>ref|XP_009129707.1| PREDICTED: polygalacturonase-like [Brassica rapa]
 ref|XP_009102886.1| PREDICTED: polygalacturonase-like [Brassica rapa]
Length=397

 Score =   335 bits (858),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 173/377 (46%), Positives = 237/377 (63%), Gaps = 9/377 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
             F+  +LA    +    + A+   D+   L K +KE C     STV+IPKG F + ++E+ 
Sbjct  11    FVFCLLALSANAREFRITARPGSDITGELSKLFKEACQCVDKSTVLIPKGEFKLGEIEMM  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPS--  424
             GPCKAPI   +   ++A     N++GK  W+  + I +F L+GGG  DG+GN     +  
Sbjct  71    GPCKAPIIFVLQGTVRAD---GNVNGKDFWVAFRRITNFRLNGGGIFDGEGNASWRANNC  127

Query  425   -KEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSP  601
              K    +  +LP ++  +++T+  +RD+T+L++K FH+NV+G KNLTF+   + AP  SP
Sbjct  128   HKTSLTQCKRLPISIRFDYITDGKVRDITSLDAKNFHINVIGAKNLTFEDIRIVAPEESP  187

Query  602   NTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGE  781
             NTDGIH+ R  GI + ++ I TGDDCIS+GDG++NL +  V+CGPGHGIS+GSLG    E
Sbjct  188   NTDGIHVGRSDGIKIINTNIKTGDDCISVGDGMKNLLVERVSCGPGHGISIGSLGLYGHE  247

Query  782   RPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPN  958
               V G+ V N     TDNGVRIKTWP++      + IHFENI + NV NPI+IDQEYCP 
Sbjct  248   EDVTGVKVVNCTLRNTDNGVRIKTWPSAACSTTASGIHFENIILHNVSNPILIDQEYCPW  307

Query  959   NECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAA  1132
             N C+K KPS +KL  I +K I G+S    AV+L CS G PC+ VEIGDI++T  G  G A
Sbjct  308   NRCNKNKPSSIKLVDIKFKNIKGSSGNKDAVKLLCSKGFPCKNVEIGDIDITYNGKDGPA  367

Query  1133  KSICKNVKPKLTGKVVP  1183
                C NV PKL GK  P
Sbjct  368   TFQCSNVSPKLVGKQCP  384



>emb|CDY22140.1| BnaC01g39610D [Brassica napus]
Length=397

 Score =   334 bits (857),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 176/380 (46%), Positives = 236/380 (62%), Gaps = 6/380 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
             F+L +L +   +         N D+  A+LKA+   C A   S V+IPKG F + +  + 
Sbjct  11    FVLCLLGYSANAEVFTAGGPPNSDITAAVLKAFTSACQAPAPSQVLIPKGDFKLGETVMT  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCK+PIE  +   +KA  +  +  GK  W+  + I+ F L+GGGT DG+GN     +  
Sbjct  71    GPCKSPIEFTLQGNVKA--DGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKANNC  128

Query  428   EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  607
              K F+  KLP ++  +F+ N+ I+D+T+L++K FH NV+ GKN+TFD+  + AP  SPNT
Sbjct  129   HKTFECKKLPISVRFDFVDNAEIKDITSLDAKNFHFNVISGKNMTFDNIKIIAPAESPNT  188

Query  608   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  787
             DGIH+ R  G+ + ++ I TGDDCIS+GDG++NL I  V CGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRCEGVKILNTKIATGDDCISVGDGMKNLLIEKVVCGPGHGISVGSLGRYGWEQD  248

Query  788   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNE  964
             V  I V N    GTDNG+RIKTWP++        IHFE+I +  V NPI+IDQEYCP N+
Sbjct  249   VTDINVKNCTLEGTDNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCPWNQ  308

Query  965   CSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKS  1138
             C+K KPS +KL  I+++ I GTS    AV+L CS G PCE VEIGDIN+   G  G    
Sbjct  309   CNKNKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGPDGPPTF  368

Query  1139  ICKNVKPKLTGKVVPPLACG  1198
              C NV PKL G   P    G
Sbjct  369   ECTNVTPKLVGTQNPKACVG  388



>gb|AAP42648.1| polygalacturonase [Brassica napus]
Length=397

 Score =   334 bits (857),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 176/380 (46%), Positives = 236/380 (62%), Gaps = 6/380 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
              +L +L +   +    V      D+  ALLKA+   C A   S V+IPKG F + ++ + 
Sbjct  11    LVLCLLGYSANAEVFTVGGPPGSDITAALLKAFTSACQAPAPSQVLIPKGDFKLGEIAMT  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCK+P+E  +   +KA  +  +  GK  W+  + I+ F L+GGGT DG+GN     +  
Sbjct  71    GPCKSPVEFTLQGNVKA--DGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKANNC  128

Query  428   EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  607
              K F+  KLP ++  +F+ N+ I+D+T+L++K FH NV+ GKN+TFD+  + AP  SPNT
Sbjct  129   HKTFECKKLPISVRFDFVDNAEIKDVTSLDAKNFHFNVISGKNMTFDNIKIIAPAESPNT  188

Query  608   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  787
             DGIH+ R  G+ + ++ I TGDDCIS+GDG++NL I  V CGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRCEGVKILNTKISTGDDCISVGDGMKNLLIEKVVCGPGHGISVGSLGRYGWEQD  248

Query  788   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNE  964
             V  I V N    GTDNG+RIKTWP++        IHFENI +  V NPI+IDQEYCP N+
Sbjct  249   VNDIKVINCTLEGTDNGLRIKTWPSAACTTTAAGIHFENIILNKVSNPILIDQEYCPWNQ  308

Query  965   CSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKS  1138
             C+K KPS +KL  I+++ I GTS    AV+L CS G PCE VEIGDIN+   G  G    
Sbjct  309   CNKSKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGPDGPPTF  368

Query  1139  ICKNVKPKLTGKVVPPLACG  1198
              C NV PKL G   P    G
Sbjct  369   ECTNVTPKLVGTQNPKACVG  388



>gb|AAM74219.1|AF518563_1 putative pollen polygalacturonase [Brassica oleracea]
Length=397

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 176/380 (46%), Positives = 236/380 (62%), Gaps = 6/380 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
              +L +L +   +    V      D+  ALLKA+   C A   S V+IPKG F + ++ + 
Sbjct  11    LVLCLLGYSANAEVFTVGGPPGSDITAALLKAFTSACQAPAPSQVLIPKGDFKLGEIAMT  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCK+P+E  +   +KA  +  +  GK  W+  + I+ F L+GGGT DG+GN     +  
Sbjct  71    GPCKSPVEFTLQGNVKA--DGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKANNC  128

Query  428   EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  607
              K F+  KLP ++  +F+ N+ I+D+T+L++K FH NV+ GKN+TFD+  + AP  SPNT
Sbjct  129   HKTFECKKLPISVRFDFVDNAEIKDVTSLDAKNFHFNVISGKNMTFDNIKIIAPAESPNT  188

Query  608   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  787
             DGIH+ R  G+ + ++ I TGDDCIS+GDG++NL I  V CGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRCEGVKILNTKISTGDDCISVGDGMKNLLIEKVVCGPGHGISVGSLGRYGWEQD  248

Query  788   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNE  964
             V  I V N    GTDNG+RIKTWP++        IHFENI +  V NPI+IDQEYCP N+
Sbjct  249   VNDIKVINCTLEGTDNGLRIKTWPSAACTTTAAGIHFENIILNKVSNPILIDQEYCPWNQ  308

Query  965   CSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKS  1138
             C+K KPS +KL  I+++ I GTS    AV+L CS G PCE VEIGDIN+   G  G    
Sbjct  309   CNKSKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGADGPPTF  368

Query  1139  ICKNVKPKLTGKVVPPLACG  1198
              C NV PKL G   P    G
Sbjct  369   ECTNVTPKLVGTQNPKACVG  388



>ref|XP_004162885.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=402

 Score =   333 bits (853),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 180/386 (47%), Positives = 240/386 (62%), Gaps = 30/386 (8%)
 Frame = +2

Query  47    TISYCAFTFILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTF  226
             TI   +   ++F L  +G          + VDV  AL  AW + CA+   S V+IPKG F
Sbjct  20    TIESRSHVDVIFHLRKYGNIV-------SGVDVTEALKDAWNDACASVPPSAVIIPKGIF  72

Query  227   PMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGN  406
              + + E  GPCK+PIE+++   L+A  +P+       W+T  Y+D   LSGG   DGQG 
Sbjct  73    KVREGEFKGPCKSPIEMRVRGTLQALNHPQG----DSWITFVYVDRMKLSGG-VFDGQG-  126

Query  407   VQVYPSKEKGFKGD--------KLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLT  562
                   KE   K D         LP +L  NF+TN ++R +T+L+SK  HVN+LG  NLT
Sbjct  127   ------KEGWXKNDCHKCINCANLPISLRFNFITNXIVRRITSLDSKNSHVNILGCNNLT  180

Query  563   FDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGH  742
             F    + AP +SPNTD IHI R I I++  S I  GDDCISLG+G + +K+T VTCGPGH
Sbjct  181   FQGVNIIAPEDSPNTDEIHIGRSIRISILKSRIAIGDDCISLGNGSKRVKVTDVTCGPGH  240

Query  743   GISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNV  919
             GIS+GSLG+   E PV+G+ V N   + T NGVRIKTW  S   G+   +HF +I M NV
Sbjct  241   GISIGSLGKYTNEEPVEGVVVKNCTIMNTTNGVRIKTWSASPVAGIAIIMHFSDITMINV  300

Query  920   KNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIG  1099
              NPI+IDQEYCP N+C++Q PS +K++K+S+K I G SAT VAV+L CSS +PCEEV++ 
Sbjct  301   SNPILIDQEYCPWNQCNRQIPSKIKINKVSFKNIRGCSATSVAVKLICSSNLPCEEVKVA  360

Query  1100  DINLTIKG--GAAKSICKNVKPKLTG  1171
             +I+L   G  G+  S C NVKP L+G
Sbjct  361   NIDLVYNGTKGSITSQCMNVKPILSG  386



>ref|XP_009124086.1| PREDICTED: polygalacturonase [Brassica rapa]
 ref|XP_009124094.1| PREDICTED: polygalacturonase [Brassica rapa]
Length=397

 Score =   332 bits (851),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 175/380 (46%), Positives = 235/380 (62%), Gaps = 6/380 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
              +L +L +   +         N D+  A+LKA+   C A   S V+IPKG F + +  + 
Sbjct  11    LVLCLLGYSANAEVFTAGGPPNSDITAAVLKAFTSACQAPAPSQVLIPKGDFKLGETVMT  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCK+PIE  +   +KA  +  +  GK  W+  + I+ F L+GGGT DG+GN     +  
Sbjct  71    GPCKSPIEFTLQGNVKA--DGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKANNC  128

Query  428   EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  607
              K F+  KLP ++  +F+ N+ I+D+T+L++K FH NV+ GKN+TFD+  + AP  SPNT
Sbjct  129   HKTFECKKLPISVRFDFVDNAEIKDITSLDAKNFHFNVISGKNMTFDNIKIIAPAESPNT  188

Query  608   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  787
             DGIH+ R  G+ + ++ I TGDDCIS+GDG++NL I  V CGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRCEGVKILNTKIATGDDCISVGDGMKNLLIEKVVCGPGHGISVGSLGRYGWEQD  248

Query  788   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNE  964
             V  I V N    GTDNG+RIKTWP++        IHFE+I +  V NPI+IDQEYCP N+
Sbjct  249   VTDINVKNCTLEGTDNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCPWNQ  308

Query  965   CSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKS  1138
             C+K KPS +KL  I+++ I GTS    AV+L CS G PCE VEIGDIN+   G  G    
Sbjct  309   CNKNKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIDYTGPDGPPTF  368

Query  1139  ICKNVKPKLTGKVVPPLACG  1198
              C NV PKL G   P    G
Sbjct  369   ECTNVTPKLVGTQNPKACVG  388



>ref|XP_010557773.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Tarenaya 
hassleriana]
Length=406

 Score =   332 bits (850),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/347 (49%), Positives = 230/347 (66%), Gaps = 5/347 (1%)
 Frame = +2

Query  167   WKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLT  346
             WK+ C AT  ST+ + KG + +T+++  GPCK P+ ++++  LKAP      +    W+ 
Sbjct  53    WKQACGATGKSTITVGKGEYLVTRIDFNGPCKGPVTVELLGNLKAPAEVTKTEAHGGWVN  112

Query  347   IKYIDHFTLSGGGT-LDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNS  520
                +  FTL+G G+ LDGQG +    +   K  K + LP N+    LTNS IR +T+ NS
Sbjct  113   FGNLVDFTLNGHGSILDGQGALAWKKNDCAKTGKCNNLPINVRFTGLTNSRIRSITSSNS  172

Query  521   KLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGL  700
             KLFH+N+L  KN+T +   + AP  S NTDGIHI R  G+ +  + + TGDDC+S+GDG 
Sbjct  173   KLFHMNILNCKNITLEDIGIDAPPESLNTDGIHIGRSNGVNLLGAHVRTGDDCVSIGDGS  232

Query  701   ENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVV  880
             ENL I  V CGPGHGI++GSLGR P E+PV+G+ V +     T NGVRIKTWP S  G+ 
Sbjct  233   ENLVIENVRCGPGHGIAIGSLGRYPNEQPVRGVHVRHCTISNTMNGVRIKTWPASPAGIA  292

Query  881   TDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLA  1060
             +++HFE+I M+NV  PI++DQEYCP N C +  PS+VK+S +S+K I GTS+T  AV+L 
Sbjct  293   SNLHFEDIVMENVGTPILVDQEYCPYNHCKRGSPSMVKISDVSFKNIRGTSSTKTAVKLV  352

Query  1061  CSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPPLAC  1195
             CS GVPC +VE+ DINLT  G  G A S C NVKP L+GK++P  AC
Sbjct  353   CSKGVPCSKVELSDINLTYNGKDGPAVSECANVKPILSGKIIPA-AC  398



>ref|XP_010675940.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   332 bits (850),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/372 (46%), Positives = 230/372 (62%), Gaps = 24/372 (6%)
 Frame = +2

Query  125   AKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAP  304
             AK + DV  A L +W   CA+   S V++P G + +  + L GPC+ P  ++I+   KAP
Sbjct  43    AKPDADVTQAFLDSWTAACASKKPSKVLVPAGNYILGAITLKGPCQTPTVIEILGNFKAP  102

Query  305   PNPKNMDGKKEWLTIKYIDHFTL---SGGGTLDGQGNVQVYPSKEKGFKGDK--------  451
              +      +  W  ++ +D   +    GGG  DGQG        + G+K ++        
Sbjct  103   SDVAAFKKEDSWFKVENVDSLIIISGKGGGVFDGQG--------QAGWKKNECTKNANCA  154

Query  452   --LPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIA  625
               LP N+  NF++NS +  LT+LNSK FHV +LG K L     T+ AP +SPNTDGIHI 
Sbjct  155   FDLPYNIRFNFVSNSKVSGLTSLNSKSFHVVLLGCKQLELSDMTITAPADSPNTDGIHIG  214

Query  626   RIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFV  805
             R   I V+   IGTGDDC+S GDG +N+ I GVTCGPGHG+SVGSLG+ P E PV  I +
Sbjct  215   RSENIIVRGWTIGTGDDCVSFGDGAKNVLIEGVTCGPGHGLSVGSLGKYPNEEPVSNITI  274

Query  806   SNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPS  985
              N     TDNGVR+KTW NS+   VT ++FE+I ++NV+NP+++DQEYCP N C  + PS
Sbjct  275   RNCTIKNTDNGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPWNHCKAKTPS  334

Query  986   LVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKP  1159
              VK+S I +K + G S+T  AV+L CS GVPC++VE+ DI++   G  G A S+CK VKP
Sbjct  335   KVKISDIRFKNVKGKSSTKEAVKLICSEGVPCDKVELADIDIQYTGPDGPAVSMCKFVKP  394

Query  1160  KLTGKVVPPLAC  1195
              LTGK  PP AC
Sbjct  395   LLTGKQSPP-AC  405



>ref|XP_006407789.1| hypothetical protein EUTSA_v10020501mg [Eutrema salsugineum]
 gb|ESQ49242.1| hypothetical protein EUTSA_v10020501mg [Eutrema salsugineum]
Length=526

 Score =   335 bits (858),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 185/383 (48%), Positives = 246/383 (64%), Gaps = 17/383 (4%)
 Frame = +2

Query  86    LAHFGESATINV---AAKAN--VDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
             L   G  A+I+V    AKA+   D   A   AWKE CA+ + ST+++PKG + +  +E  
Sbjct  140   LGFKGSGASIDVKASGAKADGKTDDSGAFAAAWKEACASASPSTILVPKGEYLVNNIEFK  199

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKE---WLTIKYIDHFTLSGGGTL-DGQGNV--Q  412
             GPCK PI  ++   LKAPPN   + G K    WL  + +  FT++G G + DGQG +  +
Sbjct  200   GPCKGPITFEVNGNLKAPPN--WLGGGKPHCGWLEFEKLTDFTINGNGAIFDGQGAIAWK  257

Query  413   VYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPG  592
             V    + G K + LP N+    LTNS I  +T+ NSKLFH+N++  KN+TF +  + AP 
Sbjct  258   VNDCAKTG-KCNTLPINIRFTGLTNSKIIGITSTNSKLFHMNIIDCKNVTFQNIGIDAPP  316

Query  593   NSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRT  772
              S NTDGIHI R  G+ +++S I TGDDCIS+GDG ENL +  V CGPGHGI++GSLG+ 
Sbjct  317   ESLNTDGIHIGRSNGVILRESKIRTGDDCISIGDGTENLLVENVECGPGHGIAIGSLGKY  376

Query  773   PGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYC  952
             P E+PV+G+ +  +    TDNGVRIKTWP S PG+ ++I F++I M NV  PI++DQ YC
Sbjct  377   PNEQPVRGVTIRKTLIKNTDNGVRIKTWPGSPPGIASNILFDDITMDNVSTPILVDQVYC  436

Query  953   PNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--G  1126
             P+  C  Q PS VKLS +S+K I GTSA+ VAV+L CS GVPC      DINL   G  G
Sbjct  437   PHGTCKSQAPSKVKLSDVSFKNIRGTSASKVAVKLLCSPGVPCTNFAFADINLVHNGKEG  496

Query  1127  AAKSICKNVKPKLTGKVVPPLAC  1195
              A S C NVKP ++GK+VPP AC
Sbjct  497   PAVSACSNVKPVVSGKMVPP-AC  518



>emb|CAN65674.1| hypothetical protein VITISV_002009 [Vitis vinifera]
Length=1260

 Score =   350 bits (898),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 226/346 (65%), Gaps = 2/346 (1%)
 Frame = +2

Query  152   ALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGK  331
             ALL AW+  CA+   S VVIP G + + QV + GPCKAPI L +   ++AP +      +
Sbjct  908   ALLTAWEAACASPIVSRVVIPAGIYALGQVTIEGPCKAPINLIVKGTVRAPVDTSRFKPQ  967

Query  332   KEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTT  511
               W+  +++D FTLSG G  DGQG         +     +LP NL  NFLTNS+I+D+T+
Sbjct  968   AGWVAFQHLDQFTLSGYGVFDGQGQSVWGQKCSRTKYCHQLPINLRFNFLTNSIIKDITS  1027

Query  512   LNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLG  691
              +SK FH+NVLG +N+TF    + AP +S NTDGIHI R  G+ +  S I TGDDC+S+G
Sbjct  1028  KDSKQFHINVLGCRNITFFQVAITAPEDSQNTDGIHIGRSRGVNITHSTIQTGDDCVSIG  1087

Query  692   DGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHP  871
             DG E + IT V CGPGHGISVGSLG    E PV GI V N     T NGVR+KT+P+S  
Sbjct  1088  DGSEQIDITKVNCGPGHGISVGSLGLYKNEAPVIGIRVKNCTLSDTTNGVRVKTYPSSPQ  1147

Query  872   GVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAV  1051
             G  T++HF +I M NV NPI+IDQEYCP+N+C+ Q PS VKLS IS+K I GT++T +AV
Sbjct  1148  GTATEMHFHDIVMNNVSNPIIIDQEYCPHNQCNLQVPSRVKLSNISFKNIRGTTSTELAV  1207

Query  1052  QLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVP  1183
              L CS G PC++VE+G+I+L   G  G A S CKNV+  L G   P
Sbjct  1208  NLVCSKGAPCQKVELGNIDLKYTGPEGTASSQCKNVEATLWGTQQP  1253


 Score =   208 bits (529),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 123/337 (36%), Positives = 176/337 (52%), Gaps = 58/337 (17%)
 Frame = +2

Query  143   VGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNM  322
             V  A + AWK  C  T  STVV+  GT+ +  V+  GPC+AP+  ++   LKAP +    
Sbjct  665   VSRAFMSAWKVACTCTDPSTVVVXGGTYVVGPVQFQGPCRAPMGFRVQGTLKAPTDLNRF  724

Query  323   DGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRD  502
             + +  W+  + ID   +SGGGT +GQG+                       +  N+  R 
Sbjct  725   ELQDGWVIFQDIDXLIISGGGTFBGQGHTA---------------------WGQNNCAR-  762

Query  503   LTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCI  682
                           G  NL   + T+ A G+S NTDGIH+ R  G+ + D++I TGDD +
Sbjct  763   -------------TGTCNLLLVYVTINATGDSLNTDGIHMGRSTGVNISDAIIKTGDDSL  809

Query  683   SLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPN  862
             S+GDG +++ +  VTCGPGHGISVGSLG+   E PV G+ V N   I T NG+R+KTWP+
Sbjct  810   SIGDGSQHINVEKVTCGPGHGISVGSLGKYHNEEPVVGVTVKNCTLINTMNGIRVKTWPD  869

Query  863   SHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATP  1042
             S   V TD+HFE+I M NV NPI+I+QEYCP ++C          +K          A+P
Sbjct  870   SPASVATDLHFEDIIMNNVGNPILINQEYCPYDQCQ---------AKALLTAWEAACASP  920

Query  1043  VAVQLACSSGV----------PCEEVEIGDINLTIKG  1123
             +  ++   +G+          PC+      INL +KG
Sbjct  921   IVSRVVIPAGIYALGQVTIEGPCK----APINLIVKG  953



>ref|XP_010099972.1| hypothetical protein L484_014009 [Morus notabilis]
 gb|EXB81077.1| hypothetical protein L484_014009 [Morus notabilis]
Length=403

 Score =   329 bits (843),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 171/392 (44%), Positives = 235/392 (60%), Gaps = 11/392 (3%)
 Frame = +2

Query  44    ATISYCAFTFILFMLAHFGESATINV--------AAKANVDVGPALLKAWKEGCAATTAS  199
             +++++C   + L +     +S   NV         A    D   A+  AW   C +    
Sbjct  3     SSLAHCVCLWFLLVSITNAKSHVRNVFNVMSYGAVADGKTDNSKAIFDAWTHACQSVGGG  62

Query  200   TVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSG  379
              V+IPKGT+ +  V L G CK  +   +   LKAP + K+ D    W+T +Y+D+F +SG
Sbjct  63    MVLIPKGTYLVNPVVLKGTCKGQMVFFLQGDLKAPTDQKSWDDIDHWITFQYVDNFVMSG  122

Query  380   GGTLDGQG-NVQVYPSKEKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKN  556
             GG+LDGQG +   Y +  K     KLP +L L+F+ N+ I  +  +NSK FH+N+    N
Sbjct  123   GGSLDGQGASAWPYNTCNKDSHCKKLPVSLRLDFVNNAWISYIKLINSKNFHMNIFACNN  182

Query  557   LTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGP  736
             +  +H  + APG+SPNTDGIHIA   GI V DS+I TGDDC+S G G++++ I  V CGP
Sbjct  183   IKLEHMHIMAPGDSPNTDGIHIALSTGIKVWDSIISTGDDCLSFGPGMKDVDIWKVQCGP  242

Query  737   GHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKTWPNSHPGVVTDIHFENIDMQN  916
             GHGIS+GSLG +P E+ V+G  V NS+FIGT NGVRIKTW   H   V +I F  I MQN
Sbjct  243   GHGISIGSLGSSPNEKDVQGFIVRNSRFIGTQNGVRIKTWALPHASNVYNITFRRIIMQN  302

Query  917   VKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEI  1096
             V NPIVIDQEYCP+ +C+ Q  S +++  + +  I GTS++ VAV L CS G PC+++ +
Sbjct  303   VANPIVIDQEYCPSGKCNPQGSSQIQIRDVKFMNIWGTSSSKVAVNLDCSKGKPCQQIVL  362

Query  1097  GDINLTIKG--GAAKSICKNVKPKLTGKVVPP  1186
              DI L  KG  G A S C NV     GK+ PP
Sbjct  363   KDIYLAYKGKDGPAISQCSNVNGVSYGKLQPP  394



>sp|P35337.1|PGLR_BRANA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Brassica napus]
 gb|AAA70402.1| polygalacturonase [Brassica napus]
Length=397

 Score =   328 bits (842),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 173/380 (46%), Positives = 233/380 (61%), Gaps = 6/380 (2%)
 Frame = +2

Query  71    FILFMLAHFGESATINVAAKANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELA  250
              +L +L +   +         N D+  A+LKA+   C A   S V+IPKG F + +  + 
Sbjct  11    LVLCLLGYSANAEVFTAGGPPNSDITAAVLKAFTSACQAPAPSQVLIPKGDFKLGETVMT  70

Query  251   GPCKAPIELKIMAILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSK-  427
             GPCK+PIE  +   +K   +  +  GK  W+  + I+ F L+GGGT DG+GN     +  
Sbjct  71    GPCKSPIEFTLQGNVKT--DGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKANNC  128

Query  428   EKGFKGDKLPNNLSLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNT  607
              K F+  KLP ++  +F+ N+ I+D+T+L++K FH NV+ GKN+TFD+  + AP  SPNT
Sbjct  129   HKTFECKKLPISVRFDFVDNAEIKDVTSLDAKNFHFNVISGKNMTFDNIKIIAPAESPNT  188

Query  608   DGIHIARIIGITVKDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERP  787
             DGIH+ R  G+ + ++ I TGDDCIS+GDG++NL I  V CGPGHGISVGSLGR   E+ 
Sbjct  189   DGIHLGRCEGVKILNTKIATGDDCISVGDGMKNLLIEKVVCGPGHGISVGSLGRYGWEQD  248

Query  788   VKGIFVSNSKFIGTDNGVRIKTWPNSH-PGVVTDIHFENIDMQNVKNPIVIDQEYCPNNE  964
             V  I V N    GT NG+RIKTWP++        IHFE+I +  V NPI+IDQEYCP N+
Sbjct  249   VTDITVKNCTLEGTSNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCPWNQ  308

Query  965   CSKQKPSLVKLSKISYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKS  1138
             C+K KPS +KL  I+++ I GTS    AV+L CS G PCE VEIGDIN+   G  G    
Sbjct  309   CNKNKPSTIKLVDITFRNIRGTSENKDAVKLLCSKGHPCENVEIGDINIEYTGPDGPPTF  368

Query  1139  ICKNVKPKLTGKVVPPLACG  1198
              C NV PKL G   P    G
Sbjct  369   ECTNVTPKLVGAQNPKACVG  388



>ref|XP_010668126.1| PREDICTED: exopolygalacturonase clone GBGA483-like, partial [Beta 
vulgaris subsp. vulgaris]
Length=366

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/363 (46%), Positives = 225/363 (62%), Gaps = 24/363 (7%)
 Frame = +2

Query  152   ALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKNMDGK  331
             A L +W   CA+   S V++P G + +  + L GPC+ P  ++I+   KAP +      +
Sbjct  3     AFLDSWTAACASKKPSKVLVPAGNYILGAITLKGPCQTPTVIEILGNFKAPSDVAAFKKE  62

Query  332   KEWLTIKYIDHFTL---SGGGTLDGQGNVQVYPSKEKGFKGDK----------LPNNLSL  472
               W  ++ +D   +    GGG  DGQG        + G+K ++          LP N+  
Sbjct  63    DSWFKVENVDSLIIISGKGGGVFDGQG--------QAGWKKNECTKNANCAFDLPYNIRF  114

Query  473   NFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKD  652
             NF++NS +  LT+LNSK FHV +LG K L     T+ AP +SPNTDGIHI R   I V+ 
Sbjct  115   NFVSNSKVSGLTSLNSKSFHVVLLGCKQLELSDMTITAPADSPNTDGIHIGRSENIIVRG  174

Query  653   SVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTD  832
               IGTGDDC+S GDG +N+ I GVTCGPGHG+SVGSLG+ P E PV  I + N     TD
Sbjct  175   WTIGTGDDCVSFGDGAKNVLIEGVTCGPGHGLSVGSLGKYPNEEPVSNITIRNCTIKNTD  234

Query  833   NGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISY  1012
             NGVR+KTW NS+   VT ++FE+I ++NV+NP+++DQEYCP N C  + PS VK+S I +
Sbjct  235   NGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPWNHCKAKTPSKVKISDIRF  294

Query  1013  KKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPP  1186
             K + G S+T  AV+L CS GVPC++VE+ DI++   G  G A S+CK VKP LTGK  PP
Sbjct  295   KNVKGKSSTKEAVKLICSEGVPCDKVELADIDIQYTGPDGPAVSMCKFVKPLLTGKQSPP  354

Query  1187  LAC  1195
              AC
Sbjct  355   -AC  356



>ref|XP_002884670.1| exopolygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60929.1| exopolygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 173/352 (49%), Positives = 222/352 (63%), Gaps = 6/352 (2%)
 Frame = +2

Query  140   DVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPPNPKN  319
             D   A + AWKE CAA   ST+ +PKG + +  +E  GPCK P+ L++   LKAP   K 
Sbjct  89    DDSAAFMAAWKEACAA--GSTITVPKGEYLVESLEFKGPCKGPVTLELNGNLKAPATVKT  146

Query  320   MDGKKEWLTIKYIDHFTLSGG-GTLDGQGNVQVYPSK-EKGFKGDKLPNNLSLNFLTNSV  493
                   W+  + +  FTL+G     DGQG++    +   K  K + LP N+    LTNS 
Sbjct  147   TKPHAGWIDFENLADFTLNGNKAIFDGQGSLAWKANDCAKTGKCNSLPINIRFTGLTNSK  206

Query  494   IRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGTGD  673
             I+ +T+ NSKLFH+N+L  KN+T +   + AP  S NTDGIHI R  G+ +  + I TGD
Sbjct  207   IKSITSTNSKLFHMNILNCKNITLEDIGIDAPPESLNTDGIHIGRSNGVNLIGAKIKTGD  266

Query  674   DCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRIKT  853
             DC+S+GDG ENL +  V CGPGHGIS+GSLGR P E+PVKG+ V       TDNGVRIKT
Sbjct  267   DCVSIGDGTENLIVENVECGPGHGISIGSLGRYPNEQPVKGVTVRKCLIKNTDNGVRIKT  326

Query  854   WPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKISYKKISGTS  1033
             WP S PG+ ++I FE+I M NV  P++IDQEYCP   C    PS VKLS ++ K I GTS
Sbjct  327   WPGSPPGIASNILFEDITMDNVSTPVLIDQEYCPYGHCKAGVPSKVKLSDVTIKNIKGTS  386

Query  1034  ATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVP  1183
             AT VAV+L CS GVPC  + + DINL   G  G A S C N+KP L+GK+VP
Sbjct  387   ATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKPILSGKLVP  438



>ref|XP_004296118.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=444

 Score =   327 bits (837),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 168/364 (46%), Positives = 234/364 (64%), Gaps = 22/364 (6%)
 Frame = +2

Query  128   KANVDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIMAILKAPP  307
             K   D+   L  AW++ C++ +AS VV+P GT+ + +    GPCKAPIE+ I   L+AP 
Sbjct  38    KPGYDIAEGLANAWRDACSSESASKVVVPSGTYKLKEAIFEGPCKAPIEVHIQGTLQAPK  97

Query  308   NPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNLSLNFLTN  487
             +P +      W+T   I+  TLSGGGT DGQG    + SK   F+      ++  + +TN
Sbjct  98    DPSS----DVWVTFSLINMLTLSGGGTFDGQG---AHGSKRSDFR------DIKFSSITN  144

Query  488   SVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITVKDSVIGT  667
             S+++++T+LNSK FH++V    N+ FDH T+ +P +  NTDGI I    GI V  + I T
Sbjct  145   SIVKNITSLNSKKFHISVTECTNVVFDHLTITSPTDDANTDGIDIGSSKGINVTHTNIAT  204

Query  668   GDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIGTDNGVRI  847
             GDDCI++ +G   L +TGVTCGPGHGIS+GSLG+ P E+PV G+ V N   +GT NG RI
Sbjct  205   GDDCIAVSEGTNQLLVTGVTCGPGHGISIGSLGQKPDEQPVVGVTVMNCTLVGTTNGARI  264

Query  848   KTWPNSHPGVVT--DIHFENIDMQNVKNPIVIDQEYCP---NNECSKQKPSLVKLSKISY  1012
             KTWP+S PG  T  DI FE+I M NV+NPI+IDQ YC    ++ C +  PS V++  + +
Sbjct  265   KTWPDS-PGASTASDIVFEDIVMVNVENPIIIDQNYCSGEDDDRCKQNIPSTVQIRNVRF  323

Query  1013  KKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG--GAAKSICKNVKPKLTGKVVPP  1186
             K I G+SATP+AV LACS  VPC+ VE+ D++LT  G  G+  S C NV+P++T +V   
Sbjct  324   KNIRGSSATPIAVNLACSPSVPCQNVELEDVDLTYSGDEGSLSSQCINVRPRIT-RVTEA  382

Query  1187  LACG  1198
             LAC 
Sbjct  383   LACA  386



>ref|XP_010689005.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=413

 Score =   324 bits (831),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/369 (43%), Positives = 230/369 (62%), Gaps = 11/369 (3%)
 Frame = +2

Query  113   INVAAKAN--VDVGPALLKAWKEGCAATTASTVVIPKGTFPMTQVELAGPCKAPIELKIM  286
             +N  AK +   D G  +L+AWK+ C +  ASTVVIP G + +  V+  GPCKA + +++ 
Sbjct  40    VNYGAKCDGKTDDGKPILEAWKQACNSNIASTVVIPPGNYILGPVDFQGPCKAAVTVRVE  99

Query  287   AILKAPPNPKNMDGKKEWLTIKYIDHFTLSGGGTLDGQGNVQVYPSKEKGFKGDKLPNNL  466
               L+AP        +  W+  + I   T+ GGGT DGQG +    +         +P N+
Sbjct  100   GYLRAPSMLDVFKLRDGWIVFRDISGLTIEGGGTFDGQGMIAWKENNCAKSGSCSMPTNI  159

Query  467   SLNFLTNSVIRDLTTLNSKLFHVNVLGGKNLTFDHFTVKAPGNSPNTDGIHIARIIGITV  646
                 +TN  + ++T+L+SK+FH+N++    +TF   T+ AP +SPNTDGIHI R   I +
Sbjct  160   RFTGITNGEVNNITSLDSKMFHMNIIKCNYMTFKGITIDAPVSSPNTDGIHIGRSSMINI  219

Query  647   KDSVIGTGDDCISLGDGLENLKITGVTCGPGHGISVGSLGRTPGERPVKGIFVSNSKFIG  826
               + I TGDDC+SLGDG +++ I  +TCGPGHGISVGSLG+ PGE+PV G+ V N   + 
Sbjct  220   TGATIRTGDDCVSLGDGSQHISINNITCGPGHGISVGSLGKYPGEQPVVGVIVRNCTLVN  279

Query  827   TDNGVRIKTWPNSHPGVVTDIHFENIDMQNVKNPIVIDQEYCPNNECSKQKPSLVKLSKI  1006
             T NG+R+KTWPNS  G+ + +HF++I + NV NP++IDQ+YCP++ C  Q PS VK+S +
Sbjct  280   TMNGLRVKTWPNSFNGIASGLHFQDIIIDNVSNPVLIDQDYCPDDLCKLQVPSKVKVSDV  339

Query  1007  SYKKISGTSATPVAVQLACSSGVPCEEVEIGDINLTIKG---------GAAKSICKNVKP  1159
              +K I GTSAT +A+QL CS  +PCE V + DI+L   G           A S C NV+P
Sbjct  340   LFKNIKGTSATKMAIQLKCSKIMPCENVTLDDIDLCYLGNKGNNRNTTSTATSECFNVRP  399

Query  1160  KLTGKVVPP  1186
              + GK+ PP
Sbjct  400   AIMGKLSPP  408



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3685527018540