BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24970_g1_i1 len=1482 path=[1:0-491 493:492-676 678:677-703
3464:704-913 9125:914-948 3707:949-997 2088:998-1026 9183:1027-1033
3791:1034-1138 9255:1139-1162 3919:1163-1289 8004:1290-1290
4046:1291-1481]

Length=1482
                                                                      Score     E

ref|XP_009612480.1|  PREDICTED: polygalacturonase-like                  456   1e-153   
ref|XP_009764608.1|  PREDICTED: polygalacturonase-like                  453   1e-152   
ref|XP_009804151.1|  PREDICTED: polygalacturonase-like                  448   1e-150   
ref|XP_009601010.1|  PREDICTED: polygalacturonase-like                  444   4e-149   
ref|XP_006366630.1|  PREDICTED: polygalacturonase-like                  429   2e-143   
ref|XP_009599317.1|  PREDICTED: polygalacturonase                       426   3e-142   
ref|XP_004253347.1|  PREDICTED: polygalacturonase-like                  426   5e-142   
ref|XP_004243884.1|  PREDICTED: polygalacturonase-like                  425   1e-141   
dbj|BAO02513.1|  predicted polygalacturonase ortholog                   424   4e-141   
sp|Q05967.1|PGLR_TOBAC  RecName: Full=Polygalacturonase; Short=PG...    422   2e-140   Nicotiana tabacum [American tobacco]
pir||S46530  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...    419   2e-139
pir||S46529  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...    416   2e-138
emb|CDP04348.1|  unnamed protein product                                413   6e-137   
emb|CAA50335.1|  polygalacturonase                                      412   1e-136   Nicotiana tabacum [American tobacco]
ref|XP_009780910.1|  PREDICTED: polygalacturonase                       411   4e-136   
emb|CDP18013.1|  unnamed protein product                                403   4e-133   
emb|CDP04343.1|  unnamed protein product                                400   7e-132   
ref|XP_002282594.1|  PREDICTED: exopolygalacturonase                    397   1e-130   Vitis vinifera
ref|XP_007009871.1|  Pectin lyase-like superfamily protein, putative    395   7e-130   
ref|XP_006447720.1|  hypothetical protein CICLE_v10015423mg             394   2e-129   
ref|XP_002282573.1|  PREDICTED: exopolygalacturonase                    393   3e-129   Vitis vinifera
gb|KHN24677.1|  Polygalacturonase                                       393   3e-129   
ref|XP_003552049.1|  PREDICTED: polygalacturonase                       392   5e-129   
ref|XP_006469749.1|  PREDICTED: polygalacturonase-like                  393   5e-129   
ref|XP_003522976.1|  PREDICTED: polygalacturonase-like                  392   5e-129   
ref|XP_003522977.1|  PREDICTED: polygalacturonase-like                  392   7e-129   
emb|CBI22050.3|  unnamed protein product                                389   2e-127   
gb|KHN15656.1|  Polygalacturonase                                       386   5e-127   
ref|XP_003522975.1|  PREDICTED: polygalacturonase-like                  387   7e-127   
ref|XP_010999485.1|  PREDICTED: exopolygalacturonase-like               387   1e-126   
ref|XP_002274096.1|  PREDICTED: exopolygalacturonase                    386   1e-126   Vitis vinifera
ref|XP_006371366.1|  hypothetical protein POPTR_0019s09500g             385   3e-126   
ref|XP_010040513.1|  PREDICTED: exopolygalacturonase-like               385   3e-126   
ref|XP_010999488.1|  PREDICTED: exopolygalacturonase-like               385   3e-126   
dbj|BAA89477.1|  polygalacturonase                                      385   5e-126   Salix gilgiana
ref|XP_010999532.1|  PREDICTED: exopolygalacturonase-like               384   5e-126   
ref|XP_010536243.1|  PREDICTED: exopolygalacturonase-like               385   6e-126   
ref|XP_007009872.1|  Pectin lyase-like superfamily protein, putative    385   6e-126   
ref|XP_010038565.1|  PREDICTED: exopolygalacturonase-like               384   7e-126   
ref|XP_010536244.1|  PREDICTED: exopolygalacturonase-like               385   8e-126   
gb|KHN10402.1|  Polygalacturonase                                       382   1e-125   
ref|XP_010042444.1|  PREDICTED: exopolygalacturonase-like               384   1e-125   
ref|XP_010042729.1|  PREDICTED: exopolygalacturonase-like               382   4e-125   
ref|XP_006387858.1|  hypothetical protein POPTR_0519s00220g             382   4e-125   
ref|XP_010999486.1|  PREDICTED: exopolygalacturonase-like               382   5e-125   
ref|XP_002274125.1|  PREDICTED: exopolygalacturonase                    382   5e-125   Vitis vinifera
ref|XP_004488391.1|  PREDICTED: polygalacturonase-like                  382   6e-125   
ref|XP_010067907.1|  PREDICTED: exopolygalacturonase-like               382   6e-125   
ref|XP_010067918.1|  PREDICTED: exopolygalacturonase-like               382   7e-125   
ref|XP_010042694.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    381   1e-124   
ref|XP_010040848.1|  PREDICTED: exopolygalacturonase-like               381   2e-124   
emb|CDP04350.1|  unnamed protein product                                381   2e-124   
ref|XP_006371367.1|  hypothetical protein POPTR_0019s09510g             380   3e-124   
dbj|BAA89476.1|  polygalacturonase                                      380   4e-124   Salix gilgiana
ref|XP_010999487.1|  PREDICTED: exopolygalacturonase-like               379   6e-124   
dbj|BAA89478.1|  polygalacturonase                                      379   7e-124   Salix gilgiana
emb|CBI28390.3|  unnamed protein product                                381   1e-123   
ref|XP_003527123.1|  PREDICTED: polygalacturonase-like                  379   1e-123   
ref|XP_010112807.1|  hypothetical protein L484_020039                   378   2e-123   
ref|XP_003544118.1|  PREDICTED: polygalacturonase-like isoform X1       378   2e-123   
gb|KCW88710.1|  hypothetical protein EUGRSUZ_A01065                     380   2e-123   
emb|CBI22052.3|  unnamed protein product                                398   3e-123   
gb|KHN46909.1|  Polygalacturonase                                       378   3e-123   
ref|XP_011097041.1|  PREDICTED: polygalacturonase-like                  378   3e-123   
ref|XP_010038564.1|  PREDICTED: exopolygalacturonase-like               380   3e-123   
ref|XP_002325639.2|  hypothetical protein POPTR_0019s09470g             379   4e-123   Populus trichocarpa [western balsam poplar]
ref|XP_011069588.1|  PREDICTED: polygalacturonase-like                  377   1e-122   
ref|XP_011097079.1|  PREDICTED: polygalacturonase-like                  376   1e-122   
ref|XP_010093135.1|  hypothetical protein L484_009327                   375   3e-122   
ref|XP_007049261.1|  Pectin lyase-like superfamily protein, putative    378   1e-121   
ref|XP_007049259.1|  Polygalacturonase                                  374   1e-121   
ref|XP_010532220.1|  PREDICTED: exopolygalacturonase-like               375   1e-121   
ref|XP_010112808.1|  hypothetical protein L484_020040                   373   2e-121   
dbj|BAA89479.1|  polygalacturonase                                      372   5e-121   Salix gilgiana
ref|XP_008342227.1|  PREDICTED: exopolygalacturonase clone GBGA48...    372   6e-121   
ref|XP_006595658.1|  PREDICTED: polygalacturonase-like isoform X2       370   2e-120   
ref|XP_008245681.1|  PREDICTED: exopolygalacturonase clone GBGA48...    370   4e-120   
ref|XP_008455553.1|  PREDICTED: exopolygalacturonase-like               369   7e-120   
ref|XP_011097055.1|  PREDICTED: polygalacturonase-like                  369   1e-119   
ref|XP_007152047.1|  hypothetical protein PHAVU_004G097300g             368   1e-119   
sp|Q6H9K0.1|PGLR2_PLAAC  RecName: Full=Exopolygalacturonase; AltN...    366   4e-119   Platanus x hispanica [London plane tree]
sp|Q40312.1|PGLR_MEDSA  RecName: Full=Polygalacturonase; Short=PG...    368   5e-119   Medicago sativa [alfalfa]
gb|EYU42739.1|  hypothetical protein MIMGU_mgv1a007536mg                367   5e-119   
gb|KCW46858.1|  hypothetical protein EUGRSUZ_K00662                     367   7e-119   
ref|XP_004173029.1|  PREDICTED: polygalacturonase-like                  367   9e-119   
gb|EYU42735.1|  hypothetical protein MIMGU_mgv1a007533mg                366   2e-118   
ref|XP_010112811.1|  hypothetical protein L484_020043                   365   2e-118   
ref|XP_003633345.1|  PREDICTED: exopolygalacturonase                    365   2e-118   
gb|EYU42734.1|  hypothetical protein MIMGU_mgv1a007528mg                365   3e-118   
gb|ADP09681.1|  polygalacturonase                                       366   3e-118   
ref|XP_010657416.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    365   3e-118   
gb|ABY21306.1|  pollen allergen Pla o 2                                 364   3e-118   Platanus orientalis
ref|XP_011099769.1|  PREDICTED: polygalacturonase-like                  364   6e-118   
ref|XP_008467043.1|  PREDICTED: exopolygalacturonase-like               363   7e-118   
gb|EYU42736.1|  hypothetical protein MIMGU_mgv1a007545mg                364   1e-117   
gb|EYU42733.1|  hypothetical protein MIMGU_mgv1a007538mg                364   1e-117   
gb|ADC53480.1|  polygalacturonase                                       364   1e-117   Gossypium hirsutum [American cotton]
ref|XP_008379967.1|  PREDICTED: exopolygalacturonase-like               363   3e-117   
emb|CAN65676.1|  hypothetical protein VITISV_002011                     368   5e-117   Vitis vinifera
ref|XP_004162875.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    362   5e-117   
ref|XP_010038561.1|  PREDICTED: exopolygalacturonase-like               365   7e-117   
ref|XP_008441641.1|  PREDICTED: exopolygalacturonase-like               362   7e-117   
ref|XP_009365185.1|  PREDICTED: exopolygalacturonase-like               362   7e-117   
ref|XP_004153076.1|  PREDICTED: polygalacturonase-like                  362   7e-117   
ref|XP_004167279.1|  PREDICTED: exopolygalacturonase-like               362   8e-117   
ref|XP_011097019.1|  PREDICTED: polygalacturonase-like                  361   8e-117   
ref|XP_009365186.1|  PREDICTED: exopolygalacturonase-like               361   9e-117   
ref|XP_004165943.1|  PREDICTED: polygalacturonase-like                  361   1e-116   
ref|XP_008349086.1|  PREDICTED: exopolygalacturonase-like               361   1e-116   
ref|XP_011097018.1|  PREDICTED: polygalacturonase-like                  359   2e-116   
ref|XP_008391258.1|  PREDICTED: exopolygalacturonase-like               360   3e-116   
gb|AFK41055.1|  unknown                                                 360   3e-116   
ref|XP_009334235.1|  PREDICTED: exopolygalacturonase-like               360   3e-116   
ref|XP_004305963.1|  PREDICTED: exopolygalacturonase-like               359   4e-116   
ref|XP_010112809.1|  hypothetical protein L484_020041                   359   6e-116   
ref|XP_003595659.1|  Polygalactorunase PG11                             360   6e-116   
ref|XP_004170151.1|  PREDICTED: polygalacturonase-like                  359   7e-116   
gb|KGN43464.1|  hypothetical protein Csa_7G037910                       359   8e-116   
gb|AES65915.2|  polygalacturonase 11c, putative                         359   1e-115   
ref|XP_006407791.1|  hypothetical protein EUTSA_v10020866mg             357   2e-115   
ref|XP_004308599.1|  PREDICTED: exopolygalacturonase-like               357   3e-115   
ref|XP_011039263.1|  PREDICTED: exopolygalacturonase-like               357   4e-115   
gb|ADK92878.1|  polygalacturonase                                       357   5e-115   
ref|XP_003544285.1|  PREDICTED: polygalacturonase-like                  356   5e-115   
ref|XP_002310765.1|  hypothetical protein POPTR_0007s11860g             356   6e-115   Populus trichocarpa [western balsam poplar]
ref|XP_008379966.1|  PREDICTED: exopolygalacturonase-like               357   6e-115   
ref|XP_008459709.1|  PREDICTED: exopolygalacturonase-like               357   7e-115   
ref|XP_004161033.1|  PREDICTED: exopolygalacturonase-like               356   8e-115   
gb|KFK38252.1|  hypothetical protein AALP_AA3G089100                    356   8e-115   
ref|XP_008229848.1|  PREDICTED: exopolygalacturonase-like               356   9e-115   
ref|XP_004491599.1|  PREDICTED: polygalacturonase-like                  356   1e-114   
ref|XP_010038563.1|  PREDICTED: exopolygalacturonase-like               356   1e-114   
gb|KCW46859.1|  hypothetical protein EUGRSUZ_K00664                     355   1e-114   
ref|XP_007142511.1|  hypothetical protein PHAVU_008G286900g             355   1e-114   
ref|XP_008229862.1|  PREDICTED: polygalacturonase-like                  365   3e-114   
ref|XP_004144612.1|  PREDICTED: exopolygalacturonase clone GBGA48...    355   4e-114   
ref|XP_009365184.1|  PREDICTED: exopolygalacturonase-like               355   4e-114   
gb|KHN40047.1|  Polygalacturonase                                       354   5e-114   
ref|XP_008462107.1|  PREDICTED: exopolygalacturonase clone GBGA483      354   7e-114   
gb|KFK38253.1|  hypothetical protein AALP_AA3G089200                    353   9e-114   
ref|XP_004295347.1|  PREDICTED: polygalacturonase-like                  354   1e-113   
ref|NP_187439.1|  polygalacturonase-like protein                        353   1e-113   Arabidopsis thaliana [mouse-ear cress]
emb|CAA05892.1|  polygalacturonase                                      353   1e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134996.1|  PREDICTED: polygalacturonase-like                  352   2e-113   
ref|XP_004490643.1|  PREDICTED: polygalacturonase-like                  352   4e-113   
ref|XP_008460220.1|  PREDICTED: exopolygalacturonase-like               352   5e-113   
ref|XP_010248093.1|  PREDICTED: exopolygalacturonase-like               350   6e-113   
ref|XP_003518573.1|  PREDICTED: polygalacturonase-like                  351   7e-113   
gb|KHN43962.1|  Polygalacturonase                                       351   8e-113   
ref|XP_009334234.1|  PREDICTED: exopolygalacturonase-like               351   9e-113   
gb|ABN13878.1|  polygalacturonase                                       350   1e-112   
emb|CAA72003.1|  polygalacturonase                                      350   1e-112   Medicago sativa [alfalfa]
ref|XP_006299274.1|  hypothetical protein CARUB_v10015428mg             350   2e-112   
sp|Q39786.1|PGLR_GOSHI  RecName: Full=Polygalacturonase; Short=PG...    350   2e-112   Gossypium hirsutum [American cotton]
ref|XP_010486355.1|  PREDICTED: polygalacturonase-like                  350   2e-112   
ref|XP_004154764.1|  PREDICTED: polygalacturonase-like                  350   2e-112   
ref|XP_010458152.1|  PREDICTED: polygalacturonase-like                  349   4e-112   
ref|XP_008222765.1|  PREDICTED: exopolygalacturonase-like               350   4e-112   
ref|XP_002884669.1|  hypothetical protein ARALYDRAFT_478121             349   4e-112   
ref|XP_002865611.1|  hypothetical protein ARALYDRAFT_494865             349   5e-112   
gb|ABL63521.1|  pollen-specific protein MF9l                            348   8e-112   Brassica oleracea var. alboglabra
gb|ABR26683.1|  polygalacturonase                                       348   1e-111   Fragaria chiloensis
ref|NP_187440.1|  polygalacturonase-like protein                        348   1e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464425.1|  PREDICTED: polygalacturonase-like                  348   1e-111   
ref|XP_008231346.1|  PREDICTED: exopolygalacturonase-like               348   1e-111   
ref|XP_002884668.1|  polygalacturonase 3                                347   2e-111   
ref|XP_003595656.1|  Polygalactorunase PG11                             348   2e-111   
ref|XP_010038560.1|  PREDICTED: exopolygalacturonase                    348   2e-111   
sp|Q39766.1|PGLR_GOSBA  RecName: Full=Polygalacturonase; Short=PG...    348   2e-111   Gossypium barbadense [Egyptian cotton]
ref|XP_006407793.1|  hypothetical protein EUTSA_v10020872mg             347   2e-111   
emb|CDY07974.1|  BnaC03g35490D                                          347   2e-111   
ref|XP_008449697.1|  PREDICTED: exopolygalacturonase-like               347   2e-111   
ref|NP_187441.1|  polygalacturonase-like protein                        347   3e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010547226.1|  PREDICTED: polygalacturonase-like                  347   3e-111   
gb|ABG38468.1|  pollen-expressed protein MF9c                           347   3e-111   Brassica oleracea
ref|XP_004292143.1|  PREDICTED: polygalacturonase-like                  350   3e-111   
gb|AAO62938.1|  polygalactorunase PG11 precursor                        347   6e-111   Medicago sativa [alfalfa]
ref|XP_010418169.1|  PREDICTED: polygalacturonase-like                  346   9e-111   
gb|KFK31316.1|  hypothetical protein AALP_AA6G096900                    346   9e-111   
gb|AFK35534.1|  unknown                                                 346   1e-110   
ref|NP_199625.1|  putative polygalacturonase / pectinase                345   1e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008449696.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    345   1e-110   
ref|XP_008455507.1|  PREDICTED: exopolygalacturonase-like               345   2e-110   
ref|XP_004140444.1|  PREDICTED: exopolygalacturonase-like               345   2e-110   
ref|XP_010548800.1|  PREDICTED: polygalacturonase-like                  345   2e-110   
ref|XP_008245812.1|  PREDICTED: exopolygalacturonase-like               345   3e-110   
sp|P24548.1|PGLR_OENOR  RecName: Full=Exopolygalacturonase; Short...    343   4e-110   Oenothera organensis
ref|XP_010548798.1|  PREDICTED: polygalacturonase-like                  344   6e-110   
ref|XP_011003515.1|  PREDICTED: exopolygalacturonase clone GBGA48...    343   7e-110   
ref|XP_008229849.1|  PREDICTED: exopolygalacturonase-like               344   7e-110   
gb|ABE77145.1|  putative polygalacturonase                              343   9e-110   Fragaria x ananassa
ref|XP_008229852.1|  PREDICTED: exopolygalacturonase-like               343   9e-110   
ref|XP_004295350.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    343   1e-109   
ref|XP_008465833.1|  PREDICTED: exopolygalacturonase-like               342   2e-109   
ref|XP_008366919.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    344   2e-109   
ref|XP_004293444.1|  PREDICTED: polygalacturonase-like                  343   2e-109   
ref|XP_008381794.1|  PREDICTED: exopolygalacturonase-like               342   3e-109   
ref|XP_008245680.1|  PREDICTED: exopolygalacturonase-like               342   3e-109   
gb|AAP37458.1|  polygalacturonase                                       342   3e-109   Fragaria x ananassa
ref|XP_010464426.1|  PREDICTED: polygalacturonase-like                  341   7e-109   
ref|XP_002526193.1|  hypothetical protein RCOM_0764760                  340   8e-109   Ricinus communis
gb|AAO24261.1|  putative pollen polygalacturonase                       340   1e-108   Turnera subulata [white alder]
ref|XP_006395214.1|  hypothetical protein EUTSA_v10004361mg             340   1e-108   
ref|XP_010667847.1|  PREDICTED: exopolygalacturonase-like               340   2e-108   
ref|XP_009365183.1|  PREDICTED: exopolygalacturonase-like               340   2e-108   
ref|XP_010439352.1|  PREDICTED: polygalacturonase-like                  339   3e-108   
ref|XP_009124109.1|  PREDICTED: polygalacturonase-like                  339   4e-108   
ref|XP_006489998.1|  PREDICTED: exopolygalacturonase-like               338   7e-108   
ref|XP_010675884.1|  PREDICTED: exopolygalacturonase-like               338   8e-108   
ref|XP_010482057.1|  PREDICTED: polygalacturonase-like                  338   9e-108   
ref|XP_006407789.1|  hypothetical protein EUTSA_v10020501mg             342   2e-107   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    364   2e-107   
ref|XP_006299755.1|  hypothetical protein CARUB_v10015950mg             338   3e-107   
ref|XP_009350286.1|  PREDICTED: exopolygalacturonase-like               337   3e-107   
ref|XP_006299382.1|  hypothetical protein CARUB_v10015541mg             336   7e-107   
ref|XP_010675930.1|  PREDICTED: exopolygalacturonase-like               336   7e-107   
emb|CAN65674.1|  hypothetical protein VITISV_002009                     357   8e-107   Vitis vinifera
emb|CDY22140.1|  BnaC01g39610D                                          335   1e-106   
ref|XP_006495222.1|  PREDICTED: exopolygalacturonase-like               335   1e-106   
ref|XP_006407792.1|  hypothetical protein EUTSA_v10020872mg             334   1e-106   
ref|XP_004144529.1|  PREDICTED: polygalacturonase-like                  335   2e-106   
emb|CDY22137.1|  BnaC01g39640D                                          335   2e-106   
ref|XP_010442229.1|  PREDICTED: polygalacturonase-like                  334   3e-106   
ref|XP_009124086.1|  PREDICTED: polygalacturonase                       334   3e-106   
ref|XP_004514023.1|  PREDICTED: polygalacturonase-like                  334   3e-106   
ref|XP_006492955.1|  PREDICTED: exopolygalacturonase-like               334   4e-106   
ref|XP_010675940.1|  PREDICTED: exopolygalacturonase-like               334   5e-106   
ref|XP_004163433.1|  PREDICTED: polygalacturonase-like                  334   6e-106   
ref|XP_004162885.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    332   2e-105   
emb|CDX86325.1|  BnaA06g30420D                                          332   2e-105   
gb|ACP74159.1|  putative polygalacturonase                              332   2e-105   
sp|P35337.1|PGLR_BRANA  RecName: Full=Polygalacturonase; Short=PG...    332   3e-105   Brassica napus [oilseed rape]
ref|XP_006279754.1|  hypothetical protein CARUB_v10027711mg             332   3e-105   
emb|CDY05701.1|  BnaC02g38360D                                          331   3e-105   
ref|XP_009151612.1|  PREDICTED: polygalacturonase                       330   9e-105   
ref|XP_009134997.1|  PREDICTED: polygalacturonase                       330   1e-104   
ref|XP_009129707.1|  PREDICTED: polygalacturonase-like                  330   1e-104   
ref|XP_002526191.1|  Polygalacturonase precursor, putative              330   1e-104   Ricinus communis
emb|CDY54512.1|  BnaC07g49180D                                          330   2e-104   
gb|AAM74219.1|AF518563_1  putative pollen polygalacturonase             330   2e-104   Brassica oleracea
gb|AAP42648.1|  polygalacturonase                                       329   3e-104   Brassica napus [oilseed rape]
emb|CDP04342.1|  unnamed protein product                                324   1e-103   
ref|XP_011073814.1|  PREDICTED: exopolygalacturonase clone GBGA48...    325   6e-103   
ref|XP_010668126.1|  PREDICTED: exopolygalacturonase clone GBGA48...    324   8e-103   
ref|XP_010464428.1|  PREDICTED: exopolygalacturonase clone GBGA48...    326   2e-102   
ref|XP_010557773.1|  PREDICTED: exopolygalacturonase clone GBGA48...    325   2e-102   
ref|XP_004169306.1|  PREDICTED: polygalacturonase-like                  325   2e-102   
ref|XP_002884670.1|  exopolygalacturonase                               325   4e-102   
ref|XP_010675916.1|  PREDICTED: exopolygalacturonase-like               323   2e-101   
ref|XP_004144611.1|  PREDICTED: polygalacturonase-like                  324   6e-101   
ref|XP_010486356.1|  PREDICTED: exopolygalacturonase clone GBGA48...    322   6e-101   
ref|XP_004289173.1|  PREDICTED: polygalacturonase-like                  320   8e-101   
ref|XP_010458380.1|  PREDICTED: exopolygalacturonase clone GBGA48...    319   7e-100   
gb|KFK38239.1|  hypothetical protein AALP_AA3G087400                    320   2e-99    
ref|XP_010458261.1|  PREDICTED: exopolygalacturonase clone GBGA48...    318   3e-99    
ref|XP_008462134.1|  PREDICTED: exopolygalacturonase-like               319   7e-99    
ref|XP_010999531.1|  PREDICTED: polygalacturonase-like                  313   8e-99    
ref|XP_006371365.1|  hypothetical protein POPTR_0019s09490g             312   1e-98    
ref|XP_009147021.1|  PREDICTED: exopolygalacturonase clone GBGA48...    318   1e-98    
ref|XP_010253373.1|  PREDICTED: exopolygalacturonase-like               313   1e-98    
ref|XP_006375551.1|  hypothetical protein POPTR_0014s16040g             313   2e-98    
gb|AHL24657.1|  Sal k 6.01 allergen                                     313   2e-98    
ref|XP_010064300.1|  PREDICTED: exopolygalacturonase-like               313   3e-98    
ref|XP_009147020.1|  PREDICTED: exopolygalacturonase clone GBGA48...    316   5e-98    
ref|XP_010675951.1|  PREDICTED: exopolygalacturonase-like isoform X1    312   2e-97    
ref|XP_010324136.1|  PREDICTED: exopolygalacturonase-like               311   2e-97    
ref|XP_010913952.1|  PREDICTED: exopolygalacturonase-like               312   3e-97    
ref|XP_010689005.1|  PREDICTED: exopolygalacturonase-like               311   4e-97    
ref|XP_002885005.1|  polygalacturonase                                  312   4e-97    
ref|XP_002862616.1|  polygalacturonase                                  312   4e-97    
ref|XP_006299516.1|  hypothetical protein CARUB_v10015686mg             312   5e-97    
ref|XP_008367231.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    309   6e-97    
ref|XP_008227080.1|  PREDICTED: exopolygalacturonase-like               310   1e-96    
ref|XP_010099972.1|  hypothetical protein L484_014009                   310   1e-96    
gb|AAQ63000.1|  oil palm polygalacturonase allergen PEST643             310   1e-96    Elaeis guineensis
emb|CBI28399.3|  unnamed protein product                                308   1e-96    
ref|XP_008229865.1|  PREDICTED: polygalacturonase                       307   2e-96    
emb|CDX80531.1|  BnaC07g29130D                                          310   2e-96    
emb|CDY07972.1|  BnaC03g35510D                                          309   2e-96    
gb|KCW46857.1|  hypothetical protein EUGRSUZ_K00661                     307   3e-96    
emb|CDX74027.1|  BnaA03g30200D                                          308   5e-96    
dbj|BAK05779.1|  predicted protein                                      308   6e-96    
ref|XP_009134998.1|  PREDICTED: exopolygalacturonase clone GBGA48...    308   6e-96    
ref|XP_006421347.1|  hypothetical protein CICLE_v10006970mg             306   1e-95    
ref|XP_007020651.1|  Pectin lyase-like superfamily protein, putative    307   1e-95    
ref|XP_004292620.1|  PREDICTED: polygalacturonase-like                  313   2e-95    
ref|XP_010064302.1|  PREDICTED: exopolygalacturonase-like               306   2e-95    
ref|XP_007143499.1|  hypothetical protein PHAVU_007G076800g             303   2e-95    
gb|EMT33862.1|  putative Exopolygalacturonase                           306   3e-95    
ref|XP_009596400.1|  PREDICTED: exopolygalacturonase-like               305   6e-95    
ref|XP_008798766.1|  PREDICTED: exopolygalacturonase-like               305   2e-94    
ref|XP_004296118.1|  PREDICTED: polygalacturonase-like                  305   2e-94    
emb|CAA51692.1|  exopolygalacturonase                                   305   2e-94    
ref|XP_006845389.1|  hypothetical protein AMTR_s00019p00055210          303   4e-94    
gb|KCW66880.1|  hypothetical protein EUGRSUZ_F00634                     302   5e-94    
ref|NP_188020.1|  exopolygalacturonase / galacturan 1,4-alpha-gal...    304   7e-94    
emb|CAA11160.1|  polygalacturonase                                      304   7e-94    
gb|AAL32525.1|  polygalacturonase; pectinase                            304   7e-94    
ref|XP_010675960.1|  PREDICTED: exopolygalacturonase clone GBGA48...    300   8e-94    
ref|NP_187442.1|  polygalacturonase-like protein                        303   1e-93    
ref|XP_002437276.1|  hypothetical protein SORBIDRAFT_10g024020          302   1e-93    
emb|CAA51033.1|  exopolygalacturonase                                   303   1e-93    
ref|XP_009767891.1|  PREDICTED: exopolygalacturonase-like               301   2e-93    
ref|XP_010259722.1|  PREDICTED: exopolygalacturonase-like               303   3e-93    
ref|XP_008349920.1|  PREDICTED: exopolygalacturonase-like               300   3e-93    
gb|EYU29596.1|  hypothetical protein MIMGU_mgv1a020057mg                299   7e-93    
ref|XP_008366452.1|  PREDICTED: exopolygalacturonase-like               299   7e-93    
ref|XP_010259724.1|  PREDICTED: exopolygalacturonase-like               301   9e-93    
ref|XP_010431549.1|  PREDICTED: exopolygalacturonase-like               298   5e-92    
ref|XP_009367790.1|  PREDICTED: exopolygalacturonase-like               297   5e-92    
ref|XP_008383110.1|  PREDICTED: exopolygalacturonase-like               297   6e-92    
ref|XP_010540121.1|  PREDICTED: exopolygalacturonase                    297   6e-92    
ref|XP_008226319.1|  PREDICTED: exopolygalacturonase                    297   7e-92    
ref|XP_010509923.1|  PREDICTED: exopolygalacturonase-like               297   9e-92    
ref|XP_003560585.2|  PREDICTED: exopolygalacturonase-like               297   9e-92    
emb|CDX88444.1|  BnaC06g38880D                                          296   1e-91    
ref|XP_010472056.1|  PREDICTED: exopolygalacturonase-like               296   1e-91    
ref|XP_008364854.1|  PREDICTED: exopolygalacturonase-like               296   1e-91    
ref|XP_004306136.1|  PREDICTED: exopolygalacturonase-like               295   2e-91    
ref|XP_004967187.1|  PREDICTED: polygalacturonase-like                  296   2e-91    
ref|XP_004289111.1|  PREDICTED: exopolygalacturonase-like               296   2e-91    
ref|XP_006656242.1|  PREDICTED: exopolygalacturonase-like               296   2e-91    
ref|XP_004153799.1|  PREDICTED: polygalacturonase-like                  293   2e-91    
ref|XP_004142607.1|  PREDICTED: polygalacturonase-like                  293   3e-91    
ref|XP_010469513.1|  PREDICTED: exopolygalacturonase-like               295   3e-91    
ref|XP_010913888.1|  PREDICTED: exopolygalacturonase-like               295   4e-91    
ref|XP_009379685.1|  PREDICTED: exopolygalacturonase-like               295   4e-91    
ref|XP_006845467.1|  hypothetical protein AMTR_s00019p00130680          295   4e-91    
ref|XP_010690734.1|  PREDICTED: exopolygalacturonase                    295   6e-91    
ref|XP_009106547.1|  PREDICTED: exopolygalacturonase                    294   8e-91    
emb|CDY52447.1|  BnaA07g39240D                                          294   9e-91    
ref|XP_007143501.1|  hypothetical protein PHAVU_007G0769002g            288   1e-90    
ref|XP_011083297.1|  PREDICTED: exopolygalacturonase-like               294   1e-90    
ref|NP_001152243.1|  polygalacturonase precursor                        294   2e-90    
gb|EYU35786.1|  hypothetical protein MIMGU_mgv1a026431mg                293   2e-90    
ref|XP_010530386.1|  PREDICTED: exopolygalacturonase                    294   2e-90    
gb|KDP24950.1|  hypothetical protein JCGZ_24417                         294   2e-90    
ref|XP_007199143.1|  hypothetical protein PRUPE_ppa019563mg             293   2e-90    
ref|XP_003617998.1|  Polygalacturonase                                  291   4e-90    
ref|XP_008813782.1|  PREDICTED: polygalacturonase-like                  291   8e-90    
ref|XP_011083305.1|  PREDICTED: exopolygalacturonase-like               291   9e-90    
ref|XP_008226942.1|  PREDICTED: polygalacturonase-like                  292   1e-89    
ref|XP_006838947.1|  hypothetical protein AMTR_s00002p00270640          291   1e-89    
ref|XP_010277790.1|  PREDICTED: polygalacturonase-like                  291   1e-89    
emb|CDY22139.1|  BnaC01g39620D                                          290   2e-89    
ref|XP_009589812.1|  PREDICTED: exopolygalacturonase-like               291   2e-89    
ref|XP_004144607.1|  PREDICTED: polygalacturonase-like                  292   2e-89    
ref|XP_006856225.1|  hypothetical protein AMTR_s00059p00207430          291   2e-89    
ref|XP_006410452.1|  hypothetical protein EUTSA_v10017763mg             291   2e-89    
ref|XP_006353088.1|  PREDICTED: exopolygalacturonase-like               290   3e-89    
ref|XP_004134494.1|  PREDICTED: exopolygalacturonase-like               291   3e-89    
emb|CDY28013.1|  BnaC05g44150D                                          293   3e-89    
gb|KEH33414.1|  polygalacturonase/glycoside hydrolase family protein    290   4e-89    
ref|XP_009776874.1|  PREDICTED: exopolygalacturonase-like               290   6e-89    
ref|XP_011085138.1|  PREDICTED: polygalacturonase                       289   7e-89    
ref|XP_002273801.1|  PREDICTED: exopolygalacturonase                    289   7e-89    
ref|XP_010413907.1|  PREDICTED: exopolygalacturonase-like               288   8e-89    
ref|XP_002272193.1|  PREDICTED: exopolygalacturonase                    290   9e-89    
gb|KCW80887.1|  hypothetical protein EUGRSUZ_C02251                     289   1e-88    
ref|XP_011073040.1|  PREDICTED: exopolygalacturonase-like               292   1e-88    
ref|NP_001141808.1|  uncharacterized protein LOC100273946 precursor     289   1e-88    
ref|XP_004146727.1|  PREDICTED: polygalacturonase-like                  286   2e-88    
ref|XP_006647023.1|  PREDICTED: exopolygalacturonase-like               288   2e-88    
ref|XP_010650742.1|  PREDICTED: polygalacturonase                       287   3e-88    
gb|KGN43436.1|  Polygalacturonase                                       285   4e-88    
ref|XP_010269646.1|  PREDICTED: exopolygalacturonase-like               290   4e-88    
ref|XP_010912751.1|  PREDICTED: polygalacturonase-like                  286   4e-88    
ref|XP_007043095.1|  Pectin lyase-like superfamily protein isoform 1    288   5e-88    
gb|KDO51597.1|  hypothetical protein CISIN_1g046411mg                   287   5e-88    
gb|EYU31582.1|  hypothetical protein MIMGU_mgv1a023133mg                286   5e-88    
ref|XP_006389987.1|  hypothetical protein EUTSA_v10018650mg             287   5e-88    
ref|NP_177961.2|  pectin lyase-like superfamily protein                 287   6e-88    
ref|XP_010266273.1|  PREDICTED: exopolygalacturonase-like               288   7e-88    
emb|CDX79512.1|  BnaC03g18480D                                          287   7e-88    
ref|XP_008235914.1|  PREDICTED: exopolygalacturonase                    291   9e-88    
emb|CDY35969.1|  BnaA05g29810D                                          290   9e-88    
ref|XP_004248938.2|  PREDICTED: exopolygalacturonase-like               285   1e-87    
ref|XP_009333810.1|  PREDICTED: exopolygalacturonase-like               286   1e-87    
gb|KDP27317.1|  hypothetical protein JCGZ_21001                         286   2e-87    
ref|XP_002879431.1|  hypothetical protein ARALYDRAFT_902380             285   2e-87    
ref|XP_010277791.1|  PREDICTED: polygalacturonase-like                  285   2e-87    
ref|XP_011004576.1|  PREDICTED: polygalacturonase-like                  285   3e-87    
ref|XP_002451722.1|  hypothetical protein SORBIDRAFT_04g006610          287   3e-87    
ref|XP_009354960.1|  PREDICTED: exopolygalacturonase-like               285   3e-87    
ref|XP_008645431.1|  PREDICTED: exopolygalacturonase-like               285   3e-87    
ref|XP_007140804.1|  hypothetical protein PHAVU_008G143500g             285   3e-87    
ref|XP_009132913.1|  PREDICTED: exopolygalacturonase-like               285   4e-87    
ref|XP_010277789.1|  PREDICTED: polygalacturonase-like                  284   5e-87    
ref|XP_009341510.1|  PREDICTED: exopolygalacturonase-like               285   5e-87    
ref|XP_008438909.1|  PREDICTED: exopolygalacturonase-like               285   6e-87    
emb|CDP04349.1|  unnamed protein product                                279   6e-87    
ref|XP_008645416.1|  PREDICTED: exopolygalacturonase-like               285   6e-87    
ref|XP_006493147.1|  PREDICTED: polygalacturonase-like                  284   7e-87    
ref|XP_008357338.1|  PREDICTED: exopolygalacturonase-like               285   7e-87    
ref|XP_006492953.1|  PREDICTED: exopolygalacturonase clone GBGA48...    283   8e-87    
ref|XP_002889191.1|  predicted protein                                  284   9e-87    
ref|XP_008377875.1|  PREDICTED: exopolygalacturonase-like               285   1e-86    
ref|XP_009416030.1|  PREDICTED: polygalacturonase-like                  283   1e-86    
emb|CDX84700.1|  BnaA03g15300D                                          283   1e-86    
ref|XP_008449197.1|  PREDICTED: exopolygalacturonase-like               281   2e-86    
ref|XP_009411633.1|  PREDICTED: exopolygalacturonase-like               283   2e-86    
ref|XP_003532865.2|  PREDICTED: exopolygalacturonase-like               285   2e-86    
ref|XP_009398783.1|  PREDICTED: exopolygalacturonase-like               283   3e-86    
gb|AFW76314.1|  hypothetical protein ZEAMMB73_313945                    283   3e-86    
gb|KCW80886.1|  hypothetical protein EUGRSUZ_C02249                     283   3e-86    
gb|AAF71796.1|AC013430_5  F3F9.9                                        283   3e-86    
ref|XP_004174175.1|  PREDICTED: exopolygalacturonase-like               278   3e-86    
gb|AFD62267.1|  endopolygalacturonase                                   282   4e-86    
gb|ADT82706.1|  endopolygalacturonase                                   282   4e-86    
emb|CDP06168.1|  unnamed protein product                                282   4e-86    
ref|XP_007050989.1|  Polygalacturonase 4, putative                      283   4e-86    
ref|XP_006486583.1|  PREDICTED: exopolygalacturonase-like               283   4e-86    
ref|XP_002890206.1|  glycoside hydrolase family 28 protein              282   5e-86    
ref|XP_008394262.1|  PREDICTED: polygalacturonase-like                  281   6e-86    
gb|AAC64184.1|  endopolygalacturonase                                   281   7e-86    
ref|XP_007022170.1|  Pectin lyase-like superfamily protein, putative    283   8e-86    
ref|XP_009343653.1|  PREDICTED: polygalacturonase-like                  281   8e-86    
ref|XP_006353113.1|  PREDICTED: polygalacturonase-like                  281   9e-86    
gb|ABV32553.1|  endopolygalacturonase                                   281   1e-85    
ref|XP_007213884.1|  hypothetical protein PRUPE_ppa006857mg             281   1e-85    
gb|KCW66879.1|  hypothetical protein EUGRSUZ_F00633                     279   1e-85    
ref|XP_008227253.1|  PREDICTED: polygalacturonase                       280   1e-85    
ref|XP_006372690.1|  hypothetical protein POPTR_0017s03910g             280   2e-85    
ref|XP_007213880.1|  hypothetical protein PRUPE_ppa006839mg             280   2e-85    
ref|XP_006656243.1|  PREDICTED: exopolygalacturonase-like               281   2e-85    
ref|XP_009149159.1|  PREDICTED: exopolygalacturonase isoform X2         280   2e-85    
ref|XP_002312795.2|  hypothetical protein POPTR_0009s17010g             281   2e-85    
ref|XP_009768372.1|  PREDICTED: polygalacturonase-like                  280   3e-85    
ref|XP_006301427.1|  hypothetical protein CARUB_v10021845mg             280   3e-85    
gb|AGR44470.1|  polygalacturonase 2                                     280   3e-85    
ref|XP_011000860.1|  PREDICTED: exopolygalacturonase-like               281   3e-85    
emb|CAH18935.1|  polygalacturonase                                      280   3e-85    
gb|ABD33834.1|  polygalacturonase                                       280   4e-85    
ref|XP_010536242.1|  PREDICTED: polygalacturonase-like                  276   4e-85    
ref|XP_008805455.1|  PREDICTED: exopolygalacturonase-like               280   4e-85    
gb|AAP21999.1|  endopolygalacturonase                                   278   4e-85    
gb|AER27668.1|  polygalacturonase                                       280   4e-85    
ref|XP_004287176.1|  PREDICTED: polygalacturonase-like                  279   5e-85    
emb|CDY01524.1|  BnaC07g35140D                                          280   5e-85    
ref|XP_006295486.1|  hypothetical protein CARUB_v10024590mg             279   5e-85    
ref|NP_180874.1|  protein NIMNA                                         286   9e-85    
ref|XP_006372686.1|  hypothetical protein POPTR_0017s03870g             278   1e-84    
ref|XP_002529091.1|  Polygalacturonase precursor, putative              278   1e-84    
ref|XP_002438528.1|  hypothetical protein SORBIDRAFT_10g021590          279   1e-84    
ref|XP_004298148.1|  PREDICTED: exopolygalacturonase clone GBGE18...    279   1e-84    
ref|XP_007026504.1|  Polygalacturonase                                  278   1e-84    
ref|XP_010522804.1|  PREDICTED: exopolygalacturonase clone GBGE18...    280   1e-84    
ref|XP_004149595.1|  PREDICTED: exopolygalacturonase-like               277   2e-84    
ref|XP_008451196.1|  PREDICTED: exopolygalacturonase isoform X3         277   2e-84    
dbj|BAF42034.1|  polygalacturonase3                                     278   2e-84    
emb|CDP16134.1|  unnamed protein product                                278   2e-84    
ref|XP_004251991.1|  PREDICTED: polygalacturonase-like                  278   2e-84    
ref|XP_008451195.1|  PREDICTED: exopolygalacturonase isoform X2         278   2e-84    
dbj|BAC22689.1|  polygalacturonase                                      278   2e-84    
ref|XP_006856226.1|  hypothetical protein AMTR_s00059p00207710          278   2e-84    
dbj|BAK05871.1|  predicted protein                                      278   2e-84    
sp|P48979.1|PGLR_PRUPE  RecName: Full=Polygalacturonase; Short=PG...    277   3e-84    
ref|XP_008451194.1|  PREDICTED: exopolygalacturonase isoform X1         278   3e-84    
ref|XP_009149158.1|  PREDICTED: exopolygalacturonase isoform X1         277   3e-84    
ref|XP_004302209.1|  PREDICTED: polygalacturonase-like                  277   3e-84    
ref|XP_004304844.1|  PREDICTED: polygalacturonase-like                  277   3e-84    
ref|XP_006295765.1|  hypothetical protein CARUB_v10024886mg             277   4e-84    
gb|EAZ01647.1|  hypothetical protein OsI_23683                          277   5e-84    
ref|XP_010317352.1|  PREDICTED: exopolygalacturonase-like               276   5e-84    
ref|XP_002314373.2|  hypothetical protein POPTR_0010s01470g             277   6e-84    
ref|XP_004171844.1|  PREDICTED: polygalacturonase-like                  271   7e-84    
gb|KGN43365.1|  hypothetical protein Csa_7G027810                       278   7e-84    
ref|XP_006656147.1|  PREDICTED: exopolygalacturonase-like               276   8e-84    
ref|NP_001045053.1|  Os01g0891100                                       276   9e-84    
ref|NP_001058060.1|  Os06g0611400                                       276   1e-83    
ref|NP_173158.1|  pectin lyase-like protein                             276   1e-83    
ref|XP_009400098.1|  PREDICTED: exopolygalacturonase-like               278   1e-83    
ref|XP_006477959.1|  PREDICTED: exopolygalacturonase-like               277   1e-83    
gb|AIL01320.1|  group 13 allergen Sor h 13.01                           276   1e-83    
ref|XP_009765923.1|  PREDICTED: polygalacturonase-like                  275   2e-83    
gb|KCW57484.1|  hypothetical protein EUGRSUZ_H00254                     274   2e-83    
ref|XP_003519756.1|  PREDICTED: exopolygalacturonase clone GBGE18...    276   2e-83    
ref|XP_003517970.1|  PREDICTED: polygalacturonase-like                  275   2e-83    
emb|CAN69218.1|  hypothetical protein VITISV_012014                     287   2e-83    
ref|XP_007224043.1|  hypothetical protein PRUPE_ppa015208mg             275   2e-83    
gb|KHN29178.1|  Exopolygalacturonase                                    274   2e-83    
ref|XP_008353213.1|  PREDICTED: exopolygalacturonase-like               276   2e-83    
ref|XP_010507659.1|  PREDICTED: exopolygalacturonase-like               275   3e-83    
gb|ABD79098.1|  Zea m 13 allergen                                       275   3e-83    
gb|ACN85300.1|  exopolygalacturonase precursor                          275   3e-83    
ref|XP_010251320.1|  PREDICTED: exopolygalacturonase-like               275   3e-83    
ref|XP_004513513.1|  PREDICTED: polygalacturonase-like                  274   3e-83    
ref|XP_008223247.1|  PREDICTED: exopolygalacturonase-like               275   3e-83    
ref|XP_010324075.1|  PREDICTED: exopolygalacturonase-like               275   3e-83    
ref|XP_010101341.1|  hypothetical protein L484_020356                   275   3e-83    
ref|NP_179148.1|  glycoside hydrolase family 28 protein / polygal...    275   3e-83    
ref|XP_004965898.1|  PREDICTED: exopolygalacturonase-like               275   3e-83    
ref|XP_008807270.1|  PREDICTED: polygalacturonase-like                  274   4e-83    
ref|XP_006442242.1|  hypothetical protein CICLE_v10023493mg             274   4e-83    
ref|NP_179147.1|  glycoside hydrolase family 28 protein / polygal...    275   4e-83    
ref|XP_007224662.1|  hypothetical protein PRUPE_ppa026115mg             273   4e-83    
gb|EYU42737.1|  hypothetical protein MIMGU_mgv1a0087912mg               269   4e-83    
emb|CDY47808.1|  BnaC07g07010D                                          274   5e-83    
ref|XP_010909879.1|  PREDICTED: polygalacturonase-like                  274   5e-83    
ref|XP_008649075.1|  PREDICTED: exopolygalacturonase-like               275   5e-83    



>ref|XP_009612480.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=401

 Score =   456 bits (1172),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 231/391 (59%), Positives = 285/391 (73%), Gaps = 13/391 (3%)
 Frame = +3

Query  126   YCAFTFVLFLLADLGESAE------FKVTAEG---DSDISPELLKAWDEACAATTPSIIV  278
             + +F F+L   A +G++        F VT  G   + DIS  +L A+ EACAAT+PS IV
Sbjct  5     FTSFAFLLLFFARIGDAQPTASPGVFDVTKYGATTNGDISKAVLDAFKEACAATSPSTIV  64

Query  279   IPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGT  458
             IPKGT+QM Q  L+GPCKAP+EL+++A LKAP +P  +    EWLT+NY+D FTLSG G 
Sbjct  65    IPKGTYQMNQVKLQGPCKAPVELQVQAILKAPSDPKQLSADIEWLTVNYIDRFTLSGGGV  124

Query  459   LDGQGDVQIYGQKKDTGFKS-DKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLT  635
              DGQG  Q +GQ      KS   LPNNLS NFL NS I+DITS +SKLFH+NV G KNLT
Sbjct  125   FDGQGK-QAWGQNNCKDSKSCSNLPNNLSFNFLTNSTIQDITSQDSKLFHINVNGCKNLT  183

Query  636   FQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGH  815
             F ++ I AP +S NTDGIH+A+  +V I D VIGTGDDCIS+GD LE L+I  VTCGPGH
Sbjct  184   FIRVNITAPQESINTDGIHVARSSNVNITDCVIGTGDDCISVGDELEQLHITRVTCGPGH  243

Query  816   GISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVK  995
             GISVGSLGKTPGE+PV GV VK+  FI TDNG+R+KTWP SH GVVTD+HY  I +++V 
Sbjct  244   GISVGSLGKTPGEKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTDLHYEDIIVQNVS  303

Query  996   NPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGD  1175
             NPIVIDQ YCP NQC+K+ PS VKIS VS  NI+GTS T++AV++ CS G PC+ V+ GD
Sbjct  304   NPIVIDQVYCPYNQCNKDLPSKVKISKVSIKNIRGTSRTQDAVLLLCSKGAPCDGVEVGD  363

Query  1176  INLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             I++T+ G  G AK+ C N KPKL GKQ PP+
Sbjct  364   IDITYNGKEGPAKSSCENVKPKLVGKQNPPI  394



>ref|XP_009764608.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=401

 Score =   453 bits (1165),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 230/391 (59%), Positives = 284/391 (73%), Gaps = 13/391 (3%)
 Frame = +3

Query  126   YCAFTFVLFLLADLGESAE------FKVTAEG---DSDISPELLKAWDEACAATTPSIIV  278
             + +F F+L  LA +G++        F VT  G   + DIS  +L A+ EACAAT+PS IV
Sbjct  5     FISFAFLLLFLARIGDAQPTTSPGVFDVTKYGATTNGDISKAVLDAFKEACAATSPSTIV  64

Query  279   IPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGT  458
             IPKGT+QM Q  L+GPCKAP+EL+++A LKAP +P  +    EWLT+NY+D FTLSG G 
Sbjct  65    IPKGTYQMNQVKLQGPCKAPVELQVQAILKAPSDPKQLNADVEWLTVNYIDRFTLSGGGV  124

Query  459   LDGQGDVQIYGQKKDTGFKS-DKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLT  635
              DGQG  Q + Q      KS   LPNNLS NFL NS I+DITS +SKLFH+NV G KNLT
Sbjct  125   FDGQGK-QAWDQNNCKDSKSCSNLPNNLSFNFLTNSTIQDITSQDSKLFHINVNGCKNLT  183

Query  636   FQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGH  815
             F ++ I AP +S NTDGIH+A+  +V I D VIGTGDDCIS+GD LE L+I  VTCGPGH
Sbjct  184   FIRVNITAPPESINTDGIHVARSSNVNITDCVIGTGDDCISVGDELEQLHITRVTCGPGH  243

Query  816   GISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVK  995
             GISVGSLGKTPGE+PV GV VK+  FI TDNG+R+KTWP SH GVVTD+HY  I +++V 
Sbjct  244   GISVGSLGKTPGEKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTDLHYEDIIVQNVS  303

Query  996   NPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGD  1175
             NPIVIDQ YCP NQC+K+ PS VKIS VS  NI+GTS T++AV++ CS G PC+ V+ GD
Sbjct  304   NPIVIDQVYCPYNQCNKDLPSQVKISKVSIKNIRGTSRTQDAVLLLCSKGAPCDGVEVGD  363

Query  1176  INLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             I++T+ G  G AK+ C N KPK  GKQ PP+
Sbjct  364   IDITYNGKEGPAKSSCENVKPKFVGKQNPPI  394



>ref|XP_009804151.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=401

 Score =   448 bits (1152),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 233/390 (60%), Positives = 281/390 (72%), Gaps = 11/390 (3%)
 Frame = +3

Query  123   FYCAFTFVLFLLADLGES--AEFKVTAEG-----DSDISPELLKAWDEACAATTPSIIVI  281
             F  +F F L  L  +GES  A F VT  G     + DIS  LL A+ EAC +  PS +VI
Sbjct  5     FKLSFAFALLFLVHIGESQPAVFDVTKFGAKPDSNEDISKALLSAFKEACNSKIPSKVVI  64

Query  282   PKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTL  461
             PKGT+ M Q  L+G CKAPIEL+I+ATLKAPPNP+ ++   EWLTIN++D FTLSG G  
Sbjct  65    PKGTYLMNQVRLEGNCKAPIELEIQATLKAPPNPSQLKKDMEWLTINHIDHFTLSGGGIF  124

Query  462   DGQGDVQIYGQKKDTGFKS-DKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTF  638
             DGQG+ Q + Q      +S  KLPNNLS NFL NSIIRDITSL+SKLFH+NV G KNLTF
Sbjct  125   DGQGE-QGWAQNDCKNSESCGKLPNNLSFNFLTNSIIRDITSLDSKLFHINVLGCKNLTF  183

Query  639   QKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHG  818
               + IKAPA S NTDGIH+A+   + I +S IGTGDDCISIGDG++ + I  VTCGPGHG
Sbjct  184   IGVNIKAPAQSLNTDGIHVARSRGLNITNSQIGTGDDCISIGDGIQQMYITNVTCGPGHG  243

Query  819   ISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKN  998
             ISVGSLGKTPGE PV GV V++  FI TDNG+R+KTWP SH GVV D+HY  I +++V N
Sbjct  244   ISVGSLGKTPGELPVVGVFVQNCTFIDTDNGVRVKTWPASHNGVVRDLHYEDIIVQNVSN  303

Query  999   PIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDI  1178
             P+VIDQ YCP NQC K+ PS VKIS VS+ NI+GTS T++A+ I CS GVPCE V+ GDI
Sbjct  304   PVVIDQLYCPYNQCKKDLPSQVKISKVSFKNIRGTSRTQDAIKINCSKGVPCEGVEVGDI  363

Query  1179  NLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             ++T+ G  G AK+ C N  P   GKQ PPV
Sbjct  364   DITYNGNEGPAKSTCQNVDPSFVGKQIPPV  393



>ref|XP_009601010.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=401

 Score =   444 bits (1142),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 233/390 (60%), Positives = 278/390 (71%), Gaps = 11/390 (3%)
 Frame = +3

Query  123   FYCAFTFVLFLLADLGES--AEFKVTAEG-----DSDISPELLKAWDEACAATTPSIIVI  281
             F   F F L  L   GES  A F VT  G     + DIS  LL A+ EAC +  PS +VI
Sbjct  5     FKLPFAFALVFLVYTGESQPAVFDVTKFGAKPDSNEDISKALLSAFKEACNSKIPSKVVI  64

Query  282   PKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTL  461
             PKG + M Q  L+G CKAPIEL+I+ATLKAPPNP+ ++   EWLTIN++D FTLSG G  
Sbjct  65    PKGIYLMNQVRLEGNCKAPIELQIQATLKAPPNPSQLKKDMEWLTINHIDHFTLSGGGIF  124

Query  462   DGQGDVQIYGQKKDTGFKS-DKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTF  638
             DGQG+ Q + Q      +S  KLPNNLS NFL NSIIRDITSL+SKLFH+NV G KNLTF
Sbjct  125   DGQGE-QGWAQNDCKNSESCGKLPNNLSFNFLTNSIIRDITSLDSKLFHINVLGCKNLTF  183

Query  639   QKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHG  818
               + IKAPA S NTDGIH+A+   V I +S IGTGDDCISIGDG++ + I  VTCGPGHG
Sbjct  184   IGVNIKAPAQSLNTDGIHVARSRGVNITNSEIGTGDDCISIGDGVQQMYITNVTCGPGHG  243

Query  819   ISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKN  998
             ISVGSLGKTPGE PV GV V++  FI TDNG+R+KTWP SH GVV D+HY  I +++V N
Sbjct  244   ISVGSLGKTPGELPVVGVFVQNCTFIDTDNGVRVKTWPASHNGVVRDLHYEDIIVQNVSN  303

Query  999   PIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDI  1178
             P+VIDQ YCP NQC K+ PS VKIS VS+ NI+GTS T++A+ I CS GVPCE V+ GDI
Sbjct  304   PVVIDQLYCPYNQCKKDLPSQVKISKVSFKNIRGTSRTQDAIQINCSKGVPCEGVEVGDI  363

Query  1179  NLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             ++T+ G  G AK+ C N  P   GKQ PPV
Sbjct  364   DITYNGNEGPAKSSCQNVDPSFVGKQNPPV  393



>ref|XP_006366630.1| PREDICTED: polygalacturonase-like [Solanum tuberosum]
Length=384

 Score =   429 bits (1102),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 220/379 (58%), Positives = 274/379 (72%), Gaps = 9/379 (2%)
 Frame = +3

Query  147   LFLLADLG--ESAEFKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQA  311
             +  LA LG  ++  F VT  G   + DIS  +L A+ EACA+T+ S I++PKG FQMKQ 
Sbjct  1     MLFLARLGAAQAGVFDVTKFGATPNGDISKAILDAFKEACASTSASRIIVPKGRFQMKQV  60

Query  312   LLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYG  491
              L+GPCKAP+E +++ TL+A P+P  +  + EW T+NY++ FTLSG G  DGQG    + 
Sbjct  61    KLEGPCKAPLEFQLQGTLEASPDPKILP-EGEWFTVNYLNQFTLSGTGIFDGQGKAA-WA  118

Query  492   QKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADS  671
             Q      K   LP NLS NFL +S I+DITS +SK FH+NV G  NLTF +ITI AP +S
Sbjct  119   QNDCAKTKCAHLPYNLSFNFLNSSTIQDITSKDSKNFHMNVNGCNNLTFNRITITAPKES  178

Query  672   HNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPG  851
              NTDGIH+A+  +V I DSVIGTGDDCIS+GD LE L+I  VTCGPGHGISVGSLGKTPG
Sbjct  179   INTDGIHVARSKNVNITDSVIGTGDDCISVGDELEQLHITKVTCGPGHGISVGSLGKTPG  238

Query  852   EEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPN  1031
             E+PV GV VK+  FI TDNG+R+KTWP SH GVVT++HY  I +++V NPIVIDQ YCP 
Sbjct  239   EKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTELHYEDIIVQNVSNPIVIDQVYCPY  298

Query  1032  NQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAA  1205
             NQC+K+ PSLVKIS VS  N+KGTS T++AV++ CS GVPCE V+ GDI++T+ G  G A
Sbjct  299   NQCNKDLPSLVKISKVSIKNVKGTSRTQDAVLLLCSKGVPCEGVEVGDIDITYNGKEGPA  358

Query  1206  KTVCSNAKPKLTGKQTPPV  1262
             KT C N KP   G Q PPV
Sbjct  359   KTSCENVKPTFVGNQNPPV  377



>ref|XP_009599317.1| PREDICTED: polygalacturonase [Nicotiana tomentosiformis]
Length=396

 Score =   426 bits (1096),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 220/391 (56%), Positives = 274/391 (70%), Gaps = 11/391 (3%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAE--FKVT---AEGDSDISPELLKAWDEACAATTPSII  275
             MD  F   F  VL  LA  GES    F +T   A  ++DIS  LL A+ EAC +T+PS I
Sbjct  1     MDLKFKVHFALVLLFLAHFGESQTGVFDITKYGANSNADISEALLNAFKEACQSTSPSTI  60

Query  276   VIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDG  455
             VIPKGTF M Q  L+GPCK+P+EL+I+ATLKAP +P+ ++   EWLT+N +D FT+SG G
Sbjct  61    VIPKGTFTMNQVKLEGPCKSPLELQIQATLKAPSDPSQLKVG-EWLTVNKLDQFTMSGGG  119

Query  456   TLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLT  635
              LDGQ       ++     K +KLPNNLS N L NS I+DIT+L+SK FHVNV   KNLT
Sbjct  120   ILDGQAAAAWECKQSK---KCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLT  176

Query  636   FQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGH  815
             F +  + APA+S NTDGIH+++   V I DS   TGDDCIS+GD  E L I  VTCGPGH
Sbjct  177   FIRFNVSAPANSPNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGH  236

Query  816   GISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVK  995
             GISVGSLG  P E+PV GV V++  F  TDNG+RIKTWP SHPGVV D+H+  I +++V 
Sbjct  237   GISVGSLGGNPDEKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVS  296

Query  996   NPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGD  1175
             NP+VIDQ YCP N+C+K+ PS VKIS VS+ NIKGTS T++AV + CS GVPCE ++ GD
Sbjct  297   NPVVIDQVYCPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGD  356

Query  1176  INLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             I++T+ G  G AK+ C N KP L GKQ PPV
Sbjct  357   IDITYSGKEGPAKSSCENIKPSLKGKQNPPV  387



>ref|XP_004253347.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=403

 Score =   426 bits (1095),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 226/388 (58%), Positives = 276/388 (71%), Gaps = 11/388 (3%)
 Frame = +3

Query  120   IFYCAFTFVLFLLADLGES--AEFKVT---AEGDSDISPELLKAWDEACAATTPSIIVIP  284
             I +  F   +  LA  GES  A F +T   A  ++DIS  + KA+ EACA+T+PS IVIP
Sbjct  5     IKFVYFGLGVLFLAHFGESQNATFDITKYGATANADISEAVGKAFKEACASTSPSTIVIP  64

Query  285   KGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLD  464
             KGTFQM Q LL+GPCK PIEL+I+A LKAP +PN ++   EWLT+N +D FT+SG GTLD
Sbjct  65    KGTFQMNQVLLEGPCKGPIELQIQAILKAPTDPNAIK-TGEWLTVNKLDFFTMSGGGTLD  123

Query  465   GQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQK  644
             GQG  + +  KK    K  KLPNNLS N L NSII+DIT+L+SK FHVNV   KNLTF K
Sbjct  124   GQGK-EAWECKKSK--KCTKLPNNLSFNSLTNSIIKDITTLDSKAFHVNVNQCKNLTFTK  180

Query  645   ITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGIS  824
               + APADS NTDGIH+A+   V I +S   TGDDCISIGD  E L I  VTCGPGHGIS
Sbjct  181   FNVSAPADSPNTDGIHVARASSVNITESSFSTGDDCISIGDETEQLYITKVTCGPGHGIS  240

Query  825   VGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPI  1004
             VGSLG  PGE+PV GV VK+   + TDNG+RIKTWP SHPGVV+DIH+  I +++V NPI
Sbjct  241   VGSLGGNPGEKPVVGVFVKNCTLVSTDNGVRIKTWPASHPGVVSDIHFEDIIVQNVSNPI  300

Query  1005  VIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINL  1184
             VIDQ YCP+ +C+K+ PS VKIS VS  NIKGTS T+ A+ + CS G PCE V+ GD+++
Sbjct  301   VIDQVYCPSGKCNKDLPSQVKISKVSIQNIKGTSRTQNAISLTCSKGSPCEGVEVGDVDI  360

Query  1185  TFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             ++ G  G AK+ C N KP   GKQTP V
Sbjct  361   SYSGKEGPAKSSCENIKPTFKGKQTPAV  388



>ref|XP_004243884.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=392

 Score =   425 bits (1092),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 215/373 (58%), Positives = 269/373 (72%), Gaps = 7/373 (2%)
 Frame = +3

Query  159   ADLGESAEFKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPC  329
             A  G+   F VT  G   + DIS  +L A+ EACA+T+PS +++PKGTFQMKQ  L+GPC
Sbjct  15    APTGQPGVFDVTKFGATPNGDISKAILDAFKEACASTSPSRVIVPKGTFQMKQVKLEGPC  74

Query  330   KAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTG  509
             KAP+E +++ TL+A P+P  +  + EW T+NYV+ FTLSG G  DGQG    + Q     
Sbjct  75    KAPLEFQLQGTLQASPDPKALP-EGEWFTVNYVNQFTLSGTGIFDGQGKAA-WAQNDCAK  132

Query  510   FKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGI  689
              K   LP NLS N+L +S I+DITS +SK FH+NV G  N T  ++TI AP +S NTDGI
Sbjct  133   TKCAHLPYNLSFNYLNSSTIQDITSKDSKNFHMNVNGCNNFTLNRVTISAPKESINTDGI  192

Query  690   HIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKG  869
             H+A+  +V I D VIGTGDDCISIGD LE L+I  VTCGPGHGISVGSLGKTPGE+PV G
Sbjct  193   HVARSKNVNITDCVIGTGDDCISIGDELEQLHITKVTCGPGHGISVGSLGKTPGEKPVVG  252

Query  870   VTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKE  1049
             V VK+  FI TDNG+R+KTWP SH GVVT++HY  I +++V NP+VIDQ YCP NQC+K+
Sbjct  253   VYVKNCTFINTDNGVRVKTWPASHQGVVTELHYEDIVVQNVSNPVVIDQVYCPYNQCNKD  312

Query  1050  KPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSN  1223
              PSLVKIS VS  N+KGTS+T++AV + CS GVPCE V+ GDI++ + G  G AKT C N
Sbjct  313   LPSLVKISKVSIKNVKGTSSTQDAVQLLCSKGVPCEGVEVGDIDIAYNGKEGPAKTSCEN  372

Query  1224  AKPKLTGKQTPPV  1262
              KP   GKQ PPV
Sbjct  373   VKPTFVGKQNPPV  385



>dbj|BAO02513.1| predicted polygalacturonase ortholog [Nicotiana alata]
Length=401

 Score =   424 bits (1089),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 219/391 (56%), Positives = 273/391 (70%), Gaps = 11/391 (3%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAE--FKVT---AEGDSDISPELLKAWDEACAATTPSII  275
             MD  F   F  VL  LA  GES    F +T   A  ++DIS  LL A+ EAC +T+PS I
Sbjct  1     MDLKFKVHFALVLLFLAHFGESQTGVFDITKYGANSNADISEALLSAFKEACQSTSPSTI  60

Query  276   VIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDG  455
             VIPKGTF M Q  L+GPCK+P+EL+I+ATLKAP +P+ ++   EWLT+N +D FT+SG G
Sbjct  61    VIPKGTFTMNQVKLEGPCKSPLELQIQATLKAPSDPSQLKVG-EWLTVNKIDQFTMSGGG  119

Query  456   TLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLT  635
              LDGQ       +      K +KLPNNLS N L NS I+DIT+L+SK FHVNV   KNLT
Sbjct  120   ILDGQAAAAWECKNSK---KCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLT  176

Query  636   FQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGH  815
             F +  + APA+S NTDGIH+++   V I DS   TGDDCIS+GD  E L I  VTCGPGH
Sbjct  177   FIRFNVSAPANSPNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGH  236

Query  816   GISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVK  995
             GISVGSLG  P E+PV GV V++  F  TDNG+RIKTWP SHPGVV D+H+  I +++V 
Sbjct  237   GISVGSLGGNPDEKPVIGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVS  296

Query  996   NPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGD  1175
             NP+VIDQ YCP N+C+K+ PS VKIS VS+ NIKGTS T++AV + CS GVPCE ++ GD
Sbjct  297   NPVVIDQVYCPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGD  356

Query  1176  INLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             I++++ G  G AK+ C N KP L GKQ PPV
Sbjct  357   IDISYSGKEGPAKSSCENIKPSLKGKQNPPV  387



>sp|Q05967.1|PGLR_TOBAC RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA50338.1| polygalacturonase [Nicotiana tabacum]
Length=396

 Score =   422 bits (1085),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 219/391 (56%), Positives = 273/391 (70%), Gaps = 11/391 (3%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAE--FKVT---AEGDSDISPELLKAWDEACAATTPSII  275
             MD  F   F  VL  LA  GES    F +T   A  ++DIS  LL A+ EAC +T+PS I
Sbjct  1     MDLKFKVHFALVLLFLAHFGESQTGVFDITKYGANSNADISEALLNAFKEACQSTSPSTI  60

Query  276   VIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDG  455
             VIPKGTF M Q  L+GPCK+P+EL+I+ATLKAP +P+ ++   EWLT+N +D FT+SG G
Sbjct  61    VIPKGTFTMNQVKLEGPCKSPLELQIQATLKAPSDPSQLKVG-EWLTVNKLDQFTMSGGG  119

Query  456   TLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLT  635
              LDGQ       ++     K +KLPNNLS N L NS I+DIT+L+SK FHVNV   KNLT
Sbjct  120   ILDGQAAAAWECKQSK---KCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLT  176

Query  636   FQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGH  815
             F +  + APA+S NTDGIH+++   V I DS   TGDDCIS+GD  E L I  VTCGPGH
Sbjct  177   FIRFNVSAPANSPNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGH  236

Query  816   GISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVK  995
             GISVGSLG  P E+PV GV V++  F  TDNG+RIKTWP SHPGVV D+H+  I +++V 
Sbjct  237   GISVGSLGGNPDEKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVS  296

Query  996   NPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGD  1175
             NP+VIDQ YCP N+C+K+ PS VKIS VS+ NIKGTS T++AV +  S GVPCE ++ GD
Sbjct  297   NPVVIDQVYCPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLRSKGVPCEGIEVGD  356

Query  1176  INLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             I++T+ G  G AK+ C N KP L GKQ PPV
Sbjct  357   IDITYSGKEGPAKSSCENIKPSLKGKQNPPV  387



>pir||S46530 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.X and clone 
pC27.Y) - common tobacco (fragment)
 emb|CAA50334.1| polygalacturonase [Nicotiana tabacum]
 emb|CAA50336.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   419 bits (1077),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 216/380 (57%), Positives = 270/380 (71%), Gaps = 11/380 (3%)
 Frame = +3

Query  144   VLFLLADLGESAE--FKVT---AEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQ  308
             VL  LA  GES    F +T   A  ++DIS  LL A+ EAC +T+PS IVIPKGTF M Q
Sbjct  1     VLLFLAHFGESQTGVFDITKYGANSNADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQ  60

Query  309   ALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIY  488
               L+GPCK+P+EL+I+ATLKAP +P+ ++   EWLT+N +D FT+SG G LDGQ      
Sbjct  61    VKLEGPCKSPLELQIQATLKAPSDPSQLKVG-EWLTVNKLDQFTMSGGGILDGQAAAAWE  119

Query  489   GQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPAD  668
              ++     K +KLPNNLS N L NS I+DIT+L+SK FHVNV   KNLTF +  + APA+
Sbjct  120   CKQSK---KCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPAN  176

Query  669   SHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTP  848
             S NTDGIH+++   V I DS   TGDDCIS+GD  E L I  VTCGPGHGISVGSLG  P
Sbjct  177   SPNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNP  236

Query  849   GEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCP  1028
              E+PV GV V++  F  TDNG+RIKTWP SHPGVV D+H+  I +++V NP+VIDQ YCP
Sbjct  237   DEKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCP  296

Query  1029  NNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GA  1202
              N+C+K+ PS VKIS VS+ NIKGTS T++AV + CS GVPCE ++ GDI++T+ G  G 
Sbjct  297   FNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGP  356

Query  1203  AKTVCSNAKPKLTGKQTPPV  1262
             AK+ C N KP L GKQ PPV
Sbjct  357   AKSSCENIKPSLKGKQNPPV  376



>pir||S46529 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.W) - common 
tobacco (fragment)
 emb|CAA50337.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   416 bits (1070),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 215/380 (57%), Positives = 269/380 (71%), Gaps = 11/380 (3%)
 Frame = +3

Query  144   VLFLLADLGESAE--FKVT---AEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQ  308
             VL  LA  GES    F +T   A  ++DIS  LL A+ EAC +T+PS IVIPKGTF M Q
Sbjct  1     VLLFLAHFGESQTGVFDITKYGANSNADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQ  60

Query  309   ALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIY  488
               L+GPCK+P+EL+I+ATLKAP +P+ ++   EWLT+N +D FT+SG G LDGQ      
Sbjct  61    VKLEGPCKSPLELQIQATLKAPSDPSQLKVG-EWLTVNKLDQFTMSGGGILDGQAAAAWE  119

Query  489   GQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPAD  668
              ++     K +KLPNNLS N L NS I+DIT+L+SK FHVNV   KNLTF +  + APA+
Sbjct  120   CKQSK---KCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPAN  176

Query  669   SHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTP  848
             S NTDGIH+++   V I DS   TGDDCIS+GD  E L I  VTCGPGHGISVGSLG  P
Sbjct  177   SPNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNP  236

Query  849   GEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCP  1028
              E+PV GV V++  F  TDNG+RIKTWP SHPGVV D+H+  I +++V NP+VIDQ YCP
Sbjct  237   DEKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCP  296

Query  1029  NNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GA  1202
              N+C+K+ PS VKIS VS+ NIKGTS T++AV + CS GVPCE ++ GDI++T+ G  G 
Sbjct  297   FNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGP  356

Query  1203  AKTVCSNAKPKLTGKQTPPV  1262
             AK+ C N KP L  KQ PPV
Sbjct  357   AKSSCENIKPSLKDKQNPPV  376



>emb|CDP04348.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   413 bits (1062),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 206/391 (53%), Positives = 266/391 (68%), Gaps = 5/391 (1%)
 Frame = +3

Query  105   R*MDTIFYCAFTFVLFLL-ADLG--ESAEFKVTAEGDSDISPELLKAWDEACAATTPSII  275
             R + T   C++ F   ++ A  G  +  +     +G +D+S  L  AW +AC +TTPS I
Sbjct  3     RALGTTLLCSWLFFTCIVQAQTGPIDVTQLGAKPDGSADMSQVLADAWKQACNSTTPSTI  62

Query  276   VIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDG  455
             +IPKGTF +K+A L GPCKAP+E++I+ T+KAP +P  +   KEW++I YVD  TLSG G
Sbjct  63    LIPKGTFLLKEASLAGPCKAPVEVQIQGTVKAPEDPAQITKDKEWMSIIYVDQLTLSGGG  122

Query  456   TLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLT  635
             TLDGQG       +     +  KLPN LSLNF+ N++IRD+TSLNSKLFHVN+FG  N+T
Sbjct  123   TLDGQGAKAWTQNECRVKTECSKLPNTLSLNFVNNTVIRDLTSLNSKLFHVNLFGCNNIT  182

Query  636   FQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGH  815
             FQ  TI AP DS NTDGIHI     V I DS IGTGDDCISIGDG + +NI  VTCGPGH
Sbjct  183   FQHFTIIAPGDSPNTDGIHIGHSTGVVITDSNIGTGDDCISIGDGAKQVNISKVTCGPGH  242

Query  816   GISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVK  995
             GISVGSLG+   E PV+G+ V D    GT NG+R+K+WP S  G  T++H+  I M++V 
Sbjct  243   GISVGSLGRYDNELPVEGIFVTDCTISGTLNGVRVKSWPASKSGSATNMHFEGIIMQNVS  302

Query  996   NPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGD  1175
             NP++IDQEYCPNNQC+   PS VKI+ VS+ NI GTSAT  AV + CS  +PCE V+  D
Sbjct  303   NPVIIDQEYCPNNQCTNTAPSSVKIAQVSFKNITGTSATPAAVTLLCSKSIPCEGVEVAD  362

Query  1176  INLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             I+L + G  G+  + C+N KP L+GK  PP+
Sbjct  363   IDLAYNGNQGSVSSNCANVKPALSGKLNPPI  393



>emb|CAA50335.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   412 bits (1058),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 213/380 (56%), Positives = 267/380 (70%), Gaps = 11/380 (3%)
 Frame = +3

Query  144   VLFLLADLGESAE--FKVT---AEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQ  308
             VL  LA  GES    F +T   A  ++DIS  LL A+ EAC +T+PS IVIPKGTF M Q
Sbjct  1     VLLFLAHFGESQTGVFDITKYGANSNADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQ  60

Query  309   ALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIY  488
               L+GPCK+P+EL+I+ATLKAP +P+ ++   EWLT+N +D FT+SG G LDGQ      
Sbjct  61    VKLEGPCKSPLELQIQATLKAPSDPSQLKVG-EWLTVNKLDQFTMSGGGILDGQAAAAWE  119

Query  489   GQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPAD  668
              ++     K +KLPNNLS N L NS ++DIT+L+SK FHVNV   KNLTF +  + APA+
Sbjct  120   CKQSK---KCNKLPNNLSFNSLTNSTVKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPAN  176

Query  669   SHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTP  848
             S NTDGIH+++   V I DS   TGDDCIS+GD  E L I  VTCGPGHGISVGSLG  P
Sbjct  177   SPNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNP  236

Query  849   GEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCP  1028
              E+PV GV V +     TDNG+RIKTWP SHPGVV D+ +  I +++V NP+VIDQ YCP
Sbjct  237   DEKPVVGVFVSNCTVTNTDNGVRIKTWPASHPGVVNDVRFEDIIVQNVSNPVVIDQVYCP  296

Query  1029  NNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GA  1202
              N+C+K+ PS VKIS VS+ NIKGTS T++AV + CS GVPCE ++ GDI++T+ G  G 
Sbjct  297   FNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGP  356

Query  1203  AKTVCSNAKPKLTGKQTPPV  1262
             AK+ C N KP L GKQ PPV
Sbjct  357   AKSSCENIKPSLKGKQNPPV  376



>ref|XP_009780910.1| PREDICTED: polygalacturonase [Nicotiana sylvestris]
Length=402

 Score =   411 bits (1056),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 207/361 (57%), Positives = 261/361 (72%), Gaps = 6/361 (2%)
 Frame = +3

Query  186   KVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATL  365
             K  A  ++DIS  LL A+ EAC +T+PS IVIPKGTF M Q  L+GPCK+P+EL+I+ATL
Sbjct  32    KYGANSNADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQVKLEGPCKSPLELQIQATL  91

Query  366   KAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSL  545
             KAP +P+ ++   EWLT+N +D FT+SG G LDGQ       ++     K +KLPNNLS 
Sbjct  92    KAPSDPSQLKVG-EWLTVNKIDQFTMSGGGILDGQAAAAWECKQSK---KCNKLPNNLSF  147

Query  546   NFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKD  725
             N L NS ++DIT+L+SK FHVNV   KNLTF +  + APA+S NTDGIH+++   V I D
Sbjct  148   NSLTNSTVKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPANSPNTDGIHVSRSSSVNITD  207

Query  726   SVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTD  905
             S   TGDDCIS+GD  E L I  VTCGPGHGISVGSLG  P E+PV GV V++  F  TD
Sbjct  208   SNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNPDEKPVVGVFVRNCTFTNTD  267

Query  906   NGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSY  1085
             NG+RIKTWP SHPGVV D+H+  I +++V NP+VIDQ YCP N+C+K+ PS VKIS VS+
Sbjct  268   NGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPFNKCNKDLPSQVKISKVSF  327

Query  1086  TNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTPP  1259
              NIKGTS T++AV + CS GVPCE ++ GDI++T+ G  G AK+ C N KP L GKQ PP
Sbjct  328   QNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPAKSSCENIKPSLKGKQNPP  387

Query  1260  V  1262
             V
Sbjct  388   V  388



>emb|CDP18013.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   403 bits (1036),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 200/386 (52%), Positives = 257/386 (67%), Gaps = 4/386 (1%)
 Frame = +3

Query  117   TIFYCAFTFVLFLLADLG--ESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             T+      F   + A  G  +  +     +G +D+S  L  AW +AC +TT S I+IPKG
Sbjct  8     TLLCSWLFFTCIVQAQTGPIDVTQLGAKPDGSADMSQVLADAWKQACNSTTASTILIPKG  67

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
             TF +K+A L GPCKAP+E++I+  +KAP +P  +    EW+TI YVD  TLSG GTLDGQ
Sbjct  68    TFLLKEASLAGPCKAPVEIQIQGIIKAPEDPAQISKDNEWMTIKYVDQLTLSGGGTLDGQ  127

Query  471   GDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
             G       +     +  KLPN LSLNF+ N++IRD+TSLNSKLFHVN+FG  N+TFQ  T
Sbjct  128   GAKAWTQNECRVKTECSKLPNTLSLNFVNNTVIRDLTSLNSKLFHVNLFGCNNITFQHFT  187

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             I AP DS NTDGIHI     V I DS IGTGDDCISIGDG + +NI  VTCGPGHGISVG
Sbjct  188   ITAPGDSPNTDGIHIGHSTGVVITDSNIGTGDDCISIGDGAKQVNISKVTCGPGHGISVG  247

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVI  1010
             SLG+   E PV+G+ V D    GT NG+R+K+WP +  G  T++H+  I M++V NP++I
Sbjct  248   SLGRYDNELPVEGIFVTDCTISGTLNGVRVKSWPAAKSGSATNMHFEGIIMQNVSNPVII  307

Query  1011  DQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTF  1190
             DQEYCPNNQC+   PS VKI+ VS+ NI GTSAT  AV + CS  +PC+ V+  DI+L +
Sbjct  308   DQEYCPNNQCTNTAPSSVKIAQVSFKNITGTSATPAAVTLLCSKSIPCDGVEIADIDLAY  367

Query  1191  KG--GAAKTVCSNAKPKLTGKQTPPV  1262
              G  G   + C+N KP L+GK  PP+
Sbjct  368   NGNQGNVSSNCANVKPALSGKLNPPI  393



>emb|CDP04343.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   400 bits (1028),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 201/391 (51%), Positives = 261/391 (67%), Gaps = 5/391 (1%)
 Frame = +3

Query  105   R*MDTIFYCAFTFVLFLL-ADLG--ESAEFKVTAEGDSDISPELLKAWDEACAATTPSII  275
             R +D    C++ F   ++ A  G  +  +     +G +D+S  L  AW +AC +TT S I
Sbjct  3     RALDITLLCSWLFFTCIVQARTGPIDVIQLGAKRDGRADMSQVLANAWKQACNSTTASTI  62

Query  276   VIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDG  455
             +IPKGTF +K+A L GPCKAPI ++I+ T+KAP +P  +   KEW+TI YV+  TLSG G
Sbjct  63    LIPKGTFLLKEASLVGPCKAPITIQIQGTIKAPADPAQISKDKEWITIMYVNQLTLSGGG  122

Query  456   TLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLT  635
             TLDGQG       +     +  KLPN LSLNF+ N++IRD+TSLNSKLFHVN+F   N+T
Sbjct  123   TLDGQGAKAWTQNECRVKTECSKLPNTLSLNFVNNTVIRDLTSLNSKLFHVNLFACNNVT  182

Query  636   FQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGH  815
             FQ  TI AP DS NTDGIHI     V I +S IGTGDDCISIGDG + +NI  VTCGPGH
Sbjct  183   FQHFTITAPGDSPNTDGIHIGHSTGVVITNSNIGTGDDCISIGDGAKQVNISKVTCGPGH  242

Query  816   GISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVK  995
             GISVGSLG+   E PV+G+ V D    GT NG+R+K+WP S  G  T++H+  I M++V 
Sbjct  243   GISVGSLGRYDNELPVEGIFVTDCTISGTLNGVRVKSWPASKRGSATNMHFEGIIMQNVS  302

Query  996   NPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGD  1175
             NP++IDQEYCPNNQC+   PS VKI+ VS+ +I GTSAT  AV + CS  +PCE V+   
Sbjct  303   NPVIIDQEYCPNNQCTNTAPSRVKIAQVSFKHITGTSATPAAVTLLCSKSIPCEGVEVAH  362

Query  1176  INLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             I+L + G  G   + C+N KP L+GK  PP+
Sbjct  363   IDLAYNGKQGTLSSKCANVKPVLSGKLNPPI  393



>ref|XP_002282594.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   397 bits (1019),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 187/363 (52%), Positives = 251/363 (69%), Gaps = 3/363 (1%)
 Frame = +3

Query  180   EFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKA  359
             ++    +G+SDIS  LLKAW +AC++   S ++IP GT+ + Q ++ GPCKAPI   ++ 
Sbjct  32    KYGARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAGPCKAPINFVVQG  91

Query  360   TLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNL  539
             T+ AP + +    +  W+T   +D FTLSGDG  DGQG + ++G K  +    ++LP NL
Sbjct  92    TVMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKI-VWGTKCLSSAYCNQLPINL  150

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
               NF+ NS+++DITS +SK FH+N+ G KNLTF  I I AP +S NTDGIHI +   + I
Sbjct  151   RFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNIVISAPQESLNTDGIHIGRSSGINI  210

Query  720   KDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIG  899
              DS I TGDDC+SIGDG E +NI  VTCGPGHGISVGSLGK P EEPV G++VK+     
Sbjct  211   TDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGISVKNCTLTN  270

Query  900   TDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
             T NG+R+KTWP SH G  +++H+  I M +V NPI+IDQEYCP+NQC+ + PS +KISNV
Sbjct  271   TQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSPSRIKISNV  330

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQT  1253
             S+ NI+GT++T+ AV + CS GVPC DV+ GDINL + G  G A + C N KP L G Q 
Sbjct  331   SFRNIRGTTSTQVAVKLICSQGVPCHDVELGDINLEYNGNEGPAMSQCKNIKPNLLGVQL  390

Query  1254  PPV  1262
             P +
Sbjct  391   PRI  393



>ref|XP_007009871.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18681.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=400

 Score =   395 bits (1014),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 192/361 (53%), Positives = 251/361 (70%), Gaps = 4/361 (1%)
 Frame = +3

Query  183   FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKAT  362
             F   A G +DIS  L+ AW EACA  +PS +VIP+G + + Q  L GPCKAP+E++++  
Sbjct  34    FGAKAGGKTDISQALMAAWREACALVSPSKVVIPEGEYVLSQVTLAGPCKAPVEVQVRGN  93

Query  363   LKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKK-DTGFKSDKLPNNL  539
             LKAP +P+       W+T   +D FTLSG GT DGQG    + Q       K +KLP N+
Sbjct  94    LKAPADPSKFNNVPSWVTFQRIDHFTLSGAGTFDGQGGYAAWAQNDCKQSKKCNKLPINI  153

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
               NF+ N ++RDITS++SK FH+N+ G KNLTF  ITI AP  S NTDGIHI +   + I
Sbjct  154   RFNFVTNGLVRDITSVDSKQFHINLLGCKNLTFANITINAPDQSPNTDGIHIGRSSGIDI  213

Query  720   KDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIG  899
              DS I TGDDCIS+G G +N+ I  VTCGPGHGISVGSLGK   +EPV G+ V +   I 
Sbjct  214   TDSRISTGDDCISLGGGSQNITISRVTCGPGHGISVGSLGKYK-DEPVFGINVVNCALIN  272

Query  900   TDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
             T NG+R+KTWP S  G+ +D+H+  I M +V NP++IDQEYCP+N+C+ + PS VKISNV
Sbjct  273   TSNGVRVKTWPASLEGIASDMHFEDIVMVNVSNPVLIDQEYCPSNKCNLKAPSRVKISNV  332

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQT  1253
             S+ NI+GTSAT+ AV +ACSSG+PCE+V+ GDINL++ G  G A + CSN KP + G+QT
Sbjct  333   SFKNIRGTSATQVAVKLACSSGIPCENVEIGDINLSYIGTKGPATSQCSNVKPTIAGRQT  392

Query  1254  P  1256
             P
Sbjct  393   P  393



>ref|XP_006447720.1| hypothetical protein CICLE_v10015423mg [Citrus clementina]
 gb|ESR60960.1| hypothetical protein CICLE_v10015423mg [Citrus clementina]
 gb|KDO58459.1| hypothetical protein CISIN_1g015254mg [Citrus sinensis]
Length=410

 Score =   394 bits (1013),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/357 (52%), Positives = 255/357 (71%), Gaps = 2/357 (1%)
 Frame = +3

Query  195   AEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAP  374
             A+ ++DIS  L  AW EACAATTPS ++IP+GT+Q+    ++GPCKA IEL++K TLKA 
Sbjct  31    AKQNADISQALRDAWKEACAATTPSKVLIPQGTYQLSPVTMEGPCKAAIELQVKGTLKAL  90

Query  375   PNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFL  554
              +P +++    W++ N ++  T+SG GT DGQG V     +KD   K   + +NLS N +
Sbjct  91    TDPANVKDAGSWVSFNKIEHLTVSGGGTFDGQGAVAPSECEKDDYCKKRPIVSNLSFNAI  150

Query  555   KNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVI  734
              NS+++D+TSLNSK FH+NV G KN TFQ++T+ AP +S NTDGIH+ +   VTI DS I
Sbjct  151   TNSVVQDVTSLNSKQFHINVIGAKNFTFQRVTVTAPEESLNTDGIHVGRSSGVTITDSKI  210

Query  735   GTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGL  914
             GTGDDCISIGDG + + I+ + CGPGHGISVGSLGK   E+PV G+ V++     T NG+
Sbjct  211   GTGDDCISIGDGTQQMEINKIDCGPGHGISVGSLGKYQNEQPVVGIRVRECNISNTSNGV  270

Query  915   RIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNI  1094
             RIKTWP S+PG  +D+H+  I+M +V NPI++DQ YCP+NQC+ + PS VK+  VS+ NI
Sbjct  271   RIKTWPASYPGTASDLHFEDIKMNNVSNPILLDQVYCPHNQCNAKVPSRVKLDRVSFKNI  330

Query  1095  KGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTPP  1259
             +GTSAT  A+ +ACS GVPCE V+  DI+LT+ G  G  K+ C+N +PK +GK  PP
Sbjct  331   RGTSATAVAIKLACSGGVPCEGVELADISLTYTGPEGPIKSECTNIQPKTSGKMNPP  387



>ref|XP_002282573.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   393 bits (1010),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/363 (51%), Positives = 250/363 (69%), Gaps = 3/363 (1%)
 Frame = +3

Query  180   EFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKA  359
             ++    +G+SDIS  LLKAW +AC++   S ++IP GT+ + Q ++ GPCKAPI   ++ 
Sbjct  32    KYGARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAGPCKAPINFVVQG  91

Query  360   TLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNL  539
             T+ AP + +    +  W+T   +D FTLSGDG  DGQG   ++G K  +    ++LP NL
Sbjct  92    TVMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKT-VWGTKCLSSSYCNQLPINL  150

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
               NF+ NS+++DITS +SK FH+N+ G KNLTF  + I AP +S NTDGIHI +   + I
Sbjct  151   RFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNVVISAPQESLNTDGIHIGRSSGINI  210

Query  720   KDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIG  899
              DS I TGDDC+SIGDG E +NI  VTCGPGHGISVGSLGK P EEPV G++VK+     
Sbjct  211   TDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGISVKNCTLTN  270

Query  900   TDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
             T NG+R+KTWP SH G  +++H+  I M +V NPI+IDQEYCP+NQC+ + PS +KISNV
Sbjct  271   TQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSPSRIKISNV  330

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQT  1253
             S+ NI+GT++T+ AV + CS G PC+DV+ GDINL + G  G A + C N KP L G Q 
Sbjct  331   SFRNIRGTTSTQVAVKLICSQGEPCQDVELGDINLEYNGNEGPAMSQCKNIKPNLLGVQL  390

Query  1254  PPV  1262
             P +
Sbjct  391   PRI  393



>gb|KHN24677.1| Polygalacturonase [Glycine soja]
Length=389

 Score =   393 bits (1009),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 200/382 (52%), Positives = 247/382 (65%), Gaps = 21/382 (5%)
 Frame = +3

Query  141   FVLFLLADLGESAEFKVTAEGDSDIS-----------PELLKAWDEACAATTPSIIVIPK  287
             F LFLL       +F    +GD DIS              L AW +ACA+ T   IVIP 
Sbjct  10    FSLFLL-------DFGFAQQGDLDISRFGGKPNTNIGQAFLSAWTQACASPTAVKIVIPA  62

Query  288   GTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDG  467
             GT+QM    +KGPCKAPIE+++  T++AP NP D++   +W  + YV+ FTLSG G  DG
Sbjct  63    GTYQMGAVDVKGPCKAPIEVQVDGTIQAPANPTDLKAAHQWFVVQYVNSFTLSGKGVFDG  122

Query  468   QGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKI  647
             QG          T      L  N   NFL NSI+RDITS +SK FHVNV G  N TF   
Sbjct  123   QGATAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNFTFDGF  182

Query  648   TIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISV  827
              + AP DS NTDGIHI +  DV I ++ I TGDDC+S+GDG +N+ +  V CGPGHGISV
Sbjct  183   KVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGCKNITVQNVNCGPGHGISV  242

Query  828   GSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV--VTDIHYHKIEMEDVKNP  1001
             GSLGK   EEPV G+ VK+    GTDNG+RIKTWPN+ PG   +TD+H+  + M +V NP
Sbjct  243   GSLGKYDAEEPVAGLLVKNCTLNGTDNGVRIKTWPNT-PGAITITDMHFEDLTMNNVTNP  301

Query  1002  IVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDIN  1181
             I+IDQEYCP NQCSK+ PS +KIS VS+ NIKGTS T+E V++ CSSGVPCE V+  DI+
Sbjct  302   IIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGTKEGVVLVCSSGVPCEAVEMADID  361

Query  1182  LTFKGGAAKTVCSNAKPKLTGK  1247
             LTF G AA   C+N KP +TGK
Sbjct  362   LTFNGSAATAKCANVKPTITGK  383



>ref|XP_003552049.1| PREDICTED: polygalacturonase [Glycine max]
Length=389

 Score =   392 bits (1008),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 200/382 (52%), Positives = 247/382 (65%), Gaps = 21/382 (5%)
 Frame = +3

Query  141   FVLFLLADLGESAEFKVTAEGDSDIS-----------PELLKAWDEACAATTPSIIVIPK  287
             F LFLL       +F    +GD DIS              L AW +ACA+ T   IVIP 
Sbjct  10    FSLFLL-------DFGFAQQGDLDISRFGGKPNTNIGQAFLSAWTQACASPTTVKIVIPA  62

Query  288   GTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDG  467
             GT+QM    +KGPCKAPIE+++  T++AP NP D++   +W  + YV+ FTLSG G  DG
Sbjct  63    GTYQMGAVDVKGPCKAPIEVQVDGTIQAPANPTDLKAAHQWFVVQYVNSFTLSGKGVFDG  122

Query  468   QGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKI  647
             QG          T      L  N   NFL NSI+RDITS +SK FHVNV G  N TF   
Sbjct  123   QGATAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNFTFDGF  182

Query  648   TIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISV  827
              + AP DS NTDGIHI +  DV I ++ I TGDDC+S+GDG +N+ +  V CGPGHGISV
Sbjct  183   KVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGCKNITVQNVNCGPGHGISV  242

Query  828   GSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV--VTDIHYHKIEMEDVKNP  1001
             GSLGK   EEPV G+ VK+    GTDNG+RIKTWPN+ PG   +TD+H+  + M +V NP
Sbjct  243   GSLGKYDAEEPVAGLLVKNCTLNGTDNGVRIKTWPNT-PGAITITDMHFEDLTMNNVMNP  301

Query  1002  IVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDIN  1181
             I+IDQEYCP NQCSK+ PS +KIS VS+ NIKGTS T+E V++ CSSGVPCE V+  DI+
Sbjct  302   IIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGTKEGVVLVCSSGVPCEAVEMADID  361

Query  1182  LTFKGGAAKTVCSNAKPKLTGK  1247
             LTF G AA   C+N KP +TGK
Sbjct  362   LTFNGSAATAKCANVKPTITGK  383



>ref|XP_006469749.1| PREDICTED: polygalacturonase-like [Citrus sinensis]
Length=408

 Score =   393 bits (1010),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 189/357 (53%), Positives = 255/357 (71%), Gaps = 4/357 (1%)
 Frame = +3

Query  195   AEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAP  374
             A+ ++DIS  L  AW EACAATTPS ++IP+GT+Q+    ++GPCKA IEL++K TLKA 
Sbjct  31    AKQNADISQALRDAWKEACAATTPSKVLIPQGTYQLSPVTMEGPCKAAIELQVKGTLKAL  90

Query  375   PNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFL  554
              +P +++    W++ N ++  T+SG GT DGQG V     +KD   K  K P NLS N +
Sbjct  91    TDPANVKDAGSWVSFNKIEHLTVSGGGTFDGQGAVAPSECEKDDYCK--KRPINLSFNAI  148

Query  555   KNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVI  734
              NS+++D+TSLNSK FH+NV G KN TFQ++T+ AP +S NTDGIH+ +   VTI DS I
Sbjct  149   TNSVVQDVTSLNSKQFHINVIGAKNFTFQRVTVTAPEESLNTDGIHVGRSSGVTITDSKI  208

Query  735   GTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGL  914
             GTGDDCISIGDG + + I+ + CGPGHGISVGSLGK   E+PV G+ V++     T NG+
Sbjct  209   GTGDDCISIGDGTQQMEINKIDCGPGHGISVGSLGKYQNEQPVVGIRVRECNISNTSNGV  268

Query  915   RIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNI  1094
             RIKTWP S+PG  +D+H+  I+M +V NPI++DQ YCP+NQC+ + PS VK+  VS+ NI
Sbjct  269   RIKTWPASYPGTASDLHFEDIKMNNVSNPILLDQVYCPHNQCNAKVPSRVKLDRVSFKNI  328

Query  1095  KGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTPP  1259
             +GTSAT  A+ +ACS GVPCE V+  DI+LT+ G  G  K+ C+N +PK +GK  PP
Sbjct  329   RGTSATAVAIKLACSGGVPCEGVELADISLTYTGPEGPIKSECTNIQPKTSGKMNPP  385



>ref|XP_003522976.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   392 bits (1008),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 196/379 (52%), Positives = 249/379 (66%), Gaps = 4/379 (1%)
 Frame = +3

Query  117   TIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTF  296
             TIF+  F  + F  A  G+    +   + +++I    L AW +ACA+ T   IVIP GT+
Sbjct  7     TIFFSLF-LLDFGFAQQGDLDISRFGGKPNTNIGQAFLSAWTQACASPTAVKIVIPAGTY  65

Query  297   QMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGD  476
             QM    +KGPCKAPIE+++  T++AP NP D++   +W  + YV+ FTLSG G  DGQG 
Sbjct  66    QMGAVDVKGPCKAPIEVQVDGTIQAPANPTDLKAAHQWFVVQYVNSFTLSGKGVFDGQGA  125

Query  477   VQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIK  656
                      T      L  N   NFL NSI+RDITS +SK FHVNV G  N TF    + 
Sbjct  126   TAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNFTFDGFKVS  185

Query  657   APADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSL  836
             AP DS NTDGIHI +  DV I ++ I TGDDC+S+GDG +N+ +  V CGPGHGISVGSL
Sbjct  186   APKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGCKNITVQNVNCGPGHGISVGSL  245

Query  837   GKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV--VTDIHYHKIEMEDVKNPIVI  1010
             GK   EEPV G  VK+    GTDNG+RIKTWPN+ PG   +TD+H+  + M +V NPI+I
Sbjct  246   GKYDSEEPVAGFLVKNCTLNGTDNGVRIKTWPNT-PGAITITDMHFEDLTMNNVTNPIII  304

Query  1011  DQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTF  1190
             DQEYCP NQCSK+ PS +KIS VS+ NIKGTS ++E V++ CSSGVPCE V+  DI+LTF
Sbjct  305   DQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEGVEMADIDLTF  364

Query  1191  KGGAAKTVCSNAKPKLTGK  1247
              G AA   C+N KP +TGK
Sbjct  365   NGAAATAKCANVKPTITGK  383



>ref|XP_003522977.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   392 bits (1007),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 196/379 (52%), Positives = 249/379 (66%), Gaps = 4/379 (1%)
 Frame = +3

Query  117   TIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTF  296
             TIF+  F  + F  A  G+    +   + +++I    L AW +ACA+ T   IVIP GT+
Sbjct  7     TIFFSLF-LLDFGFAQQGDLDISRFGGKPNTNIGQAFLSAWTQACASPTAVKIVIPAGTY  65

Query  297   QMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGD  476
             QM    +KGPCKAPIE+++  T++AP NP D++   +W  + YV+ FTLSG G  DGQG 
Sbjct  66    QMGAVDVKGPCKAPIEVQVDGTIQAPTNPTDLKAAHQWFVVQYVNSFTLSGKGVFDGQGA  125

Query  477   VQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIK  656
                      T      L  N   NFL NSI+RDITS +SK FHVNV G  N TF    + 
Sbjct  126   TAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNFTFDGFKVS  185

Query  657   APADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSL  836
             AP DS NTDGIHI +  DV I ++ I TGDDC+S+GDG +N+ +  V CGPGHGISVGSL
Sbjct  186   APKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGCKNITVQNVNCGPGHGISVGSL  245

Query  837   GKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV--VTDIHYHKIEMEDVKNPIVI  1010
             GK   EEPV G  VK+    GTDNG+RIKTWPN+ PG   +TD+H+  + M +V NPI+I
Sbjct  246   GKYDSEEPVAGFLVKNCTLNGTDNGVRIKTWPNT-PGAITITDMHFEDLTMNNVTNPIII  304

Query  1011  DQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTF  1190
             DQEYCP NQCSK+ PS +KIS VS+ NIKGTS ++E V++ CSSGVPCE V+  DI+LTF
Sbjct  305   DQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEGVEMADIDLTF  364

Query  1191  KGGAAKTVCSNAKPKLTGK  1247
              G AA   C+N KP +TGK
Sbjct  365   NGAAATAKCANVKPTITGK  383



>emb|CBI22050.3| unnamed protein product [Vitis vinifera]
Length=414

 Score =   389 bits (999),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 247/357 (69%), Gaps = 3/357 (1%)
 Frame = +3

Query  180   EFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKA  359
             ++    +G+SDIS  LLKAW +AC++   S ++IP GT+ + Q ++ GPCKAPI   ++ 
Sbjct  32    KYGARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAGPCKAPINFVVQG  91

Query  360   TLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNL  539
             T+ AP + +    +  W+T   +D FTLSGDG  DGQG   ++G K  +    ++LP NL
Sbjct  92    TVMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKT-VWGTKCLSSSYCNQLPINL  150

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
               NF+ NS+++DITS +SK FH+N+ G KNLTF  + I AP +S NTDGIHI +   + I
Sbjct  151   RFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNVVISAPQESLNTDGIHIGRSSGINI  210

Query  720   KDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIG  899
              DS I TGDDC+SIGDG E +NI  VTCGPGHGISVGSLGK P EEPV G++VK+     
Sbjct  211   TDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGISVKNCTLTN  270

Query  900   TDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
             T NG+R+KTWP SH G  +++H+  I M +V NPI+IDQEYCP+NQC+ + PS +KISNV
Sbjct  271   TQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSPSRIKISNV  330

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTG  1244
             S+ NI+GT++T+ AV + CS G PC+DV+ GDINL + G  G A + C N KP L G
Sbjct  331   SFRNIRGTTSTQVAVKLICSQGEPCQDVELGDINLEYNGNEGPAMSQCKNIKPNLLG  387



>gb|KHN15656.1| Polygalacturonase, partial [Glycine soja]
Length=350

 Score =   386 bits (991),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 188/343 (55%), Positives = 233/343 (68%), Gaps = 3/343 (1%)
 Frame = +3

Query  225   LLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKK  404
              L AW +ACA+ T   IVIP GT+QM    +KGPCKAPIE+++  T++AP NP D++   
Sbjct  3     FLSAWTQACASPTAVKIVIPAGTYQMGAVDVKGPCKAPIEVQVDGTIQAPANPTDLKAAH  62

Query  405   EWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITS  584
             +W  + YV+ FTLSG G  DGQG          T      L  N   NFL NSI+RDITS
Sbjct  63    QWFVVQYVNSFTLSGKGVFDGQGATAWKQNDCTTNKNCKMLCMNFGFNFLNNSIVRDITS  122

Query  585   LNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIG  764
              +SK FHVNV G  N TF    + AP DS NTDGIHI +  DV I ++ I TGDDC+S+G
Sbjct  123   KDSKNFHVNVLGCNNFTFDGFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLG  182

Query  765   DGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHP  944
             DG +N+ +  V CGPGHGISVGSLGK   EEPV G  VK+    GTDNG+RIKTWPN+ P
Sbjct  183   DGCKNITVQNVNCGPGHGISVGSLGKYDSEEPVAGFLVKNCTLNGTDNGVRIKTWPNT-P  241

Query  945   GV--VTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEE  1118
             G   +TD+H+  + M +V NPI+IDQEYCP NQCSK+ PS +KIS VS+ NIKGTS ++E
Sbjct  242   GAITITDMHFEDLTMNNVTNPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQE  301

Query  1119  AVIIACSSGVPCEDVKFGDINLTFKGGAAKTVCSNAKPKLTGK  1247
              V++ CSSGVPCE V+  DI+LTF G AA   C+N KP +TGK
Sbjct  302   GVVLVCSSGVPCEAVEMADIDLTFNGSAATAKCANVKPTITGK  344



>ref|XP_003522975.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   387 bits (994),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 194/379 (51%), Positives = 248/379 (65%), Gaps = 4/379 (1%)
 Frame = +3

Query  117   TIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTF  296
             TIF+  F  + F  A  G+    +   + +++I    L AW +ACA+ T   IVIP GT+
Sbjct  7     TIFFSLF-LLDFGFAQQGDLDISRFGGKPNTNIGQAFLSAWTQACASPTAVKIVIPAGTY  65

Query  297   QMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGD  476
             QM    +KGPCKAPIE+++  T++AP NP D++   +W  + YV+ FTLSG G  DGQG 
Sbjct  66    QMGAVDVKGPCKAPIEVQVDGTIQAPANPTDLKAAHQWFVVQYVNSFTLSGKGVFDGQGA  125

Query  477   VQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIK  656
                      T      L  N   NFL NSI+RDITS +SK FHVNV G  N TF    + 
Sbjct  126   TAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNFTFDGFKVS  185

Query  657   APADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSL  836
             AP DS NTDGIHI +  DV I ++ I TGDDC+S+GDG +N+ +  V CGPGHGISVGSL
Sbjct  186   APKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGSKNITVQNVNCGPGHGISVGSL  245

Query  837   GKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV--VTDIHYHKIEMEDVKNPIVI  1010
             GK   EEPV G  VK+     TDNG+RIKTWPN+ PG   +TD+H+  + M +V NPI+I
Sbjct  246   GKYDSEEPVAGFLVKNCTLNETDNGVRIKTWPNT-PGAITITDMHFEDLTMNNVTNPIII  304

Query  1011  DQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTF  1190
             DQEYCP NQCSK+ PS +KIS VS+ NIKGTS +++ V++ CSSGVPCE V+  DI+LTF
Sbjct  305   DQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQDGVVLVCSSGVPCEGVEMADIDLTF  364

Query  1191  KGGAAKTVCSNAKPKLTGK  1247
              G AA   C+N KP +TGK
Sbjct  365   NGAAATAKCANVKPTITGK  383



>ref|XP_010999485.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   387 bits (993),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 198/382 (52%), Positives = 251/382 (66%), Gaps = 8/382 (2%)
 Frame = +3

Query  135   FTFVLFLLADLGESAE----FKVTAEG-DSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
              +F LFLL      A+    F VT  G D DI+  L  AW +ACA+T PS ++IP GT+ 
Sbjct  11    ISFSLFLLLASTAKAQSKGVFDVTKYGADKDITEALTNAWKDACASTNPSKVLIPSGTYS  70

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
             +++  L GPCKA IEL++   LKAP +PN       W+   YVD FTLSG GT DGQG V
Sbjct  71    LRKLTLAGPCKAAIELQVDGILKAPVDPNQFS-GGHWVNFRYVDKFTLSGSGTFDGQGKV  129

Query  480   QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKA  659
                          D LP N+  +F+ N+++RDIT+ +SK FHVNV G KNLTFQ  T+ A
Sbjct  130   AWSKSTCQKDKDCDSLPMNIRFDFITNALVRDITTRDSKNFHVNVLGCKNLTFQHFTVSA  189

Query  660   PADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLG  839
             P DS NTDGIH+ +   + I DS IGTGDDCIS+GDG E L+I  VTCGPGHGISVGSLG
Sbjct  190   PGDSVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITRVTCGPGHGISVGSLG  249

Query  840   KTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQE  1019
             K P E+PV G+ VK      T NG+RIK+WP  + GV +++H+  I M +V+NP++IDQ 
Sbjct  250   KYPNEKPVSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQV  309

Query  1020  YCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG-  1196
             YCP NQCS + PS VKIS+VS+ NI+GTSAT   V IACSSG+PCE V+  DI L + G 
Sbjct  310   YCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVELADIKLAYSGP  369

Query  1197  -GAAKTVCSNAKPKLTGKQTPP  1259
              G  K+ CSN KP ++G  + P
Sbjct  370   DGPPKSQCSNVKPMISGIMSAP  391



>ref|XP_002274096.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28389.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   386 bits (992),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 191/369 (52%), Positives = 247/369 (67%), Gaps = 5/369 (1%)
 Frame = +3

Query  162   DLGESAEFKVTAEG----DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPC  329
             ++ E A F VT  G     SDIS  LL AW EACA+ TPS +++P GT+ + Q   +GPC
Sbjct  21    EVSEGASFDVTKHGAKADGSDISQALLAAWKEACASPTPSSVLVPAGTYGLGQICFEGPC  80

Query  330   KAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTG  509
             KAPI L ++ TLKAP +  + +    W+    +D FTLSG G  DGQG   ++G+K    
Sbjct  81    KAPINLIVEGTLKAPVDTKNFKADAGWVAFQNIDHFTLSGKGVFDGQGPA-VWGKKCARS  139

Query  510   FKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGI  689
                  LP NL  NFL NS++RD+T+ +SK FHVNV G KNL+F   T+ AP +S NTDGI
Sbjct  140   SYCGALPINLKFNFLTNSMVRDVTTKDSKQFHVNVLGCKNLSFYHFTVSAPEESLNTDGI  199

Query  690   HIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKG  869
             HI +   + I ++ I TGDDCISIGDG E + ID VTCGPGHGISVGSLGK   E PV G
Sbjct  200   HIGRSSGINITNTNIKTGDDCISIGDGSEQITIDQVTCGPGHGISVGSLGKYANEAPVVG  259

Query  870   VTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKE  1049
             + V  S    T NG+R+KTWP S  G+ +++H+  I M +V NPI+IDQEYCP +QC ++
Sbjct  260   IKVTGSTLTNTQNGIRVKTWPASPAGIASNMHFEDIIMNNVGNPILIDQEYCPYSQCKQQ  319

Query  1050  KPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGGAAKTVCSNAK  1229
              PS VKIS+V++ NI+GTS+TE AV + CSSGVPC++V+  DINL F GGA  ++C N K
Sbjct  320   IPSRVKISDVTFKNIRGTSSTELAVKLVCSSGVPCQNVQLTDINLKFNGGAPTSICKNVK  379

Query  1230  PKLTGKQTP  1256
             P L G Q P
Sbjct  380   PILGGVQQP  388



>ref|XP_006371366.1| hypothetical protein POPTR_0019s09500g [Populus trichocarpa]
 gb|ERP49163.1| hypothetical protein POPTR_0019s09500g [Populus trichocarpa]
Length=393

 Score =   385 bits (990),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 197/381 (52%), Positives = 251/381 (66%), Gaps = 8/381 (2%)
 Frame = +3

Query  138   TFVLFLLADLGESAE----FKVTAEG-DSDISPELLKAWDEACAATTPSIIVIPKGTFQM  302
             +F LFLL      A+    F VT  G D DI+  L  AW +ACA+T PS ++IP GT+ +
Sbjct  12    SFSLFLLLASTAKAQSKGVFDVTKYGSDKDITEALTNAWKDACASTNPSKVLIPSGTYSL  71

Query  303   KQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQ  482
             ++  L GPCKA IEL++   LKAP +PN       W+   +VD FTLSG GT DGQG   
Sbjct  72    RKLTLAGPCKAAIELQVDGMLKAPVDPNQFS-GGHWVNFGHVDKFTLSGSGTFDGQGKAA  130

Query  483   IYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAP  662
                         D LP NL  +F+ N+++RDIT+ +SK FHVNV G KNLTFQ  T+ AP
Sbjct  131   WSKSTCQKDKDCDSLPMNLRFDFITNALVRDITTRDSKNFHVNVLGCKNLTFQHFTVSAP  190

Query  663   ADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGK  842
              +S NTDGIH+ +   + I DS IGTGDDCIS+GDG E L+I GVTCGPGHGISVGSLGK
Sbjct  191   GESVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITGVTCGPGHGISVGSLGK  250

Query  843   TPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEY  1022
              P E+PV G+ VK+     T NG+RIK+WP  + GV +++H+  I M +V+NP++IDQ Y
Sbjct  251   YPNEKPVSGIFVKNCTLSDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQVY  310

Query  1023  CPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--  1196
             CP NQCS + PS VKIS VS+ NI+GTSAT   V IACSSG PCE V+  DI + + G  
Sbjct  311   CPWNQCSLKAPSKVKISGVSFKNIRGTSATPVVVQIACSSGFPCEKVELADIKVAYSGPD  370

Query  1197  GAAKTVCSNAKPKLTGKQTPP  1259
             G AK+ CSN KP ++G  + P
Sbjct  371   GPAKSQCSNVKPIISGTMSAP  391



>ref|XP_010040513.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW45154.1| hypothetical protein EUGRSUZ_L01230 [Eucalyptus grandis]
Length=396

 Score =   385 bits (990),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 190/370 (51%), Positives = 251/370 (68%), Gaps = 9/370 (2%)
 Frame = +3

Query  177   AEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIK  356
             A +    +G SDIS  LL AW EACA+TTP+ ++IP GTF + +  L GPCKAP+E +++
Sbjct  28    ATYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFELQ  87

Query  357   ATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQK---KDTGFKSDKL  527
              TLKAP +P+  +    W+   ++D  T+SG GT DGQG    +GQ    K+T  ++  L
Sbjct  88    GTLKAPADPSLFK-TDGWVVFQHIDGLTMSGGGTFDGQGKTA-WGQNDCAKNTNCRT--L  143

Query  528   PNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKIC  707
             P NL  NF+ N++I D+T+L+SK F VNV G KN+TFQ   + APADS NTDGIHI +  
Sbjct  144   PTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRSD  203

Query  708   DVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDS  887
              V I DS I TGDDC+S+GDG   + + GVTCGPGHGISVGSLGK   EEPV+GV V + 
Sbjct  204   GVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTNC  263

Query  888   KFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVK  1067
               IG DNG+RIKTWP S PG  +D+H+  I+M++V NP+++DQ YCP NQC    PSL+K
Sbjct  264   TIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAGVPSLIK  323

Query  1068  ISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLT  1241
             IS VS+  I+GTSA++ AV + CS  VPCE+V+  DI+L + G  G A + C+N KP L+
Sbjct  324   ISKVSFKKIRGTSASQVAVKVLCSRSVPCEEVEIADIDLVYNGPEGPATSECANVKPVLS  383

Query  1242  GKQTPPVTCK  1271
             GK  P    K
Sbjct  384   GKLNPAACAK  393



>ref|XP_010999488.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   385 bits (989),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 195/385 (51%), Positives = 258/385 (67%), Gaps = 8/385 (2%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAE----FKVTAEG-DSDISPELLKAWDEACAATTPSII  275
             ++ +     +F LFLL      A+    F VT  G   DI+  L  AW +ACA+T PS +
Sbjct  3     LEVVSSAIISFSLFLLLASTTQAQSNGVFDVTKYGAGKDITEALANAWKDACASTKPSKV  62

Query  276   VIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDG  455
             +IP+GT+ +++  + GPCKA I+L++   L+AP +PN +    +W+   YVD FTLSG G
Sbjct  63    LIPRGTYWLRKVTIAGPCKAAIKLQVDGILQAPVDPNKLS-GGDWVNFRYVDQFTLSGSG  121

Query  456   TLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLT  635
             T DGQG V               LP N+  +++ N+++RDIT+L+SK FHVNV G KNLT
Sbjct  122   TFDGQGKVAWSRSTCHRDKNCKGLPMNMRFDYITNALVRDITTLDSKNFHVNVLGCKNLT  181

Query  636   FQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGH  815
             FQ  T++AP +S NTDGIHI +   + I DS I TGDDCIS+GDG E L+I GVTCGPGH
Sbjct  182   FQHFTVRAPRESVNTDGIHIGRSTGIYIIDSKISTGDDCISVGDGTEELHITGVTCGPGH  241

Query  816   GISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVK  995
             GISVGSLGK P E+PV G+ VK+     T NG+RIK+WP  + GV +++H+  I M +V+
Sbjct  242   GISVGSLGKYPNEKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQ  301

Query  996   NPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGD  1175
             NP++IDQ YCP NQCS + PS VKIS+VS+ NI+GTSAT   V IACSSG PCE VK  +
Sbjct  302   NPVIIDQGYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGFPCEKVKLAN  361

Query  1176  INLTFK--GGAAKTVCSNAKPKLTG  1244
             INL +K  GG AK+ CSN KP ++G
Sbjct  362   INLAYKGPGGPAKSQCSNVKPIISG  386



>dbj|BAA89477.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   385 bits (988),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 190/357 (53%), Positives = 246/357 (69%), Gaps = 4/357 (1%)
 Frame = +3

Query  183   FKVTAEG-DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKA  359
             F VT  G   DI+  L  AW +ACA+T PS ++IP GT+ ++Q  L GPCKA IEL++  
Sbjct  31    FDVTKYGGKEDITEALNNAWKDACASTNPSKVLIPSGTYSLRQVTLAGPCKAAIELQVNG  90

Query  360   TLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNL  539
              LKAP NP D      W+   Y+D  TLSG GT DGQG+V             + LP N+
Sbjct  91    ILKAPVNP-DQFSGSHWVNFRYIDQLTLSGSGTFDGQGNVAWSKSTCSKNKNCEGLPMNI  149

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
               +F+ N ++RDIT+ +SK FHVNV G KNLTFQ  T+ APA+S NTDGIHI +   + I
Sbjct  150   RFDFITNGLVRDITTRDSKNFHVNVLGCKNLTFQHFTVTAPAESINTDGIHIGRSTGIYI  209

Query  720   KDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIG  899
              DS IGTGDDCIS+GDG E L++ GVTCGPGHGISVGSLG+ P E+PV G+ VK+     
Sbjct  210   IDSKIGTGDDCISVGDGTEELHVTGVTCGPGHGISVGSLGRYPNEKPVSGIFVKNCTISN  269

Query  900   TDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
             T NG+RIK+WP+ + GV +++H+  I M +V+NPI++DQ YCP NQCS + PS VKIS+V
Sbjct  270   TANGVRIKSWPDLYGGVASNMHFEDIVMNNVQNPILLDQVYCPWNQCSLKAPSKVKISDV  329

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTG  1244
             S+ NI+GTSAT   V +ACSSG+PCE V+  +INL + G  G AK+ CSN KPK++G
Sbjct  330   SFKNIRGTSATPVVVKLACSSGIPCEKVELANINLLYSGSEGPAKSQCSNVKPKISG  386



>ref|XP_010999532.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=384

 Score =   384 bits (987),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 197/372 (53%), Positives = 247/372 (66%), Gaps = 8/372 (2%)
 Frame = +3

Query  138   TFVLFLLADLGESAE----FKVTAEG-DSDISPELLKAWDEACAATTPSIIVIPKGTFQM  302
             +F +FLL      A+    F VT  G D DI+  L  AW +ACA+T PS ++IP GT+ +
Sbjct  12    SFSIFLLLSSTAKAQSKGVFDVTKYGADKDITEALTNAWKDACASTNPSKVLIPSGTYSL  71

Query  303   KQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQ  482
             ++  L GPCKA IEL++   LKAP +PN       W+   YVD FTLSG GT DGQG V 
Sbjct  72    RKLTLAGPCKAAIELQVDGILKAPVDPNQFS-GGHWVNFRYVDKFTLSGSGTFDGQGKVA  130

Query  483   IYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAP  662
                         D LP N+  +F+ N+++RDIT+ +SK FHVNV G KNLTFQ  T+ AP
Sbjct  131   WSKSTCQKDKDCDSLPMNIRFDFITNALVRDITTRDSKNFHVNVLGCKNLTFQHFTVSAP  190

Query  663   ADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGK  842
              DS NTDGIH+ +   + I DS IGTGDDCIS+GDG E L+I  VTCGPGHGISVGSLGK
Sbjct  191   GDSVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITRVTCGPGHGISVGSLGK  250

Query  843   TPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEY  1022
              P E+P  G+ VK      T NG+RIK+WP  + GV +++H+  I M +V+NP++IDQ Y
Sbjct  251   YPNEKPFSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQVY  310

Query  1023  CPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFK--G  1196
             CP NQCS + PS VKIS+VS+ NI+GTSAT   V IACSSG PCE VK  +INL +K  G
Sbjct  311   CPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGFPCEKVKLANINLAYKGPG  370

Query  1197  GAAKTVCSNAKP  1232
             G AK+ CSN KP
Sbjct  371   GPAKSQCSNVKP  382



>ref|XP_010536243.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score =   385 bits (989),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 178/362 (49%), Positives = 250/362 (69%), Gaps = 2/362 (1%)
 Frame = +3

Query  177   AEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIK  356
             A + +    D DI+     AW  AC++T+PS +++PKGT+ ++Q + +GPCKAP+EL++ 
Sbjct  36    ANYGLKGTEDEDITKAFSVAWKAACSSTSPSKLIVPKGTYVLRQVVFEGPCKAPLELQVH  95

Query  357   ATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNN  536
              T+KAP +P+D   K  W++   +D F L G+GT DGQG             + +KLP N
Sbjct  96    GTIKAPEDPSDFIEKAGWISFQRIDRFALVGNGTFDGQGSTAWSQNDCHKTGECNKLPIN  155

Query  537   LSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVT  716
             +  NF+ N +++DITSLNSKLFH+NV G  NLTF ++ IKAP DS NTDGIHI +  ++ 
Sbjct  156   IRFNFITNGLVQDITSLNSKLFHINVLGCNNLTFSRVNIKAPEDSPNTDGIHIGRSKNIN  215

Query  717   IKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFI  896
             I DSV+ TGDDCIS+G G EN+ I+ V CGPGHGISVGSLG+   EEPV G+ V++  F 
Sbjct  216   ITDSVMSTGDDCISMGRGSENIAIERVKCGPGHGISVGSLGRYTKEEPVSGIIVRNCTFF  275

Query  897   GTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISN  1076
              TDNG+R+KTW +S   + T +++  I + +V NP+VIDQEYCP N C  +KPS VK+SN
Sbjct  276   NTDNGVRVKTWMSSEKAIATGLYFQDIAVVNVSNPVVIDQEYCPYNHCKAKKPSQVKLSN  335

Query  1077  VSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQ  1250
             +S+ NI GTS+T+ A+ +ACSSGVPCE+V+  DI++ + G  G + + C+N  PK+ GKQ
Sbjct  336   ISFRNIHGTSSTQMAMKLACSSGVPCENVEISDIDIKYTGSDGDSMSDCTNVSPKIFGKQ  395

Query  1251  TP  1256
              P
Sbjct  396   YP  397



>ref|XP_007009872.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18682.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=399

 Score =   385 bits (988),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 252/362 (70%), Gaps = 7/362 (2%)
 Frame = +3

Query  183   FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKAT  362
             F   A+G +DIS  L+ AW +ACA  +PS +VIP+G + + Q  L GPCKAP+E++++ T
Sbjct  34    FGAKADGKTDISQALMAAWRKACAVVSPSKVVIPEGEYILSQVTLAGPCKAPLEVQVRGT  93

Query  363   LKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQK--KDTGFKSDKLPNN  536
             LKA  +P+       W+T   +D FTLSG GT DGQG    + Q   K  G + +KLP N
Sbjct  94    LKATADPSKFNNVPTWVTFQRIDRFTLSGAGTFDGQGGKAAWAQNDCKQVG-RCNKLPIN  152

Query  537   LSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVT  716
             L  N + N ++RDITS++SK  H+N+   KNLTF  IT+ APA S NTDGIHI +   + 
Sbjct  153   LRFNAVTNGLVRDITSVDSKQTHINLLSCKNLTFANITVNAPAQSPNTDGIHIGRSSGIN  212

Query  717   IKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFI  896
             I DS I TGDDC+S+G+G + + +  VTCGPGHGISVGSLG+   E+PV G+TV +   I
Sbjct  213   ITDSRISTGDDCVSLGEGSQKITVRRVTCGPGHGISVGSLGRYR-EDPVFGITVANCTLI  271

Query  897   GTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISN  1076
              T NG+R+KTWP S  G+ +D+H+  I M +V NP++IDQEYCP N+C+K  PS VKISN
Sbjct  272   NTSNGVRVKTWPASLEGIASDMHFEDIVMVNVSNPVLIDQEYCPGNKCAKA-PSRVKISN  330

Query  1077  VSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQ  1250
             VS+ NI+GTSAT+ AV + CSSG+PCE+V+ GDINL++ G  G A + CSN KP +TGKQ
Sbjct  331   VSFKNIRGTSATQVAVELRCSSGIPCENVEIGDINLSYIGTEGPATSRCSNVKPIITGKQ  390

Query  1251  TP  1256
             TP
Sbjct  391   TP  392



>ref|XP_010038565.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW46861.1| hypothetical protein EUGRSUZ_K00666 [Eucalyptus grandis]
Length=396

 Score =   384 bits (987),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 190/370 (51%), Positives = 251/370 (68%), Gaps = 9/370 (2%)
 Frame = +3

Query  177   AEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIK  356
             A +    +G SDIS  LL AW EACA+TTP+ ++IP GTF + +  L GPCKAP+E +++
Sbjct  28    ASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFELQ  87

Query  357   ATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQK---KDTGFKSDKL  527
              TLKAP +P+  +    W+   ++D  T+SG GT DGQG    +GQ    K+T  ++  L
Sbjct  88    GTLKAPADPSLFK-TDGWVVFQHIDGLTMSGGGTFDGQGKTA-WGQNDCAKNTNCRT--L  143

Query  528   PNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKIC  707
             P NL  NF+ N++I D+T+L+SK F VNV G KN+TFQ   + APADS NTDGIHI +  
Sbjct  144   PTNLRFNFVTNALIHDVTTLDSKNFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRSD  203

Query  708   DVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDS  887
              V I DS I TGDDC+S+GDG   + + GVTCGPGHGISVGSLGK   EEPV+GV V + 
Sbjct  204   GVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTNC  263

Query  888   KFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVK  1067
               IG DNG+RIKTWP S PG  +D+H+  I+M++V NP+++DQ YCP NQC    PSL+K
Sbjct  264   TIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAGVPSLIK  323

Query  1068  ISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLT  1241
             IS VS+  I+GTSA++ AV + CS  VPCE+V+  DI+L + G  G A + C+N KP L+
Sbjct  324   ISKVSFKKIRGTSASQVAVKVLCSRSVPCEEVEIADIDLVYNGPEGPATSECANVKPVLS  383

Query  1242  GKQTPPVTCK  1271
             GK  P    K
Sbjct  384   GKLNPAACAK  393



>ref|XP_010536244.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score =   385 bits (988),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 182/379 (48%), Positives = 255/379 (67%), Gaps = 7/379 (2%)
 Frame = +3

Query  141   FVLFLLADLGESAEFKVTAEG-----DSDISPELLKAWDEACAATTPSIIVIPKGTFQMK  305
              V   +    +S  F +T  G     D DI+     AW+ AC++T+PS +++PKGT+ ++
Sbjct  19    LVASFVQSAADSITFSITNYGLKGTEDEDITKAFSVAWEAACSSTSPSKLIVPKGTYVLR  78

Query  306   QALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQI  485
             Q + +GPCKAP+EL++  T+KAP +P+    K  W++   +D F L G+GT DGQG    
Sbjct  79    QVVFEGPCKAPLELQVHGTIKAPEDPSYFIEKAGWISFQRIDRFALVGNGTFDGQGSTAW  138

Query  486   YGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPA  665
                      + +KLP N+  NF+ N +++DITSLNSKLFH+NV G  NLTF ++ IKAP 
Sbjct  139   SQNDCHKTGECNKLPINIRFNFITNGLVQDITSLNSKLFHINVLGCNNLTFSRVNIKAPE  198

Query  666   DSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKT  845
             DS NTDGIHI +  ++ I DSV+ TGDDCIS+G G EN+ I+ V CGPGHGISVGSLG+ 
Sbjct  199   DSPNTDGIHIGRSKNINITDSVMSTGDDCISMGRGSENIAIERVKCGPGHGISVGSLGRY  258

Query  846   PGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYC  1025
               EEPV G+ V++  F  TDNG+R+KTW +S   + T +++  I + +V NPIVIDQEYC
Sbjct  259   TKEEPVSGIIVRNCTFFNTDNGVRVKTWMSSEKAIATGLYFQDIAVVNVSNPIVIDQEYC  318

Query  1026  PNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--G  1199
             P N C  +KPS VK+SN+S+ NI GTS+T+ A+ +ACSSGVPCE+V+  DI++ + G  G
Sbjct  319   PYNHCKAKKPSQVKLSNISFRNIHGTSSTQMAMKLACSSGVPCENVEISDIDIKYTGSDG  378

Query  1200  AAKTVCSNAKPKLTGKQTP  1256
              + + C+N  PK+ GKQ P
Sbjct  379   DSMSDCTNVSPKIFGKQYP  397



>gb|KHN10402.1| Polygalacturonase, partial [Glycine soja]
Length=350

 Score =   382 bits (982),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 187/343 (55%), Positives = 232/343 (68%), Gaps = 3/343 (1%)
 Frame = +3

Query  225   LLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKK  404
              L AW +ACA+ T   IVIP GT+QM    +KGPCKAPIE+++  T++AP NP D++   
Sbjct  3     FLSAWTQACASPTAVKIVIPAGTYQMGAVDVKGPCKAPIEVQVDGTIQAPANPTDLKAAH  62

Query  405   EWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITS  584
             +W  + YV+ FTLSG G  DGQG          T      L  N   NFL NSI+RDITS
Sbjct  63    QWFVVQYVNSFTLSGKGVFDGQGATAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITS  122

Query  585   LNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIG  764
              +SK FHVNV G  N TF    + AP DS NTDGIHI +  DV I ++ I TGDDC+S+G
Sbjct  123   KDSKNFHVNVLGCNNFTFDGFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLG  182

Query  765   DGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHP  944
             DG +N+ +  V CGPGHGISVGSLGK   EEPV G  VK+     TDNG+RIKTWPN+ P
Sbjct  183   DGCKNITVQNVNCGPGHGISVGSLGKYDSEEPVAGFLVKNCTLNETDNGVRIKTWPNT-P  241

Query  945   GV--VTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEE  1118
             G   +TD+H+  + M +V NPI+IDQEYCP NQCSK+ PS +KIS VS+ NIKGTS ++E
Sbjct  242   GAITITDMHFEDLTMNNVMNPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQE  301

Query  1119  AVIIACSSGVPCEDVKFGDINLTFKGGAAKTVCSNAKPKLTGK  1247
              V++ CSSGVPCE V+  DI+LTF G AA   C+N KP +TGK
Sbjct  302   GVVLVCSSGVPCEAVEMADIDLTFNGSAATAKCANVKPTITGK  344



>ref|XP_010042444.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score =   384 bits (986),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/376 (51%), Positives = 253/376 (67%), Gaps = 9/376 (2%)
 Frame = +3

Query  159   ADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAP  338
             A +   A +    +G SDIS  LL AW EACA+TTP+ ++IP GTF + +  L GPCKAP
Sbjct  22    AQVFNVATYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAP  81

Query  339   IELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQK---KDTG  509
             +E +++ TLKAP +P+  +    W+   ++D  T+SG GT DGQG    +GQ    K+T 
Sbjct  82    VEFELQGTLKAPTDPSLFK-TDGWVVFQHIDGLTMSGGGTFDGQGKTA-WGQNDCAKNTN  139

Query  510   FKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGI  689
              ++  LP NL  NF+ N++I D+T+L+SK F VNV G KN+TFQ   + APADS NTDGI
Sbjct  140   CRT--LPTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGI  197

Query  690   HIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKG  869
             HI +   V I DS I TGDDC+S+GDG   + + GVTCGPGHGISVGSLGK   EEPV+G
Sbjct  198   HIGRSDGVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEG  257

Query  870   VTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKE  1049
             V V +   IG DNG+RIKTWP S PG  +D+H+  I+M++V NP+++DQ YCP NQC   
Sbjct  258   VFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAG  317

Query  1050  KPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSN  1223
              PSL+KIS VS+  I+GTSA++ AV + CS  VPC++V+  DI+L + G  G A + C+N
Sbjct  318   VPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECAN  377

Query  1224  AKPKLTGKQTPPVTCK  1271
              KP L+GK  P    K
Sbjct  378   VKPVLSGKLNPAACAK  393



>ref|XP_010042729.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score =   382 bits (982),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 188/370 (51%), Positives = 251/370 (68%), Gaps = 9/370 (2%)
 Frame = +3

Query  177   AEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIK  356
             A +    +G SDIS  LL AW EACA+TTP+ ++IP GTF + +  L GPCKAP+E +++
Sbjct  28    ATYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFELQ  87

Query  357   ATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQK---KDTGFKSDKL  527
              TLKAP +P+  +    W+   ++D  T+SG GT DGQG    +GQ    K+T  ++  L
Sbjct  88    GTLKAPADPSLFK-TDGWVVFQHIDGLTMSGGGTFDGQGKTA-WGQNDCAKNTNCRT--L  143

Query  528   PNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKIC  707
             P NL  NF+ N++I D+T+L+SK F VNV G KN+TFQ   + APADS NTDGIHI +  
Sbjct  144   PTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRSD  203

Query  708   DVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDS  887
              V I DS I TGDDC+S+GDG   + + GVTCGPGHGISVGSLGK   EEPV+GV V + 
Sbjct  204   GVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTNC  263

Query  888   KFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVK  1067
               IG DNG+RIKTWP S PG  +D+H+  I+M++V NP+++DQ YCP +QC    PSL+K
Sbjct  264   TIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFDQCKAGVPSLIK  323

Query  1068  ISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLT  1241
             IS VS+  I+GTSA++ AV + CS  VPC++V+  DI+L + G  G A + C+N KP L+
Sbjct  324   ISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECANVKPVLS  383

Query  1242  GKQTPPVTCK  1271
             GK  P    K
Sbjct  384   GKLNPAACAK  393



>ref|XP_006387858.1| hypothetical protein POPTR_0519s00220g [Populus trichocarpa]
 gb|ERP46772.1| hypothetical protein POPTR_0519s00220g [Populus trichocarpa]
Length=393

 Score =   382 bits (982),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 195/385 (51%), Positives = 255/385 (66%), Gaps = 8/385 (2%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAE----FKVTAEG-DSDISPELLKAWDEACAATTPSII  275
             ++ +     +F LFLL      A+    F VT  G   DI+  L  AW  ACA+T PS +
Sbjct  3     LEVVSSAIISFSLFLLLASTTQAQSNGVFDVTKYGAGKDITEALTNAWKSACASTKPSKV  62

Query  276   VIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDG  455
             +IP GT+ +++  L GPCKA I+L++   LKAP +PN +     W+   YVD FTLSG G
Sbjct  63    LIPSGTYWLRKVTLAGPCKAAIKLQVDGILKAPVDPNKLS-GGHWVNFRYVDQFTLSGRG  121

Query  456   TLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLT  635
             T DGQG V               LP NL  +F+ N+++RDIT+L+SK FHVNV G KNLT
Sbjct  122   TFDGQGKVAWSKSTCHKDKNCKGLPMNLRFDFITNALVRDITTLDSKNFHVNVLGCKNLT  181

Query  636   FQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGH  815
             FQ  T++AP +S NTDGIHI +   + I DS I TGDDCIS+GDG E L+I GVTCGPGH
Sbjct  182   FQHFTVRAPGESVNTDGIHIGRSTGIYIIDSKISTGDDCISVGDGTEELHITGVTCGPGH  241

Query  816   GISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVK  995
             GISVGSLGK P E+PV G+ VK+     T NG+RIK+WP  + GV +++H+  I M +V+
Sbjct  242   GISVGSLGKYPNEKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQ  301

Query  996   NPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGD  1175
             NP++IDQ YCP NQC+ + PS VKIS+VS+ +I+GTSAT   V IACSSG PC+ VK  +
Sbjct  302   NPVIIDQGYCPWNQCTLKAPSKVKISDVSFKSIRGTSATPVVVRIACSSGFPCQKVKLAN  361

Query  1176  INLTFK--GGAAKTVCSNAKPKLTG  1244
             INL ++  GG AK+ CSN KP ++G
Sbjct  362   INLAYRGPGGPAKSQCSNVKPIISG  386



>ref|XP_010999486.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   382 bits (982),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 196/382 (51%), Positives = 250/382 (65%), Gaps = 8/382 (2%)
 Frame = +3

Query  135   FTFVLFLL----ADLGESAEFKVTAEG-DSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
              +F LFLL    A+      F VT  G D DI+  L  AW +ACA+T PS ++I  GT+ 
Sbjct  11    ISFSLFLLLASTANAQSKGVFDVTKYGADKDITEALTNAWKDACASTNPSKVLISSGTYS  70

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
             +++  L GPCKA IEL++   L+AP +PN       W+   YVD FTLSG GT DGQG V
Sbjct  71    LRKLTLAGPCKAAIELQVDGILQAPVDPNQFS-GGHWVNFRYVDKFTLSGSGTFDGQGKV  129

Query  480   QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKA  659
                          D LP N+  +F+ N+++RDIT+ +SK FHVNV G KNLTFQ  T+ A
Sbjct  130   AWSKSTCQKDKDCDSLPMNIRFDFITNALVRDITTRDSKNFHVNVLGCKNLTFQHFTVSA  189

Query  660   PADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLG  839
             P DS NTDGIH+ +   + I DS IGTGDDCIS+GDG E L+I  VTCGPGHGISVGSLG
Sbjct  190   PGDSVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITRVTCGPGHGISVGSLG  249

Query  840   KTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQE  1019
             K P E+PV G+ VK      T NG+RIK+WP  + GV +++H+  I M +V+NP++IDQ 
Sbjct  250   KYPNEKPVSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQV  309

Query  1020  YCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG-  1196
             YCP NQCS + PS VKIS+VS+ NI+GTSAT   V IACSSG+PCE V+  DI L + G 
Sbjct  310   YCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVELADIKLAYSGP  369

Query  1197  -GAAKTVCSNAKPKLTGKQTPP  1259
              G  K+ CSN KP ++G  + P
Sbjct  370   DGPPKSQCSNVKPIISGIMSAP  391



>ref|XP_002274125.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   382 bits (981),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 181/363 (50%), Positives = 248/363 (68%), Gaps = 3/363 (1%)
 Frame = +3

Query  180   EFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKA  359
             ++   A+G SDIS  LLKAW ++C++   S ++IP GT+ + Q  + GPCKAPI   ++ 
Sbjct  32    KYGARADGHSDISQALLKAWGDSCSSPVASTVMIPNGTYALGQITIGGPCKAPINFVVQG  91

Query  360   TLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNL  539
             T+ AP + +  + +  W+    +D FTLSG G  DGQG   ++G+K        +LP NL
Sbjct  92    TVMAPVDTSRFKAEAGWIAFQQIDQFTLSGGGVFDGQGKT-VWGRKCPHYAYCKQLPINL  150

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
               NF+ NS+++DITS +SK FH+N+ G KNL F  + I AP +S NTDGIHI +   + I
Sbjct  151   RFNFITNSMVKDITSRDSKQFHINLLGCKNLAFYNVAISAPDESLNTDGIHIGRSSGINI  210

Query  720   KDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIG  899
              DS I TGDDC+SIGDG E +NI  VTCGPGHGISVGSLGK P EEPV G++VK+     
Sbjct  211   TDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGISVKNCTLTN  270

Query  900   TDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
             T NG+R+KT+P SH G+ +++H+  I M +V NPI+IDQEYCP+NQC+ + PS +K+SNV
Sbjct  271   TQNGVRVKTFPASHQGIASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSPSRIKLSNV  330

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQT  1253
             S+ NI+GT++T+ AV + CS GVPC+DV+ GDINL + G  G A + C N KP L G Q 
Sbjct  331   SFRNIRGTTSTQVAVKLLCSQGVPCQDVELGDINLKYNGKEGPAMSQCKNIKPNLLGVQL  390

Query  1254  PPV  1262
             P +
Sbjct  391   PRI  393



>ref|XP_004488391.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=391

 Score =   382 bits (981),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 194/373 (52%), Positives = 253/373 (68%), Gaps = 8/373 (2%)
 Frame = +3

Query  147   LFLLADLG--ESAEFKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQA  311
                LADLG  +S +  ++  G   ++DI+   + AW+EACA+TT   IVIP GT+ M++ 
Sbjct  11    FLFLADLGAVQSLDLDISKFGGAPNADITQAFISAWNEACASTTAVKIVIPAGTYNMREV  70

Query  312   LLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYG  491
              +KGPCKAPIE+++  T+KAP NP++++   +W+ I Y +  TLSG G  DGQG      
Sbjct  71    DVKGPCKAPIEIQVDGTIKAPANPDELKGADQWVKIGYTNFLTLSGKGVFDGQGAAAWKQ  130

Query  492   QKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADS  671
                 T      L  N   NFL NSI+RDITS +SK FHVNV G  N TF   T+ APA S
Sbjct  131   NDCSTNKNCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNFTFDGFTVTAPATS  190

Query  672   HNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPG  851
              NTDGIHI +  DV + ++ IGTGDDC+S+GDG + + +  V CGPGHGISVGSLGK   
Sbjct  191   LNTDGIHIGRSTDVKVLNTNIGTGDDCVSLGDGDKQITVQNVHCGPGHGISVGSLGKYTT  250

Query  852   EEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPG--VVTDIHYHKIEMEDVKNPIVIDQEYC  1025
             E PV+GV +K+     TDNG+RIKTWP++ PG   VTD+++  I M +V+NPI+IDQEYC
Sbjct  251   ESPVEGVLIKNCTLTETDNGVRIKTWPDA-PGTITVTDMNFEDITMVNVRNPIIIDQEYC  309

Query  1026  PNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGGAA  1205
             P NQCSK+ PS +KIS VS+ NIKGTSAT E V++ CSSGVPC+ V+  +I+LTF G  A
Sbjct  310   PWNQCSKKNPSKIKISKVSFKNIKGTSATPEGVLLICSSGVPCDGVELNNIDLTFNGAPA  369

Query  1206  KTVCSNAKPKLTG  1244
             K  CSN KP +TG
Sbjct  370   KANCSNVKPIITG  382



>ref|XP_010067907.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=401

 Score =   382 bits (982),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 192/392 (49%), Positives = 261/392 (67%), Gaps = 16/392 (4%)
 Frame = +3

Query  117   TIFYCAFTFVLF------LLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIV  278
             +I   A   + F      L+ D+   A++       SDI+  L+ AW EACAAT  S ++
Sbjct  5     SILPAAIALLFFASTARSLVCDI---AKYGAGGGTSSDITQALVSAWKEACAATEASKVL  61

Query  279   IPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGT  458
             +P GT+ +++ +L+GPCK+ IE+++  TL+AP +P  M+    W+    VD  TLSG GT
Sbjct  62    VPAGTYVLREVVLEGPCKSSIEVQVDGTLQAPADPAQMK-TDGWVAFRGVDLLTLSGSGT  120

Query  459   LDGQGDVQIYGQKKDTGFKSD--KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNL  632
              DGQG  +    K D   K+D   LP N+  + + N +++DITSL+SK FHVNV   KNL
Sbjct  121   FDGQG--KTAWTKNDCNLKTDCVTLPINIRFDSVTNGMVKDITSLDSKQFHVNVLNCKNL  178

Query  633   TFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPG  812
             TFQ +TI AP DS NTDGIHI +   + I D+ I TGDDCISIGDG E + I GVTCGPG
Sbjct  179   TFQHVTITAPGDSPNTDGIHIGRSTGINIIDTGIKTGDDCISIGDGSEQMTITGVTCGPG  238

Query  813   HGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDV  992
             HGISVGSLGK P E+PV G+ VK+    GT NGLRIKTWP S  G  +D+H+  I +++V
Sbjct  239   HGISVGSLGKYPNEQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNV  298

Query  993   KNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFG  1172
              NP++IDQ+YCP NQC  + PS +KISNVS++ I+GTS+T+ AV +ACSS +PC +V+  
Sbjct  299   GNPVIIDQQYCPWNQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVEIS  358

Query  1173  DINLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             DI++ + G  G A +VCSN KP ++GKQ P +
Sbjct  359   DIDIAYHGPEGPATSVCSNVKPTISGKQNPAI  390



>ref|XP_010067918.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW88713.1| hypothetical protein EUGRSUZ_A01068 [Eucalyptus grandis]
Length=401

 Score =   382 bits (981),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 192/392 (49%), Positives = 261/392 (67%), Gaps = 16/392 (4%)
 Frame = +3

Query  117   TIFYCAFTFVLF------LLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIV  278
             +I   A   + F      L+ D+   A++       SDI+  L+ AW EACAAT  S ++
Sbjct  5     SILPAAIALLFFASTARSLVCDI---AKYGAGGGTSSDITQALVSAWKEACAATEASKVL  61

Query  279   IPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGT  458
             +P GT+ +++ +L+GPCK+ IE+++  TL+AP +P  M+    W+    VD  TLSG GT
Sbjct  62    VPAGTYVLREVVLEGPCKSSIEVQVDGTLQAPADPAQMK-TDGWVAFRGVDLLTLSGSGT  120

Query  459   LDGQGDVQIYGQKKDTGFKSD--KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNL  632
              DGQG  +    K D   K+D   LP N+  + + N +++DITSL+SK FHVNV   KNL
Sbjct  121   FDGQG--KTAWTKNDCNLKTDCVTLPINIRFDSVTNGMVKDITSLDSKQFHVNVLNCKNL  178

Query  633   TFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPG  812
             TFQ +TI AP DS NTDGIHI +   + I D+ I TGDDCISIGDG E + I GVTCGPG
Sbjct  179   TFQHVTITAPGDSPNTDGIHIGRSTGINIIDTGIKTGDDCISIGDGSEQMTITGVTCGPG  238

Query  813   HGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDV  992
             HGISVGSLGK P E+PV G+ VK+    GT NGLRIKTWP S  G  +D+H+  I +++V
Sbjct  239   HGISVGSLGKYPNEQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNV  298

Query  993   KNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFG  1172
              NP++IDQ+YCP NQC  + PS +KISNVS++ I+GTS+T+ AV +ACSS +PC +V+  
Sbjct  299   GNPVIIDQQYCPWNQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVEIS  358

Query  1173  DINLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             DI++ + G  G A +VCSN KP ++GKQ P +
Sbjct  359   DIDIAYHGPEGPATSVCSNVKPTISGKQNPAI  390



>ref|XP_010042694.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Eucalyptus 
grandis]
Length=396

 Score =   381 bits (979),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 189/370 (51%), Positives = 250/370 (68%), Gaps = 9/370 (2%)
 Frame = +3

Query  177   AEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIK  356
             A +    +G SDIS  LL AW EACA+TTP+ ++IP GTF + +  L GPCKAP+E +++
Sbjct  28    ASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFELQ  87

Query  357   ATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQK---KDTGFKSDKL  527
              TLKAP +P+  +    W+    +D  T+SG GT DGQG    +GQ    K+T  ++  L
Sbjct  88    GTLKAPADPSLFK-TDGWVVFQRIDGLTVSGGGTFDGQGKTA-WGQNDCAKNTNCRT--L  143

Query  528   PNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKIC  707
             P NL  NF+ N++I D+T+L+SK F VNV G KN+TFQ   + APADS NTDGIHI +  
Sbjct  144   PTNLRFNFVTNALIHDVTTLDSKNFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRSD  203

Query  708   DVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDS  887
              V I DS I TGDDC+S+GDG   + + GVTCGPGHGISVGSLGK   EEPV+GV V + 
Sbjct  204   GVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTNC  263

Query  888   KFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVK  1067
               IG DNG+RIKTWP S PG  +D+H+  I+M++V NP+++DQ YCP NQC    PSL+K
Sbjct  264   TIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAGVPSLIK  323

Query  1068  ISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLT  1241
             IS VS+  I+GTSA++ AV + CS  VPC++V+  DI+L + G  G A + C+N KP L+
Sbjct  324   ISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECANVKPVLS  383

Query  1242  GKQTPPVTCK  1271
             GK  P    K
Sbjct  384   GKLNPAACAK  393



>ref|XP_010040848.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW44869.1| hypothetical protein EUGRSUZ_L01551 [Eucalyptus grandis]
 gb|KCW46860.1| hypothetical protein EUGRSUZ_K00665 [Eucalyptus grandis]
Length=396

 Score =   381 bits (978),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 188/370 (51%), Positives = 250/370 (68%), Gaps = 9/370 (2%)
 Frame = +3

Query  177   AEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIK  356
             A +    +G SDIS  LL AW EACA+TTP+ ++IP GTF + +  L GPCKAP+E +++
Sbjct  28    ASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFELQ  87

Query  357   ATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQK---KDTGFKSDKL  527
              TLKAP +P+  +    W+    +D  T+SG GT DGQG    +GQ    K+T  ++  L
Sbjct  88    GTLKAPADPSLFK-TDGWVVFQRIDGLTVSGGGTFDGQGKTA-WGQNDCAKNTNCRT--L  143

Query  528   PNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKIC  707
             P NL  NF+ N++I D+T+L+SK F VNV G KN+TFQ   + APADS NTDGIHI +  
Sbjct  144   PTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRSD  203

Query  708   DVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDS  887
              V I DS I TGDDC+S+GDG   + + GVTCGPGHGISVGSLGK   EEPV+GV V + 
Sbjct  204   GVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTNC  263

Query  888   KFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVK  1067
               IG DNG+RIKTWP S PG  +D+H+  I+M++V NP+++DQ YCP +QC    PSL+K
Sbjct  264   TIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFDQCKAGVPSLIK  323

Query  1068  ISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLT  1241
             IS VS+  I+GTSA++ AV + CS  VPC++V+  DI+L + G  G A + C+N KP L+
Sbjct  324   ISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECANVKPVLS  383

Query  1242  GKQTPPVTCK  1271
             GK  P    K
Sbjct  384   GKLNPAACAK  393



>emb|CDP04350.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   381 bits (979),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 207/398 (52%), Positives = 262/398 (66%), Gaps = 14/398 (4%)
 Frame = +3

Query  111   MDTIF-YCAFTFVLFLLADLGESAE------FKVTAEGDSDISPELLKAWDEACAATTPS  269
             M T F    F+  L L + +G  +       F    +G SDIS  LL AW  AC +  PS
Sbjct  1     MSTTFCITLFSSWLLLASIVGAQSRPLDVRSFGAKGDGVSDISQALLSAWKAACNSPKPS  60

Query  270   IIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSG  449
              IVIP+GTF + QA L+GPCKAPIEL+++ TLKAP NPN ++   EW+TI Y+D FTLSG
Sbjct  61    TIVIPRGTFGLLQATLEGPCKAPIELQVQGTLKAPQNPNLIK-DGEWVTIQYLDHFTLSG  119

Query  450   DGTLDGQGDVQIYGQKKDTGFKSD--KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGG  623
              GT DGQG  + + Q  D    SD  KLPNN S NFL NSII  I SLNSKLFH+N+ G 
Sbjct  120   SGTFDGQG-ARAWAQN-DCAKASDCSKLPNNFSFNFLNNSIISGIASLNSKLFHMNILGC  177

Query  624   KNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTC  803
              N+T  ++TI AP  S NTDGIH+ +   V I DS IGTGDDC+S+GDG + ++I  V C
Sbjct  178   NNVTLSRLTITAPGTSLNTDGIHVGRSSGVNITDSTIGTGDDCVSLGDGSKQVSITNVVC  237

Query  804   GPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEM  983
             GPGHGIS+GSLG+   EEPV GV V++   I T  G+R+K+WP++  G  TD+H+  I M
Sbjct  238   GPGHGISIGSLGRYKNEEPVVGVFVRNCTLINTLTGVRVKSWPSATTGAATDVHFDDITM  297

Query  984   EDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDV  1163
              +V +PIVIDQEYCPNNQC+   PS VKIS VS+ NI+GTSA+  AV + CS   PCE V
Sbjct  298   RNVTSPIVIDQEYCPNNQCTLGAPSRVKISKVSFNNIRGTSASALAVKLVCSKTFPCEGV  357

Query  1164  KFGDINLTFKG--GAAKTVCSNAKPKLTGKQTPPVTCK  1271
             + GDI+L + G  G   T C+N +P   G+Q PP+  K
Sbjct  358   EIGDIDLAYHGSLGNITTNCANVQPTFMGRQNPPICAK  395



>ref|XP_006371367.1| hypothetical protein POPTR_0019s09510g, partial [Populus trichocarpa]
 gb|ERP49164.1| hypothetical protein POPTR_0019s09510g, partial [Populus trichocarpa]
Length=373

 Score =   380 bits (975),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 191/362 (53%), Positives = 243/362 (67%), Gaps = 4/362 (1%)
 Frame = +3

Query  183   FKVTAEG-DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKA  359
             F VT  G D DI+  L  AW +ACA+T PS ++IP GT+ +++  L GPCKA IEL++  
Sbjct  11    FDVTKYGSDKDITEALTNAWKDACASTNPSKVLIPSGTYSLRKLTLAGPCKAAIELQVDG  70

Query  360   TLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNL  539
              LKAP +PN       W+   +VD FTLSG GT DGQG               D LP NL
Sbjct  71    MLKAPVDPNQFS-GGHWVNFGHVDKFTLSGSGTFDGQGKAAWSKSTCQKDKDCDSLPMNL  129

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
               +F+ N+++RDIT+ +SK FHVNV G KNLTFQ  T+ AP +S NTDGIH+ +   + I
Sbjct  130   RFDFITNALVRDITTRDSKNFHVNVLGCKNLTFQHFTVSAPGESVNTDGIHVGQSTGIYI  189

Query  720   KDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIG  899
              DS IGTGDDCIS+GDG E L+I GVTCGPGHGISVGSLGK P E+PV G+ VK+     
Sbjct  190   IDSKIGTGDDCISVGDGTEELHITGVTCGPGHGISVGSLGKYPNEKPVSGIFVKNCTLSD  249

Query  900   TDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
             T NG+RIK+WP  + GV +++H+  I M +V+NP++IDQ YCP NQCS + PS VKIS V
Sbjct  250   TTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQVYCPWNQCSLKAPSKVKISGV  309

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQT  1253
             S+ NI+GTSAT   V IACSSG PCE V+  DI L + G  G +K+ CSN KP ++G  +
Sbjct  310   SFKNIRGTSATPVVVQIACSSGFPCEKVELADIKLAYSGPDGPSKSQCSNVKPIISGIMS  369

Query  1254  PP  1259
              P
Sbjct  370   AP  371



>dbj|BAA89476.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   380 bits (976),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 188/357 (53%), Positives = 244/357 (68%), Gaps = 4/357 (1%)
 Frame = +3

Query  183   FKVTAEG-DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKA  359
             F VT  G   DI+  L  AW +ACA+T PS + IP GT+ ++Q  L GPCK+ IEL++  
Sbjct  31    FDVTKYGGKQDITAALTNAWKDACASTKPSKVRIPSGTYSLRQVTLAGPCKSAIELQVNG  90

Query  360   TLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNL  539
              LKAP NP D      W+   Y+D  TLSG GT DGQG+V             + LP N+
Sbjct  91    ILKAPVNP-DQFSGGHWVNFRYIDHLTLSGSGTFDGQGNVAWSKSTCSKNKNCEGLPMNI  149

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
               +F+ N ++RDIT+ +SK FHVNV G KNLTFQ  T+ APA+S NTDGIHI +   + I
Sbjct  150   RFDFITNGLVRDITTRDSKNFHVNVLGCKNLTFQHFTVTAPAESINTDGIHIGRSTGIYI  209

Query  720   KDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIG  899
              DS IGTGDDCIS+GDG E L++  VTCGPGHGISVGSLG+ P E+PV G+ VK+     
Sbjct  210   IDSKIGTGDDCISVGDGTEELHVTRVTCGPGHGISVGSLGRYPNEKPVSGIFVKNCTISN  269

Query  900   TDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
             T NG+RIK+WP+ + GV +++H+  I M +V+NPI++DQ YCP NQCS + PS VKIS+V
Sbjct  270   TANGVRIKSWPDLYGGVASNMHFEDIVMNNVQNPILLDQVYCPWNQCSLKAPSKVKISDV  329

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTG  1244
             S+ NI+GTSAT   V +ACSSG+PCE V+  +INL + G  G AK+ CSN KPK++G
Sbjct  330   SFKNIRGTSATPVVVKLACSSGIPCEKVELANINLVYSGSEGPAKSQCSNVKPKISG  386



>ref|XP_010999487.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   379 bits (974),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 194/382 (51%), Positives = 249/382 (65%), Gaps = 8/382 (2%)
 Frame = +3

Query  135   FTFVLFLLADLGESAE----FKVTAEG-DSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
              +F +FLL      A+    F VT  G D DI+  L  AW +ACA+T PS ++IP GT+ 
Sbjct  11    ISFSIFLLLSSTAKAQSKGVFDVTKYGADKDITEALTNAWKDACASTNPSKVLIPSGTYS  70

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
             +++  L GPCKA IEL++   LKAP +PN       W+   YVD FTLSG GT DGQG +
Sbjct  71    LRKLTLAGPCKAAIELQVDGILKAPVDPNQFS-GGHWVNFRYVDKFTLSGSGTFDGQGKL  129

Query  480   QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKA  659
                          D LP N+  +F+ N+++RDIT+ +SK FHVNV G KNLTFQ  T+ A
Sbjct  130   AWSKSTCQKDKDCDSLPMNIRFDFITNALVRDITTRDSKNFHVNVLGCKNLTFQHFTVSA  189

Query  660   PADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLG  839
             P DS NTDGIH+ +   + I DS IGTGDDCIS+GDG E L+I  VTCGPGHGISVGSLG
Sbjct  190   PGDSVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITRVTCGPGHGISVGSLG  249

Query  840   KTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQE  1019
             K P E+P  G+ VK      T NG+RIK+WP  + G  +++H+  I M +V+NP++IDQ 
Sbjct  250   KYPNEKPASGIFVKSCTISDTPNGVRIKSWPALYGGGASNMHFEDIVMNNVQNPVIIDQV  309

Query  1020  YCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG-  1196
             YCP NQCS + PS VKIS+VS+ NI+GTSAT   V IACSSG+PCE V+  DI L + G 
Sbjct  310   YCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVELADIKLAYSGP  369

Query  1197  -GAAKTVCSNAKPKLTGKQTPP  1259
              G  K+ CSN KP ++G  + P
Sbjct  370   DGPPKSQCSNVKPIMSGIMSAP  391



>dbj|BAA89478.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   379 bits (974),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 185/351 (53%), Positives = 242/351 (69%), Gaps = 3/351 (1%)
 Frame = +3

Query  198   EGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPP  377
             +G  DI+  L  AW +ACA+T PS ++IP GT+ ++Q  L GPCKA IEL++   LKAP 
Sbjct  37    DGKEDITEALNNAWKDACASTNPSKVLIPSGTYSLRQVTLAGPCKAAIELQVDGILKAPV  96

Query  378   NPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLK  557
             NP D      W+   +VD  TLSG GT DGQG+V       +     + LP N+  +F+ 
Sbjct  97    NP-DQFSGGSWVDFRHVDQLTLSGSGTFDGQGNVAWSKSTCNKDKNCEGLPMNIRFDFIT  155

Query  558   NSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIG  737
             N ++RDIT+ +SK FHVNV G KNLTFQ  T+ AP +S NTDGIHI +   + I DS IG
Sbjct  156   NGLVRDITTRDSKNFHVNVLGCKNLTFQHFTMTAPGESINTDGIHIGQSTGIYIIDSNIG  215

Query  738   TGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLR  917
             TGDDCIS+GDG E L++ GVTCGPGHGISVGSLG+ P E+PV G+ VK+     T NG+R
Sbjct  216   TGDDCISVGDGTEELHVTGVTCGPGHGISVGSLGRYPNEKPVSGIFVKNCTISNTANGVR  275

Query  918   IKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIK  1097
             IK+WP+ + G  +++H+  I M +V+NP+V+DQEYCP NQCS + PS VKIS+VS+ NI+
Sbjct  276   IKSWPDLYGGAASNMHFEDIVMNNVQNPVVVDQEYCPWNQCSLKSPSKVKISDVSFKNIR  335

Query  1098  GTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTG  1244
             GTSAT   V +ACS G+PCE V+  DINL + G  G AK+ CSN KP ++G
Sbjct  336   GTSATPVVVKLACSGGIPCEKVELADINLVYSGSEGPAKSQCSNVKPTISG  386



>emb|CBI28390.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   381 bits (978),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/359 (50%), Positives = 247/359 (69%), Gaps = 3/359 (1%)
 Frame = +3

Query  180   EFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKA  359
             ++   A+G SDIS  LLKAW ++C++   S ++IP GT+ + Q  + GPCKAPI   ++ 
Sbjct  32    KYGARADGHSDISQALLKAWGDSCSSPVASTVMIPNGTYALGQITIGGPCKAPINFVVQG  91

Query  360   TLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNL  539
             T+ AP + +  + +  W+    +D FTLSG G  DGQG   ++G+K        +LP NL
Sbjct  92    TVMAPVDTSRFKAEAGWIAFQQIDQFTLSGGGVFDGQGKT-VWGRKCPHYAYCKQLPINL  150

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
               NF+ NS+++DITS +SK FH+N+ G KNL F  + I AP +S NTDGIHI +   + I
Sbjct  151   RFNFITNSMVKDITSRDSKQFHINLLGCKNLAFYNVAISAPDESLNTDGIHIGRSSGINI  210

Query  720   KDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIG  899
              DS I TGDDC+SIGDG E +NI  VTCGPGHGISVGSLGK P EEPV G++VK+     
Sbjct  211   TDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGISVKNCTLTN  270

Query  900   TDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
             T NG+R+KT+P SH G+ +++H+  I M +V NPI+IDQEYCP+NQC+ + PS +K+SNV
Sbjct  271   TQNGVRVKTFPASHQGIASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSPSRIKLSNV  330

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQ  1250
             S+ NI+GT++T+ AV + CS GVPC+DV+ GDINL + G  G A + C N KP L G++
Sbjct  331   SFRNIRGTTSTQVAVKLLCSQGVPCQDVELGDINLKYNGKEGPAMSQCKNIKPNLLGQE  389



>ref|XP_003527123.1| PREDICTED: polygalacturonase-like [Glycine max]
 gb|KHN05204.1| Polygalacturonase [Glycine soja]
Length=389

 Score =   379 bits (972),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 194/378 (51%), Positives = 249/378 (66%), Gaps = 2/378 (1%)
 Frame = +3

Query  117   TIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTF  296
             TIF+  F  V F  A  G+    +   + +SDIS   L AW +ACA+TT   IVIP GT+
Sbjct  7     TIFFSLF-LVDFGFAQQGDLDISRFGGKPNSDISQAFLSAWTQACASTTAVKIVIPAGTY  65

Query  297   QMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGD  476
             QM    +KGPCKAPIE+++  T++AP N  +++   +WL + +V+ FTLSG G  DGQG 
Sbjct  66    QMGAVDVKGPCKAPIEVQVDGTIQAPTNVVNLKGADQWLKVQHVNSFTLSGKGVFDGQGP  125

Query  477   VQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIK  656
                      T      L  N   NFL NSI+RD+TS +SK FHVNV G  N+TF    I 
Sbjct  126   TAWKQNDCTTNKNCKMLCMNFGFNFLNNSIVRDLTSKDSKNFHVNVLGCNNMTFDGFKIS  185

Query  657   APADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSL  836
             APA+S NTDGIHI +  DV + ++ I TGDDCIS+GDG +N+ +  V CGPGHGISVGSL
Sbjct  186   APAESPNTDGIHIGRSTDVKVLNTNIATGDDCISLGDGNKNITVQNVNCGPGHGISVGSL  245

Query  837   GKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVID  1013
             G+   EE V+G+ VK+     TDNGLRIKTWP++   + VTD+H+  I ME+V NP++ID
Sbjct  246   GRYDNEEAVEGLLVKNCTLNNTDNGLRIKTWPSTPLTITVTDMHFEDITMENVSNPVIID  305

Query  1014  QEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFK  1193
             QEYCP NQCSK+ PS +KIS VS+ NIKGTS T+E VI  CSS  PCE V+  D++LTF 
Sbjct  306   QEYCPWNQCSKKNPSKIKISKVSFKNIKGTSGTKEGVIFICSSVAPCEGVEMTDVDLTFN  365

Query  1194  GGAAKTVCSNAKPKLTGK  1247
             G A    C+N KP +TGK
Sbjct  366   GAATTAKCANVKPVITGK  383



>ref|XP_010112807.1| hypothetical protein L484_020039 [Morus notabilis]
 gb|EXC34922.1| hypothetical protein L484_020039 [Morus notabilis]
Length=396

 Score =   378 bits (971),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 186/379 (49%), Positives = 255/379 (67%), Gaps = 10/379 (3%)
 Frame = +3

Query  147   LFLLADLGESAEF-------KVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMK  305
             LF+L  +  +A+        K  A+ ++D +  L +AW  ACA+  PS +V+PKGTF++ 
Sbjct  12    LFVLLAITATAQCGNVYDITKYGAKSNNDANQALGQAWKAACASKVPSKVVVPKGTFRLS  71

Query  306   QALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQI  485
             +A   GPCKAPIE  I  TL+AP NP   +    W+T   +D  TL G GT DG G   +
Sbjct  72    RAAFFGPCKAPIEFMIVGTLQAPQNPGGFKDGDGWVTFQDIDRLTLDGGGTFDGNGQ-NV  130

Query  486   YGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPA  665
             +G+         KLP NL  NF+KNS+I+ +TSLNSK FH+ V GG NL+F+ + I AP 
Sbjct  131   WGKHCTRLNYCSKLPINLRFNFIKNSVIKSVTSLNSKQFHIMVLGGVNLSFRNLKIIAPE  190

Query  666   DSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKT  845
             DS+NTDGIHI +  +++I DS I TGDDCIS+GDG +NL + GVTCGPGHGIS+GSLGK 
Sbjct  191   DSYNTDGIHIGRSTNISITDSYIQTGDDCISVGDGTKNLTVKGVTCGPGHGISIGSLGKY  250

Query  846   PGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYC  1025
               E PV+G+TV+D  F  T NG+RIKTWPN++ G  +D+ +  + M++V +P++IDQEYC
Sbjct  251   RNEAPVQGITVRDCTFKNTQNGVRIKTWPNANEGSASDLRFENLYMQNVGSPVLIDQEYC  310

Query  1026  PNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--G  1199
             P NQC+ + PS VK+S +S+ NI GTS+T  AV + CS G PC++V+ G+I+L +KG  G
Sbjct  311   PWNQCNTQNPSKVKLSKISFKNIWGTSSTPLAVNLICSRGYPCQNVEVGNIDLKYKGKDG  370

Query  1200  AAKTVCSNAKPKLTGKQTP  1256
              A +VC N   K+TGK  P
Sbjct  371   PAHSVCKNVNVKVTGKMNP  389



>ref|XP_003544118.1| PREDICTED: polygalacturonase-like isoform X1 [Glycine max]
Length=392

 Score =   378 bits (970),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 192/379 (51%), Positives = 249/379 (66%), Gaps = 5/379 (1%)
 Frame = +3

Query  141   FVLFLLADLGESAEFKVTA-EGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALL  317
             F+L  ++   +S +  +    G +DI+  L KAW+EACAAT+ S IVIP G+++M+   L
Sbjct  14    FLLLAISSTTQSVDINIKKFGGGADITQALTKAWEEACAATSASKIVIPGGSYKMEAVDL  73

Query  318   KGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQK  497
             KGPC APIE++   TL+AP +PN ++   EWL + +V+ FTLSG G  DGQG        
Sbjct  74    KGPCMAPIEIQFDGTLQAPADPNALDGADEWLKVQHVNFFTLSGKGVFDGQGATAWKQND  133

Query  498   KDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHN  677
               T     K   N   NFL NS++RDITS +SK FHVNV G  N TF    + AP  S N
Sbjct  134   CGTNKNCKKRSKNFGFNFLNNSMVRDITSKDSKNFHVNVLGCNNFTFDGFHVSAPNTSIN  193

Query  678   TDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEE  857
             TDGIHI +  DV I ++ I TGDDC+S+GDG + + +  V CGPGHGISVGSLGK P EE
Sbjct  194   TDGIHIGRSTDVKILNTNIATGDDCVSLGDGSKKITVQNVNCGPGHGISVGSLGKYPEEE  253

Query  858   PVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV--VTDIHYHKIEMEDVKNPIVIDQEYCPN  1031
             PV+ + VK+     TDNG+RIKTWP+S PG   +TD+H+  I M DV NP++IDQEYCP 
Sbjct  254   PVEQLLVKNCTLTNTDNGVRIKTWPSS-PGASPITDMHFEDITMVDVMNPVIIDQEYCPW  312

Query  1032  NQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGGAAKT  1211
             NQCSK+ PS +KIS V++ NI+GTS T+E V + CS GVPCEDV+  ++ LTF G     
Sbjct  313   NQCSKQAPSKIKISKVTFKNIQGTSKTKEGVTLICSKGVPCEDVELNNVALTFNGAPIVA  372

Query  1212  VCSNAKPKLTGKQTPPVTC  1268
              C+N KP +TGK  P  TC
Sbjct  373   KCANVKPIVTGK-APACTC  390



>gb|KCW88710.1| hypothetical protein EUGRSUZ_A01065 [Eucalyptus grandis]
Length=466

 Score =   380 bits (977),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 192/392 (49%), Positives = 261/392 (67%), Gaps = 16/392 (4%)
 Frame = +3

Query  117   TIFYCAFTFVLF------LLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIV  278
             +I   A   + F      L+ D+   A++       SDI+  L+ AW EACAAT  S ++
Sbjct  70    SILPAAIALLFFASTARSLVCDI---AKYGAGGGTSSDITQALVSAWKEACAATEASKVL  126

Query  279   IPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGT  458
             +P GT+ +++ +L+GPCK+ IE+++  TL+AP +P  M+    W+    VD  TLSG GT
Sbjct  127   VPAGTYVLREVVLEGPCKSSIEVQVDGTLQAPADPAQMK-TDGWVAFRGVDLLTLSGSGT  185

Query  459   LDGQGDVQIYGQKKDTGFKSD--KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNL  632
              DGQG  +    K D   K+D   LP N+  + + N +++DITSL+SK FHVNV   KNL
Sbjct  186   FDGQG--KTAWTKNDCNLKTDCVTLPINIRFDSVTNGMVKDITSLDSKQFHVNVLNCKNL  243

Query  633   TFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPG  812
             TFQ +TI AP DS NTDGIHI +   + I D+ I TGDDCISIGDG E + I GVTCGPG
Sbjct  244   TFQHVTITAPGDSPNTDGIHIGRSTGINIIDTGIKTGDDCISIGDGSEQMTITGVTCGPG  303

Query  813   HGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDV  992
             HGISVGSLGK P E+PV G+ VK+    GT NGLRIKTWP S  G  +D+H+  I +++V
Sbjct  304   HGISVGSLGKYPNEQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNV  363

Query  993   KNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFG  1172
              NP++IDQ+YCP NQC  + PS +KISNVS++ I+GTS+T+ AV +ACSS +PC +V+  
Sbjct  364   GNPVIIDQQYCPWNQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVEIS  423

Query  1173  DINLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             DI++ + G  G A +VCSN KP ++GKQ P +
Sbjct  424   DIDIAYHGPEGPATSVCSNVKPTISGKQNPAI  455



>emb|CBI22052.3| unnamed protein product [Vitis vinifera]
Length=1080

 Score =   398 bits (1022),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 187/364 (51%), Positives = 252/364 (69%), Gaps = 3/364 (1%)
 Frame = +3

Query  180   EFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKA  359
             ++    +G+SDIS  LLKAW +AC++   S ++IP GT+ + Q ++ GPCKAPI   ++ 
Sbjct  32    KYGARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAGPCKAPINFVVQG  91

Query  360   TLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNL  539
             T+ AP + +    +  W+T   +D FTLSGDG  DGQG + ++G K  +    ++LP NL
Sbjct  92    TVMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKI-VWGTKCLSSAYCNQLPINL  150

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
               NF+ NS+++DITS +SK FH+N+ G KNLTF  I I AP +S NTDGIHI +   + I
Sbjct  151   RFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNIVISAPQESLNTDGIHIGRSSGINI  210

Query  720   KDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIG  899
              DS I TGDDC+SIGDG E +NI  VTCGPGHGISVGSLGK P EEPV G++VK+     
Sbjct  211   TDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGISVKNCTLTN  270

Query  900   TDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
             T NG+R+KTWP SH G  +++H+  I M +V NPI+IDQEYCP+NQC+ + PS +KISNV
Sbjct  271   TQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSPSRIKISNV  330

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQT  1253
             S+ NI+GT++T+ AV + CS GVPC DV+ GDINL + G  G A + C N KP L G Q 
Sbjct  331   SFRNIRGTTSTQVAVKLICSQGVPCHDVELGDINLEYNGNEGPAMSQCKNIKPNLLGVQL  390

Query  1254  PPVT  1265
             P ++
Sbjct  391   PRIS  394



>gb|KHN46909.1| Polygalacturonase [Glycine soja]
Length=390

 Score =   378 bits (970),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 192/379 (51%), Positives = 249/379 (66%), Gaps = 5/379 (1%)
 Frame = +3

Query  141   FVLFLLADLGESAEFKVTA-EGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALL  317
             F+L  ++   +S +  +    G +DI+  L KAW+EACAAT+ S IVIP G+++M+   L
Sbjct  12    FLLLAISSTTQSVDINIKKFGGGADITQALTKAWEEACAATSASKIVIPGGSYKMEAVDL  71

Query  318   KGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQK  497
             KGPC APIE++   TL+AP +PN ++   EWL + +V+ FTLSG G  DGQG        
Sbjct  72    KGPCMAPIEIQFDGTLQAPADPNALDGADEWLKVQHVNFFTLSGKGVFDGQGATAWKQND  131

Query  498   KDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHN  677
               T     K   N   NFL NS++RDITS +SK FHVNV G  N TF    + AP  S N
Sbjct  132   CGTNKNCKKRSKNFGFNFLNNSMVRDITSKDSKNFHVNVLGCNNFTFDGFHVSAPNTSIN  191

Query  678   TDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEE  857
             TDGIHI +  DV I ++ I TGDDC+S+GDG + + +  V CGPGHGISVGSLGK P EE
Sbjct  192   TDGIHIGRSTDVKILNTNIATGDDCVSLGDGSKKITVQNVNCGPGHGISVGSLGKYPEEE  251

Query  858   PVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV--VTDIHYHKIEMEDVKNPIVIDQEYCPN  1031
             PV+ + VK+     TDNG+RIKTWP+S PG   +TD+H+  I M DV NP++IDQEYCP 
Sbjct  252   PVEQLLVKNCTLTNTDNGVRIKTWPSS-PGASPITDMHFEDITMVDVMNPVIIDQEYCPW  310

Query  1032  NQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGGAAKT  1211
             NQCSK+ PS +KIS V++ NI+GTS T+E V + CS GVPCEDV+  ++ LTF G     
Sbjct  311   NQCSKQAPSKIKISKVTFKNIQGTSKTKEGVTLICSKGVPCEDVELNNVALTFNGAPIVA  370

Query  1212  VCSNAKPKLTGKQTPPVTC  1268
              C+N KP +TGK  P  TC
Sbjct  371   KCANVKPIVTGK-APACTC  388



>ref|XP_011097041.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=401

 Score =   378 bits (970),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 193/389 (50%), Positives = 258/389 (66%), Gaps = 13/389 (3%)
 Frame = +3

Query  135   FTFVLFLLADLGESAEF---------KVTAEGDSDISPELLKAWDEACAATTPSIIVIPK  287
             F  +LF L+ L  +            K  A+   DIS  L+ AW EAC +T+PS IV+P+
Sbjct  5     FITILFFLSLLAINVNAQGPMTYDITKYGAKSGGDISQALMDAWKEACNSTSPSTIVVPR  64

Query  288   GTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKK-EWLTINYVDDFTLSGDGTLD  464
             GT+ + Q  L GP KAP+EL+++ TL+A PNP  +  K+ EW+TINYV+ FTLSG G  D
Sbjct  65    GTWSLSQVKLLGPNKAPLELQVQGTLQANPNPGQLPNKEGEWITINYVNYFTLSGGGVFD  124

Query  465   GQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQK  644
             GQG                KLP NLS NF+ NSIIRD+T+ +SK FHVN     N+TF +
Sbjct  125   GQGQQAWKQNDCHKNRNCAKLPMNLSFNFVNNSIIRDVTTKDSKNFHVNCISSHNVTFLR  184

Query  645   ITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGIS  824
              T+ AP DS NTDGIH+ +   + IKDS+I TGDDC+SIGD  + ++I  VTCGPGHGIS
Sbjct  185   FTVSAPGDSPNTDGIHLGRDTMINIKDSIIKTGDDCVSIGDESKEIHIQNVTCGPGHGIS  244

Query  825   VGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNP  1001
             VGSLG    E+ V+G+ V +  FIGT NG+R+KTWP++   + V+D+H+  + M++V +P
Sbjct  245   VGSLGGYAEEKDVQGIYVTNCTFIGTTNGVRVKTWPSAPATLTVSDLHFEDLIMDNVSSP  304

Query  1002  IVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDIN  1181
             I+IDQEYCP+N C K++PS +KI+NVS  N++GT+ T EAV   CS   PCE+V+ GDI+
Sbjct  305   IIIDQEYCPHNLCKKDRPSSIKITNVSIKNVRGTTNTAEAVTFICSGLKPCENVEVGDID  364

Query  1182  LTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             LT+ G  G   T C+N KPK  GKQ PPV
Sbjct  365   LTYNGNQGPITTKCANVKPKFVGKQNPPV  393



>ref|XP_010038564.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=474

 Score =   380 bits (977),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 188/370 (51%), Positives = 250/370 (68%), Gaps = 9/370 (2%)
 Frame = +3

Query  177   AEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIK  356
             A +    +G SDIS  LL AW EACA+TTP+ ++IP GTF + +  L GPCKAP+E +++
Sbjct  28    ASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFELQ  87

Query  357   ATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQK---KDTGFKSDKL  527
              TLKAP +P+  +    W+    +D  T+SG GT DGQG    +GQ    K+T  ++  L
Sbjct  88    GTLKAPADPSLFK-TDGWVVFQRIDGLTVSGGGTFDGQGKTA-WGQNDCAKNTNCRT--L  143

Query  528   PNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKIC  707
             P NL  NF+ N++I D+T+L+SK F VNV G KN+TFQ   + APADS NTDGIHI +  
Sbjct  144   PTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRSD  203

Query  708   DVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDS  887
              V I DS I TGDDC+S+GDG   + + GVTCGPGHGISVGSLGK   EEPV+GV V + 
Sbjct  204   GVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTNC  263

Query  888   KFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVK  1067
               IG DNG+RIKTWP S PG  +D+H+  I+M++V NP+++DQ YCP +QC    PSL+K
Sbjct  264   TIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFDQCKAGVPSLIK  323

Query  1068  ISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLT  1241
             IS VS+  I+GTSA++ AV + CS  VPC++V+  DI+L + G  G A + C+N KP L+
Sbjct  324   ISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECANVKPVLS  383

Query  1242  GKQTPPVTCK  1271
             GK  P    K
Sbjct  384   GKLNPAACAK  393


 Score = 71.2 bits (173),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 53/78 (68%), Gaps = 3/78 (4%)
 Frame = +3

Query  1038  CSKEK-PSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAK  1208
             C+K   P+ VKIS+VS+ +I+GTSAT  A  + C  GVPC+ ++  DINL + G  GAA 
Sbjct  391   CAKPHIPTKVKISDVSFRDIRGTSATPLAEKLGCGRGVPCQKLELADINLRYNGRNGAAT  450

Query  1209  TVCSNAKPKLTGKQTPPV  1262
             + C+N KP +TGK + P+
Sbjct  451   SQCANVKPTITGKSSLPL  468



>ref|XP_002325639.2| hypothetical protein POPTR_0019s09470g, partial [Populus trichocarpa]
 gb|EEF00021.2| hypothetical protein POPTR_0019s09470g, partial [Populus trichocarpa]
Length=434

 Score =   379 bits (972),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 189/357 (53%), Positives = 244/357 (68%), Gaps = 4/357 (1%)
 Frame = +3

Query  183   FKVTAEGDS-DISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKA  359
             F VT  G   DI+  L  AW  ACA+T PS ++IP GT+ +++  L GPCKA I+L++  
Sbjct  72    FDVTKYGAGKDITEALTNAWKSACASTKPSKVLIPSGTYWLRKVTLAGPCKAAIKLQVDG  131

Query  360   TLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNL  539
              LKAP +PN +     W+   YVD FTLSG GT DGQG V               LP NL
Sbjct  132   ILKAPVDPNKLS-GGHWVNFRYVDQFTLSGRGTFDGQGKVAWSKSTCHKDKNCKGLPMNL  190

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
               +F+ N+++RDIT+L+SK FHVNV G KNLTFQ  T++AP +S NTDGIHI +   + I
Sbjct  191   RFDFITNALVRDITTLDSKNFHVNVLGCKNLTFQHFTVRAPGESVNTDGIHIGRSTGIYI  250

Query  720   KDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIG  899
              DS I TGDDCIS+GDG E L+I GVTCGPGHGISVGSLGK P E+PV G+ VK+     
Sbjct  251   IDSKISTGDDCISVGDGTEELHITGVTCGPGHGISVGSLGKYPNEKPVSGIFVKNCTISD  310

Query  900   TDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
             T NG+RIK+WP  + GV +++H+  I M +V+NP++IDQ YCP NQC+ + PS VKIS+V
Sbjct  311   TTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQGYCPWNQCTLKAPSKVKISDV  370

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFK--GGAAKTVCSNAKPKLTG  1244
             S+ +I+GTSAT   V IACSSG PC+ VK  +INL ++  GG AK+ CSN KP ++G
Sbjct  371   SFKSIRGTSATPVVVRIACSSGFPCQKVKLANINLAYRGPGGPAKSQCSNVKPIISG  427



>ref|XP_011069588.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=401

 Score =   377 bits (967),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 195/388 (50%), Positives = 261/388 (67%), Gaps = 12/388 (3%)
 Frame = +3

Query  135   FTFVLFL-LADLGESAEFKVT-------AEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
              T +LFL L  +  +A+  +T       A+   DIS  L+ AW EAC +T+PS IVIP+G
Sbjct  6     ITILLFLPLLAINVNAQGPMTYDITKYGAKSGGDISQALMDAWKEACNSTSPSTIVIPRG  65

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKK-EWLTINYVDDFTLSGDGTLDG  467
             T+ + Q  L GP KAP+EL+++  L+A PNP  +  K+ EW+TINYV+ FTLSG G  DG
Sbjct  66    TWSLSQVKLLGPNKAPLELQVQGILQANPNPGQLPNKEGEWITINYVNYFTLSGGGVFDG  125

Query  468   QGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKI  647
             QG                KLP NLS NF+ NSIIRD+T+ +SK FHVN  G  N+TF + 
Sbjct  126   QGQQAWKQNDCHKNRNCAKLPMNLSFNFVNNSIIRDVTTKDSKNFHVNCIGSHNVTFLRF  185

Query  648   TIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISV  827
             T+ AP DS NTDGIH+ +   + IKDS+I TGDDC+SIGD  + ++I  VTCGPGHGISV
Sbjct  186   TVSAPGDSPNTDGIHLGRDTMINIKDSIIKTGDDCVSIGDESKEIHIQNVTCGPGHGISV  245

Query  828   GSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPI  1004
             GSLG    E+ V+G+ V +  FIGT NG+R+KTWP++   + V+D+H+  + M++V +PI
Sbjct  246   GSLGGYAEEKDVQGIFVTNCTFIGTQNGVRVKTWPSAPAQLTVSDLHFEDLIMDNVSSPI  305

Query  1005  VIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINL  1184
             +IDQEYCP+N C K++PS +KISNVS  N++GT+ + EAV + CS   PCE+V+ GDI+L
Sbjct  306   IIDQEYCPHNLCKKDRPSSIKISNVSIKNVRGTTNSAEAVTLICSGLKPCENVEVGDIDL  365

Query  1185  TFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             T+ G  G   T C N KPK  GKQ PPV
Sbjct  366   TYNGNQGPITTKCMNVKPKFVGKQNPPV  393



>ref|XP_011097079.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=401

 Score =   376 bits (966),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 193/389 (50%), Positives = 257/389 (66%), Gaps = 13/389 (3%)
 Frame = +3

Query  135   FTFVLFLLADLGESAEF---------KVTAEGDSDISPELLKAWDEACAATTPSIIVIPK  287
             F  +LF L  L  +            K  A+   DIS  L+ AW EAC +T+PS IV+P+
Sbjct  5     FITILFFLPLLAINVNAQGPMTYDITKYGAKSGGDISQALMDAWKEACNSTSPSTIVVPR  64

Query  288   GTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKK-EWLTINYVDDFTLSGDGTLD  464
             GT+ + Q  L GP KAP+EL+++ TL+A PNP  +  K+ EW+TINYV+ FTLSG G  D
Sbjct  65    GTWSLSQVKLLGPNKAPLELQVQGTLQANPNPGQLPNKEGEWITINYVNYFTLSGGGVFD  124

Query  465   GQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQK  644
             GQG                KLP NLS NF+ NSIIRD+T+ +SK FHVN     N+TF +
Sbjct  125   GQGQEAWKQNDCHKNRNCAKLPMNLSFNFVNNSIIRDVTTKDSKNFHVNCISSHNVTFLR  184

Query  645   ITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGIS  824
              T+ AP DS NTDGIH+ +   + IKDS+I TGDDC+SIGD  + ++I  VTCGPGHGIS
Sbjct  185   FTVSAPGDSPNTDGIHLGRDTMINIKDSIIKTGDDCVSIGDESKEIHIQNVTCGPGHGIS  244

Query  825   VGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNP  1001
             VGSLG    E+ V+G+ V +  FIGT NG+R+KTWP++   + V+D+H+  + M++V +P
Sbjct  245   VGSLGGYAEEKDVQGIYVTNCTFIGTTNGVRVKTWPSAPATLTVSDLHFEDLIMDNVSSP  304

Query  1002  IVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDIN  1181
             I+IDQEYCP+N C K++PS +KI+NVS  N++GT+ T EAV   CS   PCE+V+ GDI+
Sbjct  305   IIIDQEYCPHNLCKKDRPSSIKITNVSIKNVRGTTNTAEAVTFICSGLKPCENVEVGDID  364

Query  1182  LTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             LT+ G  G   T C+N KPK  GKQ PPV
Sbjct  365   LTYNGNQGPITTKCANVKPKFVGKQNPPV  393



>ref|XP_010093135.1| hypothetical protein L484_009327 [Morus notabilis]
 gb|EXB53587.1| hypothetical protein L484_009327 [Morus notabilis]
Length=394

 Score =   375 bits (964),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 185/378 (49%), Positives = 254/378 (67%), Gaps = 8/378 (2%)
 Frame = +3

Query  144   VLFLL--ADLGESAEFKVTAEGDS---DISPELLKAWDEACAATTPSIIVIPKGTFQMKQ  308
             VLF+L  ++L  +  F VT  G +   DI+  LLK W +ACA  + S ++IPKGTF++ Q
Sbjct  11    VLFMLVASNLSNAQVFDVTKNGANAKVDITQALLKTWKQACATKSRSQVLIPKGTFKVSQ  70

Query  309   ALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIY  488
             A  +GPCKAPIE  ++ TL AP    + +    W++  ++D  T++G GT +GQG    +
Sbjct  71    ATFQGPCKAPIEFNLQGTLLAPAVDGNFKGGDSWISFEHIDSLTVTGGGTFNGQGKTA-W  129

Query  489   GQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPAD  668
             G+   +      LP N+  NFL NS+++ +TSL+SK FHVNV G KN+TFQ   + AP D
Sbjct  130   GKTCTSSQYCGNLPINVRFNFLTNSVVQYVTSLDSKQFHVNVLGCKNITFQHFKVSAPGD  189

Query  669   SHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTP  848
             S NTDGIHI +  DV + DS I TGDDCISIG+G + + I+ V CGPGHGIS+GSLG   
Sbjct  190   SLNTDGIHIGRSTDVKVLDSNIQTGDDCISIGEGSQQVTINKVNCGPGHGISIGSLGMYA  249

Query  849   GEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCP  1028
              EE VKGV VK      T NG+RIKTWP+S PG  +D+H+  I++++V NPIVIDQEYCP
Sbjct  250   NEEAVKGVFVKSCTLKNTQNGVRIKTWPDSQPGTASDMHFEDIQLDNVGNPIVIDQEYCP  309

Query  1029  NNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GA  1202
              N+C+ +  S VK+SN+S+ NI+G+S+T  AV + CS G PC++V+  DINL++KG  GA
Sbjct  310   WNKCNAKVSSRVKLSNISFKNIRGSSSTAVAVKLVCSKGYPCQNVQLSDINLSYKGSEGA  369

Query  1203  AKTVCSNAKPKLTGKQTP  1256
               + C N KP L+GK+ P
Sbjct  370   ITSECKNVKPILSGKENP  387



>ref|XP_007049261.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOX93418.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=515

 Score =   378 bits (971),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 186/364 (51%), Positives = 256/364 (70%), Gaps = 5/364 (1%)
 Frame = +3

Query  177   AEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIK  356
             A++   A+  +D+S  LL AW EACA+TTPS IVIPKGT+++ +A L GPCK+ IEL++ 
Sbjct  33    AKYGAKADEKTDLSTPLLHAWKEACASTTPSKIVIPKGTYRLSRATLDGPCKSAIELQVS  92

Query  357   ATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFK-SDKLPN  533
              T+KAP +P+  +    W+  N+VD  T+SG G  DGQG   ++G+      K    LP 
Sbjct  93    GTIKAPADPSAFK-DPNWVVFNHVDHLTISGGGVFDGQG-AAVWGKNNCAKNKYCAALPI  150

Query  534   NLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDV  713
             NL  NF+ N+I++ IT+ +SK FHVNV G KN TFQ  T+ AP +S NTDGIHI +   +
Sbjct  151   NLRFNFVSNAIVQGITTKDSKQFHVNVLGCKNFTFQHFTVSAPENSINTDGIHIGRSNGI  210

Query  714   TIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKF  893
              I D+ I TGDDC+S+GDG +N+ ++ VTCGPGHGISVGSLGK  GEEPV G+ +++   
Sbjct  211   KILDTNIKTGDDCVSLGDGSKNVIVERVTCGPGHGISVGSLGKFKGEEPVSGIFIRNCTI  270

Query  894   IGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKIS  1073
               T NG+R+KTWP+SHPG  TD+H+  I + +V NPI+IDQEYCP N C+ + PS VK+S
Sbjct  271   SNTMNGVRVKTWPDSHPGSATDMHFEDIILNNVGNPILIDQEYCPWNLCNLKVPSRVKLS  330

Query  1074  NVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFK--GGAAKTVCSNAKPKLTGK  1247
             N+S+  I GTS+T++AV + CS G+PC+ V+  DI++T+K  GG A + C N KP+L+GK
Sbjct  331   NISFKKIWGTSSTQQAVKLVCSRGLPCDRVELADIDITYKGPGGPAISQCINVKPRLSGK  390

Query  1248  QTPP  1259
             Q PP
Sbjct  391   QNPP  394



>ref|XP_007049259.1| Polygalacturonase [Theobroma cacao]
 gb|EOX93416.1| Polygalacturonase [Theobroma cacao]
Length=405

 Score =   374 bits (960),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/364 (50%), Positives = 255/364 (70%), Gaps = 5/364 (1%)
 Frame = +3

Query  177   AEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIK  356
             A++   A+  +D+S  LL AW EACA+TTPS IVIPKGT+++ +A L GPCK+ IEL++ 
Sbjct  33    AKYGAKADEKTDLSTPLLNAWKEACASTTPSKIVIPKGTYRLSRASLDGPCKSAIELQVS  92

Query  357   ATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFK-SDKLPN  533
               +KAP +P+  +    W+  N+VD  T+SG G  DGQG   ++G+      K    LP 
Sbjct  93    GIIKAPADPSAFK-DPNWVVFNHVDHLTISGGGVFDGQG-AAVWGKNNCAKNKYCAALPI  150

Query  534   NLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDV  713
             NL  N++ N+I++ IT+ +SK FHVNV G +N TFQ  T+ AP +S NTDGIHI +   V
Sbjct  151   NLRFNYVSNAIVQGITTKDSKQFHVNVLGCRNFTFQHFTVSAPENSINTDGIHIGRSNGV  210

Query  714   TIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKF  893
              + D+ I TGDDC+S+GDG +N+ ++ VTCGPGHGISVGSLGK   EEPV G+ V++   
Sbjct  211   KVLDTNIKTGDDCVSLGDGSKNVIVERVTCGPGHGISVGSLGKFNDEEPVSGIFVRNCTL  270

Query  894   IGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKIS  1073
               T NG+R+KTWP+SHPG  TD+H+  I + +V NPI+IDQEYCP N C+ + PS +K+S
Sbjct  271   SNTMNGVRVKTWPDSHPGSATDMHFEDIILNNVGNPILIDQEYCPWNLCNLKVPSRIKLS  330

Query  1074  NVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFK--GGAAKTVCSNAKPKLTGK  1247
             N+S+  I+GTS+T++AV + CS G+PC+ V+  DI++T+K  GG A + C+N KP+ +GK
Sbjct  331   NISFKKIRGTSSTQQAVRLVCSRGLPCDRVELADIDITYKGPGGPATSECTNVKPRTSGK  390

Query  1248  QTPP  1259
             Q PP
Sbjct  391   QNPP  394



>ref|XP_010532220.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=436

 Score =   375 bits (962),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/386 (47%), Positives = 254/386 (66%), Gaps = 7/386 (2%)
 Frame = +3

Query  120   IFYCAFTFVLFLLADLGESAEFKVTAEG-----DSDISPELLKAWDEACAATTPSIIVIP  284
             +++     V F+     +S  F +T  G     D DI+     AW  AC++ + S +VIP
Sbjct  40    VYFYGGATVPFVWETCPDSVAFSITKYGLIGTEDEDITKAFSIAWKAACSSPSLSQLVIP  99

Query  285   KGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLD  464
              G++ ++Q   +GPCKAP+EL++   +KAP +P+D   K  W+T   +D FTL G+GT D
Sbjct  100   NGSYILRQVRFEGPCKAPLELQVHGIIKAPEDPSDFIEKAGWITFQRIDHFTLVGNGTFD  159

Query  465   GQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQK  644
             GQG             + +KLP N+  NF+ N +++DITSLNSKLFH+NV G  NLTF +
Sbjct  160   GQGSTAWSHNDCHKTGECNKLPINIRFNFITNGLVQDITSLNSKLFHINVLGCTNLTFDR  219

Query  645   ITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGIS  824
             + IKAP DS NTDGIHI +  ++ I DS + TGDDCIS+G G EN+ I+ V CGPGHGIS
Sbjct  220   VKIKAPEDSPNTDGIHIGRSKNINIIDSEMSTGDDCISMGRGSENITIERVKCGPGHGIS  279

Query  825   VGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPI  1004
             VGSLG+   EEPV G+ V++  F  TDNG+R+KTW +S   + T +H+H I + +V NPI
Sbjct  280   VGSLGRYTKEEPVSGIIVRNCTFFNTDNGVRVKTWLSSEKAIATGLHFHDITVVNVSNPI  339

Query  1005  VIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINL  1184
             VIDQEYCP + C  +KPS VK+SN+S+ NI GTS+T+ A+ +ACSSGVPCE+V+  +I++
Sbjct  340   VIDQEYCPYDHCKAKKPSQVKLSNISFKNIHGTSSTKMAMKLACSSGVPCENVEISNIDI  399

Query  1185  TFKG--GAAKTVCSNAKPKLTGKQTP  1256
              + G  G + + C+N  PK  GKQ P
Sbjct  400   KYIGSDGVSMSDCTNVSPKTFGKQYP  425



>ref|XP_010112808.1| hypothetical protein L484_020040 [Morus notabilis]
 gb|EXC34923.1| hypothetical protein L484_020040 [Morus notabilis]
Length=394

 Score =   373 bits (958),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/363 (49%), Positives = 252/363 (69%), Gaps = 6/363 (2%)
 Frame = +3

Query  183   FKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKI  353
             F VT  G   + DI+  L  AW +ACA+     ++IP+GT+++ +A L+GPCK PI++++
Sbjct  28    FDVTTYGAQLNMDITQALSNAWKDACASPIRGKVLIPRGTYKLSRATLEGPCKVPIKVQL  87

Query  354   KATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPN  533
             + TL+AP +P+       W+T   VD  TL+G GT DGQG   ++G+  +      KLP 
Sbjct  88    QGTLRAPTDPSGFNEGDGWVTFRNVDGLTLAGGGTFDGQGSA-VWGKNCEQQQYCGKLPI  146

Query  534   NLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDV  713
             N   +F+ NS+IRDI SLNSK FH+NV GG+N+TF ++ I AP DS NTDGIHI +   +
Sbjct  147   NFRFDFVTNSLIRDIISLNSKQFHINVLGGQNVTFSRVKIIAPEDSPNTDGIHIGRSSGI  206

Query  714   TIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKF  893
             +I D+VI TGDDC+S+GDG + ++I  VTCGPGHGISVGSLGK   E+PV+GV V++   
Sbjct  207   SITDTVIQTGDDCVSLGDGCKEISIRRVTCGPGHGISVGSLGKYSNEDPVEGVIVRNCTI  266

Query  894   IGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKIS  1073
               T NG+R+KTWP+SH G+ +++H+  I ME+V NP++IDQEYCP NQC+ + PS +KIS
Sbjct  267   RNTSNGVRVKTWPDSHDGLASNLHFEDIVMENVGNPVLIDQEYCPWNQCNAKVPSRIKIS  326

Query  1074  NVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGK  1247
             +VS+ NI+GTS T  AV + CSSG PC++V+  DI+L + G  G   + C N KP ++GK
Sbjct  327   DVSFKNIRGTSTTALAVNLVCSSGFPCQNVEIADIDLQYSGNDGPIMSQCKNVKPTISGK  386

Query  1248  QTP  1256
             Q P
Sbjct  387   QNP  389



>dbj|BAA89479.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   372 bits (955),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 186/357 (52%), Positives = 241/357 (68%), Gaps = 4/357 (1%)
 Frame = +3

Query  183   FKVTAEG-DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKA  359
             F VT  G   DI+  L  AW +ACA+T PS + IP GT+ ++Q  L GPCKA IEL++  
Sbjct  31    FDVTKYGGKEDITEALNNAWKDACASTNPSKVHIPSGTYSLRQVTLAGPCKAAIELQVDG  90

Query  360   TLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNL  539
              LKAP +PN       W+  ++VD  TLSG GT DGQG V             +  P N+
Sbjct  91    ILKAPVDPNQFS-GGHWVDFSHVDQLTLSGSGTFDGQGSVAWSKSTCSKDKNCEGFPMNI  149

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
               +F+ N  +RDIT+ +SK FHVNV   KNLTFQ  T+ APA+S NTDGIHI +   + I
Sbjct  150   RFDFITNGFVRDITTRDSKNFHVNVLECKNLTFQHFTVTAPAESINTDGIHIGRSTGIYI  209

Query  720   KDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIG  899
              DS IGTGDDCIS+GDG E+L++ GVTCGPGHGISVGSLG+ P E+PV G+ VK+     
Sbjct  210   IDSKIGTGDDCISVGDGTEDLHVTGVTCGPGHGISVGSLGRYPNEKPVSGIFVKNCTISN  269

Query  900   TDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
             T NG+RIK+WP+ + G  +++H+  I M +V+NP+ +DQEYCP NQCS + PS VKIS+V
Sbjct  270   TANGVRIKSWPDLYGGDASNMHFEDIVMNNVQNPVAVDQEYCPWNQCSLKAPSKVKISDV  329

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTG  1244
             S+ NI+GTSAT   V +ACSSG+PCE V+  DINL + G  G AK+ CSN KP ++G
Sbjct  330   SFKNIRGTSATPVVVKLACSSGIPCEKVELADINLVYSGSEGPAKSQCSNVKPIISG  386



>ref|XP_008342227.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Malus domestica]
Length=400

 Score =   372 bits (955),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 187/393 (48%), Positives = 255/393 (65%), Gaps = 10/393 (3%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESA-------EFKVTAEGDSDISPELLKAWDEACAATTPS  269
             M + F    TF LFL+A   ++        +F   A+G +D S  +  AW EAC + TPS
Sbjct  1     MGSKFVLRATFFLFLVALFIKAKAADIDIKKFGAKADGKTDDSQAINSAWKEACTSATPS  60

Query  270   IIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSG  449
              +VI KG + +     +GPCKAP+ L+++ TL+AP  P  ++ +  W+    +D  ++SG
Sbjct  61    TVVIAKGNYMVGPVKFQGPCKAPVSLRVEGTLQAPAEPEKLKSQDGWVIFQNIDALSVSG  120

Query  450   DGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKN  629
              GT DGQG +           K + LP +L L  L N+ I+DITS NSKLFH+N+   KN
Sbjct  121   GGTFDGQGSIAWSKNDCAKTGKCNSLPISLRLTGLTNAHIQDITSTNSKLFHMNILNCKN  180

Query  630   LTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGP  809
             +T Q +TIKAP +S NTDGIHI +  ++ I  + I TGDDC+SIGDG + +NI+ VTCGP
Sbjct  181   VTLQHVTIKAPGESLNTDGIHIGRSTNINITGAEIQTGDDCVSIGDGSQQINIEKVTCGP  240

Query  810   GHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMED  989
             GHGIS+GSLG+   E+PV+GVTV++     T NG+R+KTWP S  GV +D+H+  I ME+
Sbjct  241   GHGISIGSLGRYHDEQPVRGVTVRNCTIKNTSNGVRVKTWPASPNGVASDLHFEDIIMEN  300

Query  990   V-KNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVK  1166
             V  +P++IDQEYCPN QC  + PS VKISNVS+ NI+GTSA   AV +ACS G+PC++V+
Sbjct  301   VTTSPVLIDQEYCPNGQCQAKMPSRVKISNVSFKNIRGTSADPVAVKLACSKGIPCQNVE  360

Query  1167  FGDINLTFKG--GAAKTVCSNAKPKLTGKQTPP  1259
               DINLT  G  G   +VCSN  P +TGK  PP
Sbjct  361   ISDINLTCNGKNGTCTSVCSNVNPTVTGKVIPP  393



>ref|XP_006595658.1| PREDICTED: polygalacturonase-like isoform X2 [Glycine max]
Length=386

 Score =   370 bits (950),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 186/350 (53%), Positives = 235/350 (67%), Gaps = 4/350 (1%)
 Frame = +3

Query  225   LLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKK  404
             L KAW+EACAAT+ S IVIP G+++M+   LKGPC APIE++   TL+AP +PN ++   
Sbjct  37    LTKAWEEACAATSASKIVIPGGSYKMEAVDLKGPCMAPIEIQFDGTLQAPADPNALDGAD  96

Query  405   EWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITS  584
             EWL + +V+ FTLSG G  DGQG          T     K   N   NFL NS++RDITS
Sbjct  97    EWLKVQHVNFFTLSGKGVFDGQGATAWKQNDCGTNKNCKKRSKNFGFNFLNNSMVRDITS  156

Query  585   LNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIG  764
              +SK FHVNV G  N TF    + AP  S NTDGIHI +  DV I ++ I TGDDC+S+G
Sbjct  157   KDSKNFHVNVLGCNNFTFDGFHVSAPNTSINTDGIHIGRSTDVKILNTNIATGDDCVSLG  216

Query  765   DGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHP  944
             DG + + +  V CGPGHGISVGSLGK P EEPV+ + VK+     TDNG+RIKTWP+S P
Sbjct  217   DGSKKITVQNVNCGPGHGISVGSLGKYPEEEPVEQLLVKNCTLTNTDNGVRIKTWPSS-P  275

Query  945   GV--VTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEE  1118
             G   +TD+H+  I M DV NP++IDQEYCP NQCSK+ PS +KIS V++ NI+GTS T+E
Sbjct  276   GASPITDMHFEDITMVDVMNPVIIDQEYCPWNQCSKQAPSKIKISKVTFKNIQGTSKTKE  335

Query  1119  AVIIACSSGVPCEDVKFGDINLTFKGGAAKTVCSNAKPKLTGKQTPPVTC  1268
              V + CS GVPCEDV+  ++ LTF G      C+N KP +TGK  P  TC
Sbjct  336   GVTLICSKGVPCEDVELNNVALTFNGAPIVAKCANVKPIVTGK-APACTC  384



>ref|XP_008245681.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Prunus mume]
Length=402

 Score =   370 bits (950),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 186/397 (47%), Positives = 259/397 (65%), Gaps = 10/397 (3%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADL--GESAEFKVT-----AEGDSDISPELLKAWDEACAATTPS  269
             M + F    TF LFL++      +A+F +      A+G +D S  + +AW EACA+TTPS
Sbjct  1     MGSKFILGTTFFLFLISFSIKARAADFDIKKYGAKADGKTDDSQAINRAWKEACASTTPS  60

Query  270   IIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSG  449
              ++I KG +       +GPCKAP+ ++++ TL+AP  P  ++ +  W+    +D  T+SG
Sbjct  61    TVLIAKGNYMAGPVKFQGPCKAPVSIRVEGTLQAPAEPEKLKSQDGWVVFRNIDGLTVSG  120

Query  450   DGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKN  629
              GT DGQG +           K + LP N+  + L NS I++ITS NSKLFH+NV   KN
Sbjct  121   GGTFDGQGSIAWSKNDCAKTGKCNSLPINIRFSGLTNSHIQNITSSNSKLFHINVLNCKN  180

Query  630   LTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGP  809
             +T Q + I AP +S NTDGIHI +  ++ I  + I TGDDCIS+GDG + +NI+ V CGP
Sbjct  181   VTLQHVIITAPGESLNTDGIHIGRSSNINITGAEIKTGDDCISLGDGSQQINIEKVKCGP  240

Query  810   GHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMED  989
             GHGIS+GSLG+   E+PV GVTV++     T NG+R+KTWP S  GV +D+H+  I ME+
Sbjct  241   GHGISIGSLGRYHDEQPVTGVTVRNCTISNTSNGVRVKTWPASPNGVASDLHFEDIIMEN  300

Query  990   VK-NPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVK  1166
             VK +P++IDQEYCPN QC  + PS VKISNVS+ NI+GTSA    V +ACS G+PC++V+
Sbjct  301   VKTSPVLIDQEYCPNGQCQAKIPSKVKISNVSFKNIRGTSADPVVVKLACSKGIPCQNVQ  360

Query  1167  FGDINLTFKG--GAAKTVCSNAKPKLTGKQTPPVTCK  1271
               DI+LT+ G  GAA +VC+N KP +TG+  PP   K
Sbjct  361   ISDIHLTYNGKNGAATSVCTNVKPTMTGQIFPPACAK  397



>ref|XP_008455553.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=403

 Score =   369 bits (948),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 188/399 (47%), Positives = 258/399 (65%), Gaps = 19/399 (5%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAE--------FKVTAEGD----SDISPELLKAWDEACA  254
             M  I Y +   + FL+A L  + E        F +   G+    +D++  L  AW++ACA
Sbjct  1     MSVIKYSSLLVITFLMALLSFTVESRSHVDVIFHLRKYGNIVSGADVTEALKDAWNDACA  60

Query  255   ATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDD  434
             +  PS +VIPKGTF++++   KGPCK+P+E++++ TL+AP +P+       W+T  YVD 
Sbjct  61    SLRPSAVVIPKGTFKVREGEFKGPCKSPVEVRVRGTLQAPKHPHG----DSWITFAYVDR  116

Query  435   FTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNV  614
              TLSG G  DGQG                +LP +L  NF+ NSI+R ITSL+SK FHVN+
Sbjct  117   MTLSGGGVFDGQGKAGWEKNDCHKHISCARLPISLRFNFITNSIVRRITSLDSKNFHVNI  176

Query  615   FGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDG  794
              G  NLTF  + I AP DS NTDGIHI +   ++I  S I TGDDCIS+GDG + + I  
Sbjct  177   LGCNNLTFDGVNIIAPEDSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRVKITN  236

Query  795   VTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYH  971
             VTCGPGHGIS+GSLGK   EEPV+GV VK+   + T NG+RIKTWP S   G+ T++H+ 
Sbjct  237   VTCGPGHGISIGSLGKYTNEEPVEGVIVKNCTIMNTTNGVRIKTWPASPVAGIATNMHFL  296

Query  972   KIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVP  1151
              I M +V NPI+IDQEYCP NQC+++ PS +KI+ VS+ NI+G+SAT  AV + CSS +P
Sbjct  297   DITMVNVSNPILIDQEYCPWNQCNRKIPSKIKINKVSFKNIRGSSATPVAVKLICSSNLP  356

Query  1152  CEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             CE+VK  +I+L + G  G+  + C N KP ++G Q PP+
Sbjct  357   CEEVKVANIDLVYNGIKGSLTSECMNVKPIISGTQNPPI  395



>ref|XP_011097055.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=399

 Score =   369 bits (947),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 188/363 (52%), Positives = 249/363 (69%), Gaps = 6/363 (2%)
 Frame = +3

Query  186   KVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATL  365
             K  A+   DIS  L+ AW EAC +T+PS IVIP+GT+ + Q  L GP KAP+EL+++ TL
Sbjct  31    KYGAKSGGDISQALMDAWKEACNSTSPSTIVIPRGTWSLSQVKLLGPNKAPLELQVQGTL  90

Query  366   KAPPNPNDMECKK-EWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLS  542
             +A  NP  +  K+ EW+TINYV+ FTLSG G  DG+G                KLP NLS
Sbjct  91    QA--NPGQLPNKEGEWITINYVNYFTLSGGGVFDGRGQEAWKQNDCHKNKNCAKLPMNLS  148

Query  543   LNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIK  722
              NF+ NSIIRD+T+ +SK FHVN     N+TF + T+ AP DS NTDGIH+ +   + IK
Sbjct  149   FNFVNNSIIRDVTTKDSKNFHVNCISSHNVTFLRFTVSAPGDSPNTDGIHLGRDTMINIK  208

Query  723   DSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGT  902
             DS+I TGDDC+SIGD  + ++I  VTCGPGHGISVGSLG    E+ V+G+ V +  FIGT
Sbjct  209   DSIIKTGDDCVSIGDESKEIHIQNVTCGPGHGISVGSLGGYAEEKDVQGIYVTNCTFIGT  268

Query  903   DNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
              NG+R+KTWP++   + V+D+H+  + M++V +PI+IDQEYCP+N C K++PS +KISNV
Sbjct  269   TNGVRVKTWPSAPATLTVSDLHFEDLIMDNVSSPIIIDQEYCPHNLCKKDRPSSIKISNV  328

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQT  1253
             S  N++GT+ T EAV   CS   PCE+V+ GDI+LT+ G  G   T C+N KPK  GKQ 
Sbjct  329   SIKNVRGTTNTAEAVTFICSGLKPCENVEVGDIDLTYNGNQGPITTKCANVKPKFVGKQN  388

Query  1254  PPV  1262
             PPV
Sbjct  389   PPV  391



>ref|XP_007152047.1| hypothetical protein PHAVU_004G097300g [Phaseolus vulgaris]
 gb|ESW24041.1| hypothetical protein PHAVU_004G097300g [Phaseolus vulgaris]
Length=398

 Score =   368 bits (945),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 191/376 (51%), Positives = 246/376 (65%), Gaps = 9/376 (2%)
 Frame = +3

Query  144   VLFLLADLGESAEF------KVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMK  305
             +  LL     +A+F      K  A  + DI+  L  AW +ACA+TTPS +VI +G + +K
Sbjct  12    LFLLLVSSSATAQFGVFDISKYGAVPNGDITEALTNAWSDACASTTPSKVVIARGIYNLK  71

Query  306   QALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQI  485
             Q   KGPC APIE+++  T+KAP +PN +    +W+   Y++  TLSG GT DGQG    
Sbjct  72    QIEFKGPCMAPIEVQVDGTIKAPQDPNQLNGDAQWIKFTYINFLTLSGAGTFDGQG-ANA  130

Query  486   YGQKKDTGFKS-DKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAP  662
             + Q      KS  KL  N    FL N+I+RDITS +SK FHVNV G  N+TF    I AP
Sbjct  131   WTQNNCAKNKSCKKLSMNFGFGFLNNTIVRDITSKDSKYFHVNVLGCNNITFTNFNIVAP  190

Query  663   ADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGK  842
             A S NTDGIHI +   V I ++ I TGDDCIS+GDG + + +  VTCGPGHGISVGSLGK
Sbjct  191   ATSPNTDGIHIGRSTLVNIDNTNIATGDDCISLGDGSKQITVLNVTCGPGHGISVGSLGK  250

Query  843   TPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQE  1019
              P E+PV+   V +     TDNG+RIKTWP++   + VT +H+  I+M +VKNPI+IDQE
Sbjct  251   YPNEKPVEDFFVSNCILNNTDNGVRIKTWPDTPATITVTGMHFEDIKMINVKNPIIIDQE  310

Query  1020  YCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGG  1199
             YCP NQC+K+ PS +KISNVS+ NI GTS T+E V++ CSSGVPCEDV   DI+LTF G 
Sbjct  311   YCPWNQCTKQNPSKIKISNVSFKNIIGTSGTKEGVVLICSSGVPCEDVMLTDIDLTFNGT  370

Query  1200  AAKTVCSNAKPKLTGK  1247
             +A    SN KP + GK
Sbjct  371   SAAAKLSNVKPIIQGK  386



>sp|Q6H9K0.1|PGLR2_PLAAC RecName: Full=Exopolygalacturonase; AltName: Full=Pollen allergen 
Pla a 2; AltName: Allergen=Pla a 2; Flags: Precursor, partial 
[Platanus x acerifolia]
 emb|CAE52833.1| polygalacturonase [Platanus x acerifolia]
Length=377

 Score =   366 bits (940),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 173/361 (48%), Positives = 245/361 (68%), Gaps = 4/361 (1%)
 Frame = +3

Query  195   AEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCK-APIELKIKATLKA  371
             A+G  DIS  ++KAW  ACA+  PS ++IPKG + M +  ++GPCK + I  +I   +KA
Sbjct  17    AKGAGDISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGPCKGSKIGFQIDGVVKA  76

Query  372   PPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNF  551
             P +P+  +    W++   +D  T+SG GTLDGQG         D          NL  +F
Sbjct  77    PADPSKFK-SDGWVSFYRIDGLTVSGTGTLDGQGQTAWAKNNCDKNPNCKHAAMNLRFDF  135

Query  552   LKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSV  731
             LK++++RDITSLNSK+FH+NV   +++TFQ +T+ AP  S NTDGIH+     VTI ++ 
Sbjct  136   LKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDGIHVGISKGVTITNTK  195

Query  732   IGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNG  911
             I TGDDCISIG G +N+ I  V CGPGHGIS+GSLG+   E+ V+G+TVK   F GT NG
Sbjct  196   IATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVRGITVKGCTFSGTMNG  255

Query  912   LRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTN  1091
             +R+KTWPNS PG  TD+ +  + M +V+NP+++DQEYCP  QCS++ PS +K+SN+++ N
Sbjct  256   VRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCSRQAPSRIKLSNINFNN  315

Query  1092  IKGTSATEEAVIIACSSGVPCEDVKFGDINLTFK--GGAAKTVCSNAKPKLTGKQTPPVT  1265
             I+GTS  + AV+IACS G+PC ++K G+INL+++  GG A + CSN KP  +GKQ P + 
Sbjct  316   IRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCSNVKPTFSGKQVPAIK  375

Query  1266  C  1268
             C
Sbjct  376   C  376



>sp|Q40312.1|PGLR_MEDSA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Medicago sativa]
 gb|AAA62286.1| polygalacturonase [Medicago sativa]
Length=421

 Score =   368 bits (944),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 193/392 (49%), Positives = 254/392 (65%), Gaps = 12/392 (3%)
 Frame = +3

Query  111   MDTIFYCAFTFVL-FLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPK  287
               T    +F F+  F  A  G     K   + +SDI   L  AW+EACA+TT + IVIP 
Sbjct  3     FSTAIIVSFLFIADFCAAQSGVLDISKFGGKPNSDIGQALTSAWNEACASTTAAKIVIPA  62

Query  288   GTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDG  467
             GT+Q+    LKGPCKAPIEL++  T++AP +P+ ++  ++W    Y+D  TLSG G  DG
Sbjct  63    GTYQLNGIELKGPCKAPIELQVDGTIQAPADPSVIKGTEQWFKFLYMDHLTLSGKGVFDG  122

Query  468   QGDVQIYGQKKDTGFKSDKLPN-----NLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNL  632
             QG   +Y +       S K  N     N   NF+ NSI+R +TS +SK FHV VFG KN+
Sbjct  123   QG-ATVYKKAAPASAWSGKNSNSKVFMNFGFNFVNNSIVRGVTSKDSKNFHVMVFGCKNI  181

Query  633   TFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPG  812
             TF   TI AP DS NTDGIH+ K  DV I ++ IGTGDDC+SIGDG + + + GV CGPG
Sbjct  182   TFDGFTITAPGDSPNTDGIHMGKSTDVKILNTNIGTGDDCVSIGDGSKQITVQGVNCGPG  241

Query  813   HGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVT--DIHYHKIEME  986
             HG+SVGSLGK   EE V+G+TVK+     TDNG+RIKTWP++ PG +T  DIH+  I M 
Sbjct  242   HGLSVGSLGKFTTEENVEGITVKNCTLTATDNGVRIKTWPDA-PGTITVSDIHFEDITMT  300

Query  987   DVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVK  1166
             +VKNP++IDQEY P NQCSK+ PS +K+S +S+ N+KGTS T E V++ CSS VPC+ V+
Sbjct  301   NVKNPVIIDQEYYPWNQCSKKNPSKIKLSKISFKNVKGTSGTAEGVVLICSSAVPCDGVE  360

Query  1167  FGDINLTFKGGAAKTVCSNAKPKLTGKQTPPV  1262
               +++L F G      C+N KP +TG  T PV
Sbjct  361   LNNVDLKFNGAPTTAKCTNVKPLVTG--TAPV  390



>gb|EYU42739.1| hypothetical protein MIMGU_mgv1a007536mg [Erythranthe guttata]
Length=404

 Score =   367 bits (942),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 187/396 (47%), Positives = 266/396 (67%), Gaps = 12/396 (3%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFL--LADLGESAE-FKVTAEGD----SDISPELLKAWDEACAATTPS  269
             M+  F+ +   ++FL  LA   ES   F ++  G      DISP L K W EAC AT  S
Sbjct  1     MEIKFFFSAVLLVFLPFLAYHAESVTIFDISKYGAKPGGEDISPVLAKVWKEACEATNAS  60

Query  270   IIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKK-EWLTINYVDDFTLS  446
              ++IPKGT+ + Q  L GP KAP+EL+++ T++A P+   +  K  +W+TINY+D FT+S
Sbjct  61    KVLIPKGTWYLSQIRLVGPNKAPLELEVQGTVEANPDYTKLPQKDGQWITINYLDGFTIS  120

Query  447   GDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGK  626
             G G  DG+G+               KLP NLSLNF+KN+II+D+T+ +SK FH N    +
Sbjct  121   GGGVFDGKGEQAWKANDCHKNPNCPKLPINLSLNFIKNAIIKDVTTKDSKNFHCNCISSQ  180

Query  627   NLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCG  806
             N+TFQ+ TI AP +S NTDGIHIA++ +V + DS IGTGDDCISIGD   +L+I+ V CG
Sbjct  181   NVTFQRFTISAPGESINTDGIHIARVSNVKVLDSNIGTGDDCISIGDETTDLHIENVKCG  240

Query  807   PGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEM  983
             PGHGISVGS+GK P E+ V G+TVK   F GT NG+R+KTWPN+   + ++++H+  + M
Sbjct  241   PGHGISVGSMGKNPAEKDVTGITVKKCTFTGTSNGVRVKTWPNAPATLKISNLHFEDLTM  300

Query  984   EDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDV  1163
              +V  P+VIDQ+YCP N C+K+KPSL++IS ++  N++GT+ T+EA++ +CSS  PC++V
Sbjct  301   NNVSYPVVIDQQYCPWNLCTKDKPSLIQISGLTVKNVRGTANTKEALLFSCSSSKPCQNV  360

Query  1164  KFGDINLTFKGGAAK---TVCSNAKPKLTGKQTPPV  1262
             +  DI+L +         TVC N KP ++GKQ PP+
Sbjct  361   QISDIDLKYVNSIPANFTTVCENVKPTVSGKQNPPI  396



>gb|KCW46858.1| hypothetical protein EUGRSUZ_K00662, partial [Eucalyptus grandis]
Length=395

 Score =   367 bits (941),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 182/369 (49%), Positives = 240/369 (65%), Gaps = 5/369 (1%)
 Frame = +3

Query  159   ADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAP  338
             A + +   +     G  DI+  LL AW +ACA+TT + + I  GTF + + +L+GPCKA 
Sbjct  23    AQVFQVENYSAKGGGIPDITQSLLGAWKKACASTTRAKVFIAGGTFALSEVVLEGPCKAH  82

Query  339   IELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKK-DTGFK  515
             +E +I+  L+AP +P+  +    W+    +D  T+SG GT DGQG +  +GQ   D    
Sbjct  83    VEFEIRGRLQAPADPSRFK-TDGWVVFQRIDGLTVSGGGTFDGQGKIA-WGQNDCDKNTN  140

Query  516   SDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHI  695
                LP NL  NF+ N+II ++T+L+SK FHVNV G KNLTF+   + AP DS NTDGIHI
Sbjct  141   CRTLPTNLRFNFVSNAIIHNVTTLDSKNFHVNVLGAKNLTFENFHVNAPGDSVNTDGIHI  200

Query  696   AKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVT  875
              +   V I D+ I TGDDC+S+GDG   + + GVTCGPGHGISVGSLGK   EEPV GV 
Sbjct  201   GRSLGVNILDTNIKTGDDCVSLGDGSRQITVRGVTCGPGHGISVGSLGKYDNEEPVSGVF  260

Query  876   VKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKP  1055
             V +    G  NG RIKTW  S  G+ TD+H+  ++M DV NP++IDQ YCP NQC  + P
Sbjct  261   VTNCTITGATNGARIKTWLASKIGIATDMHFQDVQMNDVANPVLIDQGYCPFNQCQAQIP  320

Query  1056  SLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAK  1229
             SLVKISNVS+  I+GTS+T+ AV IACS  +PCE V+  DINL +KG  G A + CSN +
Sbjct  321   SLVKISNVSFERIRGTSSTKVAVKIACSKRIPCEGVEIADINLVYKGPDGPATSECSNVR  380

Query  1230  PKLTGKQTP  1256
             P ++G Q P
Sbjct  381   PLISGMQNP  389



>ref|XP_004173029.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=423

 Score =   367 bits (943),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 195/373 (52%), Positives = 255/373 (68%), Gaps = 14/373 (4%)
 Frame = +3

Query  168   GESAEFKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAP  338
             G    F +T  G   ++DI+  L  AW EACA+TTPS ++IPKG++ + Q+ LKGPCK+P
Sbjct  44    GAGGVFDITKYGAKPNADITAALTSAWKEACASTTPSKVLIPKGSYGLSQSNLKGPCKSP  103

Query  339   IELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKS  518
             IEL+I+ TL+AP +P      +  L +   D  T+SG G LDGQG  +   +K D   K 
Sbjct  104   IELQIEGTLQAPAHPEG----EGLLILENTDLLTVSGTGVLDGQG--KAGWEKNDCHLKK  157

Query  519   D--KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIH  692
             +  KLP NL LNF+ NSI+  ITSL+SK FH+N+ G KNLTF  +TI AP +S NTDGIH
Sbjct  158   ECTKLPMNLKLNFITNSIVTGITSLDSKNFHINLLGCKNLTFDHVTITAPGNSPNTDGIH  217

Query  693   IAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGV  872
             ++    + I ++ I TGDDCIS+GD  + + I  VTCGPGHGIS+GSLGK   E+ V GV
Sbjct  218   VSSSEQINILNTNIATGDDCISVGDSNKQVAISDVTCGPGHGISIGSLGKYTKEKEVVGV  277

Query  873   TVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKE  1049
             TVK  K  GT NG+RIKTWP+S      TD+H+  IEM++V NPI+IDQEYCP NQC+++
Sbjct  278   TVKKCKLTGTTNGVRIKTWPDSAVAFPATDMHFEDIEMDNVSNPIIIDQEYCPWNQCNRK  337

Query  1050  KPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSN  1223
               S +KISNVS+ NI+GTSAT  AV I CS  +PCE V+  DI+LT+ G  G  K+ C+N
Sbjct  338   VASKIKISNVSFKNIRGTSATAIAVKIVCSKSIPCEGVEIADIDLTYSGPEGPIKSQCAN  397

Query  1224  AKPKLTGKQTPPV  1262
              KP +TGKQ PP+
Sbjct  398   VKPVITGKQNPPI  410



>gb|EYU42735.1| hypothetical protein MIMGU_mgv1a007533mg [Erythranthe guttata]
Length=404

 Score =   366 bits (939),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 186/392 (47%), Positives = 262/392 (67%), Gaps = 11/392 (3%)
 Frame = +3

Query  120   IFYCAFTFVLF-LLADLGESAE-FKVTAEGD----SDISPELLKAWDEACAATTPSIIVI  281
             +F+ A   V    LA   ES   F ++  G      DISP L K W EAC AT  S ++I
Sbjct  5     LFFSAVLLVFLPFLAYHAESVTVFDISKYGAKPGGEDISPVLAKVWKEACEATNASKVLI  64

Query  282   PKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKK-EWLTINYVDDFTLSGDGT  458
             PKGT+ + Q  L GP KAP+EL+++ T++A P+   +  K  +W+TINY+D FT+SG G 
Sbjct  65    PKGTWYLSQIRLVGPNKAPLELEVQGTVEANPDYTKLPQKDGQWITINYLDGFTISGGGV  124

Query  459   LDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTF  638
              DG+G+               KLP NLSLNF+KN+II+D+T+ +SK FH N    +N+TF
Sbjct  125   FDGKGEQAWKANDCHKNPNCPKLPINLSLNFIKNAIIKDVTTKDSKNFHCNCISSQNVTF  184

Query  639   QKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHG  818
             Q+ TI AP +S NTDGIHIA++ +V + DS IGTGDDCISIGD   +L+I+ V CGPGHG
Sbjct  185   QRFTISAPGESINTDGIHIARVSNVKVLDSNIGTGDDCISIGDETTDLHIENVKCGPGHG  244

Query  819   ISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVK  995
             ISVGS+GK P E+ V G+TVK   F GT NG+R+KTWPN+   + ++++H+  + M +V 
Sbjct  245   ISVGSMGKNPAEKDVTGITVKKCTFTGTSNGVRVKTWPNAPATLKISNLHFEDLTMNNVS  304

Query  996   NPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGD  1175
              P+VIDQ+YCP N C+K+KPSL++IS ++  N++GT+ T+EA++ +CSS  PC++V+  D
Sbjct  305   YPVVIDQQYCPWNLCTKDKPSLIQISGLTVKNVRGTANTKEALLFSCSSSKPCQNVQISD  364

Query  1176  INLTFKGGAAK---TVCSNAKPKLTGKQTPPV  1262
             I+L +         TVC N KP ++GKQ PP+
Sbjct  365   IDLKYVNSIPANFTTVCENVKPTVSGKQIPPI  396



>ref|XP_010112811.1| hypothetical protein L484_020043 [Morus notabilis]
 gb|EXC34926.1| hypothetical protein L484_020043 [Morus notabilis]
Length=394

 Score =   365 bits (938),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 185/377 (49%), Positives = 248/377 (66%), Gaps = 7/377 (2%)
 Frame = +3

Query  144   VLFLLADLGESAEFKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQAL  314
             +L L A    +  F VTA G   ++D +  LL  W EACA+ T S IV+PKG F++ QAL
Sbjct  12    LLVLFASHANAQVFDVTANGAKPNADSTQALLTTWKEACASATRSKIVVPKGVFKVTQAL  71

Query  315   LKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQ  494
              +GPCKAPIE  ++ TL+APP     +    W+   +VD  T+SG+G  DGQG    +G+
Sbjct  72    FQGPCKAPIEFNLQGTLQAPPVGGGFKGGDTWIGFEHVDFLTVSGNGVFDGQGK-SAWGK  130

Query  495   KKD-TGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADS  671
             K D T +   +LP NL  +F+ NS+++D+T+L+SK FHVNV G KN+TF    + AP +S
Sbjct  131   KCDHTEYCGKQLPINLRFDFVTNSLVQDVTTLDSKQFHVNVLGCKNVTFHNFHVIAPENS  190

Query  672   HNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPG  851
              NTDGIHI +  D+ I +S+I TGDDC+SIGDG + + +  VTCGPGHG  +GSLGK   
Sbjct  191   VNTDGIHIGRSTDIKILNSIIQTGDDCVSIGDGSKQIYLTQVTCGPGHGFGIGSLGKYLN  250

Query  852   EEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPN  1031
             E PV+G+ V       T NG+RIKTWPNS+PG  +DIH+  I ME+V NP++IDQEYCP 
Sbjct  251   ELPVQGIFVTGCTLKNTLNGVRIKTWPNSYPGTASDIHFADITMENVGNPVLIDQEYCPW  310

Query  1032  NQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAA  1205
             NQC+ + PS VK+SN+S+  I GTS+T  AV + CSSG PC++V   DINL + G  G  
Sbjct  311   NQCNLKVPSKVKLSNISFKKIHGTSSTPLAVNLVCSSGAPCQNVVIQDINLKYSGSQGPI  370

Query  1206  KTVCSNAKPKLTGKQTP  1256
              + C N KP + G Q P
Sbjct  371   TSKCKNVKPTVGGVQNP  387



>ref|XP_003633345.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28394.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   365 bits (937),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/361 (49%), Positives = 240/361 (66%), Gaps = 3/361 (1%)
 Frame = +3

Query  180   EFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKA  359
             ++   A+G +DIS  LL AW+ ACA+   S +VIP G + + Q  ++GPCKAPI L +K 
Sbjct  30    KYGAQADGKTDISQALLTAWEAACASPIASRVVIPAGIYALGQVTIEGPCKAPINLIVKG  89

Query  360   TLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNL  539
             T++AP + +  + +  W+   ++D FTLSG G  DGQG   ++ QK        +LP NL
Sbjct  90    TVRAPVDTSRFKPQAGWVAFQHLDQFTLSGYGVFDGQGQ-SVWRQKCSRTKYCHQLPINL  148

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
               NFL NSII+DITS +SK FH+NV   +N+TF ++ I AP DS NTDGIHI +   V I
Sbjct  149   RFNFLTNSIIKDITSKDSKQFHINVLRCRNITFFQVAITAPEDSQNTDGIHIGRSRGVNI  208

Query  720   KDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIG  899
               S I TGDDC+SIGDG E ++I  V CGPGHGISVGSLG    E PV G+ VK+     
Sbjct  209   THSTIQTGDDCVSIGDGSEQIDITKVNCGPGHGISVGSLGLYKNEAPVIGIRVKNCTLSD  268

Query  900   TDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
             T NG+R+KTWP+S  G  T++H+H I M +V NPI+IDQEYCP+NQC+ + PS VK+SN+
Sbjct  269   TTNGVRVKTWPSSPQGTATEMHFHDIVMNNVSNPIIIDQEYCPHNQCNLQIPSRVKLSNI  328

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQT  1253
             S+ NI+GT++TE AV + CS G PC+ V+ G+I+L + G  G A + C N +  L G Q 
Sbjct  329   SFKNIRGTTSTELAVNLVCSKGAPCQKVELGNIDLKYTGPEGTASSQCKNVEATLWGTQQ  388

Query  1254  P  1256
             P
Sbjct  389   P  389



>gb|EYU42734.1| hypothetical protein MIMGU_mgv1a007528mg [Erythranthe guttata]
Length=404

 Score =   365 bits (938),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 186/391 (48%), Positives = 260/391 (66%), Gaps = 10/391 (3%)
 Frame = +3

Query  120   IFYCAFTFVLFLLADLGESAE-FKVTAEGDS----DISPELLKAWDEACAATTPSIIVIP  284
             IF       L  LA   ES   F ++  G      DISP L K W EAC AT  S ++IP
Sbjct  6     IFSAVLLVFLPFLAYHAESVTIFDISKYGAKPGGDDISPVLAKVWKEACEATNASKVLIP  65

Query  285   KGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKK-EWLTINYVDDFTLSGDGTL  461
             KGT+ + Q  L GP KAP+EL+++ T++A P+   +  K  +W+TINY+D FT+SG G  
Sbjct  66    KGTWYLSQIRLVGPNKAPLELEVQGTVEANPDYTKLPQKDGQWITINYLDGFTISGGGVF  125

Query  462   DGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQ  641
             DG+G+               KLP NLSLNF+KN+II+D+T+ +SK FH N    +N+TFQ
Sbjct  126   DGKGEQAWKANDCHKNPNCPKLPINLSLNFIKNAIIKDVTTKDSKNFHCNCISSQNVTFQ  185

Query  642   KITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGI  821
             + TI AP +S NTDGIHIA++ +V + DS IGTGDDCISIGD   +L+I+ V CGPGHGI
Sbjct  186   RFTISAPGESINTDGIHIARVSNVKVLDSDIGTGDDCISIGDETTDLHIENVKCGPGHGI  245

Query  822   SVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKN  998
             SVGS+GK P E+ V G+TVK   F GT NG+R+KTWPN+   + ++++H+  + M +V  
Sbjct  246   SVGSMGKNPAEKDVTGITVKKCTFTGTSNGVRVKTWPNAPATLKISNLHFEDLTMNNVSY  305

Query  999   PIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDI  1178
             P+VIDQ+YCP N C+K+KPSL++IS ++  N++GT+ T+EA++ +CSS  PC++V+  DI
Sbjct  306   PVVIDQQYCPWNLCTKDKPSLIQISGLTVKNVRGTANTKEALLFSCSSSKPCQNVQISDI  365

Query  1179  NLTFKGGAAK---TVCSNAKPKLTGKQTPPV  1262
             +L +         TVC N KP ++GKQ PP+
Sbjct  366   DLKYVNSIPANFTTVCENVKPTVSGKQNPPI  396



>gb|ADP09681.1| polygalacturonase [Cucurbita pepo]
Length=416

 Score =   366 bits (939),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 195/376 (52%), Positives = 254/376 (68%), Gaps = 17/376 (5%)
 Frame = +3

Query  174   SAEFKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIE  344
             S  F +T  G   ++D +  L  AW EACA+ TPS +++PKGT+Q+ ++ LKGPCK+PIE
Sbjct  37    SGVFDITTFGAKPNADATQALADAWKEACASATPSKVLVPKGTYQLGESRLKGPCKSPIE  96

Query  345   LKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSD-  521
             L ++ TL+A  +P D E     L + Y+D  TLSG G  DGQG      +K D   K + 
Sbjct  97    LLVEGTLQA--SPTDTE-GDGLLVMEYIDHLTLSGTGVFDGQGKAGW--EKNDCHLKKEC  151

Query  522   -KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIA  698
              KLP NL  NF+ NSI++DITSL+SK FH+NV  GKNLTF  + I AP +S NTDGIH+ 
Sbjct  152   KKLPMNLKFNFITNSIVKDITSLDSKNFHINVLAGKNLTFDHLKITAPHNSPNTDGIHLG  211

Query  699   KICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTV  878
                DV I ++ I TGDDCIS+G     + I  VTCGPGHGIS+GSLGK   E+ V GVTV
Sbjct  212   DSEDVYILNTAIATGDDCISVGYTNRKITISDVTCGPGHGISIGSLGKYKTEKEVVGVTV  271

Query  879   KDSKFIGTDNGLRIKTWPN---SHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKE  1049
             K  K IGT NG+RIK+WP+   S+P   +D+H+  IEME+V NPI+IDQEYCP NQC+++
Sbjct  272   KKCKLIGTTNGVRIKSWPDSAVSYPA--SDMHFEDIEMENVANPIIIDQEYCPWNQCNRK  329

Query  1050  KPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSN  1223
              PS +KIS VS+ NI+GTS+T  AV + CS   PCE V+  DI+LT+ G  G A + CSN
Sbjct  330   VPSAIKISKVSFKNIRGTSSTPVAVKLVCSKSNPCEGVEIADIDLTYSGKEGPAVSECSN  389

Query  1224  AKPKLTGKQTPPVTCK  1271
              KP ++GKQ PP+  K
Sbjct  390   VKPTISGKQNPPICAK  405



>ref|XP_010657416.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   365 bits (937),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 177/383 (46%), Positives = 245/383 (64%), Gaps = 11/383 (3%)
 Frame = +3

Query  138   TFVLFLLADLGESA--------EFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGT  293
             T ++ LLA   E +        ++   A+G++DIS  LLKAW +AC++   S ++ P G 
Sbjct  10    TSLMLLLASAAEVSCDTIFDVTKYGARADGNTDISQALLKAWGDACSSPVASTVMTPDGX  69

Query  294   FQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQG  473
               + Q  + GPCK PI   ++ ++KA  + +  +    W+    +D FTLSG G  DGQG
Sbjct  70    HALGQITIGGPCKDPINFIVQGSVKALMDTSRFKAXAGWIAFRQIDQFTLSGGGVFDGQG  129

Query  474   DVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITI  653
                ++G K  +    ++LP NL  NF+ NS++++ITS +S  FH+N+ G KNLTF  + I
Sbjct  130   KT-VWGTKCPSSAYCNQLPINLRFNFITNSMVKNITSRDSNQFHINLLGCKNLTFYNVAI  188

Query  654   KAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGS  833
              AP +  NTDGIHI +   + I  S I TGDDC+SIGDG E +N+  VTCGPGHG SVGS
Sbjct  189   SAPEERLNTDGIHIGRSLGINITYSTIETGDDCVSIGDGSEQINMQRVTCGPGHGTSVGS  248

Query  834   LGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVID  1013
             LGK P EEPV G++VK+     T NG+R+KTWP SH G  + +H+  I M +V NPI+ID
Sbjct  249   LGKYPNEEPVVGISVKNCTRTNTQNGVRVKTWPASHQGTASXMHFEDIVMNNVGNPIIID  308

Query  1014  QEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFK  1193
             QEYCP+NQC+ + PS + +SNVS+ NI+GT++T+ AV + CS GVPCED + GDINL + 
Sbjct  309   QEYCPHNQCNLKIPSRIMLSNVSFRNIRGTTSTQVAVKLVCSQGVPCEDAELGDINLKYN  368

Query  1194  G--GAAKTVCSNAKPKLTGKQTP  1256
             G  G A + C N KP L G Q P
Sbjct  369   GKVGHAMSQCKNIKPNLLGTQLP  391



>gb|ABY21306.1| pollen allergen Pla o 2 [Platanus orientalis]
Length=378

 Score =   364 bits (935),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 174/361 (48%), Positives = 244/361 (68%), Gaps = 4/361 (1%)
 Frame = +3

Query  195   AEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCK-APIELKIKATLKA  371
             A+G  DIS  ++KAW+ ACA+  PS ++IP G + M + LL+GPCK + I  ++   +KA
Sbjct  18    AKGSGDISQAVMKAWEAACASPGPSTVLIPTGNYIMGEVLLEGPCKGSKIGFQLDGVVKA  77

Query  372   PPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNF  551
             P + +  +  + W+  N+VD  T+SG GT DGQG         D     ++ P N+  NF
Sbjct  78    PADVSAFK-SEGWVVFNHVDGLTVSGKGTFDGQGQKAWAANNCDKDENCNRPPMNIRFNF  136

Query  552   LKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSV  731
             LKN+++RDITS+NSK+FH+NV    N++FQ +TI AP  S NTDGIHI     VTI D+ 
Sbjct  137   LKNAVVRDITSMNSKMFHINVLECDNISFQHVTISAPGTSINTDGIHIGLSRGVTITDTN  196

Query  732   IGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNG  911
             I TGDDC+SIG G +N+ +  V CGPGHGISVGSLGK   E+ V+G+TV    F GT NG
Sbjct  197   IATGDDCVSIGPGSQNVTVTKVNCGPGHGISVGSLGKYKDEKDVRGITVTGCTFTGTSNG  256

Query  912   LRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTN  1091
             +R+KTWP+S PGV TD+ +  + M++V+NP+++DQEYCP  QCS + PS VK+SN+ + N
Sbjct  257   VRVKTWPDSPPGVATDMAFEDLTMKNVQNPVILDQEYCPYGQCSLKAPSRVKLSNIKFNN  316

Query  1092  IKGTSATEEAVIIACSSGVPCEDVKFGDINLTFK--GGAAKTVCSNAKPKLTGKQTPPVT  1265
             I+GTS+  +A++IACS G PC +++ G+INL     G  A + C+NAKP  +GKQ P + 
Sbjct  317   IRGTSSGPDAIVIACSHGFPCSNLEIGEINLALHAAGAPANSTCTNAKPIFSGKQVPAIK  376

Query  1266  C  1268
             C
Sbjct  377   C  377



>ref|XP_011099769.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=402

 Score =   364 bits (935),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 183/363 (50%), Positives = 247/363 (68%), Gaps = 4/363 (1%)
 Frame = +3

Query  186   KVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATL  365
             K  A   +DIS  LLKAW EA  +  PS I+IP+GTF + Q  L+GP KAPIEL+++ TL
Sbjct  32    KYGANSGADISQALLKAWKEAIVSVVPSKILIPQGTFTVSQVKLEGPNKAPIELEVQGTL  91

Query  366   KAPPNPNDMECKK-EWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLS  542
             KA P+PN +  KK EW+TINYV+ FTLSG G  DGQG +              KLP NLS
Sbjct  92    KAFPDPNQLPDKKAEWITINYVNYFTLSGGGVFDGQGQIAWKMNDCHKNKNCPKLPYNLS  151

Query  543   LNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIK  722
              NF+ NSII D+T+ +SK FH+N     N+TF+  TI AP +S NTDGIH+ +   + I 
Sbjct  152   FNFINNSIIHDVTTKDSKNFHLNCISSHNVTFRHFTISAPDESPNTDGIHLGRSTRINII  211

Query  723   DSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGT  902
             DSVI TGDDC+SIGD  + ++I+ VTCGPGHGIS+GSLG    E+ V+G+ VK+  FIGT
Sbjct  212   DSVIRTGDDCVSIGDDTKEVHIENVTCGPGHGISIGSLGGYATEKDVEGIYVKNYTFIGT  271

Query  903   DNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
              NG+R+KTWP +   + +T++++  + M++V NPI+IDQEYCP+N C +++PS +KI+ V
Sbjct  272   GNGVRVKTWPTTPAQLSITNLNFEDLIMDNVSNPIIIDQEYCPHNLCKRDRPSFIKINKV  331

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQT  1253
             +  NI+GT+ +EEAV + CS   PCE+V  GDI+L + G  G   T C N +P   GKQ 
Sbjct  332   NLKNIRGTTNSEEAVTLLCSKLKPCENVVVGDIDLKYNGNRGPVTTKCVNVQPTFVGKQN  391

Query  1254  PPV  1262
             PP+
Sbjct  392   PPI  394



>ref|XP_008467043.1| PREDICTED: exopolygalacturonase-like, partial [Cucumis melo]
Length=365

 Score =   363 bits (931),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 188/358 (53%), Positives = 250/358 (70%), Gaps = 11/358 (3%)
 Frame = +3

Query  204   DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNP  383
             ++D++  L  AW EACA+TTPS ++IPKG++ + Q+ LKGPCK+ IEL+I+ TL+AP +P
Sbjct  1     NADVTAALASAWKEACASTTPSKVLIPKGSYGLSQSNLKGPCKSAIELQIEGTLQAPADP  60

Query  384   NDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSD--KLPNNLSLNFLK  557
                      L + YVD  T+SG G LDGQG  +   +K D   K +  KLP NL LNF+ 
Sbjct  61    KG----DGLLLLEYVDQLTVSGTGVLDGQG--KAGWEKNDCHLKKECTKLPMNLKLNFVT  114

Query  558   NSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIG  737
             NSI++DITSL+SK +H+N+ G KNLTF  +TI AP +S NTDGIH++    + I ++ I 
Sbjct  115   NSIVKDITSLDSKNYHINLLGCKNLTFDHVTITAPGNSPNTDGIHVSSSEQINILNTNIA  174

Query  738   TGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLR  917
             TGDDCIS+GD  + + I  VTCGPGHGIS+GSLGK   E+ V GVTVK  K   T NG+R
Sbjct  175   TGDDCISVGDTNKQVVISDVTCGPGHGISIGSLGKYSKEKEVVGVTVKKCKLTDTTNGVR  234

Query  918   IKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNI  1094
             IKTWP+S      +D+H+  IEM +V NP++IDQEYCP NQC+++ PS +KISNVS+ NI
Sbjct  235   IKTWPDSAVAFPASDMHFEDIEMVNVSNPVIIDQEYCPWNQCNRKVPSKIKISNVSFKNI  294

Query  1095  KGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             +GTSAT  AV I CS   PCE V+  DI+LT+ G  G  K+ C+N KP ++GKQ PP+
Sbjct  295   RGTSATPVAVKIVCSQSNPCEGVEVADIDLTYSGSEGPIKSQCANVKPVISGKQNPPI  352



>gb|EYU42736.1| hypothetical protein MIMGU_mgv1a007545mg [Erythranthe guttata]
Length=404

 Score =   364 bits (934),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/392 (47%), Positives = 262/392 (67%), Gaps = 11/392 (3%)
 Frame = +3

Query  120   IFYCAFTFVLF-LLADLGESAE-FKVTAEGD----SDISPELLKAWDEACAATTPSIIVI  281
             +F+ A   V    LA   ES   F ++  G      DISP L K W EAC AT  S ++I
Sbjct  5     LFFSAVLLVFLPFLAYHAESVTVFDISKYGAKPGGEDISPVLAKVWKEACEATNASKVLI  64

Query  282   PKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKK-EWLTINYVDDFTLSGDGT  458
             PKGT+ + Q  L GP KAP+EL+++ T++A P+   +  K  +W+TINY+D FT+SG G 
Sbjct  65    PKGTWYLSQIRLVGPNKAPLELEVQGTVEANPDYTKLPQKDGQWITINYLDGFTISGGGV  124

Query  459   LDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTF  638
              DG+G+               KLP NLSLNF+KN+II+D+T+ +SK FH N    +N+TF
Sbjct  125   FDGKGEQAWKANDCHKNPNCPKLPINLSLNFIKNAIIKDVTTKDSKNFHCNCISSQNVTF  184

Query  639   QKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHG  818
             Q+ TI AP +S NTDGIHIA++ +V + DS IGTGDDCISIGD   +L+I+ V CGPGHG
Sbjct  185   QRFTISAPGESINTDGIHIARVSNVKVLDSNIGTGDDCISIGDETTDLHIENVKCGPGHG  244

Query  819   ISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVK  995
             ISVGS+GK P E+ V G+TVK   F GT NG+R+KTWP++   + ++++H+  + M +V 
Sbjct  245   ISVGSMGKNPAEKDVTGITVKKCTFTGTSNGVRVKTWPSAPATLKISNLHFEDLTMNNVS  304

Query  996   NPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGD  1175
              P+VIDQ+YCP N C+K+KPSL++IS ++  N++GT+ T+EA++ +CSS  PC++V+  D
Sbjct  305   YPVVIDQQYCPWNLCTKDKPSLIQISGLTVKNVRGTANTKEALLFSCSSSKPCQNVQISD  364

Query  1176  INLTFKGGAAK---TVCSNAKPKLTGKQTPPV  1262
             I+L +         TVC N KP ++GKQ PP+
Sbjct  365   IDLKYVNSIPANFTTVCENVKPTVSGKQIPPI  396



>gb|EYU42733.1| hypothetical protein MIMGU_mgv1a007538mg [Erythranthe guttata]
Length=404

 Score =   364 bits (934),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/392 (47%), Positives = 261/392 (67%), Gaps = 11/392 (3%)
 Frame = +3

Query  120   IFYCA--FTFVLFLLADLGESAEFKVTAEGD----SDISPELLKAWDEACAATTPSIIVI  281
             +F+ A    F+ FL         F ++  G      DISP L K W EAC AT  S ++I
Sbjct  5     LFFSAVLLVFLPFLAYHAQAVTVFDISKYGAKPGGEDISPVLAKVWKEACEATNASKVLI  64

Query  282   PKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKK-EWLTINYVDDFTLSGDGT  458
             PKGT+ + Q  L GP KAP+EL+++ T++A P+   +  K  +W+TINY+D FT+SG G 
Sbjct  65    PKGTWYLSQIRLVGPNKAPLELEVQGTVEANPDYTKLPQKDGQWITINYLDGFTISGGGV  124

Query  459   LDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTF  638
              DG+G+               KLP NLSLNF+KN+II+D+T+ +SK FH N    +N+TF
Sbjct  125   FDGKGEQAWKANDCHKNPNCPKLPINLSLNFIKNAIIKDVTTKDSKNFHCNCISSQNVTF  184

Query  639   QKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHG  818
             Q+ TI AP +S NTDGIHIA++ +V + DS IGTGDDCISIGD   +L+I+ V CGPGHG
Sbjct  185   QRFTISAPGESINTDGIHIARVSNVKVLDSNIGTGDDCISIGDETTDLHIENVKCGPGHG  244

Query  819   ISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVK  995
             ISVGS+GK P E+ V G+TVK   F GT NG+R+KTWP++   + ++++H+  + M +V 
Sbjct  245   ISVGSMGKNPAEKDVTGITVKKCTFTGTSNGVRVKTWPSAPATLKISNLHFEDLTMNNVS  304

Query  996   NPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGD  1175
              P+VIDQ+YCP N C+K+KPSL++IS ++  N++GT+ T+EA++ +CSS  PC++V+  D
Sbjct  305   YPVVIDQQYCPWNLCTKDKPSLIQISGLTVKNVRGTANTKEALLFSCSSSKPCQNVQISD  364

Query  1176  INLTFKGGAAK---TVCSNAKPKLTGKQTPPV  1262
             I+L +         TVC N KP ++GKQ PP+
Sbjct  365   IDLKYVNSIPANFTTVCENVKPTVSGKQNPPI  396



>gb|ADC53480.1| polygalacturonase [Gossypium hirsutum]
Length=412

 Score =   364 bits (934),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/362 (51%), Positives = 246/362 (68%), Gaps = 3/362 (1%)
 Frame = +3

Query  177   AEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIK  356
             A+F   A+  +D+S  LL AW EACA+T+PS IVIPKG + +  A L GPCKAPIEL+++
Sbjct  37    AKFGAKADEKTDLSKPLLDAWKEACASTSPSKIVIPKGIYFLSTATLDGPCKAPIELQVQ  96

Query  357   ATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNN  536
              T+KAP +P   + + +W+  N +++F LSG G  DGQG      +          LP N
Sbjct  97    GTVKAPADPGAFK-EPKWIAFNRIENFKLSGGGVFDGQGTTAYKREGCKGHDYCGSLPIN  155

Query  537   LSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVT  716
             L  +FL N++I+DIT+ +SK F  NV G KN+TF+  T+ AP +S NTDGIHI +   V 
Sbjct  156   LRFDFLTNAMIQDITTKDSKQFQANVLGCKNITFEHFTVSAPDESPNTDGIHIGRSDGVN  215

Query  717   IKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFI  896
             + +S I TGDDC+SIGDG +NL I+GVTCGPGHGIS+GSLG    EEPV GVTVK+    
Sbjct  216   VLNSEIKTGDDCVSIGDGSKNLVINGVTCGPGHGISIGSLGLFKNEEPVDGVTVKNCTMT  275

Query  897   GTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISN  1076
              T NG+RIKTWP + PG  ++IH+  I + +V +PI+IDQ+YCP N+C   + S VK+SN
Sbjct  276   NTSNGVRIKTWPGAEPGTCSNIHFEDITVTNVSSPIIIDQKYCPWNKCKINEESKVKLSN  335

Query  1077  VSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQ  1250
             +S+ NI GTSA  EAV I CS+ +PCE+V+  DI +T  G  G A + CSN KPK++GKQ
Sbjct  336   ISFKNIHGTSARPEAVKIICSATLPCENVELADIEITHSGPTGPAVSQCSNVKPKVSGKQ  395

Query  1251  TP  1256
              P
Sbjct  396   NP  397



>ref|XP_008379967.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=400

 Score =   363 bits (931),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 183/376 (49%), Positives = 247/376 (66%), Gaps = 8/376 (2%)
 Frame = +3

Query  135   FTFVLFLLADLGESAEFKVTA-----EGDSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             F F+L +     +S+ + VT+     + +SDIS    KAW +ACA+T  S IV+P+GT++
Sbjct  12    FVFMLLVSTSNAKSSIYDVTSAKYGGKANSDISQAFSKAWTDACASTLASKIVVPRGTYK  71

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
                A  KGPCKAPIE++++ TL+AP + + +     W+    +D  TLSG GT DGQG  
Sbjct  72    FVGATFKGPCKAPIEIQLQGTLQAPADGSKLPKADTWVGFERIDGLTLSGGGTFDGQGAT  131

Query  480   QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKA  659
                    +       +  NL  NF+ NSIIRDIT+ +SK FHVNV G  N+ FQ  T+ A
Sbjct  132   AWKQNDCNKNKNCKSIAINLRFNFVTNSIIRDITTKDSKNFHVNVLGCNNVVFQHFTVSA  191

Query  660   PADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLG  839
             P +S NTDGIHI +   + I DS IGTGDDCISIGDG + L++  VTCGPGHGIS+GSLG
Sbjct  192   PKESMNTDGIHIGRSTGINITDSTIGTGDDCISIGDGTKQLHVTKVTCGPGHGISIGSLG  251

Query  840   KTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQ  1016
             +   EEPV G+ +K+     TDNG+RIKTWP S   GVV+D+H+  I M++V NP++IDQ
Sbjct  252   RYQNEEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIMDNVGNPVIIDQ  311

Query  1017  EYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG  1196
             EYCP NQC+ + PS VKISNVS+ NIKG+S+T   + I CS G+PCE+V+  DI+LT+ G
Sbjct  312   EYCPWNQCTLKVPSKVKISNVSFKNIKGSSSTPVGIKIVCSGGLPCENVQLSDIDLTYSG  371

Query  1197  --GAAKTVCSNAKPKL  1238
               G   + C + KP +
Sbjct  372   NKGPITSQCKHVKPTI  387



>emb|CAN65676.1| hypothetical protein VITISV_002011 [Vitis vinifera]
Length=587

 Score =   368 bits (945),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 179/361 (50%), Positives = 243/361 (67%), Gaps = 3/361 (1%)
 Frame = +3

Query  180   EFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKA  359
             ++   A+G +DIS  LL AW+ ACA+   S +VIP G + + Q  ++GPCKAPI L +K 
Sbjct  221   KYGAQADGKTDISQALLTAWEAACASPIVSRVVIPAGIYALGQVTIEGPCKAPINLIVKG  280

Query  360   TLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNL  539
             T++AP + +  + +  W+   ++D FTLSG G  DGQG   ++GQK       ++LP NL
Sbjct  281   TVRAPVDTSRFKPQAGWVAFQHLDQFTLSGYGVFDGQGQ-SVWGQKCSRTKYCNQLPINL  339

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
               NFL NSII+DITS +SK FH+NV G +N+TF ++ I AP DS NTDGIHI +   V I
Sbjct  340   RFNFLTNSIIKDITSKDSKQFHINVLGCRNITFFQVAITAPEDSQNTDGIHIGRSRGVNI  399

Query  720   KDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIG  899
               S I TGDDC+SIGDG E ++I  V CGPGHGISVGSLG    E PV G+ VK+     
Sbjct  400   THSTIQTGDDCVSIGDGSEQIDITKVNCGPGHGISVGSLGLYKNEAPVIGIRVKNCTLSD  459

Query  900   TDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
             T NG+R+KT+P+S  G  T++H+H I M +V NPI+IDQEYCP+NQC+ + PS VK+SN+
Sbjct  460   TTNGVRVKTYPSSPQGTATEMHFHDIVMNNVSNPIIIDQEYCPHNQCNLQVPSRVKLSNI  519

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQT  1253
             S+ NI+GT++TE AV + CS G PC+ V+ G+I+L + G  G A + C N +  L G Q 
Sbjct  520   SFKNIRGTTSTELAVNLVCSKGAPCQKVELGNIDLKYTGPEGTASSQCKNVEATLWGTQQ  579

Query  1254  P  1256
             P
Sbjct  580   P  580


 Score =   187 bits (475),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 117/162 (72%), Gaps = 0/162 (0%)
 Frame = +3

Query  630   LTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGP  809
             +T Q +TI A  DS NTDGIH+ +   V I D++I TGDD +SIGDG +++N++ VTCGP
Sbjct  1     MTLQYVTINATRDSLNTDGIHMGRSTGVNISDAIIKTGDDSLSIGDGSQHINVEKVTCGP  60

Query  810   GHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMED  989
             GHGISVGSLGK   EEPV GVTVK+   I T NG+R+KTWP+S   V TD+H+  I M +
Sbjct  61    GHGISVGSLGKYHNEEPVVGVTVKNCTLINTMNGIRVKTWPDSPASVATDLHFEDIIMNN  120

Query  990   VKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATE  1115
             V NPI+I+QEYCP +QC  + PS VKIS+VS+  I   S T+
Sbjct  121   VGNPILINQEYCPYDQCQAKVPSQVKISDVSFQGICSMSGTQ  162



>ref|XP_004162875.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=397

 Score =   362 bits (928),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 191/373 (51%), Positives = 252/373 (68%), Gaps = 17/373 (5%)
 Frame = +3

Query  183   FKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKA-PIELK  350
             F VT  G   ++DI+  L  AW EAC +TTPS ++IPKG +Q+ Q+ LKGPCK+ PI+++
Sbjct  22    FDVTRYGAKPNTDITQALANAWKEACMSTTPSKLLIPKGVYQLSQSYLKGPCKSVPIQVQ  81

Query  351   IKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSD---  521
             +  TLKAP +PN        +   Y+D   LSG G  DGQG     G  K+   K     
Sbjct  82    VDGTLKAPLHPNG----DGLVLFAYIDQLMLSGTGVFDGQGKA---GWDKNDCHKKKICT  134

Query  522   KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAK  701
             KLP NL  +F+ NSI++DITSL+SK FH+N+ G KN+TFQ +TI AP +S NTDGIHI+ 
Sbjct  135   KLPMNLKFSFITNSIVKDITSLDSKNFHINLLGCKNVTFQHVTISAPENSPNTDGIHISS  194

Query  702   ICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVK  881
                + I DS I TGDDC+S+GD  + + I  VTCGPGHGISVGSLGK   E+ V GVTVK
Sbjct  195   SEQINILDSKISTGDDCVSVGDSNKQVTITNVTCGPGHGISVGSLGKYTKEKDVVGVTVK  254

Query  882   DSKFIGTDNGLRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPS  1058
               K I T NG+RIKTWP+S    + +D+H+  IEM++V NP++IDQEYCP NQC+++ PS
Sbjct  255   TCKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVIIDQEYCPWNQCNRKVPS  314

Query  1059  LVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKP  1232
              +KIS VS+ NI+GTSAT  AV + CS  +PCE V+  DINLT+ G  G   + C+N +P
Sbjct  315   KIKISKVSFKNIRGTSATPIAVKLVCSKSIPCEGVEVADINLTYSGIRGPILSECANVQP  374

Query  1233  KLTGKQTPPVTCK  1271
              +TGKQ+P +  K
Sbjct  375   LITGKQSPQICAK  387



>ref|XP_010038561.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=501

 Score =   365 bits (937),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 181/361 (50%), Positives = 237/361 (66%), Gaps = 5/361 (1%)
 Frame = +3

Query  183   FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKAT  362
             +     G  DI+  LL AW +ACA+TT + + I  GTF + + +L+GPCKA +E +I+  
Sbjct  64    YSAKGGGIPDITQSLLGAWKKACASTTRAKVFIAGGTFALSEVVLEGPCKAHVEFEIRGR  123

Query  363   LKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKK-DTGFKSDKLPNNL  539
             L+AP +P+  +    W+    +D  T+SG GT DGQG +  +GQ   D       LP NL
Sbjct  124   LQAPADPSRFK-TDGWVVFQRIDGLTVSGGGTFDGQGKIA-WGQNDCDKNTNCRTLPTNL  181

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
               NF+ N+II ++T+L+SK FHVNV G KNLTF+   + AP DS NTDGIHI +   V I
Sbjct  182   RFNFVSNAIIHNVTTLDSKNFHVNVLGAKNLTFENFHVNAPGDSVNTDGIHIGRSLGVNI  241

Query  720   KDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIG  899
              D+ I TGDDC+S+GDG   + + GVTCGPGHGISVGSLGK   EEPV GV V +    G
Sbjct  242   LDTNIKTGDDCVSLGDGSRQITVRGVTCGPGHGISVGSLGKYDNEEPVSGVFVTNCTITG  301

Query  900   TDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
               NG RIKTW  S  G+ TD+H+  ++M DV NP++IDQ YCP NQC  + PSLVKISNV
Sbjct  302   ATNGARIKTWLASKIGIATDMHFQDVQMNDVANPVLIDQGYCPFNQCQAQIPSLVKISNV  361

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQT  1253
             S+  I+GTS+T+ AV IACS  +PCE V+  DINL +KG  G A + CSN +P ++G Q 
Sbjct  362   SFERIRGTSSTKVAVKIACSKRIPCEGVEIADINLVYKGPDGPATSECSNVRPLISGMQN  421

Query  1254  P  1256
             P
Sbjct  422   P  422


 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = +3

Query  1059  LVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKP  1232
             +VKIS+VS+ +I+GTSAT  A  + C  GVPC+ ++  DINL + G  GA+ +  +N KP
Sbjct  428   IVKISDVSFRDIRGTSATPLAEKLGCGRGVPCQKLELADINLRYNGRNGASTSQSANMKP  487

Query  1233  KLTGKQTPPV  1262
              +TGK + P+
Sbjct  488   TITGKSSLPI  497



>ref|XP_008441641.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=404

 Score =   362 bits (928),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 193/370 (52%), Positives = 255/370 (69%), Gaps = 14/370 (4%)
 Frame = +3

Query  177   AEFKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIEL  347
             A F VT+ G   D+DI+  L+ AW E CA+ TPS ++IPKG++ + Q+ LKGPCK+ IEL
Sbjct  28    AVFDVTSFGAKPDADITGALVSAWKEGCASITPSKVLIPKGSYGLSQSNLKGPCKSSIEL  87

Query  348   KIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKS--D  521
             +I+ TL+AP +P         L + YVD  T+SG G LDGQG  +   +K D   K    
Sbjct  88    QIEGTLQAPSDPKG----DGLLILEYVDRLTVSGMGVLDGQG--KEGWEKNDCHLKKICT  141

Query  522   KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAK  701
             KLP NL LNF+ NSI++DITSL+SK +H+N+ G KNLTF  +TI AP DS NTDGIH++ 
Sbjct  142   KLPMNLKLNFITNSIVKDITSLDSKNYHINLLGCKNLTFDHVTITAPGDSPNTDGIHVSS  201

Query  702   ICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVK  881
               ++ I ++ I TGDDCIS+GD  + + I  VTCGPGHGIS+GSLGK   E+ V GVTVK
Sbjct  202   SEEINILNTNIATGDDCISVGDTNKQIVISDVTCGPGHGISIGSLGKYSKEKEVVGVTVK  261

Query  882   DSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPS  1058
               K   T NG+RIKTWP+S      +D+H+  IEM +V NP++IDQEYCP NQC+++ PS
Sbjct  262   KCKLTSTTNGVRIKTWPDSVGTFPASDMHFEDIEMVNVSNPVIIDQEYCPWNQCNRKVPS  321

Query  1059  LVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKP  1232
              +KIS VS+ NI+GTSAT  AV I CS   PCE+V+  DI+LT+ G  G  K+ C+N KP
Sbjct  322   KIKISKVSFKNIRGTSATPVAVKIVCSKSNPCEEVEVADIDLTYSGSEGPIKSQCANVKP  381

Query  1233  KLTGKQTPPV  1262
              ++GKQ PP+
Sbjct  382   VISGKQNPPI  391



>ref|XP_009365185.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   362 bits (928),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 182/376 (48%), Positives = 248/376 (66%), Gaps = 8/376 (2%)
 Frame = +3

Query  135   FTFVLFLLADLGESAEFKVTA-----EGDSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             F F+L +     +S+ + VT+     + +SDIS    KAW +ACA+T  S IV+P+GT++
Sbjct  12    FVFLLLVSTSNAKSSIYDVTSATYGGKANSDISRPFSKAWTDACASTLASKIVVPRGTYK  71

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
                A  KGPCKAPIE++++ TL+AP + + +     W+    +D  TLSG GT DGQG  
Sbjct  72    FVGATFKGPCKAPIEIQLQGTLQAPVDGSKLSKADTWVGFERIDGLTLSGGGTFDGQGAT  131

Query  480   QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKA  659
                    +       +  NL  NF+ NSIIRDIT+ +SK FHVNV G  N+ FQ  T+ A
Sbjct  132   AWKQNDCNKNKNCKSIAINLRFNFVTNSIIRDITTKDSKNFHVNVLGCNNVAFQHFTVSA  191

Query  660   PADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLG  839
             P +S NTDGIHI +   + I DS+IGTGDDCISIGDG + L++  VTCGPGHGIS+GSLG
Sbjct  192   PKESMNTDGIHIGRSTGINITDSIIGTGDDCISIGDGTKQLHVTKVTCGPGHGISIGSLG  251

Query  840   KTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQ  1016
             +   EEPV G+ +K+     TDNG+RIKTWP S   GVV+D+H+  I M++V NP++IDQ
Sbjct  252   RYQNEEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIMDNVGNPVIIDQ  311

Query  1017  EYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG  1196
             EYCP NQC+ + PS VKISNVS+ NIKG+S++   + I CS G+PCE+V+  DI+LT+ G
Sbjct  312   EYCPWNQCTLKVPSKVKISNVSFKNIKGSSSSPVGIKIVCSGGLPCENVQLSDIDLTYTG  371

Query  1197  --GAAKTVCSNAKPKL  1238
               G   + C + KP +
Sbjct  372   NKGPITSQCKHVKPTI  387



>ref|XP_004153076.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
 ref|XP_004172630.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=397

 Score =   362 bits (928),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 191/373 (51%), Positives = 252/373 (68%), Gaps = 17/373 (5%)
 Frame = +3

Query  183   FKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKA-PIELK  350
             F VT  G   ++DI+  L  AW EAC +TTPS ++IPKG +Q+ Q+ LKGPCK+ PI+++
Sbjct  22    FDVTRYGAKPNTDITQALANAWKEACMSTTPSKLLIPKGVYQLSQSYLKGPCKSVPIQVQ  81

Query  351   IKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSD---  521
             +  TLKAP +PN        +   Y+D   LSG G  DGQG     G  K+   K     
Sbjct  82    VDGTLKAPLHPNG----DGLVLFAYIDQLMLSGTGVFDGQGKA---GWDKNDCHKKKICT  134

Query  522   KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAK  701
             KLP NL  +F+ NSI++DITSL+SK FH+N+ G KN+TFQ +TI AP +S NTDGIHI+ 
Sbjct  135   KLPMNLKFSFITNSIVKDITSLDSKNFHINLLGCKNVTFQHVTISAPENSPNTDGIHISS  194

Query  702   ICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVK  881
                + I DS I TGDDC+S+GD  + + I  VTCGPGHGISVGSLGK   E+ V GVTVK
Sbjct  195   SEQINILDSKISTGDDCVSVGDSNKQVTITNVTCGPGHGISVGSLGKYTKEKDVVGVTVK  254

Query  882   DSKFIGTDNGLRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPS  1058
               K I T NG+RIKTWP+S    + +D+H+  IEM++V NP++IDQEYCP NQC+++ PS
Sbjct  255   ACKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVIIDQEYCPWNQCNRKVPS  314

Query  1059  LVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKP  1232
              +KIS VS+ NI+GTSAT  AV + CS  +PCE V+  DINLT+ G  G   + C+N +P
Sbjct  315   KIKISKVSFKNIRGTSATPIAVKLVCSKSIPCEGVEVADINLTYSGIRGPILSECANVQP  374

Query  1233  KLTGKQTPPVTCK  1271
              +TGKQ+P +  K
Sbjct  375   LITGKQSPQICAK  387



>ref|XP_004167279.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=404

 Score =   362 bits (928),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 190/401 (47%), Positives = 258/401 (64%), Gaps = 23/401 (6%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAE--------FKVTAEGD----SDISPELLKAWDEACA  254
             M  I Y       FL++ L  + E        F +   G+    +D++  L  AW++ACA
Sbjct  1     MGVIKYSNLLVTTFLMSLLSFTIESRSHIDVIFPLEKYGNIVSGADVTEALKNAWNDACA  60

Query  255   ATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDD  434
             +  PS +VIPKG F++++   KGPCK+PIE++++ TL+AP +P        W+T  YVD 
Sbjct  61    SVHPSAVVIPKGIFKVREGKFKGPCKSPIEIRVRGTLQAPKHPYG----DSWITFAYVDR  116

Query  435   FTLSGDGTLDGQGDVQIYGQKKDTGFKSD--KLPNNLSLNFLKNSIIRDITSLNSKLFHV  608
              TLSG G  DGQG      +K D   + D   LP +L  +F+ NSI+R ITSLNSK FHV
Sbjct  117   MTLSGGGVFDGQGKTG--WEKNDCHKRIDCANLPISLRFDFITNSIVRRITSLNSKNFHV  174

Query  609   NVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNI  788
             N+ G  NLTFQ + I AP DS NTDGIHI +   ++I  S I TGDDCIS+GDG + + +
Sbjct  175   NILGCNNLTFQGVNIIAPEDSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKQVKV  234

Query  789   DGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNS-HPGVVTDIH  965
               VTCGPGHGIS+GSLGK   EEPV+GV VK+   I T NG+RIKTWP S   G+ T++H
Sbjct  235   ANVTCGPGHGISIGSLGKYTNEEPVEGVIVKNCTIINTTNGVRIKTWPTSPAAGIATNMH  294

Query  966   YHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSG  1145
             +  I M +V NPI+IDQEYCP NQC++E PS +KI+ VS+ NI+G+SAT  AV + CSS 
Sbjct  295   FSDITMVNVSNPILIDQEYCPWNQCNREIPSNIKINKVSFENIRGSSATPVAVKLICSSN  354

Query  1146  VPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             +PC++VK  +I+L + G  G+  + C N KP ++G Q P +
Sbjct  355   LPCDEVKVANIDLIYNGINGSITSQCMNVKPIISGIQNPSI  395



>ref|XP_011097019.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=399

 Score =   361 bits (927),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 194/392 (49%), Positives = 256/392 (65%), Gaps = 14/392 (4%)
 Frame = +3

Query  120   IFYCAFTFVLFLLADLGESAEFKVT-------AEGDSDISPELLKAWDEACAATTPSIIV  278
             I +    F L LLA +  +A+  VT       A+   DIS  L+ AW EAC +T+PS IV
Sbjct  3     INFITIMFFLPLLA-INVNAQGPVTYDITKYGAKSGGDISQALMDAWKEACNSTSPSTIV  61

Query  279   IPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKK-EWLTINYVDDFTLSGDG  455
             IP GT+ + Q  L GP KAPIEL+++ TL+A  NP  +  K+ EW+TINYV+ FTLSG G
Sbjct  62    IPGGTWSLSQVKLLGPNKAPIELQVQGTLQA--NPGQLPNKEGEWITINYVNYFTLSGGG  119

Query  456   TLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLT  635
               DG+G                KLP NLS NF+ NSIIRD+T+ +SK FHVN     N+T
Sbjct  120   VFDGRGQEAWKQNDCHKNKNCAKLPMNLSFNFVNNSIIRDVTTKDSKNFHVNCISSHNVT  179

Query  636   FQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGH  815
             F + T+ AP DS NTDGIH+ +   + IKDS+I TGDDC+SIGD  + ++I  VTCGPGH
Sbjct  180   FLRFTVSAPGDSPNTDGIHLGRDTMINIKDSIIKTGDDCVSIGDESKEIHIQNVTCGPGH  239

Query  816   GISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDV  992
             GISVGSLG    E+ V+G+ V +  FIGT NG+R+KTWP++   + V+D+H+  + M++V
Sbjct  240   GISVGSLGGYAEEKDVQGIYVTNCTFIGTTNGVRVKTWPSAPATLTVSDLHFEDLIMDNV  299

Query  993   KNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFG  1172
              +PI+IDQEYCP+N C K++PS +KI+NV   N++GT+ T EAV   CS   PCE    G
Sbjct  300   SSPIIIDQEYCPHNLCKKDRPSSIKITNVRERNVRGTTNTAEAVTFICSGLKPCERGGVG  359

Query  1173  DINLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             DI+LT+ G  G   T C+N KPK  GKQ PPV
Sbjct  360   DIDLTYNGNQGPITTKCANVKPKFVGKQNPPV  391



>ref|XP_009365186.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   361 bits (927),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 182/376 (48%), Positives = 247/376 (66%), Gaps = 8/376 (2%)
 Frame = +3

Query  135   FTFVLFLLADLGESAEFKVTA-----EGDSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             F F+L +     +S+ + VT+     + +SDIS    KAW +ACA+T  S IV+P+GT++
Sbjct  12    FVFLLLVSTSNAKSSIYDVTSATYGGKANSDISQAFSKAWTDACASTLASKIVVPRGTYK  71

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
                A  KGPCKAPIE++++ TL+AP + + +     W+    +D  TLSG GT DGQG  
Sbjct  72    FVGATFKGPCKAPIEIQLQGTLQAPVDGSKLSKADTWVGFERIDGLTLSGGGTFDGQGAT  131

Query  480   QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKA  659
                    +       +  NL  NF+ NSIIRDIT+ +SK FHVNV G  N+ FQ+ T+ A
Sbjct  132   AWKQNDCNKNKNCKSIAINLRFNFVTNSIIRDITTKDSKNFHVNVLGCNNVAFQRFTVSA  191

Query  660   PADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLG  839
             P +S NTDGIHI +   + I DS+IGTGDDCISIGDG + L++  VTCGPGHGIS+GSLG
Sbjct  192   PKESMNTDGIHIGRSTGINITDSIIGTGDDCISIGDGTKQLHVTKVTCGPGHGISIGSLG  251

Query  840   KTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQ  1016
             +   EEPV G+ +K+     TDNG+RIKTWP S   GVV+D+H+  I M++V NP++IDQ
Sbjct  252   RYQNEEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIMDNVGNPVIIDQ  311

Query  1017  EYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG  1196
             EYCP NQC+ + PS VKISNVS+ NIKG+S     + I CS G+PCE+V+  DI+LT+ G
Sbjct  312   EYCPWNQCTLKVPSKVKISNVSFKNIKGSSVGIVGIKIVCSGGLPCENVQLSDIDLTYTG  371

Query  1197  --GAAKTVCSNAKPKL  1238
               G   + C + KP +
Sbjct  372   NKGPITSQCKHVKPTI  387



>ref|XP_004165943.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=405

 Score =   361 bits (927),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 189/389 (49%), Positives = 259/389 (67%), Gaps = 20/389 (5%)
 Frame = +3

Query  138   TFVLFLLADLGESAE-----FKVTAEGD----SDISPELLKAWDEACAATTPSIIVIPKG  290
             TF++ LL+ + ES       F +   G+    +D++  L  AW++ACA+  PS +VIPKG
Sbjct  13    TFLMSLLSFIIESRSHVDVIFPLRKYGNIVSGADVTEALKDAWNDACASVRPSAVVIPKG  72

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              F++++   KGPCK+PIE++++ TL+AP +P+       W+T  YVD  TLSG G  DGQ
Sbjct  73    IFKVREGEFKGPCKSPIEIRVRGTLQAPKHPHG----DSWITFAYVDRMTLSGGGVFDGQ  128

Query  471   GDVQIYGQKKDTGFKSD--KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQK  644
             G      +K D   + D   LP +L  +F+ NSI++ ITSL+SK FHVN+ G  NLTF+ 
Sbjct  129   GKAG--WEKNDCHKRIDCANLPISLRFDFITNSIVKRITSLDSKNFHVNILGCNNLTFKG  186

Query  645   ITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGIS  824
             + I AP DS NTDGIHI +   ++I  S I TGDDCIS+GDG + + I  VTCGPGHGIS
Sbjct  187   VNIIAPEDSPNTDGIHIGRSIGISILKSQIATGDDCISLGDGSKRVKITNVTCGPGHGIS  246

Query  825   VGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNS-HPGVVTDIHYHKIEMEDVKNP  1001
             +GSLGK   EEPV+GV VK+   + T NG+RIKTWP S + G+ TD+H+  I M +V NP
Sbjct  247   IGSLGKYTNEEPVEGVIVKNCTIMNTTNGVRIKTWPASPNAGIATDMHFSDITMVNVSNP  306

Query  1002  IVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDIN  1181
             I+IDQEYCP NQC++E PS +KI+NVS+ NI+G+SAT  AV + CSS  PCE+VK  +I+
Sbjct  307   ILIDQEYCPWNQCNREIPSNIKINNVSFKNIRGSSATPVAVKLICSSNQPCEEVKVANID  366

Query  1182  LTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             L + G  G   + C N KP ++G Q P +
Sbjct  367   LVYNGINGPITSQCMNVKPIVSGIQNPSI  395



>ref|XP_008349086.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score =   361 bits (926),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 186/380 (49%), Positives = 248/380 (65%), Gaps = 12/380 (3%)
 Frame = +3

Query  132   AFTFVLFLLADLGESAEFKVT-----AEGDSDISPELLKAWDEACAATTPSIIVIPKGTF  296
             AF F+L       E   F VT     A+  SDI+  L KAW +ACA+  PS +V+P GT+
Sbjct  10    AFLFLLSASKTQAEPGVFDVTSATYGAKPGSDITHALAKAWIDACASPAPSKVVVPSGTY  69

Query  297   QMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGD  476
              + +A  KGPCKAPIE++++  L AP +   +     W+  ++V+  T+SG G  DGQG 
Sbjct  70    MLTEASFKGPCKAPIEIQVQGKLTAPADGGKLTRPDTWVGFDHVNKLTVSGGGXFDGQG-  128

Query  477   VQIYGQKKDTGFKSD--KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
               +  +K D     D   +  N+  NF+ NS I+DITSL+SK FHVNV G  N+TFQ++ 
Sbjct  129   -ALAWKKNDCNKNKDCKSIAINMRFNFVTNSTIQDITSLDSKNFHVNVLGCHNVTFQRVN  187

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             + AP +S NTDGIHI +   + I D+ IGTGDDC+SIGDG + + +  VTCGPGHGISVG
Sbjct  188   VTAPGESINTDGIHIGRSTGINITDAHIGTGDDCVSIGDGNKEITVTRVTCGPGHGISVG  247

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIV  1007
             SLG+ P EEPV G+ VK+     T NG+RIKTWP S   G+ +D+H+  I M +V NP++
Sbjct  248   SLGRYPNEEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVL  307

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQ+YCP NQC +  PS VKISNVS+ NIKG+SAT  AV I CS G+PCE+V+  DI+LT
Sbjct  308   IDQQYCPWNQCKQNVPSKVKISNVSFKNIKGSSATPLAVQIVCSGGIPCENVELADIDLT  367

Query  1188  FKG--GAAKTVCSNAKPKLT  1241
             + G  G   + CSN KP +T
Sbjct  368   YNGNKGPLTSQCSNVKPTIT  387



>ref|XP_011097018.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=373

 Score =   359 bits (922),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 181/350 (52%), Positives = 239/350 (68%), Gaps = 4/350 (1%)
 Frame = +3

Query  225   LLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKK  404
             L+ AW EAC +T+PS IVIP+GT+ + Q  L  P KAP+EL+++ TL+A PNP  +  K+
Sbjct  16    LMDAWKEACNSTSPSTIVIPRGTWSLSQVKLLAPNKAPVELQVQGTLQANPNPGQLPNKE  75

Query  405   -EWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDIT  581
              EW+TINYV+ FTLSG G  D QG                KLP NLS NF+ NSIIRD+T
Sbjct  76    GEWITINYVNYFTLSGGGVFDDQGQEAWKQNDCHKNRNCAKLPMNLSFNFVNNSIIRDVT  135

Query  582   SLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISI  761
             + +SK FHV      N+TF + T+ AP DS NTDGIH+ +   + IKDS+I TGDDC+SI
Sbjct  136   TKDSKNFHVICILSHNVTFLRFTVSAPGDSPNTDGIHLGRDTMINIKDSIIKTGDDCVSI  195

Query  762   GDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH  941
             GD  + ++I  VTCGPGHGISVGS G    E+ V+ + V +  FIGT NG+R+KTWP++ 
Sbjct  196   GDESKEIHIQNVTCGPGHGISVGSFGGYAVEKDVQEIYVTNCTFIGTQNGVRVKTWPSAP  255

Query  942   PGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEE  1118
               + V+D+H+  + M++V +PI+IDQEYCP+N C K++PS +KISNVS  NI+GT+ T E
Sbjct  256   ATLTVSDLHFEDLIMDNVSSPIIIDQEYCPHNLCKKDRPSSIKISNVSIKNIRGTTNTAE  315

Query  1119  AVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             AV   CS   PCE+V+ GDI+LT+ G  G   T C+N KPK  GKQ PPV
Sbjct  316   AVTFICSGLKPCENVEVGDIDLTYNGNQGPITTNCANVKPKFVGKQNPPV  365



>ref|XP_008391258.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score =   360 bits (924),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 186/380 (49%), Positives = 248/380 (65%), Gaps = 12/380 (3%)
 Frame = +3

Query  132   AFTFVLFLLADLGESAEFKVT-----AEGDSDISPELLKAWDEACAATTPSIIVIPKGTF  296
             AF F+L       E   F VT     A+  SDI+  L KAW +ACA+  PS +V+P GT+
Sbjct  10    AFLFLLSASKTQAEPGVFDVTSATYGAKPGSDITHALAKAWIDACASPAPSKVVVPSGTY  69

Query  297   QMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGD  476
              + +A  KGPCKAPIE++++  L AP +   +     W+  ++V+  T+SG GT DGQG 
Sbjct  70    MLTEASFKGPCKAPIEIQVQGKLTAPADGGKLTRPDTWVGFDHVNKLTVSGGGTFDGQG-  128

Query  477   VQIYGQKKDTGFKSD--KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
               +  +K D     D   +  N+  NF+ NS I+DITSL+SK FHVNV G  N+TF ++ 
Sbjct  129   -ALAWKKNDCNKNKDCKSIAINMRFNFVTNSTIQDITSLDSKNFHVNVLGCHNVTFXRVN  187

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             + AP +S NTDGIHI +   + I D+ IGTGDDC+SIGDG + + +  VTCGPGHGISVG
Sbjct  188   VTAPXESINTDGIHIGRSTGINITDAHIGTGDDCVSIGDGNKEITVTRVTCGPGHGISVG  247

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIV  1007
             SLG+ P EEPV G+ VK+     T NG+RIKTWP S   G+ +D+H+  I M +V NP++
Sbjct  248   SLGRYPNEEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVL  307

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQ+YCP NQC +  PS VKISNVS+ NIKG+SAT  AV I CS G+PCE+V+  DI+LT
Sbjct  308   IDQQYCPWNQCKQNVPSKVKISNVSFKNIKGSSATPLAVQIVCSGGIPCENVELADIDLT  367

Query  1188  FKG--GAAKTVCSNAKPKLT  1241
             + G  G   + CSN KP +T
Sbjct  368   YNGNKGPLTSQCSNVKPTIT  387



>gb|AFK41055.1| unknown [Lotus japonicus]
Length=394

 Score =   360 bits (923),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 185/375 (49%), Positives = 246/375 (66%), Gaps = 7/375 (2%)
 Frame = +3

Query  141   FVLFLLA-DLGESAEFKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQ  308
             FV FL      +S   +++  G   ++DI+     AW +AC +TT + IVIP GT++M  
Sbjct  12    FVSFLYGFSTAQSWVLEISKFGGAPNADITQAFTNAWKKACESTTSAKIVIPHGTYKMGA  71

Query  309   ALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIY  488
               ++GPCKA IE+++  T+KAP NP + +    W+  +Y+  FTLSG G  DG G+    
Sbjct  72    VQVQGPCKAHIEVQVDGTIKAPVNPRNFKGAGTWVQFSYISFFTLSGKGVFDGVGETAWK  131

Query  489   GQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPAD  668
                         LP N + N++ NSI+RDITS +SK F+VNV G  N TF    I A A 
Sbjct  132   RNDCSKNKHCTLLPMNFAFNYVNNSIVRDITSKDSKSFNVNVLGCNNFTFDGFKIVALAL  191

Query  669   SHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTP  848
             S NTDGIH+ +  DV I ++ IGTGDDC+S+GDG++N+ +  V CGPGHG+SVGSLGK P
Sbjct  192   SPNTDGIHVGRSTDVKILNTNIGTGDDCVSLGDGIKNVLVRNVNCGPGHGVSVGSLGKYP  251

Query  849   GEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV--VTDIHYHKIEMEDVKNPIVIDQEY  1022
              E+PV+G  VK+     TDNG+RIKTWP S PG   +TD+H+  I M +VKNPI+IDQEY
Sbjct  252   DEKPVEGFYVKNCTLTNTDNGVRIKTWP-STPGTAPITDMHFEDIIMVNVKNPIIIDQEY  310

Query  1023  CPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGGA  1202
             CP NQCSK+ PS +KIS VS+ NI+GTSAT E VI+ CSSGVPC+ V+   ++LTF G  
Sbjct  311   CPWNQCSKKSPSKIKISKVSFKNIRGTSATPEGVILICSSGVPCDTVELNGVDLTFNGAP  370

Query  1203  AKTVCSNAKPKLTGK  1247
             A   C+N KP +TGK
Sbjct  371   ATAKCANVKPIVTGK  385



>ref|XP_009334235.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=399

 Score =   360 bits (924),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 186/380 (49%), Positives = 248/380 (65%), Gaps = 12/380 (3%)
 Frame = +3

Query  132   AFTFVLFLLADLGESAEFKVT-----AEGDSDISPELLKAWDEACAATTPSIIVIPKGTF  296
             AF F+L       E   F VT     A+  SDI+  L KAW +ACA+ TPS +V+P GT+
Sbjct  10    AFLFLLSASKTQAEPGVFDVTSATYGAKPGSDITQALAKAWTDACASPTPSKVVVPSGTY  69

Query  297   QMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGD  476
              + +A  KGPCKAPIE++++  L AP +   +     W+   +V+  T+SG GT DGQG 
Sbjct  70    MLTEASFKGPCKAPIEIQVQGKLTAPADGGKLTKPDTWVCFEHVNKLTVSGGGTFDGQG-  128

Query  477   VQIYGQKKDTGFKSD--KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
               +  +K D     D   +  N+  +F+ NS I+DITSL+SK FHVNV G  N+TFQ++ 
Sbjct  129   -ALAWKKNDCNKNKDCKSMAINMRFDFVTNSTIQDITSLDSKNFHVNVLGCHNVTFQRVN  187

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             + AP +S NTDGIHI +   + I D+ IGTGDDC+SIGDG + + +  VTCGPGHGISVG
Sbjct  188   VTAPGESINTDGIHIGRSTGINITDAHIGTGDDCVSIGDGNKEITVTRVTCGPGHGISVG  247

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIV  1007
             SLG+ P EEPV G+ VK+     T NG+RIKTWP S   G+ +D+H+  I M +V NP++
Sbjct  248   SLGRYPNEEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVL  307

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQ+YCP NQC +  PS +KISNVS+ NIKG+SAT  AV I CSSG+ CE V+  DI+LT
Sbjct  308   IDQQYCPWNQCKQNVPSKIKISNVSFKNIKGSSATPLAVQIVCSSGIACEKVELDDIDLT  367

Query  1188  FKG--GAAKTVCSNAKPKLT  1241
             + G  G   + CSN KP +T
Sbjct  368   YNGNKGPLTSQCSNVKPTIT  387



>ref|XP_004305963.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=394

 Score =   359 bits (922),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 187/374 (50%), Positives = 243/374 (65%), Gaps = 8/374 (2%)
 Frame = +3

Query  141   FVLFLLADLGESAEFKVTAEG-----DSDISPELLKAWDEACAATTPSIIVIPKGTFQMK  305
             F +FLL  +   A+F VT+       +SDIS  L KAW +ACA+T+PS I++PKGTFQ+K
Sbjct  10    FPIFLLLSIAY-ADFDVTSSKYGGKPNSDISQPLAKAWSDACASTSPSRIIVPKGTFQLK  68

Query  306   QALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQI  485
              A  KGPCK PIE ++  TL+AP +   +     W+    ++  TL G GT DGQG    
Sbjct  69    GASFKGPCKGPIEFQVDGTLQAPQDGAQLIKADTWIEFANLERLTLMGTGTFDGQGQKAW  128

Query  486   YGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPA  665
                  +   K   +  NL  N +K+S+++D+TSLNSK FHVNV G + LTFQ  T+KAP 
Sbjct  129   KENDCNKNPKCSSIAINLRFNSVKHSLVKDVTSLNSKNFHVNVLGCEQLTFQHFTVKAPG  188

Query  666   DSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKT  845
             DS NTDGIHI +   + I D+ IGTGDDCISIGDG + L I+ VTCGPGHGIS+GSLG+ 
Sbjct  189   DSINTDGIHIGRSTGINITDTNIGTGDDCISIGDGTKQLTINKVTCGPGHGISIGSLGRY  248

Query  846   PGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEY  1022
               E+ V G+ VKD     T NG+RIKTWPNS      +DIH+  I M +V NPI+IDQEY
Sbjct  249   NNEDHVTGINVKDCTISNTMNGVRIKTWPNSPIATTASDIHFEHITMNNVGNPILIDQEY  308

Query  1023  CPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG-G  1199
             CP  QC+ + PS VKISNVS+ NI+GT+ T EAV I C+ G+PC+ V   DI+L   G G
Sbjct  309   CPYGQCNTQTPSKVKISNVSFKNIRGTTTTAEAVKIVCAKGLPCDKVVLSDIDLKLTGKG  368

Query  1200  AAKTVCSNAKPKLT  1241
                + C+N +P +T
Sbjct  369   TLTSQCANVQPTIT  382



>ref|XP_010112809.1| hypothetical protein L484_020041 [Morus notabilis]
 gb|EXC34924.1| hypothetical protein L484_020041 [Morus notabilis]
Length=399

 Score =   359 bits (922),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 182/365 (50%), Positives = 239/365 (65%), Gaps = 7/365 (2%)
 Frame = +3

Query  183   FKVTAEG----DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELK  350
             F VT  G     SDI+  LLKAW+ ACA+T PS +V+PKG F++  A L+GPC APIE  
Sbjct  29    FDVTENGTILPQSDITDALLKAWNNACASTIPSKVVVPKGIFKLSGATLEGPCNAPIEFD  88

Query  351   IKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLP  530
             ++  L+APP   +      W+   YVD  T+SG G  DGQG    +G+          LP
Sbjct  89    LQGILQAPPEDGNFTGGDTWVAFEYVDLLTISGGGIFDGQGK-PTWGKDCANDEYCGDLP  147

Query  531   NNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICD  710
              N+  N++ NSII++ITSL+SK FH+NV G +N+TFQ + I A  +S +TDGIHI +  D
Sbjct  148   INIRFNYVTNSIIQEITSLDSKQFHINVLGCQNVTFQHVKIIAAENSPHTDGIHIGRSTD  207

Query  711   VTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSK  890
             + + DS I TGDDCIS+GDG + + I  VTCGPGHGIS+GSLGK   EE VKGV VK   
Sbjct  208   IKVLDSNIQTGDDCISLGDGSKQITIAKVTCGPGHGISIGSLGKYLNEEAVKGVDVKSCT  267

Query  891   FIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKI  1070
                T NG+RIKTWP+S  G  +D+H+  I ME+V NP++IDQEYCP NQC  + PS V+I
Sbjct  268   LKNTQNGVRIKTWPDSQEGKASDLHFEDIIMENVGNPVMIDQEYCPWNQCVSQLPSRVQI  327

Query  1071  SNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTG  1244
             S V + NI+GTS+T  AV + CS G+PC+DV+  DI+L + G  G   + C N KP ++G
Sbjct  328   SGVRFKNIRGTSSTALAVKLVCSGGLPCQDVEMTDIDLKYSGDEGQITSECKNVKPTVSG  387

Query  1245  KQTPP  1259
              Q PP
Sbjct  388   IQNPP  392



>ref|XP_003595659.1| Polygalactorunase PG11 [Medicago truncatula]
 ref|XP_003595664.1| Polygalactorunase PG11 [Medicago truncatula]
 gb|AES65910.1| polygalacturonase 11c, putative [Medicago truncatula]
 gb|AFK38160.1| unknown [Medicago truncatula]
Length=419

 Score =   360 bits (924),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 186/392 (47%), Positives = 253/392 (65%), Gaps = 12/392 (3%)
 Frame = +3

Query  111   MDTIFYCAFTFVL-FLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPK  287
               T+   +F F+  F  A  G     K   + +SDI   L  AW EACA+TT + IVIP 
Sbjct  3     FSTVIIVSFLFLADFCAAQSGVLDIAKFGGKPNSDIGMALTAAWKEACASTTAAKIVIPA  62

Query  288   GTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDG  467
             GT+Q+    LKGPCKAPIEL++  T++AP +P+ ++  ++W    Y+D  TLSG G  DG
Sbjct  63    GTYQLNGIELKGPCKAPIELQVDGTIQAPADPSVIKGTEQWFKFLYMDHLTLSGKGVFDG  122

Query  468   QGDVQIYGQKKDTGFKSDKLPN-----NLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNL  632
             QG   +Y + +     S K  N     N   NF+ NS++  +TS +SK FHV VFG  N+
Sbjct  123   QG-ASVYKKAQPAAAWSGKGGNSKNFMNFGFNFVNNSLVHGVTSKDSKNFHVMVFGCNNI  181

Query  633   TFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPG  812
             TF   TI AP DS NTDGIH+ K   V I ++ IGTGDDC+SIGDG + + ++GV CGPG
Sbjct  182   TFDSFTITAPGDSPNTDGIHMGKSTGVKILNTNIGTGDDCVSIGDGSKQITVEGVKCGPG  241

Query  813   HGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVT--DIHYHKIEME  986
             HG+S+GSLGK   EE V+G+T+K+     TDNG+RIKTWP++ PG +T  DIH+  I M 
Sbjct  242   HGLSIGSLGKFTTEENVEGITIKNCTLTATDNGVRIKTWPDA-PGTITVSDIHFEDITMT  300

Query  987   DVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVK  1166
             +VKNP++IDQEYCP N CSK+ PS +K+S +++ N+KGTS T E V++ CSS VPC+ V+
Sbjct  301   NVKNPVIIDQEYCPWNACSKKNPSKIKLSKITFKNVKGTSGTAEGVVLICSSAVPCDGVE  360

Query  1167  FGDINLTFKGGAAKTVCSNAKPKLTGKQTPPV  1262
               +++L F G      C+N KP +TG  T PV
Sbjct  361   LNNVDLKFNGAPTTAKCTNVKPIVTG--TAPV  390



>ref|XP_004170151.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=404

 Score =   359 bits (921),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 257/388 (66%), Gaps = 19/388 (5%)
 Frame = +3

Query  138   TFVLFLLADLGESAE----FKVTAEGD----SDISPELLKAWDEACAATTPSIIVIPKGT  293
             TF++ LL+   E+      F +   G+    +D++  L  AW++ACA+  PS +VIPKGT
Sbjct  13    TFLMSLLSFTIEARSHVDIFSLRKYGNIVSGADVTEALKDAWNDACASDRPSAVVIPKGT  72

Query  294   FQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQG  473
             F++++   KGPCK+PIE ++  TL+AP +P+       W+T  YVD   LSG G  DGQG
Sbjct  73    FKVREGEFKGPCKSPIEFRVHGTLQAPKHPHG----DSWITFAYVDRLRLSGGGVFDGQG  128

Query  474   DVQIYGQKKDTGFKSD--KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKI  647
                   +K D   + D  KLP +L  +F+ NSI+R ITSL+SK FHVN+ G  NLTFQ +
Sbjct  129   KAG--WEKNDCHKRIDCAKLPISLRFDFITNSIVRRITSLDSKNFHVNILGCNNLTFQGV  186

Query  648   TIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISV  827
              I AP +S NTDGIHI +   ++I  S I TGDDCIS+GDG + + ++ V CGPGHGIS+
Sbjct  187   NIIAPENSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRIKVNNVICGPGHGISI  246

Query  828   GSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPI  1004
             GSLGK   EEPV+GV V +   I T NG+RIKTWP S   G+ T++H+  I M +V NPI
Sbjct  247   GSLGKYNNEEPVEGVIVNNCTIINTTNGVRIKTWPASPVAGIATNMHFSDITMVNVSNPI  306

Query  1005  VIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINL  1184
             +IDQEYCP NQC++E PS +KI+ VS+ NI+G+SAT  AV + CSS +PCE+VK  +I+L
Sbjct  307   LIDQEYCPWNQCNREIPSNIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEVKVANIDL  366

Query  1185  TFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
              + G  G+  + C N KP ++G Q PP+
Sbjct  367   VYNGIKGSITSECMNVKPIISGIQNPPI  394



>gb|KGN43464.1| hypothetical protein Csa_7G037910 [Cucumis sativus]
Length=404

 Score =   359 bits (921),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 257/388 (66%), Gaps = 19/388 (5%)
 Frame = +3

Query  138   TFVLFLLADLGESAE----FKVTAEGD----SDISPELLKAWDEACAATTPSIIVIPKGT  293
             TF++ LL+   E+      F +   G+    +D++  L  AW++ACA+  PS +VIPKGT
Sbjct  13    TFLMSLLSFTIEARSHVDIFSLRKYGNIVSGADVTEALKDAWNDACASDRPSAVVIPKGT  72

Query  294   FQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQG  473
             F++++   KGPCK+PIE ++  TL+AP +P+       W+T  YVD   LSG G  DGQG
Sbjct  73    FKVREGEFKGPCKSPIEFRVHGTLQAPKHPHG----DSWITFAYVDRMRLSGGGVFDGQG  128

Query  474   DVQIYGQKKDTGFKSD--KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKI  647
                   +K D   + D  KLP +L  +F+ NSI+R ITSL+SK FHVN+ G  NLTFQ +
Sbjct  129   KAG--WEKNDCHKRIDCAKLPISLRFDFITNSIVRRITSLDSKNFHVNILGCNNLTFQGV  186

Query  648   TIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISV  827
              I AP +S NTDGIHI +   ++I  S I TGDDCIS+GDG + + ++ V CGPGHGIS+
Sbjct  187   NIIAPENSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRIKVNNVICGPGHGISI  246

Query  828   GSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPI  1004
             GSLGK   EEPV+GV V +   I T NG+RIKTWP S   G+ T++H+  I M +V NPI
Sbjct  247   GSLGKYNNEEPVEGVIVNNCTIINTTNGVRIKTWPASPVAGIATNMHFSDITMVNVSNPI  306

Query  1005  VIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINL  1184
             +IDQEYCP NQC++E PS +KI+ VS+ NI+G+SAT  AV + CSS +PCE+VK  +I+L
Sbjct  307   LIDQEYCPWNQCNREIPSNIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEVKVANIDL  366

Query  1185  TFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
              + G  G+  + C N KP ++G Q PP+
Sbjct  367   VYNGIKGSITSECMNVKPIISGIQNPPI  394



>gb|AES65915.2| polygalacturonase 11c, putative [Medicago truncatula]
Length=417

 Score =   359 bits (921),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 184/390 (47%), Positives = 252/390 (65%), Gaps = 10/390 (3%)
 Frame = +3

Query  111   MDTIFYCAFTFVL-FLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPK  287
               T+   +F F+  F  A  G     K   + +SDI   L  AW EACA+TT + IVIP 
Sbjct  3     FSTVIIVSFLFLADFCAAQSGVLDIAKFGGKPNSDIGMALTAAWKEACASTTAAKIVIPA  62

Query  288   GTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDG  467
             GT+Q+    LKGPCKAPIEL++  T++AP +P+ ++  ++W    Y+D  TLSG G  DG
Sbjct  63    GTYQLNGIELKGPCKAPIELQVDGTIQAPADPSVIKGTEQWFKFLYMDHLTLSGKGVFDG  122

Query  468   QGDVQIYGQKKDTGFKSD---KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTF  638
             QG   +Y + +     S    +   N   NF+ NS++  +TS +SK FHV VFG  N+TF
Sbjct  123   QG-ASVYKKAQPAAAWSVFLVQFQQNFGFNFVNNSLVHGVTSKDSKNFHVMVFGCNNITF  181

Query  639   QKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHG  818
                TI AP DS NTDGIH+ K   V I ++ IGTGDDC+SIGDG + + ++GV CGPGHG
Sbjct  182   DSFTITAPGDSPNTDGIHMGKSTGVKILNTNIGTGDDCVSIGDGSKQITVEGVKCGPGHG  241

Query  819   ISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVT--DIHYHKIEMEDV  992
             +S+GSLGK   EE V+G+T+K+     TDNG+RIKTWP++ PG +T  DIH+  I M +V
Sbjct  242   LSIGSLGKFTTEENVEGITIKNCTLTATDNGVRIKTWPDA-PGTITVSDIHFEDITMTNV  300

Query  993   KNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFG  1172
             KNP++IDQEYCP N CSK+ PS +K+S +++ N+KGTS T E V++ CSS VPC+ V+  
Sbjct  301   KNPVIIDQEYCPWNACSKKNPSKIKLSKITFKNVKGTSGTAEGVVLICSSAVPCDGVELN  360

Query  1173  DINLTFKGGAAKTVCSNAKPKLTGKQTPPV  1262
             +++L F G      C+N KP +TG  T PV
Sbjct  361   NVDLKFNGAPTTAKCTNVKPIVTG--TAPV  388



>ref|XP_006407791.1| hypothetical protein EUTSA_v10020866mg [Eutrema salsugineum]
 gb|ESQ49244.1| hypothetical protein EUTSA_v10020866mg [Eutrema salsugineum]
Length=398

 Score =   357 bits (917),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 180/385 (47%), Positives = 252/385 (65%), Gaps = 6/385 (2%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M + F  +   VL LL     +  F+V     SDI+  LLKA+  AC A  PS ++IPKG
Sbjct  1     MGSYFGISTILVLCLLGYSANAEVFRVPGAPGSDITQALLKAFTSACQAPAPSQVLIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              +++ +  + GPCK+P+E+ ++ T+KA  N   M+ K+ W+    ++ F L+G G  DG+
Sbjct  61    EYKLGEIAMTGPCKSPVEITLQGTVKADGN---MQGKERWVVFEKINGFKLNGGGIFDGE  117

Query  471   GDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
             G+           F+  KLP +L  +F+ N+ IRDITS++SK FH+NV  GKN+TF  I 
Sbjct  118   GNAAWRTNNCHKTFECKKLPISLRFDFVDNADIRDITSMDSKNFHINVISGKNMTFDNIK  177

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             I APA+S NTDGIH+ +   V I +S I TGDDCIS+GDG++NL ++ V CGPGHGISVG
Sbjct  178   ISAPAESPNTDGIHLGRCDGVKILNSKIATGDDCISVGDGMKNLLVEKVVCGPGHGISVG  237

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIV  1007
             SLG+   EE V GV V +   +GTDNGLRIKTWP++      + IH+  I +++V NPI+
Sbjct  238   SLGRYGFEEDVAGVRVVNCTLVGTDNGLRIKTWPSAKCTTTASGIHFEDIILQNVSNPIL  297

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQEYCP NQC+K+KPS +K+ ++S+  I+GTS  ++AV + CS G+PCE+V+ GDIN+ 
Sbjct  298   IDQEYCPWNQCNKQKPSTIKLVDISFRKIRGTSGNKDAVKLLCSKGIPCENVEIGDINIE  357

Query  1188  FKG--GAAKTVCSNAKPKLTGKQTP  1256
             +KG  G     CSN  PKL G Q P
Sbjct  358   YKGADGPPTFQCSNVNPKLVGTQVP  382



>ref|XP_004308599.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=392

 Score =   357 bits (916),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 179/364 (49%), Positives = 240/364 (66%), Gaps = 4/364 (1%)
 Frame = +3

Query  186   KVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATL  365
             K  A+ +SDI+  +  AW +ACA+T PS +++PKG +++K+A   GPCKAPIEL++  TL
Sbjct  26    KYGAKPNSDITQAIANAWKDACASTMPSKVIVPKGIYKLKEANFNGPCKAPIELQVCGTL  85

Query  366   KAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSL  545
             +A P+   +     W+  +Y+D FTLSG G  DGQG             K   +  N+  
Sbjct  86    QASPDGAQLSKPDTWIMFSYLDRFTLSGTGIFDGQGQQAWKANDCHKNPKCSSIAINMRF  145

Query  546   NFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKD  725
             + +KNS++RD++SLNSK FHVNV G + LTFQ  T+ AP  S NTDGIHI +   + I D
Sbjct  146   HSVKNSLVRDVSSLNSKNFHVNVLGCERLTFQHFTVTAPETSVNTDGIHIGRSTGINITD  205

Query  726   SVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTD  905
             S I TGDDCISIGDG + L I  VTCGPGHGIS+GSLG+ P EEPV G+ +K      T 
Sbjct  206   SNISTGDDCISIGDGTKQLTITKVTCGPGHGISIGSLGRYPKEEPVTGIYIKSCTLSNTM  265

Query  906   NGLRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVS  1082
             NG+RIKTWPNS    + +DIH+  I M +V NPI+IDQEYCP N C+K+  S VKISNVS
Sbjct  266   NGIRIKTWPNSPAASIASDIHFEDIIMNNVGNPILIDQEYCPWNLCNKQVASKVKISNVS  325

Query  1083  YTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTP  1256
             + NI+GTS+T  A+ I C+ G+PC+ V+  DINL + G  G+  + CSN +P +T +   
Sbjct  326   FRNIRGTSSTPLALKILCAKGLPCDKVEMTDINLKYNGKQGSLTSQCSNVRPTIT-RVPN  384

Query  1257  PVTC  1268
             P+ C
Sbjct  385   PLAC  388



>ref|XP_011039263.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=391

 Score =   357 bits (915),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 188/379 (50%), Positives = 246/379 (65%), Gaps = 8/379 (2%)
 Frame = +3

Query  141   FVLFLLADLGESAE---FKVTAEGDS-DISPELLKAWDEACAATTPSIIVIPKGTFQMKQ  308
             F+L  L+     AE   F VT  GD  DIS     AW++ACA+T+PS ++IP+GT+ +  
Sbjct  11    FLLLFLSSTDVKAENVVFDVTKYGDEEDISKAFKSAWEDACASTSPSKVLIPRGTYLLGP  70

Query  309   ALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIY  488
              ++ GPCKA IEL++K  L+AP +  + E    W+T+NYVD FTL+G GT DGQG     
Sbjct  71    VIISGPCKAAIELQVKGKLQAPVDMREFEGFSSWITLNYVDQFTLTGGGTFDGQGK-SAS  129

Query  489   GQKKDTGFKSDKLPN-NLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPA  665
              Q      K  KLP  +L  NF+ N I+ DITS +SK FH ++ G KNLTFQ  TI A  
Sbjct  130   NQNNCGKDKHCKLPPVSLKFNFITNGIVHDITSTDSKYFHAHLLGCKNLTFQHFTITAHD  189

Query  666   DSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKT  845
             +S NTDGIHI +  D+ I DS IGTGDDCIS+G G   + I+GVTC PGHGIS+GSLGK+
Sbjct  190   ESLNTDGIHIGRSKDIKIIDSDIGTGDDCISLGHGSRQITIEGVTCAPGHGISIGSLGKS  249

Query  846   PGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYC  1025
               EE V G+ VK+     T NG+RIK+WP    G  +DIH+  I M++V NPIVIDQ YC
Sbjct  250   QNEESVSGIFVKNCTISNTQNGVRIKSWPALFGGSASDIHFEDIIMKNVSNPIVIDQVYC  309

Query  1026  PNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--G  1199
             P N+C+++  S V I NVS+ NI+GTS T  AV ++CS  +PC++V+  DI+L + G  G
Sbjct  310   PWNECNRKSASKVSIKNVSFKNIRGTSRTPVAVQLSCSKDIPCDEVEVADIDLKYTGSEG  369

Query  1200  AAKTVCSNAKPKLTGKQTP  1256
              AK  CSN +PK  GK  P
Sbjct  370   PAKFQCSNVQPKFHGKINP  388



>gb|ADK92878.1| polygalacturonase [Hypericum perforatum]
Length=398

 Score =   357 bits (915),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 173/359 (48%), Positives = 237/359 (66%), Gaps = 1/359 (0%)
 Frame = +3

Query  180   EFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKA  359
              + V  +G +D S  + KAW +ACAAT  + + I KG + + +   +GPCK+P+ +  + 
Sbjct  31    HYGVKVDGKTDDSQAINKAWKDACAATNATTLRIGKGNYMVSKMAFQGPCKSPLTVDFQG  90

Query  360   TLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNL  539
             T KAP N  + +  +EW++   ++  TL G GT DGQG V           K   LPNNL
Sbjct  91    TFKAPSNAKNYK-NQEWVSFTNLNGLTLFGGGTFDGQGAVAWSINNCAKTGKCGSLPNNL  149

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
              +  L NSIIRDITSL+SKLFH+N+   KNLT ++ITI AP  S NTDGIHI +   V I
Sbjct  150   RMTGLTNSIIRDITSLDSKLFHINIINCKNLTLERITITAPESSLNTDGIHIGRSTGVNI  209

Query  720   KDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIG  899
               + I TGDDC+SIGDG + +NI+ VTCGPGHGIS+GSLG+   E+PV G+TVK+     
Sbjct  210   TSATIKTGDDCVSIGDGAQQINIEKVTCGPGHGISIGSLGRYHDEQPVVGITVKNCTLTS  269

Query  900   TDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
             T NG+RIKTWP S  G+ +++ +  I M +V NPI+IDQ+YCP +QC  + PS VKIS+V
Sbjct  270   TMNGVRIKTWPASPSGLASNMRFENIIMNNVSNPIMIDQQYCPYSQCEAKIPSRVKISDV  329

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGGAAKTVCSNAKPKLTGKQTP  1256
             S++ I+GTSAT+ AV + CS G+PC++V  GDINL +  G A + C+N KP++ G   P
Sbjct  330   SFSGIRGTSATQLAVKLVCSKGIPCQNVAVGDINLAYNKGQATSQCANVKPQVRGSVVP  388



>ref|XP_003544285.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=386

 Score =   356 bits (914),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 181/368 (49%), Positives = 240/368 (65%), Gaps = 5/368 (1%)
 Frame = +3

Query  159   ADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAP  338
             A L +  ++ V   GD  I+  L KAW +AC +TTPS +VIP   ++++Q    GPCKAP
Sbjct  18    ASLFDIRKYGVVPNGD--ITMALQKAWRDACVSTTPSKVVIPSNKYKLRQIDFMGPCKAP  75

Query  339   IELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKS  518
             IE+ +   +KAP NP D+  + +W+   Y++  TLSG+GT  G+G +        T    
Sbjct  76    IEILVNGIIKAPKNPFDVSGQNQWVRFGYINFLTLSGNGTFHGRGKMAWKQNNCSTNKNC  135

Query  519   DKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIA  698
              KL  N    F+ NS+I DITS +SK FHVNVFG KN++F    + +PA S NTDGIHI 
Sbjct  136   KKLAMNFGFGFVNNSVIHDITSKDSKYFHVNVFGCKNISFTNFRVSSPAYSPNTDGIHIG  195

Query  699   KICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTV  878
             K   V I +S I TGDDCIS+GDG + + I  VTCGPGHGISVGSLGK   E+ V+ V V
Sbjct  196   KSTQVKITNSKIDTGDDCISLGDGSKEVTILNVTCGPGHGISVGSLGKYSNEDSVEDVIV  255

Query  879   KDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKP  1055
             K+     T+NGLRIKTWP +    + +D+H+  I M +V NPI+IDQEYCP NQCSK+ P
Sbjct  256   KNCTLKNTNNGLRIKTWPGTAIISLASDLHFEDITMINVSNPIIIDQEYCPWNQCSKQSP  315

Query  1056  SLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGGAAKTV-CSNAKP  1232
             S +KIS V++ NI+GTSAT+E + + CSSG+PCE V+  DINL F G    T  C+N KP
Sbjct  316   SKIKISKVTFKNIRGTSATQEGITLVCSSGIPCETVELSDINLRFNGTTLVTAKCANVKP  375

Query  1233  KLTGKQTP  1256
             K+ G++ P
Sbjct  376   KI-GRKAP  382



>ref|XP_002310765.1| hypothetical protein POPTR_0007s11860g [Populus trichocarpa]
 gb|EEE91215.1| hypothetical protein POPTR_0007s11860g [Populus trichocarpa]
Length=391

 Score =   356 bits (914),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 188/379 (50%), Positives = 245/379 (65%), Gaps = 8/379 (2%)
 Frame = +3

Query  141   FVLFLLADLGESAE---FKVTAEGDS-DISPELLKAWDEACAATTPSIIVIPKGTFQMKQ  308
             F+L  L      AE   F VT  GD  DIS     AW++ACA+T+PS ++IP+GT+ +  
Sbjct  11    FLLLFLTSTDVKAENVVFDVTKYGDEEDISKAFKSAWEDACASTSPSKVLIPRGTYLLGP  70

Query  309   ALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIY  488
              ++ GPCKA IEL++K  L+AP +  + E    W+T+NYVD FTL+G GT DGQG     
Sbjct  71    VIISGPCKAAIELQVKGKLQAPVDMREFEGFSSWITLNYVDQFTLTGGGTFDGQGK-SAS  129

Query  489   GQKKDTGFKSDKLPN-NLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPA  665
              Q      K  KLP  +L  NF+ N I+ DITS +SK FH ++ G KNLTFQ  TI A  
Sbjct  130   NQNNCGKDKHCKLPPVSLKFNFITNGIVHDITSTDSKYFHAHLLGCKNLTFQHFTITAHD  189

Query  666   DSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKT  845
             +S NTDGIHI +  D+ I DS IGTGDDCIS+G G   + I+GVTC PGHGIS+GSLGK+
Sbjct  190   ESLNTDGIHIGRSKDIKIIDSDIGTGDDCISLGHGSRQITIEGVTCAPGHGISIGSLGKS  249

Query  846   PGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYC  1025
               EE V G+ VK+     T NG+RIK+WP    G  +DIH+  I M++V NPIVIDQ YC
Sbjct  250   QNEESVSGIFVKNCTISNTQNGVRIKSWPALFGGSASDIHFEDIIMKNVSNPIVIDQVYC  309

Query  1026  PNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--G  1199
             P N+C+++  S V I NVS+ NI+GTS T  AV ++CS  +PC++V+  DI+L + G  G
Sbjct  310   PWNECNRKSASKVSIKNVSFKNIRGTSRTPVAVQLSCSKDIPCDEVEVADIDLKYTGSEG  369

Query  1200  AAKTVCSNAKPKLTGKQTP  1256
              AK  CSN +PK  GK  P
Sbjct  370   PAKFQCSNVQPKFHGKINP  388



>ref|XP_008379966.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=400

 Score =   357 bits (915),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 180/382 (47%), Positives = 247/382 (65%), Gaps = 8/382 (2%)
 Frame = +3

Query  135   FTFVLFLLADLGESAEFKVTA-----EGDSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             F  +L +     +S  + VT+     + +SDI+  L KAW +ACA+T+ S IV+P GT++
Sbjct  12    FVSLLLVSTSNAQSGVYDVTSANYGGKANSDITQALSKAWTDACASTSASKIVVPSGTYK  71

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
                A  KGPCKAPIE +++ TL+AP + + +     W+    +D  TLSG GT DG G  
Sbjct  72    FVGATFKGPCKAPIEFQLQGTLQAPEDGSQLPKADTWIGFERIDGLTLSGGGTFDGLGAT  131

Query  480   QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKA  659
                    +       +  NL  NF+ NSIIRDIT+ +SK FHVN+ G  N+ FQ  T+ A
Sbjct  132   AWKQNDCNKNKNCKSIAINLRFNFVTNSIIRDITTKDSKNFHVNLLGCNNVAFQHFTVSA  191

Query  660   PADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLG  839
             P +S NTDGIHI +   + I D+ IGTGDDCISIGDG + L++  VTCGPGHGIS+GSLG
Sbjct  192   PKESINTDGIHIGRSTGINITDTTIGTGDDCISIGDGTKQLHVTNVTCGPGHGISIGSLG  251

Query  840   KTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHP-GVVTDIHYHKIEMEDVKNPIVIDQ  1016
             K   EEPV G+ +K+     TDNG+RIKTWP S   GVV+D+H+  I M++VKNP++IDQ
Sbjct  252   KYENEEPVSGIFIKNCTITNTDNGVRIKTWPASPANGVVSDVHFEDIIMDNVKNPVIIDQ  311

Query  1017  EYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG  1196
             EYCP NQC+ + PS VKISNVS+ NIKG+S+T   + + CS G+PCE+V+  +I+LT+ G
Sbjct  312   EYCPYNQCTLQVPSKVKISNVSFKNIKGSSSTPVGIKLVCSGGLPCENVELSNIDLTYTG  371

Query  1197  --GAAKTVCSNAKPKLTGKQTP  1256
               G+  + C + KP +     P
Sbjct  372   KEGSITSECKHIKPTINNVAQP  393



>ref|XP_008459709.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=428

 Score =   357 bits (917),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 181/365 (50%), Positives = 242/365 (66%), Gaps = 10/365 (3%)
 Frame = +3

Query  183   FKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKI  353
             F VT  G   ++DI+  L  AW EACA+T+P  IVIP GT+++    LKG CK+PIE+++
Sbjct  55    FDVTKYGAKPNADITQALADAWKEACASTSPCKIVIPTGTYKLGTIELKGECKSPIEIQV  114

Query  354   KATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPN  533
             + TL+APP+       ++W+   Y+D  +++  G  DGQG         D   K  ++P 
Sbjct  115   QGTLQAPPDLTG----EDWVHFKYIDYLSVTSGGVFDGQGKQAWESNDCDKNPKCARIPM  170

Query  534   NLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDV  713
             NL  +F+KN+I+ DITS +SK FH+ V G  NLTFQ + + AP  S NTDGIHI +   +
Sbjct  171   NLKFSFIKNAIVSDITSKDSKNFHIQVLGCNNLTFQHVNVNAPETSINTDGIHIGRSLGI  230

Query  714   TIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKF  893
              I ++ IGTGDDCIS+GDG + + I  VTCGPGHGISVGSLG+   EEPV+G+ VK+   
Sbjct  231   NILNTNIGTGDDCISLGDGSKQVTITNVTCGPGHGISVGSLGRYNLEEPVEGLQVKNCTL  290

Query  894   IGTDNGLRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKI  1070
              GT NGLRIKTWP S   GV +D+HY  + M +V NPI+IDQEYCP NQC+K+ PS VKI
Sbjct  291   TGTTNGLRIKTWPASPAAGVASDMHYEDVVMNNVMNPILIDQEYCPYNQCNKQVPSKVKI  350

Query  1071  SNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTG  1244
             S VS+ NI+GTS    AV + CSS  PC+ V+  DI+LT+ G  G   + C+N KP ++G
Sbjct  351   SKVSFKNIRGTSGNAAAVTLVCSSSNPCDGVELADIDLTYSGSEGPITSRCANVKPTVSG  410

Query  1245  KQTPP  1259
             KQ PP
Sbjct  411   KQNPP  415



>ref|XP_004161033.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=405

 Score =   356 bits (914),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 189/401 (47%), Positives = 256/401 (64%), Gaps = 23/401 (6%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAE--------FKVTAEGD----SDISPELLKAWDEACA  254
             M  I Y   +   FL++ L  + E        F +   G+     D++  L  AW++ACA
Sbjct  1     MGMIKYSNLSITTFLMSLLSFTIESQSHVDVIFPLRKYGNIVSGDDVTEALKDAWNDACA  60

Query  255   ATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDD  434
             +  PS +VIP G F++++   KGPCK+PIE++++ TL+AP +P+       W+T  YVD 
Sbjct  61    SVRPSAVVIPDGIFKVREGEFKGPCKSPIEIRVRGTLQAPKHPHG----DSWITFAYVDR  116

Query  435   FTLSGDGTLDGQGDVQIYGQKKDTGFKSD--KLPNNLSLNFLKNSIIRDITSLNSKLFHV  608
              T+SG G  DGQG      +K D   + D   LP +L  +F+ NSI+R ITSL+SK FHV
Sbjct  117   MTISGKGVFDGQGKAG--WEKNDCHKRIDCVNLPISLRFDFITNSIVRGITSLDSKNFHV  174

Query  609   NVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNI  788
             N+ G  NLTFQ + I AP DS NTDGIHI +   ++I  S I TGDDCIS+GDG + + I
Sbjct  175   NILGCNNLTFQGVNIIAPEDSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRVKI  234

Query  789   DGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIH  965
               VTCGPGHGIS+GSLGK   EEPV  V VK+   + T NG+RIKTWP+S   G+ T++H
Sbjct  235   TNVTCGPGHGISIGSLGKYTNEEPVDDVVVKNCTIMNTTNGIRIKTWPSSPVAGIATNMH  294

Query  966   YHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSG  1145
             +  I M +V NPI+IDQEYCP NQC++E PS +KI+NVS+ NIKG+SAT  AV + CSS 
Sbjct  295   FSDITMVNVSNPILIDQEYCPWNQCNREIPSNIKINNVSFKNIKGSSATPVAVKLICSSN  354

Query  1146  VPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
              PCE+VK  +I+L + G  G   + C N KP ++G Q P +
Sbjct  355   KPCEEVKVANIDLVYNGINGPVTSQCMNVKPIISGIQNPSI  395



>gb|KFK38252.1| hypothetical protein AALP_AA3G089100 [Arabis alpina]
Length=394

 Score =   356 bits (913),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 178/385 (46%), Positives = 253/385 (66%), Gaps = 5/385 (1%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M   F  +  FV  LL     + EF + +   SDI+ ELLKA+  AC + + S +VIPKG
Sbjct  1     MGAYFGVSTIFVFCLLGFSANAEEFTIGSSSGSDITQELLKAFTSACQSPSRSRVVIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              F++ +  L+GPCKAPI++ ++ T+KA  + N    K +W+    ++ F L G G  DG+
Sbjct  61    EFKLGEIELRGPCKAPIDIVLRGTVKA--DGNTAYGKDKWVVFGNINGFKLHGGGAFDGE  118

Query  471   GDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
             G+           F+  KLP ++  +F++N+II+DI+S+++K FH+NV G KN+T   I 
Sbjct  119   GNAAWRVNNCHKTFECKKLPISIRFDFIENAIIKDISSIDAKNFHINVLGAKNMTMSNIK  178

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             I AP DS NTDGIH+ +   V I +S I TGDDCIS+GDG++NL+++GV CGPGHGISVG
Sbjct  179   IIAPEDSPNTDGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEGVVCGPGHGISVG  238

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIV  1007
             SLG+   E+ V G+TVK+     TDNGLRIKTWP+S      +DIH+  I ++DV NPI+
Sbjct  239   SLGRYGMEQDVSGITVKNCTLQSTDNGLRIKTWPSSACSTTASDIHFEDIILKDVSNPIL  298

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQEYCP NQC+K+K S +K+ N+S+  I+GTS  ++AV + CS G PC++V+ GDI++ 
Sbjct  299   IDQEYCPWNQCNKQKSSTIKLVNISFKKIRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIR  358

Query  1188  FKG--GAAKTVCSNAKPKLTGKQTP  1256
             + G  G A   CSN  PK+ G Q P
Sbjct  359   YNGADGPATFQCSNVSPKIMGTQIP  383



>ref|XP_008229848.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=399

 Score =   356 bits (914),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 180/358 (50%), Positives = 238/358 (66%), Gaps = 4/358 (1%)
 Frame = +3

Query  204   DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNP  383
             +SDI+  L KAW +ACA+T+PS +V+PKGTF+      KGPCKAPI  +++  L+AP + 
Sbjct  39    NSDITQALSKAWTDACASTSPSTLVVPKGTFKFLGTTFKGPCKAPIAFQLQGILQAPVDG  98

Query  384   NDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNS  563
             N +  K  W++ +++D  T+SG GT DGQG +               +  NL  NF+ NS
Sbjct  99    NQLPKKDTWISFDHIDRLTISGGGTFDGQGAIAWKQNDCHKNKNCKSIAINLRFNFITNS  158

Query  564   IIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTG  743
              I  IT+ +SK FHVNV G  N+ F   T+ AP +S NTDGIHI +   ++I DS I TG
Sbjct  159   RIEYITTKDSKNFHVNVLGCTNVAFHHFTVSAPKESINTDGIHIGRSTGISIIDSTIKTG  218

Query  744   DDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIK  923
             DDCISIGDG +NLN+  VTCGPGHGIS+GSLG+   EEPV G+T+K+     T NG+RIK
Sbjct  219   DDCISIGDGTKNLNVTNVTCGPGHGISIGSLGRYQKEEPVSGITIKNCTLTDTQNGVRIK  278

Query  924   TWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKG  1100
             TWP S   G  +DIH+  I M +V NPI+IDQEYCP NQC+ + PS VKISNVS+ NIKG
Sbjct  279   TWPASPSAGTASDIHFEDIIMVNVGNPILIDQEYCPWNQCTLKVPSKVKISNVSFKNIKG  338

Query  1101  TSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTPPVTC  1268
             TS T  A+ + CS G+PCE+V+  DI+L + G  G   + C+N KPK+T + T P+ C
Sbjct  339   TSTTPLALKLVCSKGLPCENVELSDIDLKYTGNQGPLTSKCTNVKPKIT-RVTKPLAC  395



>ref|XP_004491599.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=393

 Score =   356 bits (913),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 186/377 (49%), Positives = 236/377 (63%), Gaps = 8/377 (2%)
 Frame = +3

Query  138   TFVL-FLLADLG--ESAEFKVTAEG--DSDISPELLKAWDEACAATTPSIIVIPKGTFQM  302
             T VL FLL   G  +SA F +   G    DI+      W  AC +T  S + IP G+++M
Sbjct  8     TIVLSFLLTTFGIAQSAVFDIRKYGAPSGDITTAFGDVWKAACNSTGASKVWIPSGSYKM  67

Query  303   KQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQ  482
                ++KGPC  PIE+++  T+ AP NP  +    EW+   YVD FTLSG G  DGQG + 
Sbjct  68    GAIVVKGPCNGPIEVQVDGTIIAPANPAALHDAYEWIKFEYVDFFTLSGKGVFDGQGAIA  127

Query  483   IYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAP  662
                         D    N   NFLK++ +RDITS +SK FHVNV G  N TF   T+ AP
Sbjct  128   WNQNDCGKNKNCDMASMNFGFNFLKHATVRDITSKDSKNFHVNVLGCTNFTFDHFTVTAP  187

Query  663   ADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGK  842
             A S NTDGIHI +  DV I ++ IGTGDDC+S+GDG + + +  V CGPGHGISVGSLGK
Sbjct  188   ATSLNTDGIHIGRSTDVKILNTNIGTGDDCVSLGDGCKQITVQNVNCGPGHGISVGSLGK  247

Query  843   TPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV--VTDIHYHKIEMEDVKNPIVIDQ  1016
              P EEPV+ + VK+     TDNG+RIKTWP S PG   +TD+H+  I M DV NP++IDQ
Sbjct  248   YPKEEPVEQLLVKNCTLTNTDNGVRIKTWP-STPGTNPITDMHFEDITMVDVLNPVIIDQ  306

Query  1017  EYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG  1196
             EYCP NQCSK+ PS +KIS V++ NIKGTS T++ VI+ CS  VPCE V+  ++ LTF G
Sbjct  307   EYCPWNQCSKQSPSKIKISKVTFKNIKGTSKTKDGVILICSKSVPCEGVELNNVALTFNG  366

Query  1197  GAAKTVCSNAKPKLTGK  1247
                   C N KP +TGK
Sbjct  367   TEVDAKCVNVKPIVTGK  383



>ref|XP_010038563.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=395

 Score =   356 bits (913),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 182/380 (48%), Positives = 242/380 (64%), Gaps = 4/380 (1%)
 Frame = +3

Query  138   TFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALL  317
             +F   ++A + +   + VT  G  DI+  LL AW +ACA+TT   ++IP GTF + + +L
Sbjct  15    SFSSTIIAQVFQIENYNVTGGGIPDITQSLLDAWKKACASTTRPKVLIPGGTFTLSEVVL  74

Query  318   KGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQK  497
             +GPCKA +E ++ A L APP  +  +    W+  + +D  T+ G GT DGQG +      
Sbjct  75    EGPCKAHVEFEVHARLLAPPELSRFK-TDGWVVFHNIDGLTMLG-GTFDGQGKMAWAQND  132

Query  498   KDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHN  677
                      LP NL  N + N+II D+TS++SK FHV V G KN+TFQ   + AP +S N
Sbjct  133   CIKNKNCRMLPMNLRFNVVSNAIIHDVTSVDSKYFHVTVLGCKNVTFQHFHVNAPGNSVN  192

Query  678   TDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEE  857
             TDGIHI +   V I D+ I TGDDC+S+GDG   + + G+TCGPGHGISVGSLGK   EE
Sbjct  193   TDGIHIGRSLGVNILDTDIKTGDDCVSLGDGSRQVTVKGLTCGPGHGISVGSLGKYDNEE  252

Query  858   PVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQ  1037
             PV GV V +    G  NG+RIKTWP S  G+ TD+H+  I+M +V NP++IDQ YCP NQ
Sbjct  253   PVSGVFVTNCTINGATNGVRIKTWPASKIGIATDMHFEDIQMNNVFNPVLIDQGYCPWNQ  312

Query  1038  CSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKT  1211
             C  + PSLVKISNVS+  I+GTSAT+ AV IACS  +PCE V+  DINL +KG  G A +
Sbjct  313   CQAQIPSLVKISNVSFKRIRGTSATKVAVKIACSKRIPCEGVEIADINLVYKGPDGPATS  372

Query  1212  VCSNAKPKLTGKQTPPVTCK  1271
              CSN +P ++G Q P    K
Sbjct  373   ECSNVRPLISGMQNPRACAK  392



>gb|KCW46859.1| hypothetical protein EUGRSUZ_K00664 [Eucalyptus grandis]
Length=392

 Score =   355 bits (912),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 181/375 (48%), Positives = 241/375 (64%), Gaps = 4/375 (1%)
 Frame = +3

Query  138   TFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALL  317
             +F   ++A + +   + VT  G  DI+  LL AW +ACA+TT   ++IP GTF + + +L
Sbjct  15    SFSSTIIAQVFQIENYNVTGGGIPDITQSLLDAWKKACASTTRPKVLIPGGTFTLSEVVL  74

Query  318   KGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQK  497
             +GPCKA +E ++ A L APP  +  +    W+  + +D  T+ G GT DGQG +      
Sbjct  75    EGPCKAHVEFEVHARLLAPPELSRFK-TDGWVVFHNIDGLTMLG-GTFDGQGKMAWAQND  132

Query  498   KDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHN  677
                      LP NL  N + N+II D+TS++SK FHV V G KN+TFQ   + AP +S N
Sbjct  133   CIKNKNCRMLPMNLRFNVVSNAIIHDVTSVDSKYFHVTVLGCKNVTFQHFHVNAPGNSVN  192

Query  678   TDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEE  857
             TDGIHI +   V I D+ I TGDDC+S+GDG   + + G+TCGPGHGISVGSLGK   EE
Sbjct  193   TDGIHIGRSLGVNILDTDIKTGDDCVSLGDGSRQVTVKGLTCGPGHGISVGSLGKYDNEE  252

Query  858   PVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQ  1037
             PV GV V +    G  NG+RIKTWP S  G+ TD+H+  I+M +V NP++IDQ YCP NQ
Sbjct  253   PVSGVFVTNCTINGATNGVRIKTWPASKIGIATDMHFEDIQMNNVFNPVLIDQGYCPWNQ  312

Query  1038  CSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKT  1211
             C  + PSLVKISNVS+  I+GTSAT+ AV IACS  +PCE V+  DINL +KG  G A +
Sbjct  313   CQAQIPSLVKISNVSFKRIRGTSATKVAVKIACSKRIPCEGVEIADINLVYKGPDGPATS  372

Query  1212  VCSNAKPKLTGKQTP  1256
              CSN +P ++G Q P
Sbjct  373   ECSNVRPLISGMQNP  387



>ref|XP_007142511.1| hypothetical protein PHAVU_008G286900g [Phaseolus vulgaris]
 gb|ESW14505.1| hypothetical protein PHAVU_008G286900g [Phaseolus vulgaris]
Length=383

 Score =   355 bits (911),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 180/373 (48%), Positives = 238/373 (64%), Gaps = 5/373 (1%)
 Frame = +3

Query  144   VLFLLADLGESAEFKVT----AEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQA  311
             VLFLL  +  +A+  V        + DI+    KAW EACA+T+ S I+I  G ++M   
Sbjct  5     VLFLLLTISCTAQSTVIDIKKFGRNKDITQAFTKAWKEACASTSASKILISSGEYKMNAV  64

Query  312   LLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYG  491
              +KGPCKA +E+++  T++AP +P  ++   EW+ I YVD FTLSG GT DG+G +    
Sbjct  65    NVKGPCKASVEIQVDGTIQAPADPYALKDAYEWIKIEYVDSFTLSGKGTFDGKGAIAWKH  124

Query  492   QKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADS  671
                 T     +   N   NFL NSI+R +TS +SK FHVNV G  N TF    I AP  S
Sbjct  125   NNCRTHQNCKRNSMNFGFNFLNNSIVRGVTSKDSKNFHVNVLGCNNFTFDNFHISAPETS  184

Query  672   HNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPG  851
              NTDGIHI +  +V + +S I TGDDC+S+GDG   + I  V CGPGHGISVGSLGK  G
Sbjct  185   INTDGIHIGRSTNVKVLNSNIATGDDCVSLGDGSREVIIKNVKCGPGHGISVGSLGKYAG  244

Query  852   EEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCP  1028
             EEPV+ + VK+    GTDNG+RIKTWPN+     VT++H+    M +V +P++IDQEYCP
Sbjct  245   EEPVENLLVKNCTMTGTDNGVRIKTWPNTAVVTTVTNMHFEDFTMVNVLHPVIIDQEYCP  304

Query  1029  NNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGGAAK  1208
              NQCSKE PS +KIS V++ NIKGTS ++E V + CS  VPCE V+  +++LT+ G    
Sbjct  305   WNQCSKENPSKIKISKVTFKNIKGTSRSKEGVTLICSRSVPCEGVELSEVSLTYNGAPIV  364

Query  1209  TVCSNAKPKLTGK  1247
               C N KPK+TGK
Sbjct  365   AKCVNVKPKITGK  377



>ref|XP_008229862.1| PREDICTED: polygalacturonase-like [Prunus mume]
Length=726

 Score =   365 bits (937),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 188/388 (48%), Positives = 257/388 (66%), Gaps = 17/388 (4%)
 Frame = +3

Query  135   FTFVLFLLADLG--ESAEFKVTAEG-----DSDISPELLKAWDEACAATTPSIIVIPKGT  293
             + FV  LLA +   +S+ F VT+       +SDI+  L  AW +ACA+T P+ +VIPKGT
Sbjct  5     WIFVFLLLASIAKVQSSVFDVTSAAYGGKPNSDITQALANAWRDACASTWPTKVVIPKGT  64

Query  294   FQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQG  473
             + ++ A+L+GPCKAPIE++++  LKAP +   +  +  W+   YVD  TL G G+ DGQ 
Sbjct  65    YNLRGAILQGPCKAPIEVQVQGNLKAPLDSKYLTKQDTWVGFQYVDRLTLYGGGSFDGQN  124

Query  474   DVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITI  653
             +      K      +D +  NL L+F+ N++IRDITSL+SK FH+NVFG +N+TFQ +TI
Sbjct  125   NCY----KNKYCKATDAI--NLRLDFVTNAMIRDITSLDSKHFHINVFGCRNVTFQYVTI  178

Query  654   KAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGS  833
              AP DS NTDGIHI +   +TI  + IGTGDDCIS+GDG + + +  VTCGPGHGIS+GS
Sbjct  179   TAPEDSANTDGIHIGRSYGITIDHTTIGTGDDCISLGDGSQRIIVTNVTCGPGHGISIGS  238

Query  834   LGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHP-GVVTDIHYHKIEMEDVKNPIVI  1010
             LGK   E PV GV VK+     T NGLRIKTWP S   G  T IH+  I M +V NPI I
Sbjct  239   LGKYQSEVPVAGVLVKNCTLTNTQNGLRIKTWPGSPAFGTATHIHFQDIAMVNVGNPIFI  298

Query  1011  DQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTF  1190
             DQ+YCP +QC+++ PS V+IS+VS+ NIKGTSAT  AV + CS  +PC++V   DI++T+
Sbjct  299   DQQYCPYSQCAQKAPSTVQISSVSFVNIKGTSATPVAVQLMCSRKLPCQNVGLEDIDITY  358

Query  1191  KG--GAAKTVCSNAKPKLTGKQTPPVTC  1268
              G  G   + C+  KP+ T +   P++C
Sbjct  359   SGDKGPLTSQCAYVKPQFT-RVANPLSC  385



>ref|XP_004144612.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
 ref|XP_004162886.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
Length=402

 Score =   355 bits (910),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 177/387 (46%), Positives = 243/387 (63%), Gaps = 10/387 (3%)
 Frame = +3

Query  141   FVLFLLADL---GESAEFKV-----TAEGDSDISPELLKAWDEACAATTPSIIVIPKGTF  296
             F+LFL   L    ++A+F V      A G+SD S  ++KAW +AC++T PS IVIP G +
Sbjct  12    FILFLFIGLITNAQAADFHVKRYGARANGNSDDSQAIMKAWKDACSSTKPSKIVIPGGRY  71

Query  297   QMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGD  476
              +     +GPC API ++++  L+AP N   M     W+   Y++  TLSG GT DG+G 
Sbjct  72    VVDSMKFQGPCLAPIHVQVEGRLQAPTNIKKMRNDASWIVFQYINGLTLSGKGTFDGRGS  131

Query  477   VQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIK  656
             +     +  +  K   LP +L    L NS+I+DITS +SK FHVNV   +NLT Q I I 
Sbjct  132   LAWKQNQCASSGKCGSLPISLRFYSLNNSLIKDITSTDSKFFHVNVHNCRNLTLQNINID  191

Query  657   APADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSL  836
             AP DS NTDGIHI     VTI ++ I TGDDC+SIGDG + + ++ VTCGPGHGIS+GSL
Sbjct  192   APGDSPNTDGIHIGGSSGVTIHNARIKTGDDCVSIGDGSQQIKVEKVTCGPGHGISIGSL  251

Query  837   GKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQ  1016
             GK   E+PV G+TV+D     T  G+RIK+WP S  G+ +++ +  I M +V  PI+IDQ
Sbjct  252   GKYKNEKPVSGITVRDCTITNTMFGVRIKSWPASTKGIASNMQFESIVMNNVGTPILIDQ  311

Query  1017  EYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG  1196
             +YCP   C+++ PS V+ISNV + NI+GTS T+ AV + CS G PC++VK  +INL + G
Sbjct  312   QYCPYGTCNRQIPSRVQISNVGFKNIRGTSTTQVAVKLVCSRGYPCKNVKLSNINLKYSG  371

Query  1197  --GAAKTVCSNAKPKLTGKQTPPVTCK  1271
               G A + CSN KP + G   PP   +
Sbjct  372   TNGTAISECSNVKPAIAGSVVPPACTR  398



>ref|XP_009365184.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   355 bits (910),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 179/382 (47%), Positives = 247/382 (65%), Gaps = 8/382 (2%)
 Frame = +3

Query  135   FTFVLFLLADLGESAEFKVTA-----EGDSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             F  +L +     +S  + VT+     + +SDI+  L KAW +ACA+T+   IV+P GT++
Sbjct  12    FVSLLLVSTSNAQSGVYDVTSANYGGKANSDITQALSKAWTDACASTSAGKIVVPSGTYK  71

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
                A  KGPCKAPIE +++ TL+AP + + +     W+    +D  TLSG GT DG G  
Sbjct  72    FVGATFKGPCKAPIEFQLQGTLQAPEDGSQLPKADTWIGFERIDGLTLSGGGTFDGLGAT  131

Query  480   QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKA  659
                    +       +  NL  NF+ NSIIRDIT+ +SK FHVN+ G  N+ FQ  T+ A
Sbjct  132   AWKQNDCNKNKNCKSIAINLRFNFVTNSIIRDITTKDSKNFHVNLLGCNNVAFQHFTVSA  191

Query  660   PADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLG  839
             P +S NTDGIHI +   + I D+ IGTGDDCISIGDG + L++  VTCGPGHGIS+GSLG
Sbjct  192   PKESINTDGIHIGRSTGINITDTTIGTGDDCISIGDGTKQLHVTNVTCGPGHGISIGSLG  251

Query  840   KTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHP-GVVTDIHYHKIEMEDVKNPIVIDQ  1016
             K   EEPV G+ +K+     TDNG+RIKTWP S   GVV+D+H+  I M++VKNP++IDQ
Sbjct  252   KYENEEPVSGIFIKNCTISNTDNGVRIKTWPASPANGVVSDVHFEDIIMDNVKNPVIIDQ  311

Query  1017  EYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG  1196
             EYCP+NQC+ + PS VKISNVS+ NIKG+S+T   + + CS G+PCE+V+  +I+LT+ G
Sbjct  312   EYCPHNQCTLQVPSKVKISNVSFKNIKGSSSTPVGIKLVCSGGLPCENVELSNIDLTYTG  371

Query  1197  --GAAKTVCSNAKPKLTGKQTP  1256
               G+  + C + KP +     P
Sbjct  372   KEGSITSECKHIKPTIDNVAQP  393



>gb|KHN40047.1| Polygalacturonase [Glycine soja]
Length=392

 Score =   354 bits (908),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 180/368 (49%), Positives = 239/368 (65%), Gaps = 5/368 (1%)
 Frame = +3

Query  159   ADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAP  338
             A L +  ++ V   GD  I+  L KAW +AC +TTPS +VIP   ++++Q     PCKAP
Sbjct  24    ASLFDIRKYGVVPNGD--ITMALQKAWRDACVSTTPSKVVIPSNKYKLRQIDFMRPCKAP  81

Query  339   IELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKS  518
             IE+ +   +KAP NP D+  + +W+   Y++  TLSG+GT  G+G +        T    
Sbjct  82    IEILVNGIIKAPKNPFDVSGQNQWVRFGYINFLTLSGNGTFHGRGKMAWKQNNCSTNKNC  141

Query  519   DKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIA  698
              KL  N    F+ NS+I DITS +SK FHVNVFG KN++F    + +PA S NTDGIHI 
Sbjct  142   KKLAMNFGFGFVNNSVIHDITSKDSKYFHVNVFGCKNISFTNFRVSSPAYSPNTDGIHIG  201

Query  699   KICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTV  878
             K   V I +S IGTGDDCIS+GDG + + I  VTCGP HGISVGSLGK   E+ V+ V V
Sbjct  202   KSTQVKITNSKIGTGDDCISLGDGSKEVTILNVTCGPEHGISVGSLGKYSNEDSVEDVIV  261

Query  879   KDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKP  1055
             K+     T+NGLRIKTWP +    + +D+H+  I M +V NPI+IDQEYCP NQCSK+ P
Sbjct  262   KNCTLKNTNNGLRIKTWPGTAIISLASDLHFEDITMINVSNPIIIDQEYCPWNQCSKQSP  321

Query  1056  SLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGGAAKTV-CSNAKP  1232
             S +KIS V++ NI+GTSAT+E + + CSSG+PCE V+  DINL F G    T  C+N KP
Sbjct  322   SKIKISKVTFKNIRGTSATQEGITLVCSSGIPCETVELSDINLRFNGTTLVTAKCANVKP  381

Query  1233  KLTGKQTP  1256
             K+ G++ P
Sbjct  382   KI-GRKAP  388



>ref|XP_008462107.1| PREDICTED: exopolygalacturonase clone GBGA483 [Cucumis melo]
Length=403

 Score =   354 bits (908),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 177/395 (45%), Positives = 248/395 (63%), Gaps = 10/395 (3%)
 Frame = +3

Query  117   TIFYCAFTFVLFLLADL---GESAEFKV-----TAEGDSDISPELLKAWDEACAATTPSI  272
             TIF  + TF+LFL   L    ++ +F V      A G+SD S  ++KAW +AC++T PS 
Sbjct  5     TIFSRSTTFILFLFIGLITNVQAVDFHVKRYGARANGNSDDSQAIMKAWKDACSSTKPSK  64

Query  273   IVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGD  452
             IVIP G + +     +GPC API ++++  L+AP N   M     W+   Y++  T+SG 
Sbjct  65    IVIPGGRYVVDSMKFQGPCLAPIHVQVEGRLQAPTNIKKMRNDASWIVFQYINGLTVSGK  124

Query  453   GTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNL  632
             GT DG+G +     +  +  K   LP +L    L NS+I+DITS +SK FH+NV   +N+
Sbjct  125   GTFDGRGSLAWKQNQCASSGKCGSLPISLRFFSLNNSLIKDITSTDSKFFHMNVHNCRNV  184

Query  633   TFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPG  812
             T + I I AP DS NTDGIHI     +TI D+ I TGDDC+SIGDG + +N++ VTCGPG
Sbjct  185   TLRNINIDAPGDSPNTDGIHIGGSSGITIHDARIKTGDDCVSIGDGSQQINVEKVTCGPG  244

Query  813   HGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDV  992
             HGIS+GSLGK   E+PV G+TV+D     T  G+RIKTWP S  G+ +++ +  I M++V
Sbjct  245   HGISIGSLGKYKNEKPVSGITVRDCTITNTMFGVRIKTWPASTKGIASNMQFENIVMDNV  304

Query  993   KNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFG  1172
               PI+IDQ+YCP   C  + PS V+IS+V + NI+GTS T+ AV + CS G PC++VK  
Sbjct  305   GTPILIDQQYCPYGTCHHQVPSRVQISDVGFKNIRGTSTTQVAVKLVCSRGYPCKNVKLS  364

Query  1173  DINLTFKG--GAAKTVCSNAKPKLTGKQTPPVTCK  1271
             +INL + G  G A + CSN KP + G+  PP   +
Sbjct  365   NINLKYSGTNGTAISECSNVKPAVVGRVVPPACTR  399



>gb|KFK38253.1| hypothetical protein AALP_AA3G089200 [Arabis alpina]
Length=394

 Score =   353 bits (906),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 177/382 (46%), Positives = 255/382 (67%), Gaps = 7/382 (2%)
 Frame = +3

Query  126   YCAFT--FVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             Y  F+   V+FLL+    +  FKV++   SDI+  LLKA+  AC + + S +VIPKG F+
Sbjct  4     YIGFSTILVIFLLSLSANAEVFKVSSSSGSDITQALLKAFKSACQSPSASHVVIPKGEFK  63

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
             + +  L GPCKAPIE+ ++ T+KA  + N    ++ W+  + ++ F L+G G  DG+G+ 
Sbjct  64    LGEIELMGPCKAPIEITLQGTVKA--DGNTKHGRERWVVFSRINGFKLNGGGIFDGEGNA  121

Query  480   QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKA  659
                       F+  KLP ++  +F+  + IRDIT+L+SK FH+NV G KN+TF  + + A
Sbjct  122   AWRVNNCHKTFECKKLPISIRFDFVTEAEIRDITTLDSKNFHINVLGAKNMTFTNVKVIA  181

Query  660   PADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLG  839
             PA+S NTDGIH+ +   V I +S I TGDDCIS+GDG++NL+++GV CGPGHGISVGSLG
Sbjct  182   PAESPNTDGIHLGRSDGVKILNSRISTGDDCISVGDGMKNLHVEGVVCGPGHGISVGSLG  241

Query  840   KTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIVIDQ  1016
             +   E+ V G+TV +     TDNGLRIKTWP++      + IH+  I +++V NPI+IDQ
Sbjct  242   RYGHEQDVSGITVVNCTLQETDNGLRIKTWPSAACATTASGIHFENIILKNVSNPILIDQ  301

Query  1017  EYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG  1196
             EYCP NQC+K KPS +K+ ++ + NI+GTS  ++AV + CS G PC++V+ G+IN+ +KG
Sbjct  302   EYCPWNQCNKNKPSTIKLVDIKFKNIRGTSGNKDAVKLLCSKGHPCQNVEIGNINIAYKG  361

Query  1197  --GAAKTVCSNAKPKLTGKQTP  1256
               G A   CSN KPKL G Q P
Sbjct  362   ADGPATFQCSNVKPKLVGTQNP  383



>ref|XP_004295347.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=412

 Score =   354 bits (908),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 184/369 (50%), Positives = 242/369 (66%), Gaps = 12/369 (3%)
 Frame = +3

Query  162   DLGESAEFKVTA-----EGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGP  326
             +L    EF VT+     +  SDIS  L  AW +ACA+T+PS I+IPKGT+ +K+A   GP
Sbjct  24    ELLSDGEFDVTSAKYGGKAGSDISQALTNAWKDACASTSPSKIIIPKGTYPLKEAEFSGP  83

Query  327   CKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDT  506
             CKAPIE++++ TL+AP +   +     W+   Y+ DFTLSG G  DGQG       K + 
Sbjct  84    CKAPIEMQLQGTLQAPEDSTQLTKPDTWIGFLYISDFTLSGGGVFDGQG---AKAWKAND  140

Query  507   GFKSDKLPNNLSLNF--LKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNT  680
               K+ K  + +++ F  +K S+++DITSLNSK FH N+ G + LTF  +T+ AP DS NT
Sbjct  141   CQKNPKCSSTINIRFHQMKKSLVKDITSLNSKNFHFNIIGAEQLTFDHVTVTAPGDSPNT  200

Query  681   DGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEP  860
             DGIHI +   V I + VIGTGDDCISIGDG + L I+ VTCGPGHGISVGSLGK   EEP
Sbjct  201   DGIHIGRSNGVNITNCVIGTGDDCISIGDGTKQLTIEKVTCGPGHGISVGSLGKYDNEEP  260

Query  861   VKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNQ  1037
             V G+ VK+     T NG+R+KTWPN    +  +DIH+  I M++V+NPIV+DQEYCP +Q
Sbjct  261   VAGIFVKNCTISKTQNGVRVKTWPNGPSAITASDIHFEDIIMDNVQNPIVLDQEYCPYDQ  320

Query  1038  CSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG-GAAKTV  1214
             C K   S +KISNVS+ NI+GTSAT   V +ACS   PC+ V   DI+L   G G   + 
Sbjct  321   CDKSASSKIKISNVSFKNIRGTSATALGVKVACSKSNPCDQVVMSDIDLKLSGAGELTSQ  380

Query  1215  CSNAKPKLT  1241
             C+N KP +T
Sbjct  381   CTNTKPTIT  389



>ref|NP_187439.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21192.1|AC013483_16 polygalacturonase (PGA3) [Arabidopsis thaliana]
 gb|AAL38715.1| putative polygalacturonase(PGA3 [Arabidopsis thaliana]
 gb|AAM20184.1| putative polygalacturonase (PGA3) [Arabidopsis thaliana]
 gb|AAM65120.1| polygalacturonase PGA3 [Arabidopsis thaliana]
 gb|AEE74608.1| polygalacturonase [Arabidopsis thaliana]
Length=391

 Score =   353 bits (906),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 176/385 (46%), Positives = 256/385 (66%), Gaps = 5/385 (1%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M   F  +  F++ LL     +  F + +   SDI+  LLKA+  AC +++PS +VIPKG
Sbjct  1     MGGYFGVSTIFIICLLGISANAEVFTIGSSSGSDITQALLKAFTSACQSSSPSKVVIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              F++ +  ++GPCKAPIE+ ++ T+KA  + N ++ K++W+    +D F L+G G  DG+
Sbjct  61    EFKLGEIEMRGPCKAPIEVTLQGTVKA--DGNAIQGKEKWVVFGNIDGFKLNGGGAFDGE  118

Query  471   GDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
             G+           F+  KLP ++  +F+ NS IRDI+S+++K FH+NV G KN+T   I 
Sbjct  119   GNAAWRVNNCHKTFECKKLPISIRFDFILNSEIRDISSIDAKNFHINVLGAKNMTMNNIK  178

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             I AP DS NTDGIH+ +   V I +S I TGDDCIS+GDG++NL+++ VTCGPGHGISVG
Sbjct  179   IVAPEDSPNTDGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVG  238

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIV  1007
             SLG+   E+ V G+ V +     TDNGLRIKTWP++      +DIH+  I ++DV NPI+
Sbjct  239   SLGRYGHEQDVSGIKVINCTLQETDNGLRIKTWPSAACSTTASDIHFEDIILKDVSNPIL  298

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQEYCP NQC+K+K S +K+ N+S+ NI+GTS  ++AV + CS G PC++V+ GDI++ 
Sbjct  299   IDQEYCPWNQCNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIK  358

Query  1188  FKG--GAAKTVCSNAKPKLTGKQTP  1256
             + G  G A   CSN  PK+ G Q+P
Sbjct  359   YNGADGPATFHCSNVSPKILGSQSP  383



>emb|CAA05892.1| polygalacturonase [Arabidopsis thaliana]
 emb|CAA06610.1| polygalacturonase [Arabidopsis thaliana]
Length=391

 Score =   353 bits (905),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 175/385 (45%), Positives = 256/385 (66%), Gaps = 5/385 (1%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M   F  +  F++ LL     +  F + +   SDI+  LLKA+  AC +++PS +VIPKG
Sbjct  1     MGGYFGVSTIFIICLLGISANAEVFTIGSSSGSDITQALLKAFTSACQSSSPSKVVIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              F++ +  ++GPCKAPIE+ ++ T+KA  + N ++ K++W+    +D F L+G G  DG+
Sbjct  61    EFKLGEIEMRGPCKAPIEVTLQGTVKA--DGNAIQGKEKWVVFGNIDGFKLNGGGAFDGE  118

Query  471   GDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
             G+           F+  KLP ++  +F+ NS IRDI+S+++K FH+NV G KN+T   I 
Sbjct  119   GNAAWRVNNCHKTFECKKLPISIRFDFILNSEIRDISSIDAKNFHINVLGAKNMTMNNIK  178

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             I AP DS NTDGIH+ +   + I +S I TGDDCIS+GDG++NL+++ VTCGPGHGISVG
Sbjct  179   IVAPEDSPNTDGIHLGRSDGIKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVG  238

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIV  1007
             SLG+   E+ V G+ V +     TDNGLRIKTWP++      +DIH+  I ++DV NPI+
Sbjct  239   SLGRYGHEQDVSGIKVINCTLQETDNGLRIKTWPSAACSTTASDIHFEDIILKDVSNPIL  298

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQEYCP NQC+K+K S +K+ N+S+ NI+GTS  ++AV + CS G PC++V+ GDI++ 
Sbjct  299   IDQEYCPWNQCNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIK  358

Query  1188  FKG--GAAKTVCSNAKPKLTGKQTP  1256
             + G  G A   CSN  PK+ G Q+P
Sbjct  359   YNGADGPATFHCSNVSPKILGSQSP  383



>ref|XP_009134996.1| PREDICTED: polygalacturonase-like [Brassica rapa]
 emb|CDX74029.1| BnaA03g30180D [Brassica napus]
Length=395

 Score =   352 bits (904),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/382 (46%), Positives = 255/382 (67%), Gaps = 6/382 (2%)
 Frame = +3

Query  123   FYCAFTFVLFLLADLGESAEF-KVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             ++ AFT  +F L     +A +  + +   SDI+  LLKA+  AC + TPS +VIPKG F+
Sbjct  4     YFGAFTVFIFCLLGFSANAVYITIGSSPGSDITQALLKAFTTACQSPTPSRVVIPKGEFK  63

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
             + +  ++GPCKAP+E+ I+ T+KA  + N ++ K  W+    ++ F L+G G  DG+G+ 
Sbjct  64    LGEIQMRGPCKAPVEITIQGTVKA--DGNAIQGKDTWIVFGNINGFKLNGGGAFDGEGNA  121

Query  480   QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKA  659
                       F   KLP ++  +F++N+ IRDI+S+++K FH+NV G KN+T   I I A
Sbjct  122   AWRVNNCHQTFNCKKLPISIRFDFVENAEIRDISSIDAKNFHINVLGAKNMTMDHINIIA  181

Query  660   PADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLG  839
             P DS NTDGIH+ +   V I ++ I TGDDCIS+GDG++NL+++ VTCGPGHGISVGSLG
Sbjct  182   PKDSPNTDGIHLGRSDGVKILNTFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLG  241

Query  840   KTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQ  1016
             +   E+ V G+ V +     TDNGLRIKTWP++      +DIH+  I +++V NPI+IDQ
Sbjct  242   RYGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIILKNVMNPILIDQ  301

Query  1017  EYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG  1196
             EYCP NQC+K+KPS +K++N+S+  I+GTS  ++AV + CS G PC++V+ GDI++ + G
Sbjct  302   EYCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSG  361

Query  1197  --GAAKTVCSNAKPKLTGKQTP  1256
               G A   CSN  PKL G Q+P
Sbjct  362   ADGPATFQCSNVSPKLMGTQSP  383



>ref|XP_004490643.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=394

 Score =   352 bits (902),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 174/351 (50%), Positives = 230/351 (66%), Gaps = 5/351 (1%)
 Frame = +3

Query  204   DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNP  383
             + DI+  L  AW EAC + + S +V+P G ++++Q  L+GPCKAPIE+K+   ++AP NP
Sbjct  37    NGDITNALKNAWKEACESRSRSKVVVPSGRYKLQQIDLEGPCKAPIEVKVNGIIQAPKNP  96

Query  384   NDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSD--KLPNNLSLNFLK  557
               +  + +W+   Y++ FTLSG GT DGQG++    ++ D G  ++  +L  N    FL 
Sbjct  97    FHLNGQDQWIRFQYINFFTLSGKGTFDGQGEMA--WKQNDCGRNTNCKRLAMNFGFAFLN  154

Query  558   NSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIG  737
             NS+I+DI S +SK FH NVFG  N+TF    I AP  S NTDGIHI K   V I +S IG
Sbjct  155   NSVIKDINSKDSKYFHANVFGCNNVTFTNFNINAPESSPNTDGIHIGKSSRVKISNSKIG  214

Query  738   TGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLR  917
             +GDDCIS+GDG   + I  VTCGPGHGISVGSLGK P E+PV  + VK+     TDNG+R
Sbjct  215   SGDDCISLGDGSTQITIQNVTCGPGHGISVGSLGKYPNEDPVVDLIVKNCTLNNTDNGVR  274

Query  918   IKTWP-NSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNI  1094
             IKTWP  S   + + +H+  I M +V NPI+IDQ+YCP NQCSK+ PS +KI  V + NI
Sbjct  275   IKTWPGTSVISIASHLHFEDIVMVNVSNPIIIDQQYCPWNQCSKQSPSKIKIRKVIFKNI  334

Query  1095  KGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGGAAKTVCSNAKPKLTGK  1247
             +GTSAT+E V + CS GVPCE V   DINL+F G      C+N  PK+  K
Sbjct  335   RGTSATQEGVSLICSRGVPCEAVVLSDINLSFNGSEVTAKCANVNPKIRRK  385



>ref|XP_008460220.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=393

 Score =   352 bits (902),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 190/370 (51%), Positives = 249/370 (67%), Gaps = 18/370 (5%)
 Frame = +3

Query  183   FKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKI  353
             F VT  G   ++DI+  LL AW  ACA+T+ S ++IPKG + + Q+ LKGPCK+ IE+++
Sbjct  30    FDVTRYGAKPNTDITHALLNAWKGACASTSRSKVLIPKGVYLLSQSNLKGPCKSSIEIQV  89

Query  354   KATLKAPPNPNDMECKKEWLTI-NYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSD---  521
               TL+APP+P     K + L I  Y+D  TLSG G  DGQG V   G +K+   K     
Sbjct  90    DGTLQAPPDP-----KGDGLVILEYIDKLTLSGTGVFDGQGKV---GWEKNDCHKKKICT  141

Query  522   KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAK  701
             KLP  L  NF+ NSI+RDITSL+SK FH+N+ G KNLTFQ +TI AP DS NTDGIHI+ 
Sbjct  142   KLPMTLKFNFVTNSIVRDITSLDSKNFHINILGCKNLTFQHVTISAPEDSPNTDGIHISS  201

Query  702   ICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVK  881
                +TI ++ I TGDDC+S+GD  + + I  VTCGPGHGIS+GSLGK   E+ V+GV V 
Sbjct  202   SEQITILNTKISTGDDCVSVGDSNKQITIRDVTCGPGHGISIGSLGKYSKEKAVEGVWVT  261

Query  882   DSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPS  1058
               K   T NG+RIKTWP+S      +D+H+  IEM +V NPI+IDQEYCP NQC+ + PS
Sbjct  262   KCKLTSTTNGVRIKTWPDSAGEYSASDMHFEDIEMNNVSNPIIIDQEYCPWNQCNPKIPS  321

Query  1059  LVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKP  1232
              +KIS VS+ NI+GTSAT  AV + CS  +PCE V+  DI+L + G  G  K+ C+N KP
Sbjct  322   SIKISKVSFKNIRGTSATPVAVKLVCSKKIPCEAVEVVDIDLKYNGNKGPIKSQCANVKP  381

Query  1233  KLTGKQTPPV  1262
              ++GKQ P +
Sbjct  382   IISGKQNPRI  391



>ref|XP_010248093.1| PREDICTED: exopolygalacturonase-like, partial [Nelumbo nucifera]
Length=370

 Score =   350 bits (899),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 180/368 (49%), Positives = 240/368 (65%), Gaps = 6/368 (2%)
 Frame = +3

Query  171   ESAEFKVTAEGD---SDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCK-AP  338
             ++  F +TA G     DI+  ++ AW  ACAAT  + ++IPKGT+ M    L GPCK A 
Sbjct  5     QNGVFDITAYGGKDGGDITQAVMDAWKAACAATGAATVLIPKGTYTMNLVNLAGPCKQAQ  64

Query  339   IELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKS  518
             +  +++  ++AP +P  M+  + WL  ++VDD T+ G GTLDGQG       +     K 
Sbjct  65    MNFQLEGIVQAPADPAAMD-SESWLLFDHVDDLTVFGGGTLDGQGQKAWESNECSKNSKC  123

Query  519   DKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIA  698
              ++P NL LNF+ N ++ DITSLNSK+ H+ +    NLT Q +TI AP+ S NTDGIHI 
Sbjct  124   PQMPANLRLNFVNNGVVHDITSLNSKMIHIMILSANNLTIQHVTITAPSTSINTDGIHIG  183

Query  699   KICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTV  878
             +   V I D+ IGTGDDC+S+ DG +++ +  VTCGPGHG+S+GSLGK   E PV GV +
Sbjct  184   RSTGVKILDTTIGTGDDCVSVSDGNKDITVSKVTCGPGHGLSIGSLGKYDNEGPVVGVHI  243

Query  879   KDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPS  1058
              D     TDNG+RIK+WP+S PG  +DI +  I M DV NP++IDQ YCP   CS + PS
Sbjct  244   SDCTLTKTDNGVRIKSWPDSKPGSASDISFENIVMNDVGNPVIIDQAYCPYGGCS-QAPS  302

Query  1059  LVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGGAAKTVCSNAKPKL  1238
              VK+SN+    IKGTS+T+EAV I CS  +PCE+V+ GDINL F GGAA   C+N KP L
Sbjct  303   RVKLSNIKIAGIKGTSSTQEAVKIFCSPALPCENVEIGDINLAFSGGAATCTCANTKPTL  362

Query  1239  TGKQTPPV  1262
             TG Q PPV
Sbjct  363   TGTQVPPV  370



>ref|XP_003518573.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=391

 Score =   351 bits (900),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 184/382 (48%), Positives = 246/382 (64%), Gaps = 10/382 (3%)
 Frame = +3

Query  144   VLFLLADLGESAEF------KVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMK  305
             VL+L+  +  +A+       K     D+DI+     AW  ACA+T+ S I+IP GT++MK
Sbjct  11    VLYLVLTISGTAQSVGIDIKKFGGIPDADITQAFTDAWKVACASTSASKILIPNGTYKMK  70

Query  306   QALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQI  485
                +KGPC APIE++I  T++AP +PN ++  K+W+ I Y +  TLSG G  DGQG +  
Sbjct  71    AVDVKGPCMAPIEIQIDGTIQAPADPNALDGAKQWVKIGYANFITLSGKGIFDGQGAIA-  129

Query  486   YGQKKDTGFKSDKLPN-NLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAP  662
             + Q       + K+P+ N   NF+ +S++R ITS +SK FHV +FG  N TF    I AP
Sbjct  130   WKQNDCRTNTNCKIPSMNFGFNFVNHSMVRGITSKDSKSFHVILFGCYNFTFDGFHISAP  189

Query  663   ADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGK  842
               S NTDGIHI K  DV I ++ I TGDDC+S+GDG  ++ +  V CGPGHGISVGSLGK
Sbjct  190   ETSINTDGIHIGKSTDVKILNTNIATGDDCVSLGDGSIHVTVQNVNCGPGHGISVGSLGK  249

Query  843   TPGEEPVKGVTVKDSKFIGTDNGLRIKTWPN-SHPGVVTDIHYHKIEMEDVKNPIVIDQE  1019
                EEPVK + VK+     T+NG+RIKTWPN S   +VTD+H+  I M DV NP++IDQE
Sbjct  250   YTNEEPVKDLLVKNCTLTNTENGVRIKTWPNSSQTYLVTDMHFEDITMVDVLNPVIIDQE  309

Query  1020  YCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGG  1199
             YCP N C K+ PS +KI  VS+++IKGTS ++E VI  CS  VPCEDV+  ++ LTFKG 
Sbjct  310   YCPWNHCPKQSPSKIKIRKVSFSDIKGTSKSKEGVIFICSKAVPCEDVELNNVALTFKGD  369

Query  1200  AAKTVCSNAKPKLTGKQTPPVT  1265
                  C+N +PK  GK  PP T
Sbjct  370   PIVAKCANVRPKFAGK-APPCT  390



>gb|KHN43962.1| Polygalacturonase [Glycine soja]
Length=389

 Score =   351 bits (900),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 184/382 (48%), Positives = 246/382 (64%), Gaps = 10/382 (3%)
 Frame = +3

Query  144   VLFLLADLGESAEF------KVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMK  305
             VL+L+  +  +A+       K     D+DI+     AW  ACA+T+ S I+IP GT++MK
Sbjct  9     VLYLVLTISGTAQSVGIDIKKFGGIPDADITQAFTDAWKVACASTSASKILIPNGTYKMK  68

Query  306   QALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQI  485
                +KGPC APIE++I  T++AP +PN ++  K+W+ I Y +  TLSG G  DGQG +  
Sbjct  69    AVDVKGPCMAPIEIQIDGTIQAPADPNALDGAKQWVKIGYANFITLSGKGIFDGQGAIA-  127

Query  486   YGQKKDTGFKSDKLPN-NLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAP  662
             + Q       + K+P+ N   NF+ +S++R ITS +SK FHV +FG  N TF    I AP
Sbjct  128   WKQNDCRTNTNCKIPSMNFGFNFVNHSMVRGITSKDSKSFHVILFGCYNFTFDGFHISAP  187

Query  663   ADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGK  842
               S NTDGIHI K  DV I ++ I TGDDC+S+GDG  ++ +  V CGPGHGISVGSLGK
Sbjct  188   ETSINTDGIHIGKSTDVKILNTNIATGDDCVSLGDGSIHVTVQNVNCGPGHGISVGSLGK  247

Query  843   TPGEEPVKGVTVKDSKFIGTDNGLRIKTWPN-SHPGVVTDIHYHKIEMEDVKNPIVIDQE  1019
                EEPVK + VK+     T+NG+RIKTWPN S   +VTD+H+  I M DV NP++IDQE
Sbjct  248   YTNEEPVKDLLVKNCTLTNTENGVRIKTWPNSSQTYLVTDMHFEDITMVDVLNPVIIDQE  307

Query  1020  YCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGG  1199
             YCP N C K+ PS +KI  VS+++IKGTS ++E VI  CS  VPCEDV+  ++ LTFKG 
Sbjct  308   YCPWNHCPKQSPSKIKIRKVSFSDIKGTSKSKEGVIFICSKAVPCEDVELNNVALTFKGD  367

Query  1200  AAKTVCSNAKPKLTGKQTPPVT  1265
                  C+N +PK  GK  PP T
Sbjct  368   PIVAKCANVRPKFAGK-APPCT  388



>ref|XP_009334234.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=406

 Score =   351 bits (901),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 182/379 (48%), Positives = 247/379 (65%), Gaps = 12/379 (3%)
 Frame = +3

Query  141   FVLFLLADL---GESAEFKVT-----AEGDSDISPELLKAWDEACAATTPSIIVIPKGTF  296
             FV  LLA      ES+ F VT     A+  SDI+  L KAW+++CA+ + S +V+P GT+
Sbjct  11    FVFLLLASATKAHESSVFDVTSAEYGAKPGSDITFALAKAWNDSCASPSASKVVVPSGTY  70

Query  297   QMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGD  476
             ++  A  +GPCKAPIEL+++ TL+AP   +D+  +  W+   +VD  T+SG GT DGQG 
Sbjct  71    KLSGASFRGPCKAPIELQVQGTLQAPEKDSDLTMEGTWVGFQHVDMITVSGGGTFDGQGA  130

Query  477   VQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIK  656
               ++ Q   +  K      NL  +F+ NSII+D+TSLNSK FHV+V+G  N+TFQ + I 
Sbjct  131   F-VWSQNNSSKSKHCSGSVNLRFDFVTNSIIQDVTSLNSKNFHVHVYGCNNVTFQHVHIT  189

Query  657   APADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSL  836
             AP DS NTDGIHI K   + I  + IGTGDDC+SIGDG   + +  V+CGPGHGIS+GSL
Sbjct  190   APGDSKNTDGIHIGKSTGINITHTFIGTGDDCVSIGDGNNQIAVTNVSCGPGHGISIGSL  249

Query  837   GKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIVID  1013
             G+   EE + G+ VK+     T NG+RIKTWPNS      +DIH+  I M +V NPIVID
Sbjct  250   GRYDNEESLAGIIVKNCTLTNTQNGVRIKTWPNSPVATAASDIHFEDIIMVNVSNPIVID  309

Query  1014  QEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFK  1193
             Q YCP  +C    PS VKIS+VS+ NI+G+SAT  ++ I CSSG PCE+++  DI+LT+ 
Sbjct  310   QLYCPYKKCDNLPPSKVKISDVSFKNIQGSSATALSLKIVCSSGSPCENMELADIDLTYS  369

Query  1194  G--GAAKTVCSNAKPKLTG  1244
             G  G   + C N KP ++G
Sbjct  370   GAKGTLTSQCLNVKPTISG  388



>gb|ABN13878.1| polygalacturonase [Brassica rapa subsp. oleifera]
Length=395

 Score =   350 bits (899),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/382 (45%), Positives = 255/382 (67%), Gaps = 6/382 (2%)
 Frame = +3

Query  123   FYCAFTFVLFLLADLGESAEF-KVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             ++ AFT  +F L     +A +  + +   SDI+  LLKA+  AC + TPS +VIPKG F+
Sbjct  4     YFGAFTVFIFCLLGFSANAVYITIGSSPGSDITQALLKAFTTACQSPTPSRVVIPKGEFK  63

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
             + +  ++GPCKAP+E+ I+ T+KA  + N ++ K  W+    ++ F L+G G  DG+G+ 
Sbjct  64    LGEIQMRGPCKAPVEITIQGTVKA--DGNAIQGKDTWIVFGNINGFKLNGGGAFDGEGNA  121

Query  480   QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKA  659
                       F   KLP ++  +F++N+ I+DI+S+++K FH+NV G KN+T   I I A
Sbjct  122   AWRVNNCHQTFNCKKLPISIRFDFVENAEIKDISSIDAKNFHINVLGAKNMTMDHINIIA  181

Query  660   PADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLG  839
             P DS NTDGIH+ +   V I ++ I TGDDCIS+GDG++NL+++ VTCGPGHGISVGSLG
Sbjct  182   PKDSPNTDGIHLGRSDGVKILNTFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLG  241

Query  840   KTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQ  1016
             +   E+ V G+ V +     TDNGLRIKTWP++      +DIH+  I +++V NPI+IDQ
Sbjct  242   RYGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIILKNVMNPILIDQ  301

Query  1017  EYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG  1196
             EYCP NQC+K+KPS +K++N+S+  I+GTS  ++AV + CS G PC++V+ GDI++ + G
Sbjct  302   EYCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSG  361

Query  1197  --GAAKTVCSNAKPKLTGKQTP  1256
               G A   CSN  PKL G Q+P
Sbjct  362   ADGPATFQCSNVSPKLMGTQSP  383



>emb|CAA72003.1| polygalacturonase [Medicago sativa]
Length=395

 Score =   350 bits (899),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 178/374 (48%), Positives = 239/374 (64%), Gaps = 10/374 (3%)
 Frame = +3

Query  144   VLFLLADLGESAEFKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQAL  314
             +LF    + +   F + + G    +DI+     AW  AC +TT S ++IP+G ++M    
Sbjct  14    LLFATLGIAQPNIFDIKSFGGASHADITMAFTNAWKAACGSTTASKVMIPRGVYKMHAVD  73

Query  315   LKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQ  494
             +KGPCKAPIE+++  T++AP NP+++    +W+   YVD FTLSG G  DG G+     +
Sbjct  74    VKGPCKAPIEVQVDGTIQAPQNPDELNDAYQWIKFGYVDYFTLSGKGVFDGNGETA--WR  131

Query  495   KKDTGFKS--DKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPAD  668
             + D G  S   +   N   NFLK+SI+RDITS +SK FHVNV G  N TF  +TI AP  
Sbjct  132   QNDCGKNSTCKRRSMNFGFNFLKHSIVRDITSKDSKNFHVNVLGCTNFTFDSVTITAPVT  191

Query  669   SHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTP  848
             S NTDGIHI +  DV + ++ I TGDDC+S+GDG   + +  V CGPGHGISVGSLGK P
Sbjct  192   SINTDGIHIGRSTDVKVLNTNIATGDDCVSLGDGSRQITVQNVNCGPGHGISVGSLGKYP  251

Query  849   GEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV--VTDIHYHKIEMEDVKNPIVIDQEY  1022
              EE V+ V VK+     TDNG+RIKTWP+S PG   +TD+H+  I M +V NP++IDQEY
Sbjct  252   KEEAVEHVLVKNCTITNTDNGVRIKTWPSS-PGTSPITDMHFEDIIMVNVLNPVIIDQEY  310

Query  1023  CPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGGA  1202
             CP NQCSK  PS +KIS V + NI+GTS T++ V++ CS   PC+ V+  ++ LTF G  
Sbjct  311   CPWNQCSKLVPSKIKISKVIFKNIRGTSKTKDGVVLICSKSFPCDAVELNNVALTFNGAP  370

Query  1203  AKTVCSNAKPKLTG  1244
                 C N KP LTG
Sbjct  371   VNAKCVNVKPILTG  384



>ref|XP_006299274.1| hypothetical protein CARUB_v10015428mg [Capsella rubella]
 gb|EOA32172.1| hypothetical protein CARUB_v10015428mg [Capsella rubella]
Length=396

 Score =   350 bits (898),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 252/385 (65%), Gaps = 5/385 (1%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M   F  +  F++ L      +  F + +   SDI+  LLKA+  AC + +PS +VIPKG
Sbjct  1     MGAYFGVSIIFIICLSGFSANAEVFTIRSSSGSDITQALLKAFTSACQSPSPSKVVIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              F++++  ++GPCKAPIE+ I+ T+KA  + N ++ K +W+    ++ F L+G G  DG+
Sbjct  61    EFKLREIEMRGPCKAPIEITIQGTVKA--DGNAIQGKDKWVVFGNINGFKLNGGGAFDGE  118

Query  471   GDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
             G+           F+  KLP ++  +F+ NS IRDI+S++SK FH+NV G KN+T   I 
Sbjct  119   GNASWRVNNCHKTFQCKKLPISIRFDFVLNSEIRDISSIDSKNFHINVLGAKNMTMDNIK  178

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             I AP +S NTDGIH+ +   V I +S I TGDDCIS+GDG++NL+++ VTCGPGHGISVG
Sbjct  179   IIAPEESPNTDGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVG  238

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVT-DIHYHKIEMEDVKNPIV  1007
             SLG+   E+ V G+ + +     TDNGLRIKTWP++       DIH+  I +++V NPI+
Sbjct  239   SLGRYGHEQDVSGIRIINCTLQQTDNGLRIKTWPSAACSTTAFDIHFEDIIVKNVSNPIL  298

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQEYCP NQC+K+KPS +K+ N S+ NI+GTS  ++AV + CS G PC++V+ GD+++ 
Sbjct  299   IDQEYCPWNQCNKQKPSTIKLVNTSFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGDVDIK  358

Query  1188  FKG--GAAKTVCSNAKPKLTGKQTP  1256
             + G  G A   CSN  PKL G Q P
Sbjct  359   YNGADGPATFQCSNVSPKLLGTQNP  383



>sp|Q39786.1|PGLR_GOSHI RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium hirsutum]
 gb|AAA82167.1| polygalacturonase [Gossypium hirsutum]
Length=407

 Score =   350 bits (899),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 176/379 (46%), Positives = 246/379 (65%), Gaps = 8/379 (2%)
 Frame = +3

Query  141   FVLFLLADLGES------AEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQM  302
              +LF+ A   +S      A+F   A+G +D+S   L AW EACA+ TPS +VIPKGT+ +
Sbjct  15    LLLFISASKVQSDAFDVVAKFGAKADGKTDLSKPFLDAWKEACASVTPSTVVIPKGTYLL  74

Query  303   KQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQ  482
              +  L+GPCKAPIE+ ++ T++AP +P+  +    W+    V++F + G G  DGQG + 
Sbjct  75    SKVNLEGPCKAPIEINVQGTIQAPADPSAFK-DPNWVRFYSVENFKMFGGGIFDGQGSIA  133

Query  483   IYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAP  662
                   +      KLP N+  +FL N++I+DITS +SKLFH+NVF  KN+T +++ I+AP
Sbjct  134   YEKNTCENREFRSKLPVNIRFDFLTNALIQDITSKDSKLFHINVFACKNITLERLKIEAP  193

Query  663   ADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGK  842
              +S NTDGIH+ K   V I  S I TGDDCISIGDG +N+ I  +TCGPGHGIS+GSLGK
Sbjct  194   DESPNTDGIHMGKSEGVNIIASDIKTGDDCISIGDGTKNMVIKEITCGPGHGISIGSLGK  253

Query  843   TPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEY  1022
                EEPV+G+ + +     T NG RIKTWP  H G V++IH+  I M +V +PI+IDQ+Y
Sbjct  254   FQNEEPVEGIKISNCTITNTSNGARIKTWPGEHGGAVSEIHFEDITMNNVSSPILIDQQY  313

Query  1023  CPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGGA  1202
             CP N+C K + S VK+SN+S+ NI+GTSA  EA+   CS   PC++V+  DI++   G  
Sbjct  314   CPWNKCKKNEESKVKLSNISFKNIRGTSALPEAIKFICSGSSPCQNVELADIDIKHNGAE  373

Query  1203  -AKTVCSNAKPKLTGKQTP  1256
              A + C N KP  +GK  P
Sbjct  374   PATSQCLNVKPITSGKLNP  392



>ref|XP_010486355.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   350 bits (898),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 254/385 (66%), Gaps = 5/385 (1%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M   F  +  F++ LL     +  F + +   SDI+  LLKA+  AC + +PS +VIPKG
Sbjct  1     MGAYFGVSTIFIICLLRISANAEVFTIGSSSGSDITQALLKAFTAACQSPSPSKVVIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              F++ +  ++GPCKAPIE+ I+ T+KA  N N ++ K +W+    ++ F L+G G  DG+
Sbjct  61    EFKLGEIEMRGPCKAPIEVTIQGTVKA--NGNAIQGKDKWVVFGNINGFKLNGGGAFDGE  118

Query  471   GDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
             G+           F+  KLP ++  +F+ NS I+DI+S+++K FH+NV G KN+T   I 
Sbjct  119   GNASWRVNNCHKTFQCKKLPISIRFDFVLNSEIKDISSIDAKNFHINVLGAKNMTMNNIK  178

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             I AP DS NTDGIH+ +   V I +S I TGDDCIS+GDG++NL+++ VTCGPGHGISVG
Sbjct  179   IIAPEDSPNTDGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVG  238

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIV  1007
             SLG+   E+ V G+ + +     TDNGLRIKTWP++      +DIH+  I +++V NPI+
Sbjct  239   SLGRYGHEQDVSGIRIINCTLQQTDNGLRIKTWPSAACSTTASDIHFQDIIVKNVSNPIL  298

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQEYCP NQC+K+KPS +K+ N+S+ NI+GTS  ++AV + CS G PC++V+ G++++ 
Sbjct  299   IDQEYCPWNQCNKQKPSTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGNVDIK  358

Query  1188  FKG--GAAKTVCSNAKPKLTGKQTP  1256
             + G  G A   CSN  PKL G Q P
Sbjct  359   YTGADGPATFQCSNVSPKLLGTQNP  383



>ref|XP_004154764.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=406

 Score =   350 bits (899),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 188/403 (47%), Positives = 253/403 (63%), Gaps = 26/403 (6%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAE--------FKVTAEGD----SDISPELLKAWDEACA  254
             M  I Y       FL++ L  + E        F +   G+     D++  L  AW++ACA
Sbjct  1     MGMIKYSNLLITTFLMSLLSFTIESQSHVDVIFPLRKYGNIVSGDDVTEALKDAWNDACA  60

Query  255   ATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDD  434
             +  PS +VIP G F++++   KGPCK+PIE++++ TL+AP +P+       W+T  YVD 
Sbjct  61    SVRPSAVVIPDGIFKLREGEFKGPCKSPIEIRVRGTLQAPKHPHG----DSWITFAYVDR  116

Query  435   FTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNN----LSLNFLKNSIIRDITSLNSKLF  602
              T+SG G  DGQG     G +K+   K     N     L  +F+ NSI+R ITSL+SK F
Sbjct  117   MTISGKGVFDGQGKA---GWEKNDCHKRIDCVNLPIVILRFDFITNSIVRGITSLDSKNF  173

Query  603   HVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENL  782
             HVN+ G  NLTFQ + I AP DS NTDGIHI +   ++I  S I TGDDCIS+GDG + +
Sbjct  174   HVNILGCNNLTFQGVNIIAPEDSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRV  233

Query  783   NIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTD  959
              I  VTCGPGHGIS+GSLGK   EEPV  V VK+   + T NG+RIKTWP+S   G+ T+
Sbjct  234   KITNVTCGPGHGISIGSLGKYTNEEPVDDVVVKNCTIMNTTNGVRIKTWPSSPVAGIATN  293

Query  960   IHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACS  1139
             +H+  I M +V NPI+IDQEYCP NQC++E PS +KI+NVS+ NIKG+SAT  AV + CS
Sbjct  294   MHFSDITMINVSNPILIDQEYCPWNQCNREIPSNIKINNVSFKNIKGSSATPVAVKLICS  353

Query  1140  SGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             S  PCE+VK  +I+L + G  G   + C N KP ++G Q P +
Sbjct  354   SNQPCEEVKVANIDLVYNGINGPVTSQCMNVKPIISGIQNPSI  396



>ref|XP_010458152.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   349 bits (896),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 254/385 (66%), Gaps = 5/385 (1%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M   F  +  F++ LL     +  F + +   SDI+  LLKA+  AC + +PS +VIPKG
Sbjct  1     MGAYFGVSTVFIICLLGISANAEVFTIGSSSGSDITQALLKAFTAACQSPSPSKVVIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              F++ +  +KGPCKAPIE+ I+ T+KA  + N ++ K +W+    ++ F L+G G  DG+
Sbjct  61    EFKLGEIEMKGPCKAPIEVTIQGTVKA--DGNAIQGKDKWVVFGNINGFKLNGGGAFDGE  118

Query  471   GDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
             G+           F+  KLP ++  +F+ NS I+DI+S+++K FH+NV G KN+T   I 
Sbjct  119   GNASWRVNNCHKTFQCKKLPISIRFDFVLNSEIKDISSIDAKNFHINVLGAKNMTMNNIK  178

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             I AP DS NTDGIH+ +   V I +S I TGDDCIS+GDG++NL+++ VTCGPGHGISVG
Sbjct  179   IIAPEDSPNTDGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVG  238

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIV  1007
             SLG+   E+ V G+ + +     TDNGLRIKTWP++      +DIH+  I +++V NPI+
Sbjct  239   SLGRYGHEQDVSGIRIINCTLQQTDNGLRIKTWPSAACSTTASDIHFQDIIVKNVSNPIL  298

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQEYCP NQC+K+KPS +K+ N+S+ NI+GTS  ++AV + CS G PC++V+ G++++ 
Sbjct  299   IDQEYCPWNQCNKQKPSTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGNVDIK  358

Query  1188  FKG--GAAKTVCSNAKPKLTGKQTP  1256
             + G  G A   CSN  PKL G Q P
Sbjct  359   YTGADGPATFQCSNVSPKLLGTQNP  383



>ref|XP_008222765.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   350 bits (897),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 176/355 (50%), Positives = 239/355 (67%), Gaps = 5/355 (1%)
 Frame = +3

Query  192   TAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKA  371
             +A+  SD++  L KAW +ACA+ + S +V+P GT+++K+A  +GPCKAPIE++++ TL+A
Sbjct  35    SAKPGSDVTKALAKAWSDACASPSASKVVVPSGTYKLKEATFRGPCKAPIEMQVRGTLQA  94

Query  372   PPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDK-LPNNLSLN  548
             P N         W+   Y+D FTLSG GT DGQG + ++GQ      K+ K +P NL   
Sbjct  95    PANAGQFTRPDTWVGFQYIDKFTLSGGGTFDGQGAL-VWGQNDCHKNKNCKPIPINLRFE  153

Query  549   FLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDS  728
             F+ NS ++DITSLNSK FH++VF  K+ TFQ +TI AP +S NTDGIHI     + I  +
Sbjct  154   FITNSRVQDITSLNSKNFHMHVFRCKHTTFQHLTITAPEESRNTDGIHIGASTGINITHA  213

Query  729   VIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDN  908
              I TGDDC+SIGD    + +  VTCGPGHGIS+GSLG+   E+ V G+ VK+     T N
Sbjct  214   KIRTGDDCVSIGDDSHQITVTDVTCGPGHGISIGSLGRYKEEKAVTGIIVKNCTLTNTQN  273

Query  909   GLRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSY  1085
             G+RIKTWP+S      +DIHY  I M +V NPI+IDQ YCP  +C ++ PS VKI+NVS+
Sbjct  274   GVRIKTWPDSPSSSTASDIHYENIIMVNVSNPILIDQLYCPYTRCDQKPPSKVKINNVSF  333

Query  1086  TNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTG  1244
              NIKG+S T  AV + CS G+PCE+VK  DI+LT+ G  G   ++CSN KP +TG
Sbjct  334   KNIKGSSFTPLAVKLVCSRGLPCENVKLTDIDLTYGGDQGPLTSLCSNVKPTITG  388



>ref|XP_002884669.1| hypothetical protein ARALYDRAFT_478121 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60928.1| hypothetical protein ARALYDRAFT_478121 [Arabidopsis lyrata subsp. 
lyrata]
Length=397

 Score =   349 bits (896),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 176/394 (45%), Positives = 257/394 (65%), Gaps = 12/394 (3%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M + F  +  FV+ LL     +  F++ +   SDI+  LL+A+  AC A TPS +VIPKG
Sbjct  1     MGSYFGISTIFVICLLGFSANAEVFRIGSPPGSDITQALLRAFTSACQAPTPSKVVIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              F++ + ++ GPCK+P+E+ +  T+ A  + N +  K++W+    +D F L+G GT DG+
Sbjct  61    QFRLGEIMMSGPCKSPVEITLLGTVLA--DGNSIHGKEKWVVFQRMDGFRLNGGGTFDGE  118

Query  471   GDVQIYGQKKDTGFKSDKLP-NNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKI  647
             G+           F+  KLP  ++  +F+ N+ IRDI+S+++K FH+NV G KN+TF  +
Sbjct  119   GNAAWRVNNCHKTFECKKLPIVSIRFDFVTNAEIRDISSIDAKNFHINVIGAKNMTFNNV  178

Query  648   TIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISV  827
              I APA+S NTDGIH+ +   V+I +S I TGDDC+S+GDG+ NL +  V CGPGHGISV
Sbjct  179   KIMAPAESPNTDGIHLGRSVGVSIINSRIATGDDCVSVGDGMVNLLVKNVVCGPGHGISV  238

Query  828   GSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPI  1004
             GSLG+   E+ V G+ V +     TDNGLRIKTWP++      ++IH+  I + +V NPI
Sbjct  239   GSLGRYGHEQDVSGIRVINCTLQETDNGLRIKTWPSAACSTTASNIHFENIILRNVSNPI  298

Query  1005  VIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINL  1184
             +IDQEYCP NQC+K+K S +K++N+S+  I+GTS  ++AV + CS G PCE+V+ GDIN+
Sbjct  299   LIDQEYCPWNQCNKQKSSSIKLANISFKRIRGTSGNKDAVKLLCSKGYPCENVQVGDINI  358

Query  1185  TFKG--GAAKTVCSNAKPKLTGKQ------TPPV  1262
              + G  G A  +CSN +PKL G Q      TPPV
Sbjct  359   QYTGADGPATFMCSNVRPKLVGTQFPKACNTPPV  392



>ref|XP_002865611.1| hypothetical protein ARALYDRAFT_494865 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41870.1| hypothetical protein ARALYDRAFT_494865 [Arabidopsis lyrata subsp. 
lyrata]
Length=395

 Score =   349 bits (895),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 174/386 (45%), Positives = 254/386 (66%), Gaps = 7/386 (2%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAE-FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPK  287
             M  + +    F +F L  L  +A+ F + +   SDI+  LLKA++EAC   T S ++IPK
Sbjct  1     MGRVHFGVSAFFVFCLLGLSANAKVFNIGSPPGSDITNALLKAFNEACQFPTKSTVLIPK  60

Query  288   GTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDG  467
             G +++ + ++ GPCKAPI + ++ T+KA  N N    K++W+    +D F L+G G  DG
Sbjct  61    GEYKLGEIVMMGPCKAPIRIALQGTVKADGNANG---KEKWVAFRNIDGFKLNGGGVFDG  117

Query  468   QGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKI  647
             +G+           F   KLP ++  +F+ N+ IR ITSL++K FH+NV G KN+TF+ +
Sbjct  118   EGNAAWRVNNCHKTFNCKKLPISIRFDFVTNAKIRGITSLDAKNFHINVIGAKNMTFEDV  177

Query  648   TIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISV  827
              I APA+S NTDGIH+ +   + I +S I TGDDC+S+GDG++NL ++ VTCGPGHGIS+
Sbjct  178   KIIAPAESPNTDGIHVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISI  237

Query  828   GSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPI  1004
             GSLG+   EE V G+ + +     TDNGLRIKTWP++      +DIH+  I +++V NPI
Sbjct  238   GSLGRYSHEENVSGIKIINCTLQETDNGLRIKTWPSAACTTTASDIHFENILLKNVSNPI  297

Query  1005  VIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINL  1184
             +IDQEYCP NQC+K+KPS +K++N+S+  I+GTS  ++AV + CS G PC++V+ GDIN+
Sbjct  298   LIDQEYCPWNQCNKQKPSTIKLANISFKKIRGTSGNKDAVKLLCSKGHPCQNVEVGDINI  357

Query  1185  TFKG--GAAKTVCSNAKPKLTGKQTP  1256
              + G  G A   CSN  PKL G Q P
Sbjct  358   KYTGADGPATFQCSNVSPKLVGTQIP  383



>gb|ABL63521.1| pollen-specific protein MF9l [Brassica oleracea var. alboglabra]
Length=395

 Score =   348 bits (894),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 173/382 (45%), Positives = 252/382 (66%), Gaps = 6/382 (2%)
 Frame = +3

Query  123   FYCAFTFVLFLLADLGESAEFKVTAEGDS-DISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             ++ AFT  +F L     +A +         DI+  LLKA+  AC + TPS +VIPKG F+
Sbjct  4     YFGAFTVFIFCLLGFSANAVYISIGSSSGSDITQALLKAFTTACQSPTPSRVVIPKGEFK  63

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
             + +  ++GPCKAP+E+ I+ T+KA  + N ++ K  W+    ++ F L+G G  DG+G+ 
Sbjct  64    LGEIQMRGPCKAPVEITIQGTVKA--DGNAIQGKDTWIVFGNINGFKLNGGGAFDGEGNA  121

Query  480   QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKA  659
                       F   KLP ++  +F++N+ IRDI+S+++K FH+NV G KN+T   I I A
Sbjct  122   AWRVNNCHQTFNCKKLPISIRFDFVENAEIRDISSIDAKNFHINVLGAKNMTMDHINIIA  181

Query  660   PADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLG  839
             P DS NTDGIH+ +   V I ++ I TGDDCIS+GDG++NL+++ VTCGPGHGISVGSLG
Sbjct  182   PKDSPNTDGIHLGRSDGVKILNTFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLG  241

Query  840   KTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQ  1016
             +   E+ V G+ V +     TDNGLRIKTWP++      +DIH+  I +++V NPI+IDQ
Sbjct  242   RYGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIIVKNVMNPILIDQ  301

Query  1017  EYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG  1196
             EYCP NQC+K+KPS +K++N+S+  I+GTS  ++AV + CS G PC++V+ GDI++ + G
Sbjct  302   EYCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYNG  361

Query  1197  --GAAKTVCSNAKPKLTGKQTP  1256
               G A   CSN  PKL G Q+P
Sbjct  362   ADGPATFQCSNVSPKLMGTQSP  383



>gb|ABR26683.1| polygalacturonase [Fragaria chiloensis]
Length=405

 Score =   348 bits (894),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 178/391 (46%), Positives = 252/391 (64%), Gaps = 8/391 (2%)
 Frame = +3

Query  117   TIFYCAFTFVLFLLADLGESAEFKVTA-----EGDSDISPELLKAWDEACAATTPSIIVI  281
             ++F  + +     +A    S +F VT+     + ++DIS  L  AW +ACAATTPS +++
Sbjct  12    SVFLLSSSAYASRVAQFLASGDFDVTSPKYGGKPNTDISQPLANAWKDACAATTPSRVIV  71

Query  282   PKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTL  461
             PKGTFQ+K A+ KGPCKAPI +++   L+APP    +  K+ W+    V+  T+SG GT 
Sbjct  72    PKGTFQLKGAVFKGPCKAPITVQVDGILQAPPIEAQLANKEFWVQFLEVERLTVSGTGTF  131

Query  462   DGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQ  641
             DGQG         +       L  N+  + +KNS++RD+TSLNSK FH N+ G ++LTFQ
Sbjct  132   DGQGQNSWKDNDCNKNPNCGGLAINVRFDKVKNSLVRDVTSLNSKNFHFNILGCEHLTFQ  191

Query  642   KITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGI  821
              +T+KAP DS NTDGIH+ +  ++ I D+ IGTGDDCIS+GDG   L +  V+CGPGHGI
Sbjct  192   HVTVKAPGDSSNTDGIHMGRSTEINITDTNIGTGDDCISVGDGTRQLTVSKVSCGPGHGI  251

Query  822   SVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKN  998
             S+GSLG+   E+ V G+ ++D     T NG+RIKT+P S      +DIH+ KI M +V N
Sbjct  252   SIGSLGRYDNEDDVSGLNIRDCTLSNTLNGVRIKTFPASPKATPASDIHFEKITMNNVAN  311

Query  999   PIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDI  1178
             P++IDQEYCP  QC+K+ PS VKISNVS+ NI GT++T EA+ I C+ G+ C+ V   DI
Sbjct  312   PVLIDQEYCPWGQCNKQIPSKVKISNVSFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDI  371

Query  1179  NLTFKG-GAAKTVCSNAKPKLTGKQTPPVTC  1268
             +L   G G   + C+N +P +T +  PP+ C
Sbjct  372   DLKLSGKGTLTSHCANVQPTIT-RVPPPLAC  401



>ref|NP_187440.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21193.1|AC013483_17 putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE74609.1| polygalacturonase-like protein [Arabidopsis thaliana]
Length=397

 Score =   348 bits (893),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/394 (44%), Positives = 257/394 (65%), Gaps = 12/394 (3%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAE-FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPK  287
             M + F  +  FV+ LL     + E  ++T+   SDI+  LL+A+  AC + TP  +VIPK
Sbjct  1     MGSYFGISTIFVICLLGFSANAHEVLRLTSSPGSDITQALLRAFTTACQSPTPRKVVIPK  60

Query  288   GTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDG  467
             G F++ + ++ GPCK+P+E+ +  T+ A  + N +  K++W+    +D F L+G GT DG
Sbjct  61    GQFKLGEIMMSGPCKSPVEITLLGTVLA--DGNSIHGKEKWVVFQRMDGFRLNGGGTFDG  118

Query  468   QGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKI  647
             +G+           F+  KLP ++  +F+ N+ IRDI+S+++K FH+NV G KN+TF  +
Sbjct  119   EGNAAWRVNNCHKTFECKKLPISIRFDFVTNAEIRDISSIDAKNFHINVIGAKNMTFDNV  178

Query  648   TIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISV  827
              I APA+S NTDGIH+ +   V+I +S I TGDDC+S+GDG+ NL +  V CGPGHGISV
Sbjct  179   KIMAPAESPNTDGIHLGRSVGVSIINSRISTGDDCVSVGDGMVNLLVKNVVCGPGHGISV  238

Query  828   GSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPI  1004
             GSLG+   E+ V G+ V +     TDNGLRIKTWP++      ++IH+  I + +V NPI
Sbjct  239   GSLGRYGHEQDVSGIRVINCTLQETDNGLRIKTWPSAACSTTASNIHFENIILRNVSNPI  298

Query  1005  VIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINL  1184
             +IDQEYCP NQC+K+K S +K++N+S+  I+GTS  ++AV + CS G PCE+V+ GDIN+
Sbjct  299   LIDQEYCPWNQCNKQKSSSIKLANISFRRIRGTSGNKDAVKLLCSKGYPCENVQVGDINI  358

Query  1185  TFKG--GAAKTVCSNAKPKLTGKQ------TPPV  1262
              + G  G A  +CSN +PKL G Q      TPPV
Sbjct  359   QYTGADGPATFMCSNVRPKLVGTQFPKACNTPPV  392



>ref|XP_010464425.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   348 bits (892),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 253/385 (66%), Gaps = 5/385 (1%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M   F  +   ++ LL     +A F + +   SDI+  LLKA+  AC   +PS +VIPKG
Sbjct  1     MGAYFGVSTILIICLLGISANAAVFPIGSPSGSDITQALLKAFTAACQCPSPSKVVIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              F++ +  ++GPCKAPIE+ I+ T+KA  + N ++ K +W+    ++ F L+G G  DG+
Sbjct  61    EFKLGEIEMRGPCKAPIEITIQGTVKA--DGNAIQGKDKWVVFGNINGFKLNGGGAFDGE  118

Query  471   GDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
             G+           F   KLP ++  +F+ NS IRDI+S+++K FH+NV G KN+T   I 
Sbjct  119   GNASWRVNNCHKTFLCKKLPISIRFDFVLNSEIRDISSIDAKNFHINVLGAKNMTMNNIK  178

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             I AP DS NTDGIH+ +   V I +S I TGDDCIS+GDG++NL+++ VTCGPGHGISVG
Sbjct  179   IIAPEDSPNTDGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVG  238

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIV  1007
             SLG+   E+ V G+ + +     TDNGLRIKTWP++      +DIH+  I +++V NPI+
Sbjct  239   SLGRYGHEQDVSGIRIINCTLQQTDNGLRIKTWPSAACSTTASDIHFQDIILKNVNNPIL  298

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQEYCP NQC+K+KPS +K+ N+S+ NI+GTS  ++AV + CS G PC++V+ G++++ 
Sbjct  299   IDQEYCPWNQCNKQKPSTIKLVNISFKNIRGTSGNKDAVKLLCSRGYPCQNVEIGNVDIK  358

Query  1188  FKG--GAAKTVCSNAKPKLTGKQTP  1256
             + G  G A   CSN  PKL+G Q P
Sbjct  359   YTGADGPATFQCSNVSPKLSGIQNP  383



>ref|XP_008231346.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231347.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231348.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231349.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   348 bits (893),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/353 (49%), Positives = 235/353 (67%), Gaps = 3/353 (1%)
 Frame = +3

Query  195   AEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAP  374
             A+  SD+S  L KAW +ACA+ + S +V+P GT+++K+A  +GPCKAPIE++++ TL+AP
Sbjct  36    AKPGSDVSTALAKAWSDACASPSASKVVVPSGTYKLKEANFRGPCKAPIEMQVQGTLQAP  95

Query  375   PNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFL  554
              + + +     W+   Y+D  TLSG GT DGQG +               +P NL   FL
Sbjct  96    ADASQLTRPDTWVGFQYIDMLTLSGGGTFDGQGALSWNQNDCHKNKNCKPIPVNLRFEFL  155

Query  555   KNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVI  734
              NS ++DITSLNSK FH++VF   + TFQ++TI AP DS NTDGIHI     + I  + I
Sbjct  156   TNSKVQDITSLNSKFFHMHVFRCNHTTFQQLTITAPDDSRNTDGIHIGASTGINITHAKI  215

Query  735   GTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGL  914
             GTGDDCISIGD    + +  VTCGPGHGIS+GSLGK   E+ V G+ VK+     TDNG+
Sbjct  216   GTGDDCISIGDDSHEITVTDVTCGPGHGISIGSLGKYKDEKDVTGIIVKNCTLTNTDNGV  275

Query  915   RIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTN  1091
             RIKT+P+S  P   + IHY  I M +V NPI++DQ YCP  QC ++ PS VKISNVS+ N
Sbjct  276   RIKTFPDSPSPSTASGIHYEDIIMVNVSNPILVDQLYCPYTQCEQKPPSKVKISNVSFKN  335

Query  1092  IKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTG  1244
             IKG+S T  AV + C++G+PCE+V+  DI+LT+ G  G   ++CSN KP +TG
Sbjct  336   IKGSSFTPLAVKLVCTTGIPCENVELTDIDLTYGGDKGPLTSMCSNVKPTITG  388



>ref|XP_002884668.1| polygalacturonase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60927.1| polygalacturonase 3 [Arabidopsis lyrata subsp. lyrata]
Length=391

 Score =   347 bits (891),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/385 (45%), Positives = 254/385 (66%), Gaps = 5/385 (1%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M   F  +   ++ LL     +  F + +   SDI+  LLKA+  AC +++PS +VIPKG
Sbjct  1     MGAYFGVSTILIICLLGISANAEVFTIGSSSGSDITQALLKAFTSACQSSSPSKVVIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              F++ +  ++GPCKAPIE+ ++ T+KA  + N ++ K++W+    +D F L+G G  DG+
Sbjct  61    EFKLGEIEMRGPCKAPIEVTLQGTVKA--DGNAIQGKEKWVVFGNIDGFKLNGGGAFDGE  118

Query  471   GDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
             G+           F   KLP ++  +F+ NS IRDI+S+++K FH+NV G KN+T   I 
Sbjct  119   GNSAWRVNNCHKTFNCKKLPISIRFDFVLNSEIRDISSIDAKNFHINVLGAKNMTMDNIK  178

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             I AP +S NTDGIH+ +   V I +S I TGDDCIS+GDG++NL+++ VTCGPGHGISVG
Sbjct  179   IIAPEESPNTDGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVG  238

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIV  1007
             SLG+   E+ V G+ + +     TDNGLRIKTWP++      +DIH+  I +++V NPI+
Sbjct  239   SLGRYGHEQDVSGIKIINCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVSNPIL  298

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQEYCP NQC+K+K S +K+ N+S+ NI+GTS  ++AV + CS G PC++V+ GDI++ 
Sbjct  299   IDQEYCPWNQCNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIK  358

Query  1188  FKG--GAAKTVCSNAKPKLTGKQTP  1256
             + G  G A   CSN  PKL G Q+P
Sbjct  359   YNGADGPATFQCSNVSPKLLGSQSP  383



>ref|XP_003595656.1| Polygalactorunase PG11 [Medicago truncatula]
 gb|AES65907.1| polygalacturonase 11c, putative [Medicago truncatula]
Length=407

 Score =   348 bits (893),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 181/382 (47%), Positives = 244/382 (64%), Gaps = 14/382 (4%)
 Frame = +3

Query  120   IFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             +F   F  V  L+ D+      K     +SDI+  L  AW EACA+TT S IVIP GT++
Sbjct  12    LFLAEFCAVQSLVLDIS-----KFGGAPNSDITLALGNAWKEACASTTASKIVIPGGTYK  66

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
             M    LKGPCKAPIE+++  T++AP +P+ ++   +W+   Y++  TLSG G  DGQG  
Sbjct  67    MGGIELKGPCKAPIEVQVDGTIQAPADPSQIKAADQWVKFLYMEHLTLSGKGVFDGQG-A  125

Query  480   QIYGQKKDTGFKSDKLPN-----NLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQK  644
               Y Q +     S K  N     NL   F+ NS++  +TS +SK FHV V G  N TF  
Sbjct  126   TAYKQAQPAAAWSGKKSNVKILMNLGFMFVNNSMVTGVTSKDSKNFHVMVLGCNNFTFDG  185

Query  645   ITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGIS  824
              T+ AP+DS NTDGIH+ +  DV I ++ IGTGDDC+S+GDG   + + GV CGPGHGIS
Sbjct  186   FTVTAPSDSPNTDGIHMGRSTDVKILNTNIGTGDDCVSLGDGSRKITVQGVKCGPGHGIS  245

Query  825   VGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVT--DIHYHKIEMEDVKN  998
             VGSLG+   E+ V+GVTVK+     T NG+RIKTWP++ PG +T  DIH+  I M +V N
Sbjct  246   VGSLGRYTTEDNVEGVTVKNCTLTATQNGVRIKTWPDA-PGTITVSDIHFEDITMNNVTN  304

Query  999   PIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDI  1178
             PI+IDQEYCP N C+K+ PS VK+S +S+ NI+GTS   E V++ CSS VPC+ V+  ++
Sbjct  305   PIIIDQEYCPWNACNKKVPSKVKLSKISFKNIQGTSGAPEGVVLVCSSAVPCDGVELNNV  364

Query  1179  NLTFKGGAAKTVCSNAKPKLTG  1244
             ++ F G  A   CSN KP +TG
Sbjct  365   DVKFNGKPAIAKCSNVKPTVTG  386



>ref|XP_010038560.1| PREDICTED: exopolygalacturonase [Eucalyptus grandis]
Length=407

 Score =   348 bits (893),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/363 (47%), Positives = 234/363 (64%), Gaps = 2/363 (1%)
 Frame = +3

Query  180   EFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKA  359
             +F   A+G SD S  ++ AW++AC + +PS +VI KG++       +GPCKA + LK++ 
Sbjct  39    KFGAKADGRSDDSQIIVNAWNKACTSPSPSTVVISKGSYLAGPLKFQGPCKADVNLKVEG  98

Query  360   TLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNL  539
              +KAP + N  + +  W+    +D  TLSG G+ DGQG             K + LP NL
Sbjct  99    AVKAPADLNKFKSQGSWVLFQNIDGLTLSGGGSFDGQGAAAWKENNCAQTGKCNSLPTNL  158

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
                 + NS ++DITSLNSKLFHV +    N+T Q +TI AP DS NTDGIH+ +   V I
Sbjct  159   QFTSINNSHVQDITSLNSKLFHVELLNCNNVTLQHVTIDAPEDSLNTDGIHVGRSMGVNI  218

Query  720   KDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIG  899
               + I TGDDC+S+GDG + ++I+GVTCGPGHGISVGSLGK   E+PV GVTV++     
Sbjct  219   IGADIRTGDDCVSLGDGSQQVHIEGVTCGPGHGISVGSLGKYHDEQPVVGVTVRNCTLTN  278

Query  900   TDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
             T NG+R+KTWPNS  GV + +H+  I + +V  PI+IDQ YCP N C ++ PS VKIS+V
Sbjct  279   TMNGIRVKTWPNSPSGVASGMHFEDITVNNVSTPILIDQNYCPYNNCQQKIPSKVKISDV  338

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQT  1253
             S+ NI+GTSAT  AV + CS GVPC+ V+  DINL + G  G A + C N KP + GK +
Sbjct  339   SFRNIRGTSATPLAVKLVCSRGVPCQKVELADINLRYNGRNGTATSQCENVKPTIAGKLS  398

Query  1254  PPV  1262
              P+
Sbjct  399   LPI  401



>sp|Q39766.1|PGLR_GOSBA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium barbadense]
 gb|AAA58322.1| polygalacturonase [Gossypium barbadense]
Length=407

 Score =   348 bits (892),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/361 (47%), Positives = 238/361 (66%), Gaps = 2/361 (1%)
 Frame = +3

Query  177   AEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIK  356
             A+F   A+G +D+S   L AW EACA+ TPS +VIPKGT+ + +  L+GPCKAPIE+ ++
Sbjct  33    AKFGAKADGKTDLSKPFLDAWKEACASVTPSTVVIPKGTYLLSKVNLEGPCKAPIEINVQ  92

Query  357   ATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNN  536
              T++AP +P+  +    W+    V++F + G G  DGQG +       +      KLP N
Sbjct  93    GTIQAPADPSAFK-DPNWVRFYSVENFKMFGGGIFDGQGSIAYEKNTCENREFRSKLPVN  151

Query  537   LSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVT  716
             +  +F+ N++I+DITS +SKLFH+NVF  KN+T +++ I+AP +S NTDGIH+ K   V 
Sbjct  152   IRFDFVTNALIQDITSKDSKLFHINVFACKNITLERLKIEAPDESPNTDGIHMGKSEGVN  211

Query  717   IKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFI  896
             I  S I TGDDCISIGDG +N+ I  +TCGPGHGIS+GSLGK   EEPV+G+ + +    
Sbjct  212   IIASDIKTGDDCISIGDGTKNMVIKEITCGPGHGISIGSLGKFQNEEPVEGIKISNCTIT  271

Query  897   GTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISN  1076
              T NG RIKTWP  H G V++IH+  I M +V +PI+IDQ+YCP N+C K + S VK+SN
Sbjct  272   NTSNGARIKTWPGEHGGAVSEIHFEDITMNNVSSPILIDQQYCPWNKCKKNEESKVKLSN  331

Query  1077  VSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGGA-AKTVCSNAKPKLTGKQT  1253
             +S+ NI+GTSA  EA+   CS   PC++V+  DI++   G   A + C N KP   GK  
Sbjct  332   ISFKNIRGTSALPEAIKFICSGSSPCQNVELADIDIQHNGAEPATSQCLNVKPITIGKLN  391

Query  1254  P  1256
             P
Sbjct  392   P  392



>ref|XP_006407793.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
 gb|ESQ49246.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
Length=396

 Score =   347 bits (891),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 251/385 (65%), Gaps = 5/385 (1%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M   F  +   VL LL     +  F + +   SDI+  LLKA+  AC +T+PS +VIPKG
Sbjct  1     MGAHFAVSTILVLCLLGISANAEVFTIGSSSGSDITQALLKAFTSACQSTSPSKVVIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              F++ +  ++GPCKAP+E+ ++ T+KA  N N    K +W+    ++ F L+G G  DG+
Sbjct  61    EFKLGEIEMRGPCKAPVEITLQGTVKADGNTN--HGKDKWVVFGNINGFKLNGGGAFDGE  118

Query  471   GDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
             G+           F+  KLP ++  +F++N+ I+DI+S+++K FH+NV G KN+T   I 
Sbjct  119   GNAAWRVNNCHKTFECKKLPISVRFDFVENAEIKDISSIDAKNFHINVLGAKNMTMDNIK  178

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             I AP DS NTDGIH+ +   V I +S I TGDDCIS+GDG++NL+++ V CGPGHGISVG
Sbjct  179   ITAPEDSPNTDGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVVCGPGHGISVG  238

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIV  1007
             SLG+   EE V G+ V +     TDNGLRIKTWP++      +DIH+  I +++V NPI+
Sbjct  239   SLGRYGHEEDVSGIRVVNCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVSNPIL  298

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQEYCP NQC+K+K S +K+ N+S+ NI+GTS  ++AV + CS G PC+ V+ GDI++ 
Sbjct  299   IDQEYCPWNQCNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQKVEIGDIDIA  358

Query  1188  FKG--GAAKTVCSNAKPKLTGKQTP  1256
             + G  G A   CSN  P+L G Q+P
Sbjct  359   YSGADGPATFQCSNVSPQLLGSQSP  383



>emb|CDY07974.1| BnaC03g35490D [Brassica napus]
Length=395

 Score =   347 bits (891),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/382 (45%), Positives = 252/382 (66%), Gaps = 6/382 (2%)
 Frame = +3

Query  123   FYCAFTFVLFLLADLGESAEFKVTAEGDS-DISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             ++ AFT  +F L     +A +         DI+  L+KA+  AC + TPS +VIPKG F+
Sbjct  4     YFGAFTVFIFCLLGFSANAVYISIGSSSGSDITQALVKAFTTACQSPTPSRVVIPKGEFK  63

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
             + +  ++GPCKAP+E+ I+ T+KA  + N ++ K  W+    ++ F L+G G  DG+G+ 
Sbjct  64    LGEIQMRGPCKAPVEITIQGTVKA--DGNAIQGKDTWIVFGNINGFKLNGGGAFDGEGNA  121

Query  480   QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKA  659
                       F   KLP ++  +F++N+ IRDI+S+++K FH+NV G KN+T   I I A
Sbjct  122   AWRVNNCHQTFNCKKLPISIRFDFVENAEIRDISSIDAKNFHINVLGAKNMTMDHINIIA  181

Query  660   PADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLG  839
             P DS NTDGIH+ +   V I ++ I TGDDCIS+GDG++NL+++ VTCGPGHGISVGSLG
Sbjct  182   PKDSPNTDGIHLGRSDGVKILNTFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLG  241

Query  840   KTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQ  1016
             +   E+ V G+ V +     TDNGLRIKTWP++      +DIH+  I +++V NPI+IDQ
Sbjct  242   RYGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIIVKNVMNPILIDQ  301

Query  1017  EYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG  1196
             EYCP NQC+K+KPS +K++N+S+  I+GTS  ++AV + CS G PC++V+ GDI++ + G
Sbjct  302   EYCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYNG  361

Query  1197  --GAAKTVCSNAKPKLTGKQTP  1256
               G A   CSN  PKL G Q+P
Sbjct  362   ADGPATFQCSNVSPKLMGTQSP  383



>ref|XP_008449697.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=403

 Score =   347 bits (891),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 189/390 (48%), Positives = 256/390 (66%), Gaps = 16/390 (4%)
 Frame = +3

Query  123   FYCAFTFVLFLLADLGESAE--FKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPK  287
             F      +L +     +SA   F +T  G   ++DI+  L  AW EACA+TTPS ++IPK
Sbjct  7     FVALLPMLLLVSNSKAQSAAGVFDITKYGAKPNADITAALASAWKEACASTTPSKVLIPK  66

Query  288   GTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDG  467
             GT+ + Q+ LKGPCK+ IEL+++ T++A    +D++     L + YVD  T+SG G +DG
Sbjct  67    GTYGLTQSNLKGPCKSSIELQLEGTVQAS---SDVK-GDGLLLLEYVDQLTVSGTGVVDG  122

Query  468   QGDVQIYGQKKDTGFKS--DKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQ  641
             QG    +G K D   K    KLP NL  NF+ NSI++DITSL+SK +H N+   KNLTF 
Sbjct  123   QGKTA-WG-KNDCHLKKICTKLPMNLKFNFVTNSIVKDITSLDSKNYHFNLLACKNLTFD  180

Query  642   KITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGI  821
              +TI AP +S NTDGIH+     + I ++ I TGDDCIS+G   + + I  VTCGPGHGI
Sbjct  181   HVTITAPGNSPNTDGIHVGDSEQINILNTNIATGDDCISVGSSNKQIVISDVTCGPGHGI  240

Query  822   SVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKN  998
             S+GSLGK   E+ + GVTVK  K  GT NG+RIKTWP+S      +D+H+  IEM +V N
Sbjct  241   SIGSLGKYTNEKELVGVTVKKCKLTGTTNGVRIKTWPDSAVAFPASDMHFEDIEMVNVSN  300

Query  999   PIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDI  1178
             P++IDQEYCP NQC+++ PS +KIS VS+ NI+GTSAT  AV + CS   PCE V+  DI
Sbjct  301   PVLIDQEYCPWNQCNRKVPSKIKISKVSFKNIRGTSATPVAVKLVCSQSNPCEGVEVADI  360

Query  1179  NLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             +LT+ G  G  K+ C+N KP ++GKQ PP+
Sbjct  361   DLTYSGSEGPIKSQCANVKPVISGKQNPPI  390



>ref|NP_187441.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21194.1|AC013483_18 putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE74610.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=401

 Score =   347 bits (891),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 176/383 (46%), Positives = 253/383 (66%), Gaps = 8/383 (2%)
 Frame = +3

Query  126   YCAFTFVLFLLADLGESAE---FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTF  296
             Y   + VLF+++ LG SA    F V     SDI+  LLKA+  AC A T S +VI KG F
Sbjct  4     YLGISAVLFVISLLGFSANAEVFNVGGSPGSDITQALLKAFTSACQAPTASKVVITKGEF  63

Query  297   QMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGD  476
             ++ +  + GPCKAP+E+ ++ TLKA  +   ++ K+ W+    ++ F L+G G  DG+G+
Sbjct  64    KLGEIEMTGPCKAPVEINLQGTLKA--DGKAIQGKERWVVFLRINGFKLNGGGIFDGEGN  121

Query  477   VQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIK  656
                        F+  KLP ++  +F++N+ IRDI+S+++K FH+NV G KN+TF  + + 
Sbjct  122   AAWRVNNCHKTFECKKLPISIRFDFVENAEIRDISSIDAKNFHINVLGAKNMTFDNVKVI  181

Query  657   APADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSL  836
             APA+S NTDGIH+ +   V I +S I TGDDCIS+GDG++NL+++ V CGPGHGISVGSL
Sbjct  182   APAESPNTDGIHLGRSEGVKILNSKIATGDDCISVGDGMKNLHVENVMCGPGHGISVGSL  241

Query  837   GKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVID  1013
             G+   E+ V G+TV +    GTDNGLRIKTWP++      + IH+  I + +V NPI+ID
Sbjct  242   GRYVHEQDVTGITVVNCTLQGTDNGLRIKTWPSAACATTASGIHFENIILNNVSNPILID  301

Query  1014  QEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFK  1193
             QEYCP NQC+K+KPS +K+ ++S+ NI+GTS  ++AV + CS   PC +V+ G+INL +K
Sbjct  302   QEYCPWNQCNKQKPSTIKLVDISFKNIRGTSGNKDAVKLLCSKAHPCANVEIGNINLEYK  361

Query  1194  G--GAAKTVCSNAKPKLTGKQTP  1256
             G  G    +CSN  PKL G Q P
Sbjct  362   GADGPPTFMCSNVSPKLVGTQNP  384



>ref|XP_010547226.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   347 bits (891),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 178/379 (47%), Positives = 248/379 (65%), Gaps = 9/379 (2%)
 Frame = +3

Query  141   FVLFLLADLGESAEFKVTAEGD----SDISPELLKAWDEACAATTPSIIVIPKGTFQMKQ  308
             F L+LL+    +  F +   G     SDI+    +A+  AC +  PS +VIPKGT+++ +
Sbjct  11    FALYLLSFSANAEVFDIRKFGHVSVGSDITQAFRQAFQAACQSPRPSSVVIPKGTYKLGE  70

Query  309   ALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIY  488
               + GPCKAP+E+ +   L+A  N N +   ++W+   Y++ F L+G G  DGQG+    
Sbjct  71    INMIGPCKAPVEVTVNGHLQA--NGNALAGHEKWVVFRYINGFKLNGGGIFDGQGNAAWK  128

Query  489   GQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPAD  668
                        KLP ++  +F+ N  +RDITSL++K FHVNV G KN TF  + IKAPA+
Sbjct  129   SNDCHKNNNCKKLPISIRFDFVLNGEVRDITSLDAKNFHVNVLGCKNFTFDNVKIKAPAE  188

Query  669   SHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTP  848
             S NTDGIH+ +   V I  S I TGDDCISIGDG++NL+++ VTCGPGHGIS+GSLG+  
Sbjct  189   SPNTDGIHLGRSDGVNILRSFISTGDDCISIGDGMKNLHVERVTCGPGHGISIGSLGRYT  248

Query  849   GEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYC  1025
              EEPV G+ +K+     TDNGLRIKT+P+S   + V+DIH+  I +++V NPI+IDQEYC
Sbjct  249   IEEPVAGIWIKNCTLQETDNGLRIKTYPSSASSITVSDIHFEDIIVKNVSNPILIDQEYC  308

Query  1026  PNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--G  1199
             P N+C+K KPS VK+ N+S+  I+GTS  ++AV + CS GVPC +V+ GDI+L + G  G
Sbjct  309   PWNKCNKAKPSTVKLVNISFKRIRGTSGNKDAVRLLCSKGVPCTNVEVGDIDLRYGGADG  368

Query  1200  AAKTVCSNAKPKLTGKQTP  1256
              A   CSN  PKL+G Q P
Sbjct  369   PATFECSNVTPKLSGTQFP  387



>gb|ABG38468.1| pollen-expressed protein MF9c [Brassica oleracea]
Length=395

 Score =   347 bits (890),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 172/382 (45%), Positives = 252/382 (66%), Gaps = 6/382 (2%)
 Frame = +3

Query  123   FYCAFTFVLFLLADLGESAEFKVTAEGDS-DISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             ++ AFT  +F L     +A +         DI+  L+KA+  AC + TPS +VIPKG F+
Sbjct  4     YFGAFTVFIFCLLGFSANAVYISIGSSSGSDITQALVKAFTTACQSPTPSRVVIPKGEFK  63

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
             + +  ++GPCKAP+E+ I+ T+KA  + N ++ K  W+    ++ F L+G G  DG+G+ 
Sbjct  64    LGEIQMRGPCKAPVEITIQGTVKA--DGNAIQGKDTWIVFGNINGFKLNGGGAFDGEGNA  121

Query  480   QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKA  659
                       F   KLP ++  +F++N+ IRDI+S+++K FH+NV G KN+T   I I A
Sbjct  122   AWRVNNCHQTFNCKKLPISVRFDFVENAEIRDISSIDAKNFHINVLGAKNMTMDHINIIA  181

Query  660   PADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLG  839
             P DS NTDGIH+ +   V I ++ I TGDDCIS+GDG++NL+++ VTCGPGHGISVGSLG
Sbjct  182   PKDSPNTDGIHLGRSDGVKILNTFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVGSLG  241

Query  840   KTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQ  1016
             +   E+ V G+ V +     TDNGLRIKTWP++      +DIH+  I +++V NPI+IDQ
Sbjct  242   RYGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIIVKNVMNPILIDQ  301

Query  1017  EYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG  1196
             EYCP NQC+K+KPS +K++N+S+  I+GTS  ++AV + CS G PC++V+ GDI++ + G
Sbjct  302   EYCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSG  361

Query  1197  --GAAKTVCSNAKPKLTGKQTP  1256
               G A   CSN  PKL G Q+P
Sbjct  362   ADGPATFQCSNVSPKLMGTQSP  383



>ref|XP_004292143.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=498

 Score =   350 bits (899),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 186/385 (48%), Positives = 242/385 (63%), Gaps = 8/385 (2%)
 Frame = +3

Query  138   TFVLFL-LADLGESAEFKVTA-----EGDSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             +F+L L    +  S  F VT+     + ++DI+  LL AW +ACA+   S I +PKGT+ 
Sbjct  12    SFLLVLAFTPVHSSVFFDVTSAKYGGKPNTDITKALLNAWTDACASPWESTIYVPKGTYG  71

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
             +K A+  G CKAPIEL+++ TL+AP     +     W+   Y++  TLSG GT DG+G +
Sbjct  72    LKGAIFVGHCKAPIELQVEGTLQAPEETGQVTSPDTWVGFRYLNRLTLSGGGTFDGRGAL  131

Query  480   QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKA  659
                    +T         N+  +F+ ++II+DITSL+SK FH NVF   N+TFQ  TI A
Sbjct  132   SWKQNDCNTNKNCKSRVVNIRFDFVNDTIIKDITSLDSKNFHFNVFACNNITFQHATITA  191

Query  660   PADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLG  839
             P DS NTDGIHIA+   VT+ ++ IGTGDDCIS+GDG   L    VTCGPGHGIS+GSLG
Sbjct  192   PGDSVNTDGIHIARSTMVTVANTSIGTGDDCISLGDGTSQLKFTNVTCGPGHGISIGSLG  251

Query  840   KTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQE  1019
                 E+PV GV +K+  F  T NG RIKTWP S+ G+V+DIHY  I M +V NPI+IDQE
Sbjct  252   GHRDEQPVTGVIIKNVTFNSTQNGARIKTWPGSYGGLVSDIHYEDIIMVNVSNPIIIDQE  311

Query  1020  YCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG-  1196
             YCP N C+K+ PS VKISNVS+ NIKGTS T  AV   CS  VPCE+V+   I+LT+ G 
Sbjct  312   YCPWNLCNKKIPSKVKISNVSFKNIKGTSTTPLAVNFICSWSVPCENVEISGIDLTYTGH  371

Query  1197  -GAAKTVCSNAKPKLTGKQTPPVTC  1268
              G   + CSN K       T  + C
Sbjct  372   KGFISSQCSNVKLATIANVTKALAC  396



>gb|AAO62938.1| polygalactorunase PG11 precursor [Medicago sativa]
Length=407

 Score =   347 bits (889),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 177/380 (47%), Positives = 242/380 (64%), Gaps = 17/380 (4%)
 Frame = +3

Query  126   YCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMK  305
             +CA   V+  ++  G +         +SDI+  +  AW EAC +TT + I+IP GT++M 
Sbjct  17    FCAVQSVVLDISKFGGAP--------NSDITQAIGNAWKEACLSTTAAKIMIPGGTYRMN  68

Query  306   QALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQI  485
                LKGPCKAPIE+++  T++AP +P+ M+   +W+   Y++  TLSG G  DGQG   +
Sbjct  69    GVELKGPCKAPIEVQVDGTIQAPADPSQMKAADQWIKFLYMEHLTLSGKGVFDGQG-ATV  127

Query  486   YGQKKDTGFKSDKLPN-----NLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
             Y +       S K  N     NL   F+ NS++  +TS +SK FHV V G  N TF   T
Sbjct  128   YKKAAPAAAWSGKNSNVKIFMNLGFMFVNNSMVHGLTSKDSKNFHVMVLGCNNFTFDGFT  187

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             + AP DS NTDGIH+ +  D+ I ++ I TGDDCIS+GDG   + +  V CGPGHGISVG
Sbjct  188   VTAPGDSPNTDGIHMGRSTDIKILNTNIATGDDCISLGDGSRKITVQNVKCGPGHGISVG  247

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVT--DIHYHKIEMEDVKNPI  1004
             SLGK   E+ V+GV VK+     T NG+RIKTWP++ PG +T  DIH+  I M +V NP+
Sbjct  248   SLGKYTTEDNVEGVIVKNCTLTATQNGVRIKTWPDA-PGTITVSDIHFEDIIMNNVMNPV  306

Query  1005  VIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINL  1184
             +IDQEYCP NQCSK+ PS +K+S +S+ NI+GTS T E V++ CSSGVPC+ V+  ++ L
Sbjct  307   IIDQEYCPWNQCSKKNPSKIKLSKISFKNIQGTSGTPEGVVLICSSGVPCDGVELNNVGL  366

Query  1185  TFKGGAAKTVCSNAKPKLTG  1244
             TF G  A   CSN KP +TG
Sbjct  367   TFNGKPAIAKCSNVKPLVTG  386



>ref|XP_010418169.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=410

 Score =   346 bits (888),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 179/377 (47%), Positives = 251/377 (67%), Gaps = 9/377 (2%)
 Frame = +3

Query  147   LFLLADLGESAE----FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQAL  314
             +F+L  +G SA     F + +   SDI+  LLKA+  AC  TTPS +VIPKG F++ + +
Sbjct  23    IFVLCLVGFSANAHEVFNINSPPGSDITQALLKAFTAACQCTTPSRVVIPKGEFKLCEII  82

Query  315   LKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQ  494
             + GPCKAP+E+ +  TL A  + +++  K +W+    ++ F L+G GT DG+G       
Sbjct  83    MTGPCKAPVEITLLGTLLA--DGSNIHGKDKWVVFRKINGFKLNGGGTFDGEGSAAWRVN  140

Query  495   KKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSH  674
                      KLP +L  +F+ N+ IRDI+S++SK FHVNV G  N+TF  + I APA+S 
Sbjct  141   NCHKTSNCKKLPISLRFDFVTNAEIRDISSVDSKNFHVNVIGAMNMTFDNVKILAPAESP  200

Query  675   NTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGE  854
             NTDGIH+ +   V+I +S I TGDDCIS+GDG+ NL +  V CGPGHGIS+GSLG+ P E
Sbjct  201   NTDGIHLGRSDGVSIINSRISTGDDCISVGDGMVNLLVKNVVCGPGHGISIGSLGRYPHE  260

Query  855   EPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVV-TDIHYHKIEMEDVKNPIVIDQEYCPN  1031
             + V+G+ V +     TDNGLRIKTWP +   +V + IH+  I +++V NPI+IDQEYCP 
Sbjct  261   QNVRGIRVINCTVQETDNGLRIKTWPTAACSIVASGIHFEDIILKNVSNPILIDQEYCPW  320

Query  1032  NQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAA  1205
             NQC+K+K S +K+ +VS+TNI+GTSA ++AV + CS G PCE+V  G+IN+ + G  G A
Sbjct  321   NQCNKQKSSSIKLVDVSFTNIRGTSANKDAVKLLCSKGYPCENVVVGNINIEYTGRDGPA  380

Query  1206  KTVCSNAKPKLTGKQTP  1256
               +CSN KPKL G Q P
Sbjct  381   TFMCSNVKPKLVGIQNP  397



>gb|KFK31316.1| hypothetical protein AALP_AA6G096900 [Arabis alpina]
Length=395

 Score =   346 bits (887),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 171/383 (45%), Positives = 253/383 (66%), Gaps = 6/383 (2%)
 Frame = +3

Query  120   IFYCAFTFVLFLLADLGESAE-FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTF  296
             + +    F +F L  L  +A+ F + +   SDI+  LLKA+ EAC A T S ++IPKG +
Sbjct  3     VHFGVSVFFVFCLVGLSANAKVFNIGSPPGSDITKALLKAFTEACQAPTKSTVMIPKGEY  62

Query  297   QMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGD  476
             ++ +  + GPCKAPI + ++ T+KA  + N +  K++W+    +D F L+G G  DG+G+
Sbjct  63    KLGEIEMTGPCKAPIRIALQGTVKA--DGNLINGKEKWVAFRNIDGFKLNGGGVFDGEGN  120

Query  477   VQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIK  656
                        F   KLP ++  +F+ N+ IR ITSL++K FH+NV G KN+TF+ + I 
Sbjct  121   NAWRSNNCHKTFNCKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEDVKIV  180

Query  657   APADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSL  836
             APA+S NTDGIH+ +   + I +S I TGDDC+S+GDG++NL ++ VTCGPGHGIS+GSL
Sbjct  181   APAESPNTDGIHVGRSDGIRIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISIGSL  240

Query  837   GKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVID  1013
             G+   EE V G+ + +     TDNG+RIKTWP++      +DIH+  I +++V NPI+ID
Sbjct  241   GRYSHEEDVSGIKIVNCTLQETDNGIRIKTWPSAACSTTASDIHFQNIILKNVTNPILID  300

Query  1014  QEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFK  1193
             QEYCP NQC+K+K S +K+ N+S+ NI+GTS  ++AV + C+ G+PC +V+ GDIN+ + 
Sbjct  301   QEYCPWNQCNKQKSSTIKLVNISFKNIRGTSGNKDAVKLLCAKGLPCTNVELGDINIKYN  360

Query  1194  G--GAAKTVCSNAKPKLTGKQTP  1256
             G  G A   C+N  PKL G QTP
Sbjct  361   GADGPATFQCANVSPKLMGTQTP  383



>gb|AFK35534.1| unknown [Medicago truncatula]
Length=407

 Score =   346 bits (887),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 181/382 (47%), Positives = 242/382 (63%), Gaps = 14/382 (4%)
 Frame = +3

Query  120   IFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             +F   F  V  L+ D+      K     +SDI+  L  AW EACA+TT S IVIP GT++
Sbjct  12    LFLAEFCAVQSLVLDIS-----KFGGAPNSDITLALGNAWKEACASTTASKIVIPGGTYK  66

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
             M    LKGPCKAPIE+++  T++AP +P+ ++   +W+   Y++  TLSG G  DGQG  
Sbjct  67    MGGIELKGPCKAPIEVQVDGTIQAPADPSQIKAADQWVKFLYMEHLTLSGKGVFDGQG-A  125

Query  480   QIYGQKKDTGFKSDKLPN-----NLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQK  644
               Y Q +     S K  N     NL   F+ NS++  +TS +SK FHV V G  N TF  
Sbjct  126   TAYKQAQPAAAWSGKKSNVKILMNLGFMFVNNSMVTGVTSKDSKNFHVMVLGCNNFTFDG  185

Query  645   ITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGIS  824
              T+ AP+DS NTDGIH+ +  DV I ++ IGTGDDC+S+GDG   + + GV CGPGHGIS
Sbjct  186   FTVTAPSDSPNTDGIHMGRSTDVKILNTNIGTGDDCVSLGDGSRKITVQGVKCGPGHGIS  245

Query  825   VGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVT--DIHYHKIEMEDVKN  998
             VGSLG+   E+ V+GVTVK      T NG+RIKTWP++ PG +T  DIH+  I M +V N
Sbjct  246   VGSLGRYTTEDNVEGVTVKSCTLTATQNGVRIKTWPDA-PGTITVSDIHFEDITMNNVTN  304

Query  999   PIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDI  1178
             PI+IDQEYCP N C+K+ PS VK+S  S+ NI+GTS   E V++ CSS VPC+ V+  ++
Sbjct  305   PIIIDQEYCPWNACNKKVPSKVKLSKTSFKNIQGTSGAPEGVVLVCSSTVPCDGVELNNV  364

Query  1179  NLTFKGGAAKTVCSNAKPKLTG  1244
             ++ F G  A   CSN KP +TG
Sbjct  365   DVKFNGKPAIAKCSNVKPTVTG  386



>ref|NP_199625.1| putative polygalacturonase / pectinase [Arabidopsis thaliana]
 dbj|BAA96994.1| polygalacturonase [Arabidopsis thaliana]
 dbj|BAC43278.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAP81805.1| At5g48140 [Arabidopsis thaliana]
 gb|AED95623.1| putative polygalacturonase / pectinase [Arabidopsis thaliana]
Length=395

 Score =   345 bits (886),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/386 (44%), Positives = 253/386 (66%), Gaps = 7/386 (2%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAE-FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPK  287
             M  + +    F +F L  L  +A+ F + +   SDI+  LLKA++EAC   T S ++IPK
Sbjct  1     MGRVHFGVSAFFVFCLLGLSANAKIFNINSPPGSDITNALLKAFNEACQFPTKSTVMIPK  60

Query  288   GTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDG  467
             G +++ + ++ GPCKAPI + +  T+KA  N N    K++W+    ++ F L+G G  DG
Sbjct  61    GEYKLGEIVMMGPCKAPIRIALLGTVKADGNANG---KEKWVAFRNINGFKLNGGGVFDG  117

Query  468   QGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKI  647
             +G+           F   KLP ++  +F+ ++ IR ITSL++K FH+NV G KN+TF+ +
Sbjct  118   EGNAAWRVNNCHKTFNCKKLPISIRFDFVTDAKIRGITSLDAKHFHINVIGAKNVTFEDV  177

Query  648   TIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISV  827
              I APA+S NTDGIH+ +   + I +S I TGDDC+S+GDG++NL ++ VTCGPGHGIS+
Sbjct  178   KIIAPAESPNTDGIHVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISI  237

Query  828   GSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPI  1004
             GSLG+   EE V G+ + +     TDNGLRIKTWP++      +DIH+  I +++V NPI
Sbjct  238   GSLGRYSHEENVSGIKIINCTLQETDNGLRIKTWPSAACTTTASDIHFENILLKNVSNPI  297

Query  1005  VIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINL  1184
             +IDQEYCP NQC+K+KPS +K++N+S+  I+GTS  ++AV + CS G PC++V+ GD+N+
Sbjct  298   LIDQEYCPWNQCNKQKPSTIKLANISFKKIRGTSGNKDAVKLLCSKGYPCQNVEVGDVNI  357

Query  1185  TFKG--GAAKTVCSNAKPKLTGKQTP  1256
              + G  G A   CSN  PKL G Q P
Sbjct  358   QYTGADGPATFQCSNVSPKLVGTQIP  383



>ref|XP_008449696.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Cucumis 
melo]
Length=404

 Score =   345 bits (886),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 184/365 (50%), Positives = 248/365 (68%), Gaps = 13/365 (4%)
 Frame = +3

Query  186   KVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATL  365
             K  A+ ++DI+  L  AW EACA+TTPS ++IPKGT+ + Q+ LKGPCK+ IEL+++ T+
Sbjct  34    KYGAKPNADITAALASAWKEACASTTPSKVLIPKGTYGLTQSNLKGPCKSSIELQLEGTV  93

Query  366   KAPPNPNDMECKKE-WLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKS--DKLPNN  536
             +A      ++ K +  L + YVD  T+SG G +DGQG    +G K D   K    KLP N
Sbjct  94    QA-----SVDVKGDGLLLLEYVDQLTVSGTGVVDGQGKTA-WG-KNDCHLKKICTKLPMN  146

Query  537   LSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVT  716
             L  NF+ NSI++DITSL+SK +H N+   KNLTF  +TI AP +S NTDGIH+     + 
Sbjct  147   LKFNFVTNSIVKDITSLDSKNYHFNLLACKNLTFDHVTITAPGNSPNTDGIHVGDSEQIN  206

Query  717   IKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFI  896
             I ++ I TGDDCIS+G   + + I  VTCGPGHGIS+GSLGK   E+ + GVTVK  K  
Sbjct  207   ILNTNIATGDDCISVGISNKQIVISDVTCGPGHGISIGSLGKYTNEKELVGVTVKKCKLT  266

Query  897   GTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKIS  1073
             GT NG+RIKTWP+S      +D+H+  IEM +V NP++IDQEYCP NQC+++ PS +KIS
Sbjct  267   GTTNGVRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVLIDQEYCPWNQCNRKVPSKIKIS  326

Query  1074  NVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGK  1247
              VS+ NI+GTSAT  AV + CS   PCE V+  DI+LT+ G  G  K+ C+N KP ++GK
Sbjct  327   KVSFKNIRGTSATPVAVKLVCSQSNPCEGVEVADIDLTYSGSEGPIKSQCANVKPVISGK  386

Query  1248  QTPPV  1262
             Q PP+
Sbjct  387   QNPPI  391



>ref|XP_008455507.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=402

 Score =   345 bits (886),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 176/366 (48%), Positives = 245/366 (67%), Gaps = 14/366 (4%)
 Frame = +3

Query  183   FKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKI  353
             F +T  G   ++DI+  L  AW +ACA+T PS ++IP G +Q+ Q+LL GPC + IE+++
Sbjct  28    FDITTYGAKPNTDITQVLANAWKDACASTNPSQLLIPTGVYQLNQSLLIGPCNSTIEVRM  87

Query  354   KATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKS--DKL  527
             + TL+A P+P  +      +   ++D  T+SG G  DGQG+     +K D   K    +L
Sbjct  88    EGTLQAHPDPIGIG----LVLFRHIDQLTISGTGAFDGQGEKG--WEKNDCHLKKACTRL  141

Query  528   PNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKIC  707
             P N+  NF+ NSI++DITSL+SK FH+N+   KN+TFQ +TI AP  S NTDGIH++   
Sbjct  142   PMNVRFNFITNSIVKDITSLDSKNFHINLLSCKNVTFQNVTIIAPEKSPNTDGIHVSNSE  201

Query  708   DVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDS  887
             ++ I ++ I TGDDC+S+GDG + + I  VTCGPGHGIS+GSLGK   E+ V GVTVK  
Sbjct  202   EINILNTKISTGDDCVSVGDGNKQITITNVTCGPGHGISIGSLGKYTTEKEVAGVTVKSC  261

Query  888   KFIGTDNGLRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLV  1064
               I T NG+RIK+WP+S      +D+H+  IEM +V NPI+IDQEYCP+NQC+K+ PS +
Sbjct  262   NLINTSNGVRIKSWPDSAVAYTASDLHFEDIEMVNVSNPIIIDQEYCPSNQCNKKIPSKI  321

Query  1065  KISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKL  1238
             KI NVS+ NI+GTSAT  A+   CS  +PC+DV+  DINL++ G  G   + C N  P +
Sbjct  322   KIRNVSFKNIRGTSATFVAIKFICSKDLPCDDVEVADINLSYTGTQGRITSQCRNVIPII  381

Query  1239  TGKQTP  1256
             TGKQ P
Sbjct  382   TGKQNP  387



>ref|XP_004140444.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
 ref|XP_004157869.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=401

 Score =   345 bits (885),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 183/370 (49%), Positives = 250/370 (68%), Gaps = 18/370 (5%)
 Frame = +3

Query  183   FKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKI  353
             F VT  G   ++DI+  LL AW  ACA+T+ S ++IPKG + + Q+ LKGPCK+ IE+++
Sbjct  27    FDVTRYGAKPNTDITHALLNAWKGACASTSRSKVLIPKGIYLLSQSNLKGPCKSSIEIQV  86

Query  354   KATLKAPPNPNDMECKKEWLTI-NYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSD---  521
             + TL+APP+P     K + L I  Y+D  TLSG G  DGQG     G +K+   K     
Sbjct  87    QGTLQAPPDP-----KGDGLVILEYIDQLTLSGTGVFDGQGKA---GWEKNDCHKKKICT  138

Query  522   KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAK  701
             KLP  L  NF+ NSI++DITSL+SK FH+N+ G KN+TF+ +TI AP +S NTDGIHI+ 
Sbjct  139   KLPMTLKFNFVTNSIVKDITSLDSKNFHINLLGCKNITFEHVTISAPENSPNTDGIHISS  198

Query  702   ICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVK  881
                + I ++ I TGDDC+S+GD  +++ I  VTCGPGHGIS+GSLGK   E+ V+GV V 
Sbjct  199   SEQIRILNTKISTGDDCVSVGDSNKDITIRDVTCGPGHGISIGSLGKYTKEKAVEGVWVT  258

Query  882   DSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPS  1058
               K I T NG+RIKTWP+S      +D+H+  IEM DV NPI+IDQEYCP NQC+++ PS
Sbjct  259   KCKLIKTTNGVRIKTWPDSAVKYSASDMHFEDIEMIDVSNPILIDQEYCPWNQCNRKIPS  318

Query  1059  LVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKP  1232
              +KIS VS+ NI+GT+ T  AV + CS  +PCE V+  DI+L + G  G+  + C+N KP
Sbjct  319   SIKISKVSFKNIRGTTVTPVAVKLVCSKSIPCEAVEVADIDLKYNGNKGSITSQCANVKP  378

Query  1233  KLTGKQTPPV  1262
              ++GKQ P +
Sbjct  379   IISGKQNPRI  388



>ref|XP_010548800.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   345 bits (885),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 177/379 (47%), Positives = 248/379 (65%), Gaps = 9/379 (2%)
 Frame = +3

Query  141   FVLFLLADLGESAEFKV----TAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQ  308
             F L+LL+    +  F +    TA   SDI+  L +A+  AC    PS +VIPKGT+++ +
Sbjct  11    FALYLLSFSANAEVFDIRKFGTASVGSDITQALRQAFQAACQNPRPSSVVIPKGTYKLGE  70

Query  309   ALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIY  488
               + GPCKAP+E+ +   L+A  N N +  +++W+   Y++ F L+G G  DGQG+    
Sbjct  71    IDMVGPCKAPVEVTVNGHLQA--NGNALVGREKWVVFRYINGFKLNGAGIFDGQGNAAWK  128

Query  489   GQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPAD  668
                        KLP ++  +F+ N  +RDITSL++K FHVNV G KN TF  + IKAPA+
Sbjct  129   SNDCHKNNNCKKLPISIRFDFVLNGEVRDITSLDAKNFHVNVLGCKNFTFDNVKIKAPAE  188

Query  669   SHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTP  848
             S NTDGIH+ +   V I  S I TGDDCIS+GDG++NL+++ VTCGPGHGIS+GSLG+  
Sbjct  189   SPNTDGIHLGRSDGVNILRSFISTGDDCISVGDGMKNLHVERVTCGPGHGISIGSLGRYT  248

Query  849   GEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIVIDQEYC  1025
              E PV G+ +K+     TDNGLRIKT+P+S   + V+DIH+  I +++V NPI+IDQEYC
Sbjct  249   NEGPVAGIWIKNCTLQETDNGLRIKTYPSSASSITVSDIHFEDIIVKNVFNPILIDQEYC  308

Query  1026  PNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--G  1199
             P N+C+K KPS VK+ N+S+  I+GTS  ++AV + CS  VPC +V+ GDI+L + G  G
Sbjct  309   PWNKCNKAKPSTVKLVNISFKRIRGTSGNKDAVRLLCSKAVPCTNVEVGDIDLRYGGADG  368

Query  1200  AAKTVCSNAKPKLTGKQTP  1256
              A   CSN  PKL+G Q P
Sbjct  369   PATFQCSNVTPKLSGTQFP  387



>ref|XP_008245812.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   345 bits (884),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/353 (49%), Positives = 232/353 (66%), Gaps = 3/353 (1%)
 Frame = +3

Query  195   AEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAP  374
             A+  SD+S  L KAW +ACA+ + S +V+P GT+ +K+A  +GPCKAPIE++++ TL+AP
Sbjct  36    AKPGSDVSTALAKAWSDACASPSASKVVVPSGTYNLKEANFRGPCKAPIEMQVQGTLQAP  95

Query  375   PNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFL  554
              +   +     W+   Y+D  TLSG GT DGQG +               +P NL   FL
Sbjct  96    ADAGQLTRPDTWVGFQYIDMLTLSGGGTFDGQGALSWNQNDCHKNKNCKPIPVNLRFEFL  155

Query  555   KNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVI  734
              NS ++DITSLNSK FH++VF   + TFQ++TI AP DS NTDGIHI     + I  + I
Sbjct  156   TNSKVQDITSLNSKFFHMHVFRCNHTTFQQLTITAPDDSRNTDGIHIGASTGINITHAKI  215

Query  735   GTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGL  914
             GTGDDCISIGD    + +  VTCGPGHGIS+GSLGK   E+ V G+ VK+     TDNG+
Sbjct  216   GTGDDCISIGDDSHEITVTDVTCGPGHGISIGSLGKYKDEKDVTGIIVKNCTLTNTDNGV  275

Query  915   RIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTN  1091
             RIKT+P+S  P   + IHY  I M +V NPI++DQ YCP  QC ++ PS VKISNVS+ N
Sbjct  276   RIKTFPDSPSPSTASGIHYEDIIMVNVSNPILVDQLYCPYTQCEQKPPSKVKISNVSFKN  335

Query  1092  IKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTG  1244
             IKG+S T  AV + C++G+PCE+V+  DI+LT+ G  G   ++CSN KP + G
Sbjct  336   IKGSSFTPLAVKLVCTTGIPCENVELIDIDLTYGGDKGPLTSMCSNVKPTIAG  388



>sp|P24548.1|PGLR_OENOR RecName: Full=Exopolygalacturonase; Short=ExoPG; AltName: Full=Galacturan 
1,4-alpha-galacturonidase; AltName: Full=Pectinase, 
partial [Oenothera organensis]
 gb|AAB23476.1| polygalacturonase homolog {clone P22} [Oenothera organensis]
Length=362

 Score =   343 bits (879),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 175/354 (49%), Positives = 231/354 (65%), Gaps = 4/354 (1%)
 Frame = +3

Query  210   DISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPND  389
             D +  L  AW EACA+ +PS I++PKG F +    L+GPCK+ I L+++ TLKAP +P+ 
Sbjct  1     DSTQALTTAWKEACASASPSTILVPKGNFAVGLITLEGPCKSSIGLQLQGTLKAPADPSK  60

Query  390   MECKKEWLTINYVDDFTLSGDGTLDGQG-DVQIYGQKKDTGFKSDKLPNNLSLNFLKNSI  566
             ++    W+ +N +D  T+ G G  DGQG    +       G     L  NL L  + NSI
Sbjct  61    IK-GLGWINLNKIDLLTIFGGGVFDGQGKSAWVQNDCHKNGPICKTLSMNLRLYAVTNSI  119

Query  567   IRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGD  746
             +RD+T+L+SK FHVNV G KNLTF++  I A   S NTDGIHI +   V I ++ I TGD
Sbjct  120   LRDVTTLDSKNFHVNVIGCKNLTFERFKISAAETSINTDGIHIGRSDGVNIINTEIKTGD  179

Query  747   DCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKT  926
             DCIS+GDG +N+NI  +TCGPGHGISVGSLG+   EE V G+ VK+    G+ NG+RIKT
Sbjct  180   DCISLGDGSKNINITNITCGPGHGISVGSLGRYKNEESVVGIYVKNCTITGSQNGVRIKT  239

Query  927   WPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTS  1106
             WP S PG  +++H+  I M  V  PI+IDQ YCP NQC+ E PS VK+S +S+ NIKGTS
Sbjct  240   WPKSEPGEASEMHFQDITMNSVGTPILIDQGYCPYNQCTAEVPSSVKLSKISFKNIKGTS  299

Query  1107  ATEEAVIIACSSGVPCEDVKFGDINLTF--KGGAAKTVCSNAKPKLTGKQTPPV  1262
              T+EAV + CS   PC  V+  DI+LT+  KGG A +VC N KP + GKQ P +
Sbjct  300   TTKEAVKLVCSKSFPCNGVELADIDLTYSGKGGPATSVCENIKPTIKGKQIPAI  353



>ref|XP_010548798.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   344 bits (882),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 252/385 (65%), Gaps = 6/385 (2%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             + ++ +  + F  +  A++ +  +F   + G SDI+  L +A+  AC    PS +VIPKG
Sbjct  6     LASVLFALYLFSFWANAEVFDIRKFGTASVG-SDITQALRQAFQAACQNPRPSSVVIPKG  64

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
             T+++ +  + GPCKAP+E+ +   L+A  N N +  +++W+   Y++ F L+G G  DGQ
Sbjct  65    TYKLGEIDMVGPCKAPVEVTVNGHLQA--NGNALVGREKWVVFRYINGFKLNGAGIFDGQ  122

Query  471   GDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
             G+               KLP ++  +F+ N  +RDITSL++K FHVNV G KN TF  + 
Sbjct  123   GNAAWKSNDCHKNNNCKKLPISIRFDFVLNGEVRDITSLDAKNFHVNVLGCKNFTFDNVK  182

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             IKAPA+S NTDGIH+ +   V I  S I TGDDCIS+GDG++NL+++ VTCGPGHGIS+G
Sbjct  183   IKAPAESPNTDGIHLGRSDGVNILRSFISTGDDCISVGDGMKNLHVERVTCGPGHGISIG  242

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPIV  1007
             SLG+   E PV G+ +K+     TDNGLRIKT+P+S   + V+DIH+  I +++V NPI+
Sbjct  243   SLGRYTNEGPVAGIWIKNCTLQETDNGLRIKTYPSSASSITVSDIHFEDIIVKNVFNPIL  302

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQEYCP N+C+K KPS VK+ N+S+  I+GTS  ++AV + CS  VPC +V+ GDI+L 
Sbjct  303   IDQEYCPWNKCNKAKPSTVKLVNISFKRIRGTSGNKDAVRLLCSKAVPCTNVEVGDIDLR  362

Query  1188  FKG--GAAKTVCSNAKPKLTGKQTP  1256
             + G  G A   CSN  PKL+G Q P
Sbjct  363   YGGADGPATFQCSNVTPKLSGTQFP  387



>ref|XP_011003515.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Populus euphratica]
Length=397

 Score =   343 bits (881),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 176/386 (46%), Positives = 242/386 (63%), Gaps = 10/386 (3%)
 Frame = +3

Query  132   AFTFVLFLLADLGESAEFKVTAEGD-----SDISPELLKAWDEACAATTPSIIVIPKGTF  296
             A+     LL    + + F V A G      +D S  +  AW +ACAA   S +VI KG +
Sbjct  11    AYHLCFLLLVTQVQGSNFDVKAYGAKANGMTDDSKAINSAWKDACAAKEASTVVIAKGNY  70

Query  297   QMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGD  476
              +     +GPC AP+ +K++ TLKAP +P  +  + +W+    V+  T+SG G  DGQG 
Sbjct  71    MVGPLKFEGPCTAPVTVKVQGTLKAPADPKRL--RDDWVAFRNVEGLTVSGGGIFDGQGA  128

Query  477   VQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIK  656
             +           K + LP NL    L NS I  ITSLNSKLFH+N+    N+TFQ I I 
Sbjct  129   IAWSVNNCAKTGKCNSLPTNLQFTKLTNSKIEGITSLNSKLFHMNILNCNNVTFQNIVIN  188

Query  657   APADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSL  836
             AP +S NTDGIHI +   V I  + I TGDDC+S+GDG + +N++ VTCGPGHGIS+GSL
Sbjct  189   APKNSLNTDGIHIGRSTMVNITGATIKTGDDCVSLGDGCQQINVEKVTCGPGHGISIGSL  248

Query  837   GKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQ  1016
             G+   E+PV GVTV++     T+NG+RIKTWP S  GV +++++  I M +V NPI+IDQ
Sbjct  249   GRYHDEQPVIGVTVRNCTLTNTENGVRIKTWPASPSGVASNVNFEDIIMNNVSNPILIDQ  308

Query  1017  EYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG  1196
             EYCP N C  + PS VKIS+V +  I+GTSAT+ AV I CS G+PC++V   DINL + G
Sbjct  309   EYCPYNNCLAKVPSRVKISDVRFEGIRGTSATQVAVKIVCSRGLPCQNVFVEDINLVYNG  368

Query  1197  --GAAKTVCSNAKPKLTGKQTPPVTC  1268
               G++ ++C+N KP+++GK   P TC
Sbjct  369   KEGSSTSLCANVKPQVSGK-VFPATC  393



>ref|XP_008229849.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   344 bits (882),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 181/382 (47%), Positives = 238/382 (62%), Gaps = 8/382 (2%)
 Frame = +3

Query  135   FTFVLFLLADLGESAEFKVTA-----EGDSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             F F+L       +SA   VT+     + DSDI+  L KAW +ACA+T PS IV+PKGTF+
Sbjct  12    FVFLLLASTAKAQSAALDVTSAKYGGKPDSDITQALEKAWTDACASTAPSKIVVPKGTFK  71

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
                   KGPCKA IE +++ TL+AP + + +     W+  ++VD  TLSG GT DGQG +
Sbjct  72    FVGTTFKGPCKAAIEFQLQGTLQAPADGSQLPKDDTWIGFDHVDGLTLSGGGTFDGQGAL  131

Query  480   QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKA  659
                    +   +      NL  +FL NS I D+TS +SK FHVN+   + +     T+ A
Sbjct  132   SWKNNDCNKNRQCKSKHINLRFHFLTNSKILDVTSKDSKNFHVNLLKCEKVEINGFTVSA  191

Query  660   PADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLG  839
             P +S NTDGIHI +   + I D+ IGTGDDCISIGDG ++L +  VTCGPGHGI++GSLG
Sbjct  192   PKESMNTDGIHIGRSTGIDIIDTTIGTGDDCISIGDGTKDLTVTNVTCGPGHGIAIGSLG  251

Query  840   KTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQ  1016
             + P EEPV G+ +K      T NG+RIKTWP S   G  +DIH+  I M +V NPI+IDQ
Sbjct  252   RYPEEEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPILIDQ  311

Query  1017  EYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG  1196
             EYCP N+C K  PS +KISNVS+ NIKGT     AV +ACS G+PCE+V+  DI+L + G
Sbjct  312   EYCPWNECKKGAPSKIKISNVSFKNIKGTCTDPVAVKLACSPGLPCENVELSDIDLKYTG  371

Query  1197  --GAAKTVCSNAKPKLTGKQTP  1256
               G   +VCSN KP +     P
Sbjct  372   DKGPITSVCSNVKPTINRVAQP  393



>gb|ABE77145.1| putative polygalacturonase [Fragaria x ananassa]
Length=405

 Score =   343 bits (881),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 176/391 (45%), Positives = 249/391 (64%), Gaps = 8/391 (2%)
 Frame = +3

Query  117   TIFYCAFTFVLFLLADLGESAEFKVTA-----EGDSDISPELLKAWDEACAATTPSIIVI  281
             ++F  + +     +A      +F VT+     + ++DIS  L  AW +ACAATTPS +++
Sbjct  12    SVFLLSSSAYASRVAQFLAPGDFDVTSPKYGGKPNTDISQPLANAWKDACAATTPSRVIV  71

Query  282   PKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTL  461
             PKGTFQ+K A+ KGPCKAPI +++   L+APP    +  K+ W+    V+  T+SG GT 
Sbjct  72    PKGTFQLKGAVFKGPCKAPITVQVDGILQAPPIEAQLANKEFWVQFLEVERLTVSGTGTF  131

Query  462   DGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQ  641
             DGQG         +       L  N+  + +KNS++RD+TSLNSK FH N+ G ++LTFQ
Sbjct  132   DGQGQNSWKDNDCNKNPNCGGLAINVRFDRVKNSLVRDVTSLNSKNFHFNILGCEHLTFQ  191

Query  642   KITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGI  821
              + +KAP DS NTDGIH+ +   + I D+ IGTGDDCIS+GDG   L +  V+CGPGHGI
Sbjct  192   HVIVKAPGDSPNTDGIHMGRSTRINITDTNIGTGDDCISVGDGTRQLTVSKVSCGPGHGI  251

Query  822   SVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNS-HPGVVTDIHYHKIEMEDVKN  998
             S+GSLG+   E+ V G+ ++D     T NG+RIKT+P S      +DIH+ KI M +V N
Sbjct  252   SIGSLGRYDNEDDVSGLNIRDCTLSNTLNGVRIKTFPASPKATTASDIHFEKITMNNVAN  311

Query  999   PIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDI  1178
             P++IDQEYCP  QC+K+ PS VKISNVS+ NI GT++T EA+ I C+ G+ C+ V   DI
Sbjct  312   PVLIDQEYCPWGQCNKQIPSKVKISNVSFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDI  371

Query  1179  NLTFKG-GAAKTVCSNAKPKLTGKQTPPVTC  1268
             +L   G G   + C+N +P +T +  PP+ C
Sbjct  372   DLKLSGKGTLTSHCANVQPTIT-RVPPPLAC  401



>ref|XP_008229852.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=403

 Score =   343 bits (881),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 179/376 (48%), Positives = 237/376 (63%), Gaps = 8/376 (2%)
 Frame = +3

Query  135   FTFVLFLLADLGESAEFKVTA-----EGDSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             F F+L       +SA   VT+     + DSDI+  L KAW +ACA+T PS IV+PKGTF+
Sbjct  12    FVFLLLASTAKAQSAALDVTSAKYGGKPDSDITQALEKAWTDACASTAPSKIVVPKGTFK  71

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
                   KGPCKA IE +++ TL+AP + + +     W+  ++VD  TLSG GT DGQG +
Sbjct  72    FVGTTFKGPCKAAIEFQLQGTLQAPADGSQLPKDDTWIGFDHVDGLTLSGGGTFDGQGAL  131

Query  480   QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKA  659
                    +   +      NL  +FL NS I D+TS +SK FHVN+   + +     T+ A
Sbjct  132   SWKNNDCNKNRQCKSKHINLRFHFLTNSKILDVTSKDSKNFHVNLLKCEKVEINGFTVSA  191

Query  660   PADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLG  839
             P +S NTDGIHI +   + I D+ IGTGDDCISIGDG ++L +  VTCGPGHGI++GSLG
Sbjct  192   PKESMNTDGIHIGRSTGINITDTTIGTGDDCISIGDGTKDLTVTNVTCGPGHGIAIGSLG  251

Query  840   KTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQ  1016
             + P EEPV G+ +K      T NG+RIKTWP S   G  +DIH+  I M +V NPI+IDQ
Sbjct  252   RYPEEEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPILIDQ  311

Query  1017  EYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG  1196
             EYCP N+C K  PS VKISNVS+ NIKGT     AV +AC+ G+PCE+V+  DI++ + G
Sbjct  312   EYCPWNECKKGVPSKVKISNVSFKNIKGTCTDPVAVKLACAPGLPCENVELSDIDIKYTG  371

Query  1197  --GAAKTVCSNAKPKL  1238
               G   +VCSN KP +
Sbjct  372   DKGPITSVCSNVKPTI  387



>ref|XP_004295350.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase clone GBGA483-like 
[Fragaria vesca subsp. vesca]
Length=400

 Score =   343 bits (880),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 176/395 (45%), Positives = 247/395 (63%), Gaps = 4/395 (1%)
 Frame = +3

Query  99    TKR*MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIV  278
             +K  + T F     F L   A   +  ++   A+G +D S  + KAW +AC AT+ S +V
Sbjct  3     SKSFLGTCFLFLVAFSLTANAADFDVRKYGAKADGKTDDSQAINKAWTDACTATSQSTVV  62

Query  279   IPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGT  458
             I K  + +      GPCKAPI +K+  TL AP  P  ++ +  W+    VD+ ++ G   
Sbjct  63    IEKRNYLVGPVRFGGPCKAPISIKVAGTLVAPAEPEKLKSQDGWVVFQNVDNLSVFGGXV  122

Query  459   LDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTF  638
              DGQG +           K + LP N+ +  + NS I+D TSLNSKLFH+NV   K+LT 
Sbjct  123   FDGQGKLAWSRNDFAKTGKCNSLPINIRITGVTNSHIQDKTSLNSKLFHINVINSKHLTL  182

Query  639   QKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHG  818
             Q+ITI AP +S NTDGIHI +   + + D+ I TGDDC+S+GDG +N+N++ VTCG GHG
Sbjct  183   QRITIDAPQESLNTDGIHIGRSSYINVTDANIKTGDDCVSLGDGSQNINVEKVTCGSGHG  242

Query  819   ISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVK-  995
             IS+GSLG+   E+PV+GVTV+  +   T NG+RIKTWP S  GV +D+H+  I M++VK 
Sbjct  243   ISIGSLGRYHDEQPVQGVTVRYCQISNTTNGVRIKTWPASPNGVASDLHFEDISMDNVKT  302

Query  996   NPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGD  1175
             NP+++DQEYCP  QC  + PS VKISNVS+ NI+GT+    AV + CS G+PC++V+  D
Sbjct  303   NPVLVDQEYCPYGQCQAKLPSKVKISNVSFKNIRGTTQDLVAVKLVCSRGIPCQNVQVAD  362

Query  1176  INLTFKG---GAAKTVCSNAKPKLTGKQTPPVTCK  1271
             INLT+ G   G A + C+N KP ++G   P V  K
Sbjct  363   INLTYNGNKNGTAISECANVKPTVSGFNHPQVCAK  397



>ref|XP_008465833.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=384

 Score =   342 bits (877),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 181/370 (49%), Positives = 242/370 (65%), Gaps = 14/370 (4%)
 Frame = +3

Query  177   AEFKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIEL  347
             A+F VT  G   ++DI   L  AW  AC +T+ S ++IP+ T+++ +  L GPCK  I++
Sbjct  9     ADFDVTKFGAMPNTDIFQALTNAWKAACGSTSQSQVLIPEETYKLSKIELTGPCKNRIQI  68

Query  348   KIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGF--KSD  521
             +++  L+AP +      +  W++  Y+D FTL+G G  DGQG V  +G K D     K  
Sbjct  69    QLQGILQAPAD----LAEDNWISFKYIDQFTLTGKGVFDGQGKVA-WG-KNDCAINPKCA  122

Query  522   KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAK  701
             K   N+  +F+KN+I+ DITS +SK FH NV G KNLTFQ + I AP DS NTDGIHI +
Sbjct  123   KFAINVRFDFIKNAIVSDITSKDSKSFHFNVLGCKNLTFQNVNINAPEDSPNTDGIHIGR  182

Query  702   ICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVK  881
                + + ++ IGTGDDCIS+GDG + + I  VTCGPGHGISVGSLG+  GE PV+G+  K
Sbjct  183   SIGINVINTNIGTGDDCISLGDGSQQVAITNVTCGPGHGISVGSLGRYVGEAPVQGIRAK  242

Query  882   DSKFIGTDNGLRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPS  1058
             +   I T NG+RIKT P+S   GV +DIH+  I M +V NP+VIDQEYCP+NQC K+ PS
Sbjct  243   NCTLINTTNGVRIKTRPSSPSLGVASDIHFEDIIMVNVINPMVIDQEYCPSNQCDKKNPS  302

Query  1059  LVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGGA--AKTVCSNAKP  1232
              VKISNVS+TNI+GT+A   AV   CSS  PCED+K  DINLT+ G      + C   KP
Sbjct  303   KVKISNVSFTNIRGTAANALAVSFVCSSQFPCEDIKVTDINLTYNGSGDPISSTCKYVKP  362

Query  1233  KLTGKQTPPV  1262
              ++G Q P +
Sbjct  363   IVSGIQNPQI  372



>ref|XP_008366919.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Malus 
domestica]
Length=447

 Score =   344 bits (883),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 181/380 (48%), Positives = 244/380 (64%), Gaps = 17/380 (4%)
 Frame = +3

Query  132   AFTFVLFLLADLGESAE-FKVT-----AEGDSDISPELLKAWDEACAATTPSIIVIPKGT  293
             +F+  LFL +     AE F VT          DI+  L  AW +AC++  P+ +VIP+G 
Sbjct  37    SFSVFLFLASIANAKAEVFYVTNSTYGGNPSGDITLALADAWRDACSSPWPAKVVIPEGE  96

Query  294   FQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQG  473
             + ++ A+L GPCK+PIE++++  L+AP   + +  +  W+   YVD  TL G GT DGQ 
Sbjct  97    YYLRGAILHGPCKSPIEVQVQGYLRAPQESSQLLQQNTWVGFQYVDRLTLFGGGTFDGQS  156

Query  474   DVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITI  653
             +   Y        +S+++  NL  +F+ NS+I  ITSL+SK FH+NVF  +N+TFQ +TI
Sbjct  157   NCHKY-----KSCQSNRV-FNLRFDFVTNSVIEGITSLDSKNFHINVFACRNVTFQYVTI  210

Query  654   KAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGS  833
              AP DS NTDGIHI +   VTI  ++IGTGDDCIS+GDG +N+ +  VTCGPGHGIS+GS
Sbjct  211   TAPEDSVNTDGIHIGRSFGVTIDHTIIGTGDDCISLGDGSQNIVVTBVTCGPGHGISIGS  270

Query  834   LGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVT--DIHYHKIEMEDVKNPIV  1007
             LGK P EEPV GV VK+     T NG+RIKTWP S P   T   IH+  I M +V NPI 
Sbjct  271   LGKYPDEEPVVGVRVKNCTLTNTQNGVRIKTWPGS-PTFTTASHIHFQXIXMVNVSNPIS  329

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQEYCP   C K+ PS VKIS++S+TNIKG+SAT  AV + CS  +PC+ V   D++LT
Sbjct  330   IDQEYCPYTYCGKDDPSKVKISDISFTNIKGSSATPVAVKLMCSRKIPCDGVGLTDVDLT  389

Query  1188  FKG--GAAKTVCSNAKPKLT  1241
             + G  G   + C+  KP +T
Sbjct  390   YIGSKGPLTSQCAYVKPYIT  409



>ref|XP_004293444.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=405

 Score =   343 bits (879),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 177/391 (45%), Positives = 248/391 (63%), Gaps = 8/391 (2%)
 Frame = +3

Query  117   TIFYCAFTFVLFLLADLGESAEFKVTA-----EGDSDISPELLKAWDEACAATTPSIIVI  281
             ++F  + +     +A      +F VT+     + ++DIS  L  AW +ACAATTPS +++
Sbjct  12    SVFLLSSSAYASRVAQFLAPGDFDVTSPKYGGKPNTDISQPLANAWKDACAATTPSRVIV  71

Query  282   PKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTL  461
             PKGTFQ+K A+ KGPCKAPI +++   L+APP    +  K+ W+    V+  T+SG GT 
Sbjct  72    PKGTFQLKGAVFKGPCKAPITVQVDGILQAPPIEAQLANKEFWVQFLEVERLTVSGTGTF  131

Query  462   DGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQ  641
             DGQG         +       L  N+  + +KNS++RD+TSLNSK FH N+ G ++LTFQ
Sbjct  132   DGQGQNSWKDNDCNKNPNCGGLAINVRFDKVKNSLVRDVTSLNSKNFHFNILGCEHLTFQ  191

Query  642   KITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGI  821
              +TIKAP DS NTDGIH+ +   + I D  IGTGDDCIS+GDG   L +  V+CGPGHGI
Sbjct  192   HVTIKAPGDSPNTDGIHMGRSTGINITDMNIGTGDDCISVGDGTRQLTVSKVSCGPGHGI  251

Query  822   SVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNS-HPGVVTDIHYHKIEMEDVKN  998
             S+GSLG+   E+ V G+ ++D     T NG+RIKT+P S      +DIH+ KI M +V N
Sbjct  252   SIGSLGRYDNEDDVSGLNIRDCTLSNTLNGVRIKTFPASPKATTASDIHFEKITMNNVAN  311

Query  999   PIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDI  1178
             P++IDQEYCP  QC+K+ PS VKISNVS+ NI GT++T EA+ I C+ G+ C+ V   DI
Sbjct  312   PVLIDQEYCPWGQCNKQIPSKVKISNVSFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDI  371

Query  1179  NLTFKG-GAAKTVCSNAKPKLTGKQTPPVTC  1268
             +L   G G   + C+N +P +  +  PP+ C
Sbjct  372   DLKLSGKGTLTSHCANVQPTI-ARVPPPLAC  401



>ref|XP_008381794.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=401

 Score =   342 bits (877),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 177/387 (46%), Positives = 246/387 (64%), Gaps = 17/387 (4%)
 Frame = +3

Query  135   FTFVLFLLADLGESAEFKVTA-----EGDSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             F F+L + +   +S  + VT      + +SDI+  L KAW +ACA+T+ S IV+P GT++
Sbjct  12    FVFLLLVSSSNAQSGVYDVTGANYGGKANSDITQALSKAWTDACASTSASKIVVPSGTYK  71

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
                A  KGPCK PIE +++ TL+AP +  ++  +  W+    +D  TLSG GT DGQG  
Sbjct  72    FVGATFKGPCKGPIEFQLQGTLQAPEHIKELPKEDTWVAFERIDGLTLSGGGTFDGQGAT  131

Query  480   QIY----GQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKI  647
                     + KD  FK+     NL  NF+ NSI+R IT+ +SK FHVN+ G   L FQ  
Sbjct  132   AWKQNDCHKNKDCKFKAV----NLRFNFITNSIVRGITTKDSKNFHVNLLGCNKLAFQDF  187

Query  648   TIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISV  827
             T+ AP +S NTDGIH+ +  ++ I D+ IGTGDDCISIG G + L++  VTCGPGHGIS+
Sbjct  188   TVSAPKESVNTDGIHMGRSTEINITDTTIGTGDDCISIGHGTKQLHVTNVTCGPGHGISI  247

Query  828   GSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNS--HPGVVTDIHYHKIEMEDVKNP  1001
             GSLG+T  EEPV G+ +K+     TDNG+RIKTWP S      V+D+H+  I M++VKNP
Sbjct  248   GSLGRTEDEEPVSGIFIKNCTITNTDNGVRIKTWPASPAKGTAVSDVHFZDIIMDNVKNP  307

Query  1002  IVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDIN  1181
             +VIDQEYCP+  C+ E  S VKISNVS+ NIKG+S+    V + CS  +PCE+V+  +I+
Sbjct  308   VVIDQEYCPHKLCTPEVSSKVKISNVSFKNIKGSSSGPVGVKLLCSGKLPCENVELSNID  367

Query  1182  LTFKG--GAAKTVCSNAKPKLTGKQTP  1256
             LT+ G  G+  + C + KP +     P
Sbjct  368   LTYTGDKGSITSECKHVKPTINNVAKP  394



>ref|XP_008245680.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=403

 Score =   342 bits (877),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 241/386 (62%), Gaps = 9/386 (2%)
 Frame = +3

Query  135   FTFVLFLLADLGESAEFKVTA-----EGDSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             F F+L       +SA   VT+     + DSDI+  L KAW +ACA+T PS IV+PKGTF+
Sbjct  12    FVFLLLASTAKAQSAALDVTSAKYGGKPDSDITQALEKAWTDACASTAPSKIVVPKGTFK  71

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
                   KGPCKA IE +++ TL+AP + + +     W+  ++VD  TLSG GT DGQG +
Sbjct  72    FVGTTFKGPCKAAIEFQLQGTLQAPADGSQLPKDDTWIGFDHVDGLTLSGGGTFDGQGAL  131

Query  480   QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKA  659
                    +   +      NL  +FL NS I D+TS +SK FHVN+   + +     TI A
Sbjct  132   SWKNNDCNKNRQCKSKHINLRFHFLTNSKILDVTSKDSKNFHVNLQKCEKVEINGFTISA  191

Query  660   PADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLG  839
             P +S NTDGIHI +   + I D+ IGTGDDCISIGDG ++L +  VTCGPGHGI++GSLG
Sbjct  192   PKESMNTDGIHIGRSTGIDIIDTTIGTGDDCISIGDGTKDLTVTNVTCGPGHGIAIGSLG  251

Query  840   KTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVIDQ  1016
             + P EEPV G+ +K      T NG+RIKTWP S   G  +DIH+  I M +V NPI+IDQ
Sbjct  252   RYPEEEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPILIDQ  311

Query  1017  EYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG  1196
             EYCP N+C K  PS VKISNVS+ NIKGT     AV +AC+ G+PCE+V+  DI+L + G
Sbjct  312   EYCPWNECKKGVPSKVKISNVSFKNIKGTCTDPVAVKLACAPGLPCENVELSDIDLKYIG  371

Query  1197  --GAAKTVCSNAKPKLTGKQTPPVTC  1268
               G   +VCSN KP +  +   P+ C
Sbjct  372   DKGPITSVCSNVKPTIN-RVAQPLAC  396



>gb|AAP37458.1| polygalacturonase [Fragaria x ananassa]
Length=405

 Score =   342 bits (877),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 179/392 (46%), Positives = 247/392 (63%), Gaps = 17/392 (4%)
 Frame = +3

Query  141   FVLFLL---------ADLGESAEFKVTA-----EGDSDISPELLKAWDEACAATTPSIIV  278
             F +FLL         A      +F VT+     + ++DIS  L  AW +ACAATTPS ++
Sbjct  11    FSVFLLSSSAYASRVAQFLAPGDFDVTSPKYGGKPNTDISQPLANAWKDACAATTPSRVI  70

Query  279   IPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGT  458
             +PKGTFQ+K A+ KGPCKAPI +++   L+APP    +  K+ W+    V+  T+SG GT
Sbjct  71    VPKGTFQLKGAVFKGPCKAPITVQVDGILQAPPIEAQLANKEFWVQFLEVERLTVSGTGT  130

Query  459   LDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTF  638
              DGQG         +       L  N+  + +KNS++RD+TSLNSK FH N+ G ++LTF
Sbjct  131   FDGQGQNSWKDNDCNKNPNCGGLAINVRFDRVKNSLVRDVTSLNSKNFHFNILGCEHLTF  190

Query  639   QKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHG  818
             Q + +KAP DS NTDGIH+ +   + I D+ IGTGDDCIS+GDG   L +  V+CGPGHG
Sbjct  191   QHVIVKAPGDSPNTDGIHMGRSTRINITDTNIGTGDDCISVGDGTRQLTVSKVSCGPGHG  250

Query  819   ISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNS-HPGVVTDIHYHKIEMEDVK  995
             IS+GSLG+   E+ V G+ ++D     T NG+RIKT+P S      +DIH+ KI M  V 
Sbjct  251   ISIGSLGRYDNEDDVSGLNIRDCTLSNTLNGVRIKTFPASPKATTASDIHFEKITMNYVA  310

Query  996   NPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGD  1175
             NP++IDQEYCP  QC+K+ PS VKISNVS+ NI GT++T EA+ I C+ G+ C+ V   D
Sbjct  311   NPVLIDQEYCPWGQCNKQIPSKVKISNVSFKNIIGTTSTAEALKIVCAKGLHCDQVVLSD  370

Query  1176  INLTFKG-GAAKTVCSNAKPKLTGKQTPPVTC  1268
             I+L   G G   + C+N +P +T +  PP+ C
Sbjct  371   IDLKLSGKGTLTSHCANVQPTIT-RVPPPLAC  401



>ref|XP_010464426.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=398

 Score =   341 bits (874),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 179/377 (47%), Positives = 245/377 (65%), Gaps = 8/377 (2%)
 Frame = +3

Query  147   LFLLADLGESAE----FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQAL  314
             +F+L  +G SA     F V A   SDI+  LLKA+  AC  T PS +VIPKG F++ + +
Sbjct  10    IFVLCLVGFSANAHEVFNVNAPPGSDITQALLKAFTAACQCTAPSRVVIPKGEFKLCEII  69

Query  315   LKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQ  494
             + GPCKAPIE+ +  TL A    N    K +W+    ++ F L+G GT DG+G       
Sbjct  70    MTGPCKAPIEINLLGTLLAD-GSNIHHGKDKWVVFRKINGFKLNGGGTFDGEGSAAWRVN  128

Query  495   KKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSH  674
                      KLP ++  +F+ N+ IRDI+S++SK FHVNV G  N+TF  + I APA+S 
Sbjct  129   NCHKTSNCKKLPISIRFDFVTNAEIRDISSVDSKNFHVNVIGAMNMTFDNVKILAPAESP  188

Query  675   NTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGE  854
             NTDGIH+ +   V+I +S I TGDDCIS+GDG+ NL +  V CGPGHGIS+GSLG+ P E
Sbjct  189   NTDGIHLGRSDGVSIINSRISTGDDCISVGDGMVNLLVKNVVCGPGHGISIGSLGRYPHE  248

Query  855   EPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPN  1031
             + V+G+ V +     TDNGLRIKTWP +    V + IH+  I +++V NPI+IDQEYCP 
Sbjct  249   QNVRGIKVINCTVQETDNGLRIKTWPTAACSTVASGIHFEDIILKNVSNPILIDQEYCPW  308

Query  1032  NQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAA  1205
             NQC+K+K S +K+ +VS+TNI+GTS  ++AV + CS G PCE+V  G+IN+ + G  G A
Sbjct  309   NQCNKQKSSSIKLIDVSFTNIRGTSGNKDAVKLLCSKGYPCENVVVGNINIEYTGRDGPA  368

Query  1206  KTVCSNAKPKLTGKQTP  1256
               +CSN KP+L G Q P
Sbjct  369   TFMCSNVKPRLVGIQNP  385



>ref|XP_002526193.1| hypothetical protein RCOM_0764760 [Ricinus communis]
 gb|EEF36197.1| hypothetical protein RCOM_0764760 [Ricinus communis]
Length=392

 Score =   340 bits (873),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 180/377 (48%), Positives = 233/377 (62%), Gaps = 11/377 (3%)
 Frame = +3

Query  135   FTFVLFLLADLGESAE-------FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGT  293
              T  + L   L   AE       F  T    +DIS  LL AW  AC+    S I+IP   
Sbjct  8     LTIFVLLSISLKIRAEKVFDVKNFGATPSQKNDISKALLDAWKAACSTPGASRILIPHAK  67

Query  294   FQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQG  473
             + ++  LL+GPCK  + L+IK TL AP +P++    + W+T  +VD  T+SG G LDG+G
Sbjct  68    YALRDVLLEGPCKGSMVLQIKGTLMAPSDPSEHH-SQGWITFQHVDHLTISG-GNLDGRG  125

Query  474   DVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITI  653
              +        T      LP NL  +F+ N+II D+TS +SK FH+N+ G +N T Q+I I
Sbjct  126   KIAWGKNTCRTNVNCKNLPMNLRFDFVTNTIIEDLTSRDSKNFHMNLIGCQNFTLQRIKI  185

Query  654   KAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGS  833
              AP DS NTDGIHI +   V I DS IGTGDDCISIGDG  N+ I GV CGPGHGIS+GS
Sbjct  186   IAPGDSANTDGIHIGRSNGVNIIDSKIGTGDDCISIGDGSRNIKITGVRCGPGHGISIGS  245

Query  834   LGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVID  1013
             LGK   EEPV GV VK    I T NG+RIK+WP  + G  TD+H+  I M +V N I+ID
Sbjct  246   LGKYKNEEPVSGVYVKKCDLINTTNGIRIKSWPGLYSGTATDLHFEDISMNNVSNAILID  305

Query  1014  QEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFK  1193
             Q YCP N C+ +  S VKIS V+++NIKGTS+    V + CS G+PCE V+  +IN+ +K
Sbjct  306   QMYCPWNHCNSKASSNVKISKVTFSNIKGTSSIPTIVKLLCSKGLPCEGVELNNINVVYK  365

Query  1194  G--GAAKTVCSNAKPKL  1238
             G  G AK+ C+N KPK+
Sbjct  366   GPEGPAKSECTNVKPKI  382



>gb|AAO24261.1| putative pollen polygalacturonase [Turnera subulata]
Length=382

 Score =   340 bits (872),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 173/349 (50%), Positives = 229/349 (66%), Gaps = 6/349 (2%)
 Frame = +3

Query  207   SDISPELLKAWD-EACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNP  383
             +DI+  L  A+  +ACA+ TPS +V+P G + M    +KGPCK+ +E+++   LKAP  P
Sbjct  36    ADIAEALSAAFQKDACASATPSKVVVPAGEYTMGPVDMKGPCKSTVEVQVDGNLKAPAEP  95

Query  384   NDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNS  563
                  +  W++  Y+D  T SG G  DGQG +       +        P N     LK++
Sbjct  96    KG---EPGWVSFEYIDGLTFSGKGVFDGQGHIAWANNNCNKNPNCKSFPLNFRFTSLKHA  152

Query  564   IIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTG  743
             +I+D+TS +SK FHVNV   +N+TFQ   I APA+S NTDGIH+ +   + I DS IGTG
Sbjct  153   LIKDLTSKDSKNFHVNVINCENVTFQNFVIDAPAESLNTDGIHMGRSKGIKIIDSKIGTG  212

Query  744   DDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIK  923
             DDCISIGDG E + + GVTCGPGHGIS+GSLG+   E+PV+GV VK+     TDNG+RIK
Sbjct  213   DDCISIGDGTEQVTVTGVTCGPGHGISIGSLGRYDNEQPVRGVLVKNCILKNTDNGVRIK  272

Query  924   TWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGT  1103
             +WP    G  +DIH+  I ME+V NP++IDQEYCP NQC+K+ PS VKISNVS+ NIKGT
Sbjct  273   SWPAMKGGEASDIHFEDITMENVTNPVIIDQEYCPWNQCTKDAPSKVKISNVSFKNIKGT  332

Query  1104  SATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTG  1244
             + T EAV I CSS +PCE V+   I+L + G  G AK+ C NAK  +TG
Sbjct  333   TNTPEAVKIICSSALPCEQVQLNGIDLKYTGTQGPAKSECKNAKLTVTG  381



>ref|XP_006395214.1| hypothetical protein EUTSA_v10004361mg [Eutrema salsugineum]
 gb|ESQ32500.1| hypothetical protein EUTSA_v10004361mg [Eutrema salsugineum]
Length=396

 Score =   340 bits (873),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 248/385 (64%), Gaps = 6/385 (2%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M   F  +  FV  LL     +  FK+T+   SDI+  LLK ++EAC   T + ++IPKG
Sbjct  1     MGVHFGISTLFVFCLLGLSANAKVFKITSPTGSDITSALLKTFNEACQFPTKATVMIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              +++ +  + GPCKAPI + ++ T+KA  N   ++ K  W+    ++ F L+G G  DG+
Sbjct  61    EYKLGEIEMVGPCKAPIRIALQGTVKADGN---IKGKDFWVAFKKINGFKLNGGGVFDGE  117

Query  471   GDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
             G+           F+  KLP ++  +F+ ++ IR ITSL+SK FH+NV G KN+TF+ I 
Sbjct  118   GNAAWRVNNCHKTFECKKLPISVRFDFVTDAKIRGITSLDSKNFHINVIGAKNMTFEDIK  177

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             I APA S NTDGIH+ +   + I +S I TGDDCIS+GDG+ NL ++ VTCGPGHGISVG
Sbjct  178   IVAPAGSPNTDGIHVGRSDGIKIINSFISTGDDCISVGDGMRNLLVERVTCGPGHGISVG  237

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIV  1007
             SLG+   EE V G+ V +     TDNG+RIKTWP++      ++IH+  I +++V NPI+
Sbjct  238   SLGRYGHEEDVTGIRVVNCTLQNTDNGVRIKTWPSAKCATTASEIHFENILLKNVSNPIL  297

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQEYCP NQC+K+KPS +K+ N+S+  I+GTS  ++AV + CS G PC++V+ GDIN+ 
Sbjct  298   IDQEYCPWNQCNKQKPSTIKLVNISFKKIRGTSGNKDAVKLLCSKGYPCKNVEIGDINIK  357

Query  1188  FKG--GAAKTVCSNAKPKLTGKQTP  1256
             + G  G A   CSN  PKL G Q P
Sbjct  358   YTGADGPATFSCSNVSPKLKGTQVP  382



>ref|XP_010667847.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=400

 Score =   340 bits (872),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/364 (47%), Positives = 230/364 (63%), Gaps = 4/364 (1%)
 Frame = +3

Query  186   KVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATL  365
             K+ A+ + D +  L+ AW +ACAA  P+ IV+P G+F +      GPCKA + ++I    
Sbjct  30    KLGAKPNGDATQGLMAAWKQACAAPAPTKIVVPPGSFLLNVIKFTGPCKAAVTIEIAGNF  89

Query  366   KAPPNPNDMECKKEWLTINYVDDFT---LSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNN  536
             KAPPNP  M+    W+ I  +   T   L   GT DGQG +             + LP N
Sbjct  90    KAPPNPAQMKGSDTWVKIENIQGLTINCLPTGGTFDGQGQMAWKQNNCAKTGSCNNLPYN  149

Query  537   LSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVT  716
                N L NS I  I SLNSKL+H+ V G KN T    TI+AP DS NTDGIHI +   + 
Sbjct  150   FRFNSLTNSKISGIKSLNSKLYHMGVLGCKNFTLFDTTIQAPKDSLNTDGIHIGRSAGIF  209

Query  717   IKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFI  896
             +  + IGTGDDCIS+GDG  +++I+ +TCGPGHGIS+GSLG+   E PV GVTVK     
Sbjct  210   VTKAKIGTGDDCISMGDGAVDVHIEDITCGPGHGISIGSLGRYQKEAPVTGVTVKKCTIS  269

Query  897   GTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISN  1076
              TDNG+RIK+W NS   + +++H+  I +++V NPI+IDQEYCP N C  + PS VK+SN
Sbjct  270   DTDNGVRIKSWLNSFEAIASNLHFEDITVKNVLNPILIDQEYCPYNHCKAKTPSKVKLSN  329

Query  1077  VSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGGAAKTVCSNAKPKLTGKQTP  1256
             +S+ NI+GT+ ++EAV I CSSG PC+ V+  DI+LTF GG A ++C N KP  +GKQ  
Sbjct  330   ISFKNIRGTAGSKEAVKILCSSGAPCDKVELADIDLTFNGGHAVSMCKNVKPITSGKQN-  388

Query  1257  PVTC  1268
             PV C
Sbjct  389   PVAC  392



>ref|XP_009365183.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=401

 Score =   340 bits (871),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 178/385 (46%), Positives = 246/385 (64%), Gaps = 15/385 (4%)
 Frame = +3

Query  141   FVLFLLADL--GESAEFKVTA-----EGDSDISPELLKAWDEACAATTPSIIVIPKGTFQ  299
             FV  LLA     +S  + VT      + +SDI+  L KAW +ACA+T+ S IV+P GT++
Sbjct  12    FVYLLLASTSNAQSGVYDVTGANYGGKANSDITQALSKAWTDACASTSASKIVVPSGTYK  71

Query  300   MKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDV  479
                A  KGPCKAPIE +++ T++AP +  ++  +  W+    +D  TLSG G  DGQG  
Sbjct  72    FVGATFKGPCKAPIEFQLQGTVQAPEHIKELPKEDTWVAFERIDGLTLSGGGIFDGQGTT  131

Query  480   QIYGQ--KKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITI  653
                     K+   KS  +  NL  NF+ NSI+R+IT+ +SK FHVN+ G  NL FQ  T+
Sbjct  132   AWKQNDCHKNKNCKSKAV--NLRFNFVTNSIVREITTKDSKNFHVNLLGCNNLAFQHFTV  189

Query  654   KAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGS  833
              AP +S NTDGIH+ +  ++ I D+ IGTGDDCISIG G + L++  VTCGPGHGIS+GS
Sbjct  190   SAPKESVNTDGIHMGRSTEINITDTTIGTGDDCISIGHGTKQLHVTNVTCGPGHGISIGS  249

Query  834   LGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNS--HPGVVTDIHYHKIEMEDVKNPIV  1007
             LG+T  EEPV G+ +K+     TDNG+RIKTWP S      V+D+H+  I M++VKNP+V
Sbjct  250   LGRTEDEEPVSGIFIKNCTISNTDNGVRIKTWPASPAKGTAVSDVHFEDIIMDNVKNPVV  309

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQEYCP+  C+ E  S VKISNVS+ NIKG+S+    V + CS  +PCE+V+  +I+LT
Sbjct  310   IDQEYCPHKLCTPEVSSKVKISNVSFKNIKGSSSGPVGVKLLCSGKLPCENVELSNIDLT  369

Query  1188  FKG--GAAKTVCSNAKPKLTGKQTP  1256
             + G  G+  + C + KP +     P
Sbjct  370   YTGDKGSLTSECKHVKPTINNVAKP  394



>ref|XP_010439352.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   339 bits (870),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 170/386 (44%), Positives = 250/386 (65%), Gaps = 7/386 (2%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAE-FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPK  287
             M  + +    F +F L  L  +A+ F + ++   DI+  LLKA++EAC   T S ++IPK
Sbjct  1     MGRVNFGVSAFFIFCLLGLSANAKVFNIGSKPGCDITKALLKAFNEACQFPTKSTVLIPK  60

Query  288   GTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDG  467
             G +++ +  + GPCKAPI + ++ T+KA  N    E   +W+    +D F L+G G  DG
Sbjct  61    GEYKLGEIEMTGPCKAPIRIALQGTVKADGNAVHSE---KWIAFRNIDGFKLNGGGVFDG  117

Query  468   QGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKI  647
             +G+           +K  KLP ++  +F+ N+ IR ITSL++K FH+NV G KN+TF+++
Sbjct  118   EGNAAWRVNNCHHTWKCKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEEV  177

Query  648   TIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISV  827
              I APA+S NTDGIH+ +   + I +S I TGDDC+S+GDG++NL ++ VTCGPGHGIS+
Sbjct  178   KIVAPAESPNTDGIHVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISI  237

Query  828   GSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPI  1004
             GSLG+   E+ V G+ + +     TDNGLRIKTWP +      +DIH+  I +++V NPI
Sbjct  238   GSLGRYGHEQDVMGIKIVNCTLQETDNGLRIKTWPTAACSTSASDIHFENILLKNVSNPI  297

Query  1005  VIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINL  1184
             +IDQEYCP NQC K+K S +K+S +S+ NI+GTS  ++AV + CS G PC++V+ G+IN+
Sbjct  298   LIDQEYCPWNQCDKKKASTIKLSKISFKNIRGTSGNKDAVKLLCSKGHPCQNVELGNINI  357

Query  1185  TFKG--GAAKTVCSNAKPKLTGKQTP  1256
              + G  G A   CSN  PKL G Q P
Sbjct  358   KYTGADGPATFQCSNVSPKLMGTQVP  383



>ref|XP_009124109.1| PREDICTED: polygalacturonase-like [Brassica rapa]
Length=396

 Score =   339 bits (869),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 173/385 (45%), Positives = 253/385 (66%), Gaps = 5/385 (1%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M   F  +  F+L LL     +  F + +   SDI+  LLKA+  AC + +PS +VIPKG
Sbjct  1     MGAYFGVSTIFILCLLGFSANAEVFSIGSSSGSDITQALLKAFTSACQSPSPSKVVIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              F++ +  ++GPCKAP+E+ ++ T+KA  + N ++ K++W+    ++ F L+G G  DG+
Sbjct  61    EFKLGEIEMRGPCKAPVEITLQGTVKA--DGNAIQGKEKWVVFGNINGFKLNGGGAFDGE  118

Query  471   GDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
             G+           F   KLP ++  +F++N+ I+DI+S+++K FH+NV G KN+T   I 
Sbjct  119   GNAAWRVNNCHKTFNCKKLPISIRFDFVENAEIKDISSIDAKNFHINVLGAKNMTMSNIK  178

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             I AP DS NTDGIH+ +   V I DS I TGDDCIS+GDG  NL+++ VTCGPGHGISVG
Sbjct  179   ITAPEDSPNTDGIHLGRSDGVKILDSFISTGDDCISVGDGTSNLHVEKVTCGPGHGISVG  238

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIV  1007
             SLG+   E+ V G+ V +     TDNGLRIKTWP++      +DIH+  I +++V NPI+
Sbjct  239   SLGRYGKEQDVSGIRVVNCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVTNPIL  298

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQEYCP NQC+K+K S +K+ N+S+ N++GTS  ++AV + CS G PC++V+ GDI++ 
Sbjct  299   IDQEYCPWNQCNKKKASTIKLVNISFKNVRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIK  358

Query  1188  FKG--GAAKTVCSNAKPKLTGKQTP  1256
             + G  G A   CSN  PKL G Q+P
Sbjct  359   YSGEDGPATFQCSNVSPKLLGAQSP  383



>ref|XP_006489998.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=402

 Score =   338 bits (868),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 172/367 (47%), Positives = 235/367 (64%), Gaps = 6/367 (2%)
 Frame = +3

Query  180   EFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKA  359
             +F   A+G  D S     AW EAC   T S +++P G + +   + KGPCKAPI  +++ 
Sbjct  37    DFGAIADGIRDNSRAFENAWREACYWNTYSTVLVPPGKYLVTSVVFKGPCKAPISFQLQG  96

Query  360   TLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNL  539
              + APP  + +  K+ W+T   +  FTL+G GT  GQG    + + +     + +LP ++
Sbjct  97    LILAPPGLSKLADKESWITFESLRSFTLTGGGTFHGQGRTA-WPENQCHKNSNCQLPISI  155

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
               N L +S I  + S++SK FH+N+ G  NL   KI I AP DS NTDGIHI +   + I
Sbjct  156   RFNKLNDSTITGVQSVDSKFFHINILGCYNLKLNKINISAPDDSPNTDGIHIGRSNGIEI  215

Query  720   KDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIG  899
              +S+I TGDDC+S+GDG +N+ +  V+CGPGHGISVGSLGK   EE V G+TV +  F G
Sbjct  216   SNSIIATGDDCVSLGDGSQNVLVSDVSCGPGHGISVGSLGKYKKEEDVVGLTVINCTFTG  275

Query  900   TDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNV  1079
             T NG+RIKTWP+S  G  ++  +  + M +V+NPIVIDQEYCP+NQC+ + PS VKISNV
Sbjct  276   TSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPHNQCNIKVPSRVKISNV  335

Query  1080  SYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG----GAAKTVCSNAKPKLTGK  1247
              + NI+GTS T+EAV I CS  +PC++V+ GDINL + G    G A + CSN KP L GK
Sbjct  336   RFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKGPAISSCSNVKPTLVGK  395

Query  1248  QTPPVTC  1268
             Q  P TC
Sbjct  396   QI-PATC  401



>ref|XP_010675884.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=388

 Score =   338 bits (866),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 164/350 (47%), Positives = 229/350 (65%), Gaps = 6/350 (2%)
 Frame = +3

Query  165   LGESAEFKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKA  335
             L   A   +T  G   + D +   L AW  ACA+TTPS +++P+G++ +    L+GPCK+
Sbjct  28    LRHGAVLDITRHGAKPNGDATQAFLHAWKVACASTTPSKVLVPRGSYILHAIKLQGPCKS  87

Query  336   PIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLS---GDGTLDGQGDVQIYGQKKDT  506
              + ++I    KAP +P   + +  W+ I  +D  T++   G G  DG G +         
Sbjct  88    RVTIEILGNFKAPADPAQFKGEDTWVKIERIDGLTITAPKGAGVFDGAGQIAWKQNDCSK  147

Query  507   GFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDG  686
               K + LP N   NFL NS+I  ITSLNSKLFH+ + G K L    IT+ APADS NTDG
Sbjct  148   TGKCNSLPYNFRFNFLTNSVINGITSLNSKLFHMAILGCKQLRIHDITVTAPADSLNTDG  207

Query  687   IHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVK  866
             IHI +   V I  + IGTGDDC+SIGDG +N++I+ +TCGPGHGISVGSLG+ P EEPV+
Sbjct  208   IHIGRSDGVNITAAHIGTGDDCVSIGDGAKNVHIEQITCGPGHGISVGSLGRYPNEEPVQ  267

Query  867   GVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSK  1046
             G+TVK      T NG+R+KTW NS+ GVVT +H+  I +E+V NPI++DQEYCP N C +
Sbjct  268   GITVKGCTIKNTHNGVRVKTWHNSYEGVVTGLHFEDIIVENVLNPIIVDQEYCPYNHCKQ  327

Query  1047  EKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG  1196
             + PS VK+S++ + N++GTS+++EAV + CSSGVPCE V+  +I+L + G
Sbjct  328   KTPSKVKLSDIKFQNVRGTSSSKEAVKVVCSSGVPCEKVQLVNIDLKYTG  377



>ref|XP_010482057.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   338 bits (867),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 170/386 (44%), Positives = 249/386 (65%), Gaps = 7/386 (2%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAE-FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPK  287
             M  I +    F +F L  L  +A+ F + ++   DI+  LLKA++EAC   T S ++IPK
Sbjct  1     MGRIHFGVSAFFVFCLLGLSANAKVFNIGSKPGCDITKALLKAFNEACQFPTKSTVLIPK  60

Query  288   GTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDG  467
             G +++ +  + GPCKAPI + ++ T+KA  N    E   +W+    +D F L+G G  DG
Sbjct  61    GEYKLGEIEMMGPCKAPIRIALQGTVKADGNAVHSE---KWIAFRNIDGFKLNGGGVFDG  117

Query  468   QGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKI  647
             +G+           +K  KLP ++  +F+ N+ IR ITSL++K FH+NV G KN+TF+++
Sbjct  118   EGNAAWRVNNCHHTWKCKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEEV  177

Query  648   TIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISV  827
              I APA+S NTDGIH+ +   + I +S I TGDDC+S+GDG++NL ++ VTCGPGHGIS+
Sbjct  178   KIVAPAESPNTDGIHVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISI  237

Query  828   GSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPI  1004
             GSLG+   E+ V G+ + +     TDNGLRIKTWP +      +DIH+  I +++V NPI
Sbjct  238   GSLGRYGHEQDVMGIKIVNCTLQETDNGLRIKTWPTAACSTSASDIHFENILLKNVSNPI  297

Query  1005  VIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINL  1184
             +IDQEYCP NQC K+K S +K+S +S+ NI+GTS  ++AV + CS   PC++V+ G+IN+
Sbjct  298   LIDQEYCPWNQCDKKKASTIKLSKISFKNIRGTSGNKDAVKLLCSKAHPCQNVELGNINI  357

Query  1185  TFKG--GAAKTVCSNAKPKLTGKQTP  1256
              + G  G A   CSN  PKL G Q P
Sbjct  358   KYTGADGPATFQCSNVSPKLMGTQVP  383



>ref|XP_006407789.1| hypothetical protein EUTSA_v10020501mg [Eutrema salsugineum]
 gb|ESQ49242.1| hypothetical protein EUTSA_v10020501mg [Eutrema salsugineum]
Length=526

 Score =   342 bits (876),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 176/362 (49%), Positives = 233/362 (64%), Gaps = 8/362 (2%)
 Frame = +3

Query  195   AEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAP  374
             A+G +D S     AW EACA+ +PS I++PKG + +     KGPCK PI  ++   LKAP
Sbjct  158   ADGKTDDSGAFAAAWKEACASASPSTILVPKGEYLVNNIEFKGPCKGPITFEVNGNLKAP  217

Query  375   PN---PNDMECKKEWLTINYVDDFTLSGDGTL-DGQGDVQIYGQKKDTGFKSDKLPNNLS  542
             PN        C   WL    + DFT++G+G + DGQG +           K + LP N+ 
Sbjct  218   PNWLGGGKPHCG--WLEFEKLTDFTINGNGAIFDGQGAIAWKVNDCAKTGKCNTLPINIR  275

Query  543   LNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIK  722
                L NS I  ITS NSKLFH+N+   KN+TFQ I I AP +S NTDGIHI +   V ++
Sbjct  276   FTGLTNSKIIGITSTNSKLFHMNIIDCKNVTFQNIGIDAPPESLNTDGIHIGRSNGVILR  335

Query  723   DSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGT  902
             +S I TGDDCISIGDG ENL ++ V CGPGHGI++GSLGK P E+PV+GVT++ +    T
Sbjct  336   ESKIRTGDDCISIGDGTENLLVENVECGPGHGIAIGSLGKYPNEQPVRGVTIRKTLIKNT  395

Query  903   DNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVS  1082
             DNG+RIKTWP S PG+ ++I +  I M++V  PI++DQ YCP+  C  + PS VK+S+VS
Sbjct  396   DNGVRIKTWPGSPPGIASNILFDDITMDNVSTPILVDQVYCPHGTCKSQAPSKVKLSDVS  455

Query  1083  YTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTP  1256
             + NI+GTSA++ AV + CS GVPC +  F DINL   G  G A + CSN KP ++GK  P
Sbjct  456   FKNIRGTSASKVAVKLLCSPGVPCTNFAFADINLVHNGKEGPAVSACSNVKPVVSGKMVP  515

Query  1257  PV  1262
             P 
Sbjct  516   PA  517



>ref|XP_004158053.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=2882

 Score =   364 bits (934),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 194/370 (52%), Positives = 253/370 (68%), Gaps = 18/370 (5%)
 Frame = +3

Query  183   FKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKI  353
             F VT+ G   + DI+  LL AW +ACA+TTPS ++IPKG++ + Q+ LKGPCK+PIEL+I
Sbjct  631   FDVTSFGAKPNGDITGPLLVAWKDACASTTPSKVLIPKGSYGLSQSNLKGPCKSPIELQI  690

Query  354   KATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKS--DKL  527
             + TL+A P+P         L + Y+D  T+SG G LDGQG      +K D   K    KL
Sbjct  691   EGTLQASPDPKG----DGLLLLEYIDQLTVSGTGVLDGQGKAG--WEKNDCHLKKICTKL  744

Query  528   PNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKIC  707
             P  L LNF+ NSI++DITSL+SK +H+N+ G KNLT   +TI AP +S NTDGIH++   
Sbjct  745   PMTLKLNFITNSIVKDITSLDSKNYHINLLGCKNLTIDHVTITAPENSPNTDGIHVSSSE  804

Query  708   DVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDS  887
              + I ++ I TGDDCIS+GD  + + I  VTCGPGHGIS+GSLGK   E+ V GVTVK  
Sbjct  805   QINILNTNIATGDDCISVGDTNKQIVISDVTCGPGHGISIGSLGKYSKEKEVVGVTVKKC  864

Query  888   KFIGTDNGLRIKTWPNS---HPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPS  1058
             K   T NG+RIKTWP+S    P   TD+H+  IEM +V NPI+IDQEYCP NQC+++ PS
Sbjct  865   KLTSTTNGVRIKTWPDSVGTFPA--TDMHFEDIEMVNVSNPIIIDQEYCPWNQCNRKVPS  922

Query  1059  LVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKP  1232
              +KIS VS+ NI+GTSAT  AV I CS   PCE+V+  DI+LT+ G  G  K+ C+N KP
Sbjct  923   KIKISKVSFKNIRGTSATAVAVKIVCSQSNPCEEVEVADIDLTYSGSEGPIKSQCANVKP  982

Query  1233  KLTGKQTPPV  1262
              +TGKQ PP+
Sbjct  983   VITGKQNPPI  992



>ref|XP_006299755.1| hypothetical protein CARUB_v10015950mg [Capsella rubella]
 gb|EOA32653.1| hypothetical protein CARUB_v10015950mg [Capsella rubella]
Length=447

 Score =   338 bits (867),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 174/386 (45%), Positives = 248/386 (64%), Gaps = 6/386 (2%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAE-FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPK  287
             M + F  +  FV+ LL       E F++ +   SDI+    KA+  AC A TPS ++IPK
Sbjct  1     MGSYFGISTIFVVCLLGLSANGHEVFRIGSPPGSDITQAFFKAFKAACQAPTPSKVLIPK  60

Query  288   GTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDG  467
             G F++ + +++GPCK PIE  +  T++A  + N  + K +W+    ++ F L+G GT DG
Sbjct  61    GQFRLGEIIMEGPCKFPIEFTLLGTVQA--DGNAGQGKDKWVVFRKMNGFKLNGGGTFDG  118

Query  468   QGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKI  647
             QG                KLP +L  +F+ N++IRDI+S++SK FHVNV G +N+TF  +
Sbjct  119   QGTAAWRVNNCHQTKSCKKLPISLRFDFVTNAVIRDISSVDSKNFHVNVIGARNMTFDNV  178

Query  648   TIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISV  827
              I APA+S NTDGIH+ +   V+I +S I TGDDC+S+GDG+ NL +  V CGPGHGISV
Sbjct  179   KILAPAESPNTDGIHLGRSDGVSIINSRISTGDDCVSVGDGMVNLLVKNVLCGPGHGISV  238

Query  828   GSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPI  1004
             GSLG+   EE V+G+ V +     TDNGLRIKTWP++      +DIH+  I + +V NPI
Sbjct  239   GSLGRYGHEENVRGIRVINCTVQETDNGLRIKTWPSAACSTTASDIHFEDIILRNVSNPI  298

Query  1005  VIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINL  1184
             +IDQEYCP N C+K+K S +K++N+S+  I+GTS  ++AV + CS G PCE+V  GDI++
Sbjct  299   LIDQEYCPWNHCNKQKSSSIKLANISFRKIRGTSGNKDAVKLLCSKGYPCENVVVGDIDI  358

Query  1185  TFKG--GAAKTVCSNAKPKLTGKQTP  1256
              + G  G A  +CSN +PKL G Q P
Sbjct  359   QYTGADGPATFMCSNVRPKLVGIQNP  384



>ref|XP_009350286.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=408

 Score =   337 bits (864),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 180/382 (47%), Positives = 242/382 (63%), Gaps = 18/382 (5%)
 Frame = +3

Query  126   YCAFTFVLFLLADLGESAE-FKVT-----AEGDSDISPELLKAWDEACAATTPSIIVIPK  287
             Y  F F LFL +     AE F VT          DI+  L  AW +AC++  P+ +VIP+
Sbjct  4     YWIFVF-LFLASVANAKAEVFYVTNSTYGGNPSGDITLALADAWRDACSSPWPAKVVIPE  62

Query  288   GTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDG  467
             G + ++ A+L+GPCK+PIE++++  L+AP   + +  +  W+   YVD  TL G GT DG
Sbjct  63    GEYYLRGAILRGPCKSPIEIQVQGYLRAPQESSQLLQQNTWIGFQYVDRLTLFGGGTFDG  122

Query  468   QGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKI  647
             Q +   Y        +S+++  NL  +F+ NS+I  ITSL+SK FH+NVF  +N+TFQ +
Sbjct  123   QSNCHKY-----KSCQSNRV-FNLRFDFVTNSVIEGITSLDSKNFHINVFACRNVTFQYV  176

Query  648   TIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISV  827
             TI AP DS NTDGIHI +   V+I  + IGTGDDC+S+GDG +N+ +  VTCGPGHGIS+
Sbjct  177   TITAPGDSVNTDGIHIGRSFGVSIDHTTIGTGDDCVSLGDGSQNIVVTNVTCGPGHGISI  236

Query  828   GSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVT--DIHYHKIEMEDVKNP  1001
             GSLGK P EEPV GV V +     T NG+RIKTWP S P   T   IH+  I M +V NP
Sbjct  237   GSLGKYPNEEPVVGVRVTNCTLTNTQNGVRIKTWPGS-PTFTTASHIHFQDITMVNVSNP  295

Query  1002  IVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDIN  1181
             I IDQEYCP   C K+ PS VKIS++S+TNIKG+SAT  AV + CS  +PC+ V   D++
Sbjct  296   ISIDQEYCPYTYCGKDDPSKVKISDISFTNIKGSSATPVAVKLMCSRKIPCDGVGLTDVD  355

Query  1182  LTFKG--GAAKTVCSNAKPKLT  1241
             LT  G  G   + C+  KP +T
Sbjct  356   LTNIGSKGPLTSQCAYVKPYIT  377



>ref|XP_006299382.1| hypothetical protein CARUB_v10015541mg [Capsella rubella]
 gb|EOA32280.1| hypothetical protein CARUB_v10015541mg [Capsella rubella]
Length=400

 Score =   336 bits (861),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 172/381 (45%), Positives = 246/381 (65%), Gaps = 6/381 (2%)
 Frame = +3

Query  126   YCAFTFVLFLLADLGESAE-FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQM  302
             Y     +LF+L  +  +AE F V     SDI+  LLKA+  AC A T S +VIPKG F++
Sbjct  4     YLGIFAILFVLLGVSANAEVFPVGGSPGSDITQALLKAFTSACQAPTASKVVIPKGEFKL  63

Query  303   KQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQ  482
              +  + GPCKAPIE+ ++ T+KA  +   +  K+ W+    +  F L+G GT DG+G+  
Sbjct  64    GEIEMAGPCKAPIEINLQGTVKA--DGTAIHGKERWVVFTKIVGFKLNGGGTFDGEGNAA  121

Query  483   IYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAP  662
                          KLP ++  +F++ + IRDI+++++K FH+NV G K + F  + + AP
Sbjct  122   WRVNNCHQTEACKKLPISIRFDFVEKAEIRDISTIDAKNFHINVIGAKEMVFDNVKVIAP  181

Query  663   ADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGK  842
             A+S NTDGIH+ +   V I +S I TGDDCIS+GDG++NL+++ V CGPGHGISVGSLG+
Sbjct  182   AESPNTDGIHLGRSDGVKILNSKIATGDDCISVGDGMKNLHVEKVVCGPGHGISVGSLGR  241

Query  843   TPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQE  1019
                E+ V G+TVK+   IGTDNGLRIKTWP++      + IH+  I + +V NPI+IDQE
Sbjct  242   YGHEQDVAGITVKNCTLIGTDNGLRIKTWPSAACSTTASGIHFEDIILNNVSNPILIDQE  301

Query  1020  YCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG-  1196
             YCP N C+K+KPS +K+ ++S+ NI+GTS  ++AV + CS   PC +V+ G+INL +KG 
Sbjct  302   YCPWNHCNKQKPSTIKLVDISFKNIRGTSGNKDAVKLLCSKAHPCVNVEIGNINLEYKGA  361

Query  1197  -GAAKTVCSNAKPKLTGKQTP  1256
              G     CSN  PKL G Q P
Sbjct  362   DGPPTFTCSNVTPKLVGTQNP  382



>ref|XP_010675930.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   336 bits (862),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 167/376 (44%), Positives = 235/376 (63%), Gaps = 15/376 (4%)
 Frame = +3

Query  168   GESAEFKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAP  338
             G++  F +T +G   D+D++   L +W  ACA+  PS +++P G + +    LKGPC+ P
Sbjct  31    GDTIVFDITTKGAKPDADVTQAFLDSWTAACASVKPSKVLVPAGNYILGAIKLKGPCQTP  90

Query  339   IELKIKATLKAPPNPNDMECKKEWLTINYVDDFTL---SGDGTLDGQGDVQIY----GQK  497
               ++I    KAPP+      +  W  + YVD   L    G G  DGQG          + 
Sbjct  91    TVIEILGNFKAPPDVAAFNKEDTWFKVEYVDSLILITGKGGGVFDGQGQAAWKLNECTKN  150

Query  498   KDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHN  677
              + GF    LP N   NF+ NS +  +TS+NSKL+H  + G K L    ITI APADS N
Sbjct  151   ANCGFD---LPYNFRFNFVTNSKVSGLTSINSKLYHFALLGCKQLEMSDITITAPADSPN  207

Query  678   TDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEE  857
             TDGIHI +   V ++   IGTGDDC+S GDG +N+ ++GVTCGPGHG+SVGSLGK P EE
Sbjct  208   TDGIHIGRSDGVIVRGFTIGTGDDCVSFGDGAKNVLVEGVTCGPGHGLSVGSLGKYPNEE  267

Query  858   PVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQ  1037
             PV  +T+++     TDNG+R+KTW NS+   VT +++  I +E+V+NP+++DQEYCP N 
Sbjct  268   PVSNITIRNCTIKNTDNGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPWNH  327

Query  1038  CSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKT  1211
             C  + PS VKIS++ + N+KG S+ +EAV + CS GVPC+ V+  DI+L + G  G A +
Sbjct  328   CKAKTPSKVKISDIRFKNVKGKSSGKEAVKLICSEGVPCDKVELADIDLQYTGTDGPAVS  387

Query  1212  VCSNAKPKLTGKQTPP  1259
             +C   KP LTGKQ+PP
Sbjct  388   MCKFVKPLLTGKQSPP  403



>emb|CAN65674.1| hypothetical protein VITISV_002009 [Vitis vinifera]
Length=1260

 Score =   357 bits (915),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 176/350 (50%), Positives = 235/350 (67%), Gaps = 4/350 (1%)
 Frame = +3

Query  225   LLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKK  404
             LL AW+ ACA+   S +VIP G + + Q  ++GPCKAPI L +K T++AP + +  + + 
Sbjct  909   LLTAWEAACASPIVSRVVIPAGIYALGQVTIEGPCKAPINLIVKGTVRAPVDTSRFKPQA  968

Query  405   EWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITS  584
              W+   ++D FTLSG G  DGQG   ++GQK        +LP NL  NFL NSII+DITS
Sbjct  969   GWVAFQHLDQFTLSGYGVFDGQGQ-SVWGQKCSRTKYCHQLPINLRFNFLTNSIIKDITS  1027

Query  585   LNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIG  764
              +SK FH+NV G +N+TF ++ I AP DS NTDGIHI +   V I  S I TGDDC+SIG
Sbjct  1028  KDSKQFHINVLGCRNITFFQVAITAPEDSQNTDGIHIGRSRGVNITHSTIQTGDDCVSIG  1087

Query  765   DGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHP  944
             DG E ++I  V CGPGHGISVGSLG    E PV G+ VK+     T NG+R+KT+P+S  
Sbjct  1088  DGSEQIDITKVNCGPGHGISVGSLGLYKNEAPVIGIRVKNCTLSDTTNGVRVKTYPSSPQ  1147

Query  945   GVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAV  1124
             G  T++H+H I M +V NPI+IDQEYCP+NQC+ + PS VK+SN+S+ NI+GT++TE AV
Sbjct  1148  GTATEMHFHDIVMNNVSNPIIIDQEYCPHNQCNLQVPSRVKLSNISFKNIRGTTSTELAV  1207

Query  1125  IIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTPPVTC  1268
              + CS G PC+ V+ G+I+L + G  G A + C N +  L G Q P  TC
Sbjct  1208  NLVCSKGAPCQKVELGNIDLKYTGPEGTASSQCKNVEATLWGTQQPK-TC  1256


 Score =   214 bits (546),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 121/295 (41%), Positives = 164/295 (56%), Gaps = 39/295 (13%)
 Frame = +3

Query  159   ADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAP  338
             A  G+      + EG   +S   + AW  AC  T PS +V+  GT+ +     +GPC+AP
Sbjct  650   AVFGDXGRVXQSLEG---VSRAFMSAWKVACTCTDPSTVVVXGGTYVVGPVQFQGPCRAP  706

Query  339   IELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKS  518
             +  +++ TLKAP + N  E +  W+    +D   +SG GT +GQG    +GQ        
Sbjct  707   MGFRVQGTLKAPTDLNRFELQDGWVIFQDIDXLIISGGGTFBGQGHTA-WGQ--------  757

Query  519   DKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIA  698
                 NN +                         G  NL    +TI A  DS NTDGIH+ 
Sbjct  758   ----NNCART-----------------------GTCNLLLVYVTINATGDSLNTDGIHMG  790

Query  699   KICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTV  878
             +   V I D++I TGDD +SIGDG +++N++ VTCGPGHGISVGSLGK   EEPV GVTV
Sbjct  791   RSTGVNISDAIIKTGDDSLSIGDGSQHINVEKVTCGPGHGISVGSLGKYHNEEPVVGVTV  850

Query  879   KDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCS  1043
             K+   I T NG+R+KTWP+S   V TD+H+  I M +V NPI+I+QEYCP +QC 
Sbjct  851   KNCTLINTMNGIRVKTWPDSPASVATDLHFEDIIMNNVGNPILINQEYCPYDQCQ  905



>emb|CDY22140.1| BnaC01g39610D [Brassica napus]
Length=397

 Score =   335 bits (859),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 173/376 (46%), Positives = 243/376 (65%), Gaps = 8/376 (2%)
 Frame = +3

Query  147   LFLLADLGESAEFKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALL  317
             +F+L  LG SA  +V   G   +SDI+  +LKA+  AC A  PS ++IPKG F++ + ++
Sbjct  10    IFVLCLLGYSANAEVFTAGGPPNSDITAAVLKAFTSACQAPAPSQVLIPKGDFKLGETVM  69

Query  318   KGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQK  497
              GPCK+PIE  ++  +KA  +    + K  W+    ++ F L+G GT DG+G+       
Sbjct  70    TGPCKSPIEFTLQGNVKA--DGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKANN  127

Query  498   KDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHN  677
                 F+  KLP ++  +F+ N+ I+DITSL++K FH NV  GKN+TF  I I APA+S N
Sbjct  128   CHKTFECKKLPISVRFDFVDNAEIKDITSLDAKNFHFNVISGKNMTFDNIKIIAPAESPN  187

Query  678   TDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEE  857
             TDGIH+ +   V I ++ I TGDDCIS+GDG++NL I+ V CGPGHGISVGSLG+   E+
Sbjct  188   TDGIHLGRCEGVKILNTKIATGDDCISVGDGMKNLLIEKVVCGPGHGISVGSLGRYGWEQ  247

Query  858   PVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNN  1034
              V  + VK+    GTDNGLRIKTWP++        IH+  I +  V NPI+IDQEYCP N
Sbjct  248   DVTDINVKNCTLEGTDNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCPWN  307

Query  1035  QCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAK  1208
             QC+K KPS +K+ ++++ NI+GTS  ++AV + CS G PCE+V+ GDIN+ + G  G   
Sbjct  308   QCNKNKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGPDGPPT  367

Query  1209  TVCSNAKPKLTGKQTP  1256
               C+N  PKL G Q P
Sbjct  368   FECTNVTPKLVGTQNP  383



>ref|XP_006495222.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score =   335 bits (860),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 173/372 (47%), Positives = 237/372 (64%), Gaps = 11/372 (3%)
 Frame = +3

Query  180   EFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKA  359
             +F   A+G  D S     AW EAC   T S +++P G + +  A+ KGPCKAPI  +++ 
Sbjct  37    DFGAMADGIRDNSKAFENAWREACNWNTYSTVLVPPGKYFVTSAVFKGPCKAPISFQLQG  96

Query  360   TLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNL  539
              + APP  + +  K+ W+T   +  FTL+G GT  GQG    + + +     + +LP ++
Sbjct  97    LILAPPGLSKLADKESWITFESLRSFTLTGGGTFHGQGRTA-WPENQCHKNSNCQLPISI  155

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
               N L +S I  + S++SK FH+N+ G  NL   KI I AP DS NTDGIHI +   + I
Sbjct  156   RFNKLNDSTITGVQSVDSKFFHINILGCYNLKLNKINISAPDDSPNTDGIHIGRSNGIEI  215

Query  720   KDSVIGTGDDCISIGDG-----LENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKD  884
              +S+I TGDDC+S+GDG     ++N+ +  V+CGPGHGISVGSLGK   EE V G+TV +
Sbjct  216   SNSIIATGDDCVSLGDGSQNVLVQNVLVSDVSCGPGHGISVGSLGKYKKEEDVVGLTVIN  275

Query  885   SKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLV  1064
               F GT NG+RIKTWP+S  G  ++  +  + M +V+NPIVIDQEYCP+NQC+ + PS V
Sbjct  276   CTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPHNQCNIKVPSRV  335

Query  1065  KISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG----GAAKTVCSNAKP  1232
             KISNV + NI+GTS T+EAV I CS  +PC++V+ GDINL + G    G A + CSN KP
Sbjct  336   KISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKGPAISSCSNVKP  395

Query  1233  KLTGKQTPPVTC  1268
              L GKQ  P TC
Sbjct  396   TLVGKQI-PATC  406



>ref|XP_006407792.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
 gb|ESQ49245.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
Length=382

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/355 (47%), Positives = 239/355 (67%), Gaps = 5/355 (1%)
 Frame = +3

Query  201   GDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPN  380
             G S  +  LLKA+  AC +T+PS +VIPKG F++ +  ++GPCKAP+E+ ++ T+KA  N
Sbjct  17    GISANAEALLKAFTSACQSTSPSKVVIPKGEFKLGEIEMRGPCKAPVEITLQGTVKADGN  76

Query  381   PNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKN  560
              N    K +W+    ++ F L+G G  DG+G+           F+  KLP ++  +F++N
Sbjct  77    TN--HGKDKWVVFGNINGFKLNGGGAFDGEGNAAWRVNNCHKTFECKKLPISVRFDFVEN  134

Query  561   SIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGT  740
             + I+DI+S+++K FH+NV G KN+T   I I AP DS NTDGIH+ +   V I +S I T
Sbjct  135   AEIKDISSIDAKNFHINVLGAKNMTMDNIKITAPEDSPNTDGIHLGRSDGVKILNSFIST  194

Query  741   GDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRI  920
             GDDCIS+GDG++NL+++ V CGPGHGISVGSLG+   EE V G+ V +     TDNGLRI
Sbjct  195   GDDCISVGDGMKNLHVEKVVCGPGHGISVGSLGRYGHEEDVSGIRVVNCTLQETDNGLRI  254

Query  921   KTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIK  1097
             KTWP++      +DIH+  I +++V NPI+IDQEYCP NQC+K+K S +K+ N+S+ NI+
Sbjct  255   KTWPSAACSTTASDIHFEDIIVKNVSNPILIDQEYCPWNQCNKQKASTIKLVNISFKNIR  314

Query  1098  GTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTP  1256
             GTS  ++AV + CS G PC+ V+ GDI++ + G  G A   CSN  P+L G Q+P
Sbjct  315   GTSGNKDAVKLLCSKGYPCQKVEIGDIDIAYSGADGPATFQCSNVSPQLLGSQSP  369



>ref|XP_004144529.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=412

 Score =   335 bits (860),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 176/366 (48%), Positives = 240/366 (66%), Gaps = 14/366 (4%)
 Frame = +3

Query  183   FKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKI  353
             F +T  G   ++DI+  L  AW +ACA+T  S ++IP G + + Q++L GPCK+ IE+++
Sbjct  38    FDITTYGAKPNTDITQALANAWKDACASTYSSKLLIPMGVYHLNQSILHGPCKSTIEVRM  97

Query  354   KATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKS--DKL  527
             + TL+A P+P         +   Y+D  TLSG G  DGQG+     +K D   K    KL
Sbjct  98    EGTLQAHPDP----IGDGLVLFQYIDQLTLSGTGAFDGQGEKG--WEKNDCHLKKICTKL  151

Query  528   PNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKIC  707
             P N+  +F+ NS+++DITSL+SK FH N+ G KN+TFQ +TI AP +S NTDGIH++   
Sbjct  152   PMNVKFSFVTNSMVKDITSLDSKNFHFNLLGCKNVTFQNVTIIAPENSPNTDGIHVSSSE  211

Query  708   DVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDS  887
              + I ++ I TGDDCIS+GD  + + I  VTCGPGHGIS+GSLGK   E+ V GVTVK  
Sbjct  212   VINIFNTRISTGDDCISVGDSNKQITITNVTCGPGHGISIGSLGKYTKEKEVAGVTVKSC  271

Query  888   KFIGTDNGLRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLV  1064
             K I T NG+RIKTWP+       +D+H+  IEM +V NP++IDQEYCP+NQC+K+ PS +
Sbjct  272   KLINTSNGVRIKTWPDCAVAYTASDLHFEDIEMVNVSNPVIIDQEYCPSNQCNKKIPSKI  331

Query  1065  KISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKL  1238
             KISNVS+ NI+GTSAT  AV   CS+   CE V+  DI+L + G  G   + C N  P +
Sbjct  332   KISNVSFKNIRGTSATFVAVKFICSTVFSCEGVEVTDIDLAYIGTQGRITSQCRNVIPII  391

Query  1239  TGKQTP  1256
             TGKQ P
Sbjct  392   TGKQNP  397



>emb|CDY22137.1| BnaC01g39640D [Brassica napus]
Length=396

 Score =   335 bits (858),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 252/385 (65%), Gaps = 5/385 (1%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M   F  +  F+  LL     +  F + +   SDI+  LLKA+  AC + +PS +VIP+G
Sbjct  1     MGAYFGVSTIFIFCLLGFSANAEVFSIDSSSGSDITQALLKAFTSACQSPSPSKVVIPEG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              F++ +  ++GPCKAP+E+ ++ T+KA  + N ++ K++W+    ++ F L+G G  DG+
Sbjct  61    EFKLGEIEMRGPCKAPVEITLQGTVKA--DGNAIQGKEKWVVFGNINGFKLNGGGAFDGE  118

Query  471   GDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
             G+           F   KLP ++  +F++N+ I+DI+S+++K FH+NV G KN+T   I 
Sbjct  119   GNAAWRVNNCHKTFNCKKLPISIRFDFVENAEIKDISSIDAKNFHINVLGAKNMTMSNIK  178

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             I AP DS NTDGIH+ +   V I +S I TGDDCIS+GDG  NL+++ VTCGPGHGISVG
Sbjct  179   ITAPEDSPNTDGIHLGRSDGVKILNSFISTGDDCISVGDGTNNLHVEKVTCGPGHGISVG  238

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIV  1007
             SLG+   E+ V G+ V +     TDNGLRIKTWP++      +DIH+  I +++V NPI+
Sbjct  239   SLGRYGKEQDVSGIRVVNCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVTNPIL  298

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQEYCP NQC+K+K S +K+ N+S+ N++GTS  ++AV + CS G PC++V+ GDI++ 
Sbjct  299   IDQEYCPWNQCNKKKASTIKLVNISFKNVRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIK  358

Query  1188  FKG--GAAKTVCSNAKPKLTGKQTP  1256
             + G  G A   CSN  PKL G Q+P
Sbjct  359   YSGADGPATFQCSNVSPKLLGAQSP  383



>ref|XP_010442229.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   334 bits (857),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 168/386 (44%), Positives = 250/386 (65%), Gaps = 7/386 (2%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAE-FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPK  287
             M  + +    F +F L  L  +A+ F + ++   DI+  LLKA+++AC   T S ++IPK
Sbjct  1     MGRVNFGVSAFFIFCLLGLSANAKVFNIGSKPGCDITKALLKAFNQACQFPTKSTVLIPK  60

Query  288   GTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDG  467
             G +++ +  + GPCKAPI + ++ T+KA  N    E   +W+  + +D F L+G G  DG
Sbjct  61    GEYKLGEIEMMGPCKAPIRIALQGTVKADGNAVHSE---KWIAFHNIDGFKLNGGGVFDG  117

Query  468   QGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKI  647
             +G+           +K  KLP ++  +F+ N+ IR ITSL++K FH+NV G KN+TF+++
Sbjct  118   EGNAAWRVNNCHHTWKCKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEEV  177

Query  648   TIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISV  827
              I APA+S NTDGI + +   + I +S I TGDDC+S+GDG++NL ++ VTCGPGHGIS+
Sbjct  178   KIVAPAESPNTDGILVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISI  237

Query  828   GSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPI  1004
             GSLG+   E+ V G+ + +     TDNGLRIKTWP +      +DIH+  I +++V NPI
Sbjct  238   GSLGRYGHEQDVMGIKIVNCTLQETDNGLRIKTWPTAACSTSASDIHFENILLKNVSNPI  297

Query  1005  VIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINL  1184
             +IDQEYCP NQC K+K S +K+S +S+ NI+GTS  ++AV + CS G PC++V+ G+IN+
Sbjct  298   LIDQEYCPWNQCDKKKASTIKLSKISFKNIRGTSGNKDAVKLLCSKGHPCQNVELGNINI  357

Query  1185  TFKG--GAAKTVCSNAKPKLTGKQTP  1256
              + G  G A   CSN  PKL G Q P
Sbjct  358   KYTGSDGPATFQCSNVSPKLMGTQVP  383



>ref|XP_009124086.1| PREDICTED: polygalacturonase [Brassica rapa]
 ref|XP_009124094.1| PREDICTED: polygalacturonase [Brassica rapa]
Length=397

 Score =   334 bits (857),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 172/378 (46%), Positives = 243/378 (64%), Gaps = 8/378 (2%)
 Frame = +3

Query  141   FVLFLLADLGESAEFKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQA  311
             + + +L  LG SA  +V   G   +SDI+  +LKA+  AC A  PS ++IPKG F++ + 
Sbjct  8     YTILVLCLLGYSANAEVFTAGGPPNSDITAAVLKAFTSACQAPAPSQVLIPKGDFKLGET  67

Query  312   LLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYG  491
             ++ GPCK+PIE  ++  +KA  +    + K  W+    ++ F L+G GT DG+G+     
Sbjct  68    VMTGPCKSPIEFTLQGNVKA--DGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKA  125

Query  492   QKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADS  671
                   F+  KLP ++  +F+ N+ I+DITSL++K FH NV  GKN+TF  I I APA+S
Sbjct  126   NNCHKTFECKKLPISVRFDFVDNAEIKDITSLDAKNFHFNVISGKNMTFDNIKIIAPAES  185

Query  672   HNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPG  851
              NTDGIH+ +   V I ++ I TGDDCIS+GDG++NL I+ V CGPGHGISVGSLG+   
Sbjct  186   PNTDGIHLGRCEGVKILNTKIATGDDCISVGDGMKNLLIEKVVCGPGHGISVGSLGRYGW  245

Query  852   EEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCP  1028
             E+ V  + VK+    GTDNGLRIKTWP++        IH+  I +  V NPI+IDQEYCP
Sbjct  246   EQDVTDINVKNCTLEGTDNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCP  305

Query  1029  NNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GA  1202
              NQC+K KPS +K+ ++++ NI+GTS  ++AV + CS G PCE+V+ GDIN+ + G  G 
Sbjct  306   WNQCNKNKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIDYTGPDGP  365

Query  1203  AKTVCSNAKPKLTGKQTP  1256
                 C+N  PKL G Q P
Sbjct  366   PTFECTNVTPKLVGTQNP  383



>ref|XP_004514023.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=390

 Score =   334 bits (856),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 228/348 (66%), Gaps = 5/348 (1%)
 Frame = +3

Query  204   DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNP  383
             + DI+  L  AW EAC + + S +V+P G ++++Q  L+GPCKAPIE+K+   ++AP NP
Sbjct  37    NGDITNALKNAWKEACESRSRSKVVVPSGRYKLQQIDLEGPCKAPIEVKVNGIIQAPKNP  96

Query  384   NDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSD--KLPNNLSLNFLK  557
               +  + +W+   Y++ FTLSG GT DGQG++    ++ D G  ++  +L  N    FL 
Sbjct  97    FHLNGQDQWIRFQYINFFTLSGKGTFDGQGEMAW--KQNDCGRNTNCKRLAMNFGFAFLN  154

Query  558   NSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIG  737
             NS+I+DI S +SK FH NVFG  N+TF    I AP  S NTDGIHI K   V I +S IG
Sbjct  155   NSVIKDINSKDSKYFHANVFGCNNVTFTNFNINAPESSPNTDGIHIGKSSRVKISNSKIG  214

Query  738   TGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLR  917
             +GDDCIS+GDG   + I  VTCGPGHGISVGSLGK P E+PV  + VK+     TDNG+R
Sbjct  215   SGDDCISLGDGSTQITIQNVTCGPGHGISVGSLGKYPNEDPVVDLIVKNCTLNNTDNGVR  274

Query  918   IKTWP-NSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNI  1094
             IKTWP  S   + + +H+  I M +V NPI+IDQ+YCP NQCSK+ PS +KI  V + NI
Sbjct  275   IKTWPGTSVISIASHLHFEDIVMVNVSNPIIIDQQYCPWNQCSKQSPSKIKIKKVIFKNI  334

Query  1095  KGTSATEEAVIIACSSGVPCEDVKFGDINLTFKGGAAKTVCSNAKPKL  1238
             +GTSAT+E V +  S GVPCE V   DINL+F G      C+N KP +
Sbjct  335   RGTSATQEGVSLIRSRGVPCEAVVLSDINLSFNGSKVTAKCANVKPTI  382



>ref|XP_006492955.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score =   334 bits (857),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 172/372 (46%), Positives = 236/372 (63%), Gaps = 11/372 (3%)
 Frame = +3

Query  180   EFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKA  359
             +F   A+G  D S     AW EAC   T S +++P G + +   + KGPCKAPI  +++ 
Sbjct  37    DFGAIADGIRDNSRAFENAWREACYWNTYSTVLVPPGKYLVTSVVFKGPCKAPISFQLQG  96

Query  360   TLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNL  539
              + APP  + +  K+ W+T   +  FTL+G GT  GQG    + + +     + +LP ++
Sbjct  97    LILAPPGLSKLADKESWITFESLRSFTLTGGGTFHGQGRTA-WPENQCHKNSNCQLPISI  155

Query  540   SLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTI  719
               N L +S I  + S++SK FH+N+ G  NL   KI I AP DS NTDGIHI +   + I
Sbjct  156   RFNKLNDSTITGVQSVDSKFFHINILGCYNLKLNKINISAPDDSPNTDGIHIGRSNGIEI  215

Query  720   KDSVIGTGDDCISIGDG-----LENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKD  884
              +S+I TGDDC+S+GDG     ++N+ +  V+CGPGHGISVGSLGK   EE V G+TV +
Sbjct  216   SNSIIATGDDCVSLGDGSQNVLVQNVLVSDVSCGPGHGISVGSLGKYKKEEDVVGLTVIN  275

Query  885   SKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLV  1064
               F GT NG+RIKTWP+S  G  ++  +  + M +V+NPIVIDQEYCP+NQC+ + PS V
Sbjct  276   CTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPHNQCNIKVPSRV  335

Query  1065  KISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG----GAAKTVCSNAKP  1232
             KISNV + NI+GTS T+EAV I CS  +PC++V+ GDINL + G    G A + CSN KP
Sbjct  336   KISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKGPAISSCSNVKP  395

Query  1233  KLTGKQTPPVTC  1268
              L GKQ  P TC
Sbjct  396   TLVGKQI-PATC  406



>ref|XP_010675940.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   334 bits (856),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 167/376 (44%), Positives = 239/376 (64%), Gaps = 15/376 (4%)
 Frame = +3

Query  168   GESAEFKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAP  338
             G++  F +T +G   D+D++   L +W  ACA+  PS +++P G + +    LKGPC+ P
Sbjct  31    GDTIVFDITTKGAKPDADVTQAFLDSWTAACASKKPSKVLVPAGNYILGAITLKGPCQTP  90

Query  339   IELKIKATLKAPPNPNDMECKKEWLTINYVDDFTL---SGDGTLDGQGDVQIYGQKKDTG  509
               ++I    KAP +    + +  W  +  VD   +    G G  DGQG     G KK+  
Sbjct  91    TVIEILGNFKAPSDVAAFKKEDSWFKVENVDSLIIISGKGGGVFDGQGQA---GWKKNEC  147

Query  510   FKSDK----LPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHN  677
              K+      LP N+  NF+ NS +  +TSLNSK FHV + G K L    +TI APADS N
Sbjct  148   TKNANCAFDLPYNIRFNFVSNSKVSGLTSLNSKSFHVVLLGCKQLELSDMTITAPADSPN  207

Query  678   TDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEE  857
             TDGIHI +  ++ ++   IGTGDDC+S GDG +N+ I+GVTCGPGHG+SVGSLGK P EE
Sbjct  208   TDGIHIGRSENIIVRGWTIGTGDDCVSFGDGAKNVLIEGVTCGPGHGLSVGSLGKYPNEE  267

Query  858   PVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQ  1037
             PV  +T+++     TDNG+R+KTW NS+   VT +++  I +E+V+NP+++DQEYCP N 
Sbjct  268   PVSNITIRNCTIKNTDNGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPWNH  327

Query  1038  CSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKT  1211
             C  + PS VKIS++ + N+KG S+T+EAV + CS GVPC+ V+  DI++ + G  G A +
Sbjct  328   CKAKTPSKVKISDIRFKNVKGKSSTKEAVKLICSEGVPCDKVELADIDIQYTGPDGPAVS  387

Query  1212  VCSNAKPKLTGKQTPP  1259
             +C   KP LTGKQ+PP
Sbjct  388   MCKFVKPLLTGKQSPP  403



>ref|XP_004163433.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=412

 Score =   334 bits (856),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 175/366 (48%), Positives = 240/366 (66%), Gaps = 14/366 (4%)
 Frame = +3

Query  183   FKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKI  353
             F +T  G   ++DI+  L  AW +ACA+T  S ++IP G + + Q++L GPCK+ IE+++
Sbjct  38    FDITTYGAKPNTDITQALANAWKDACASTYSSKLLIPMGVYHLNQSILHGPCKSTIEVRM  97

Query  354   KATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKS--DKL  527
             + TL+A P+P         +   Y+D  TLSG G  DGQG+     +K D   K    KL
Sbjct  98    EGTLQAHPDP----IGDGLVLFQYIDQLTLSGTGAFDGQGEKG--WEKNDCHLKKICTKL  151

Query  528   PNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKIC  707
             P N+  +F+ NS+++DITSL+SK FH N+ G KN+TFQ +TI AP +S NTDGIH++   
Sbjct  152   PMNVKFSFVTNSMVKDITSLDSKNFHFNLLGCKNVTFQNVTIIAPENSPNTDGIHVSSSE  211

Query  708   DVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDS  887
              + I ++ I TGDDCIS+GD  + + I  VTCGPGHGIS+GSLGK   E+ V GVTVK  
Sbjct  212   VINIFNTRISTGDDCISVGDSNKQITITNVTCGPGHGISIGSLGKYTKEKEVAGVTVKSC  271

Query  888   KFIGTDNGLRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLV  1064
             K I T NG+RIKTWP+       +D+H+  IEM +V NP++IDQEYCP+NQC+K+ PS +
Sbjct  272   KLINTSNGVRIKTWPDCAVAYTASDLHFEDIEMVNVSNPVIIDQEYCPSNQCNKKIPSKI  331

Query  1065  KISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKL  1238
             KI+NVS+ NI+GTSAT  AV   CS+   CE V+  DI+L + G  G   + C N  P +
Sbjct  332   KINNVSFKNIRGTSATFVAVKFICSTVFSCEGVEVTDIDLAYIGTQGRITSQCRNVIPII  391

Query  1239  TGKQTP  1256
             TGKQ P
Sbjct  392   TGKQNP  397



>ref|XP_004162885.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=402

 Score =   332 bits (852),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 176/387 (45%), Positives = 241/387 (62%), Gaps = 17/387 (4%)
 Frame = +3

Query  138   TFVLFLLADLGESAE-----FKVTAEGD----SDISPELLKAWDEACAATTPSIIVIPKG  290
             TF++ LL+   ES       F +   G+     D++  L  AW++ACA+  PS ++IPKG
Sbjct  11    TFLMILLSFTIESRSHVDVIFHLRKYGNIVSGVDVTEALKDAWNDACASVPPSAVIIPKG  70

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              F++++   KGPCK+PIE++++ TL+A  +P        W+T  YVD   LSG G  DGQ
Sbjct  71    IFKVREGEFKGPCKSPIEMRVRGTLQALNHPQG----DSWITFVYVDRMKLSG-GVFDGQ  125

Query  471   GDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKIT  650
             G                 LP +L  NF+ N I+R ITSL+SK  HVN+ G  NLTFQ + 
Sbjct  126   GKEGWXKNDCHKCINCANLPISLRFNFITNXIVRRITSLDSKNSHVNILGCNNLTFQGVN  185

Query  651   IKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVG  830
             I AP DS NTD IHI +   ++I  S I  GDDCIS+G+G + + +  VTCGPGHGIS+G
Sbjct  186   IIAPEDSPNTDEIHIGRSIRISILKSRIAIGDDCISLGNGSKRVKVTDVTCGPGHGISIG  245

Query  831   SLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIV  1007
             SLGK   EEPV+GV VK+   + T NG+RIKTW  S   G+   +H+  I M +V NPI+
Sbjct  246   SLGKYTNEEPVEGVVVKNCTIMNTTNGVRIKTWSASPVAGIAIIMHFSDITMINVSNPIL  305

Query  1008  IDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLT  1187
             IDQEYCP NQC+++ PS +KI+ VS+ NI+G SAT  AV + CSS +PCE+VK  +I+L 
Sbjct  306   IDQEYCPWNQCNRQIPSKIKINKVSFKNIRGCSATSVAVKLICSSNLPCEEVKVANIDLV  365

Query  1188  FKG--GAAKTVCSNAKPKLTGKQTPPV  1262
             + G  G+  + C N KP L+G Q P +
Sbjct  366   YNGTKGSITSQCMNVKPILSGIQNPSI  392



>emb|CDX86325.1| BnaA06g30420D [Brassica napus]
Length=397

 Score =   332 bits (851),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 173/387 (45%), Positives = 249/387 (64%), Gaps = 8/387 (2%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M   F  +  FV+ LL     + +F +TA   SDI+  LLKA++EAC   T S ++IPKG
Sbjct  1     MGVHFGISVLFVVCLLGLSANAKDFTITAPPGSDITSLLLKAFNEACQFPTRSSVLIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              ++++Q  + GPCKAPI + ++ T+KA  N N  +    W+    ++ F L+G G  DG+
Sbjct  61    EYKLRQIEMMGPCKAPIRITLQGTVKADGNVNGND---YWVAFRRINGFKLNGGGIFDGE  117

Query  471   GDVQIYGQK--KDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQK  644
             G+         K    +  KLP ++  +F+ ++ IR ITSL+SK FH+NV G +N+T ++
Sbjct  118   GNAAWRANNCHKMALTQCKKLPISIRFDFVTDAKIRGITSLDSKNFHINVLGARNMTLEE  177

Query  645   ITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGIS  824
             ITI AP +S NTDGIH+ +   V I +S I TGDDCISIGDG  +L ++ VTCGPGHGIS
Sbjct  178   ITIIAPEESPNTDGIHVGRSVGVQIINSNIKTGDDCISIGDGTRDLLVERVTCGPGHGIS  237

Query  825   VGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNP  1001
             +GSLG    EE V G+ V +S  I TDNG+RIKTWP++      + IH+  I +++V NP
Sbjct  238   IGSLGLYVKEEDVTGIRVVNSTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNP  297

Query  1002  IVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDIN  1181
             I+IDQEYCP N+C+K KPS +K+ ++S+ +I+GTS  ++AV + CS G PC++V+ GDI+
Sbjct  298   ILIDQEYCPWNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVQIGDID  357

Query  1182  LTFKG--GAAKTVCSNAKPKLTGKQTP  1256
             + + G  G A   CSN  P L G Q P
Sbjct  358   IKYTGADGPATFQCSNVSPTLMGTQVP  384



>gb|ACP74159.1| putative polygalacturonase [Brassica rapa subsp. oleifera]
Length=397

 Score =   332 bits (851),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 250/387 (65%), Gaps = 8/387 (2%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M   F  +  FV+ LL     + +F +TA   SDI+  LLK ++EAC   T S ++IPKG
Sbjct  1     MGVHFGISVLFVVCLLGLSANAKDFTITAPPGSDITSLLLKTFNEACQFPTRSSVLIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              ++++Q  + GPCKAPI + ++ T+KA  N N  +    W+    ++ F L+G G  DG+
Sbjct  61    EYKLRQIEMMGPCKAPIRITLQGTVKADGNVNGND---YWVAFRRINGFKLNGGGIFDGE  117

Query  471   GDV--QIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQK  644
             G+   +   + K    +  KLP ++  +F+ ++ IR ITSL+SK FH+NV G +N+T ++
Sbjct  118   GNAAWRANNRHKMALTQCKKLPISIRFDFVTDAKIRGITSLDSKNFHINVLGARNMTLEE  177

Query  645   ITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGIS  824
             ITI AP +S NTDGIH+ +   V I +S I TGDDCISIGDG  +L ++ VTCGPGHGIS
Sbjct  178   ITIIAPEESPNTDGIHVGRSVGVQIINSNIKTGDDCISIGDGTRDLLVERVTCGPGHGIS  237

Query  825   VGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNP  1001
             +GSLG    EE V G+ V +S  I TDNG+RIKTWP++      + IH+  I +++V NP
Sbjct  238   IGSLGLYVKEEDVTGIRVVNSTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNP  297

Query  1002  IVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDIN  1181
             I+IDQEYCP N+C+K KPS +K+ ++S+ +I+GTS  ++AV + CS G PC++V+ GDI+
Sbjct  298   ILIDQEYCPWNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVQIGDID  357

Query  1182  LTFKG--GAAKTVCSNAKPKLTGKQTP  1256
             + + G  G A   CSN  P L G Q P
Sbjct  358   IKYTGADGPATFQCSNVSPTLMGTQVP  384



>sp|P35337.1|PGLR_BRANA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Brassica napus]
 gb|AAA70402.1| polygalacturonase [Brassica napus]
Length=397

 Score =   332 bits (850),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 170/378 (45%), Positives = 242/378 (64%), Gaps = 8/378 (2%)
 Frame = +3

Query  141   FVLFLLADLGESAEFKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQA  311
             + + +L  LG SA  +V   G   +SDI+  +LKA+  AC A  PS ++IPKG F++ + 
Sbjct  8     YTILVLCLLGYSANAEVFTAGGPPNSDITAAVLKAFTSACQAPAPSQVLIPKGDFKLGET  67

Query  312   LLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYG  491
             ++ GPCK+PIE  ++  +K   +    + K  W+    ++ F L+G GT DG+G+     
Sbjct  68    VMTGPCKSPIEFTLQGNVKT--DGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKA  125

Query  492   QKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADS  671
                   F+  KLP ++  +F+ N+ I+D+TSL++K FH NV  GKN+TF  I I APA+S
Sbjct  126   NNCHKTFECKKLPISVRFDFVDNAEIKDVTSLDAKNFHFNVISGKNMTFDNIKIIAPAES  185

Query  672   HNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPG  851
              NTDGIH+ +   V I ++ I TGDDCIS+GDG++NL I+ V CGPGHGISVGSLG+   
Sbjct  186   PNTDGIHLGRCEGVKILNTKIATGDDCISVGDGMKNLLIEKVVCGPGHGISVGSLGRYGW  245

Query  852   EEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCP  1028
             E+ V  +TVK+    GT NGLRIKTWP++        IH+  I +  V NPI+IDQEYCP
Sbjct  246   EQDVTDITVKNCTLEGTSNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCP  305

Query  1029  NNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GA  1202
              NQC+K KPS +K+ ++++ NI+GTS  ++AV + CS G PCE+V+ GDIN+ + G  G 
Sbjct  306   WNQCNKNKPSTIKLVDITFRNIRGTSENKDAVKLLCSKGHPCENVEIGDINIEYTGPDGP  365

Query  1203  AKTVCSNAKPKLTGKQTP  1256
                 C+N  PKL G Q P
Sbjct  366   PTFECTNVTPKLVGAQNP  383



>ref|XP_006279754.1| hypothetical protein CARUB_v10027711mg [Capsella rubella]
 gb|EOA12652.1| hypothetical protein CARUB_v10027711mg [Capsella rubella]
Length=395

 Score =   332 bits (850),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 166/386 (43%), Positives = 251/386 (65%), Gaps = 7/386 (2%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAE-FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPK  287
             M  + +    F +F L  L  +A+ F + +   SDI+  LLK ++EAC   T S ++IPK
Sbjct  1     MGRVNFGVSAFFVFCLLGLSANAKVFNIGSPPGSDITKALLKTFNEACQFPTKSTVLIPK  60

Query  288   GTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDG  467
             G +++ +  + GPCKAPI + ++ TLKA  N       ++W+    ++ F L+G G  DG
Sbjct  61    GEYKLGEIEMLGPCKAPIRIALQGTLKADGNAVH---NQKWVAFRNINGFKLNGGGVFDG  117

Query  468   QGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKI  647
             +G+            +  KLP ++  +++ +  +R ITSL++K FH+NV G KNLTF+++
Sbjct  118   EGNAAWRVNNCHKTEQCKKLPISIRFDYITDGKVRGITSLDAKNFHINVIGAKNLTFEEV  177

Query  648   TIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISV  827
              I APA+S NTDGIH+ +   + I +SVI TGDDC+S+GDG++NL ++ VTCGPGHGISV
Sbjct  178   RIIAPAESPNTDGIHVGRSDGIKIINSVITTGDDCVSVGDGMKNLLVERVTCGPGHGISV  237

Query  828   GSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV-VTDIHYHKIEMEDVKNPI  1004
             GSLG+   E+ VKG+ + +     TDNG+RIKTWP++      +DIH+  I +++V NPI
Sbjct  238   GSLGRYGHEQDVKGIKIINCTLQETDNGIRIKTWPSAACSTSASDIHFENIVLKNVTNPI  297

Query  1005  VIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINL  1184
             +IDQEYCP N C+K KPS +K+SN+S+ NI+GTS  ++AV + CS G PC++V+ G+I++
Sbjct  298   LIDQEYCPWNHCNKAKPSTIKLSNISFKNIRGTSGNKDAVKLLCSKGFPCQNVELGNIDI  357

Query  1185  TFKG--GAAKTVCSNAKPKLTGKQTP  1256
              + G  G A   C+N  PK+ G Q P
Sbjct  358   KYTGADGPATFQCANVSPKIMGTQVP  383



>emb|CDY05701.1| BnaC02g38360D [Brassica napus]
Length=397

 Score =   331 bits (849),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 247/387 (64%), Gaps = 8/387 (2%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M   F  +  FV  LLA    + EF++TA   SDI+ EL K + EAC     S ++IPKG
Sbjct  1     MGVHFGVSTLFVFCLLALSANAREFRITARPGSDITGELSKLFKEACQCVDKSTVLIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              F++ +  + GPCKAPI   ++ T++A  N N    K  W+    + +F L+G G  DG+
Sbjct  61    EFKLGEIEMMGPCKAPIIFVLQGTVRADGNVNG---KDFWVAFRRITNFRLNGGGIFDGE  117

Query  471   GDVQIYGQK--KDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQK  644
             G+         K +  +  +LP ++  +++ +  +RDITSL++K FH+NV G KNLTF+ 
Sbjct  118   GNASWRANNCHKTSLTQCKRLPISIRFDYITDGKVRDITSLDAKNFHINVIGAKNLTFED  177

Query  645   ITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGIS  824
             I I AP +S NTDGIH+ +   + I ++ I TGDDCIS+GDG++NL ++ VTCGPGHGIS
Sbjct  178   IRIVAPDESPNTDGIHVGRSDGIKIINTNIKTGDDCISVGDGMKNLLVERVTCGPGHGIS  237

Query  825   VGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNP  1001
             +GSLG    EE V GV V +     TDNG+RIKTWP++      + IH+  I +++V NP
Sbjct  238   IGSLGLYGHEEDVTGVKVVNCTLRNTDNGVRIKTWPSAACSTTASGIHFENIILQNVSNP  297

Query  1002  IVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDIN  1181
             I+IDQEYCP N+C+K KPS +K+ ++ + NIKG+S  ++AV + CS G PC++V+ GDI+
Sbjct  298   ILIDQEYCPWNRCNKNKPSSIKLVDIKFKNIKGSSGNKDAVKLLCSKGFPCKNVEIGDID  357

Query  1182  LTFKG--GAAKTVCSNAKPKLTGKQTP  1256
             +T+ G  G A   CSN  PKL GKQ P
Sbjct  358   ITYNGKDGPATFQCSNVSPKLVGKQCP  384



>ref|XP_009151612.1| PREDICTED: polygalacturonase [Brassica rapa]
 gb|ABG38467.1| pollen-expressed protein MF6t [Brassica juncea]
Length=397

 Score =   330 bits (847),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 248/387 (64%), Gaps = 8/387 (2%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M   F  +  FV+ LL     + +F +TA   SDI+  LLK ++EAC   T S ++IPKG
Sbjct  1     MGVHFGISVLFVVCLLGLSANAKDFTITAPPGSDITSLLLKTFNEACQFPTRSSVLIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              ++++Q  + GPCKAPI + ++ T+KA  N N  +    W+    ++ F L+G G  DG+
Sbjct  61    EYKLRQIEMMGPCKAPIRITLQGTVKADGNVNGND---YWVAFRRINGFKLNGGGIFDGE  117

Query  471   GDVQIYGQK--KDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQK  644
             G+         K    +  KLP ++  +F+ ++ IR ITSL+SK FH+NV G +N+T ++
Sbjct  118   GNAAWRANNCHKMALTQCKKLPISIRFDFVTDAKIRGITSLDSKNFHINVLGARNMTLEE  177

Query  645   ITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGIS  824
             ITI AP +S NTDGIH+ +   V I +S I TGDDCISIGDG  +L ++ VTCGPGHGIS
Sbjct  178   ITIIAPEESPNTDGIHVGRSVGVQIINSNIKTGDDCISIGDGTRDLLVERVTCGPGHGIS  237

Query  825   VGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNP  1001
             +GSLG    EE V G+ V +S  I TDNG+RIKTWP++      + IH+  I +++V NP
Sbjct  238   IGSLGLYVKEEDVTGIRVVNSTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNP  297

Query  1002  IVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDIN  1181
             I+IDQEYCP N+C+K KPS +K+ ++S+ +I+GTS  ++AV + CS G PC++V+ GDI+
Sbjct  298   ILIDQEYCPWNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVQIGDID  357

Query  1182  LTFKG--GAAKTVCSNAKPKLTGKQTP  1256
             + + G  G A   CSN  P L G Q P
Sbjct  358   IKYTGADGPATFQCSNVSPTLMGTQVP  384



>ref|XP_009134997.1| PREDICTED: polygalacturonase [Brassica rapa]
Length=397

 Score =   330 bits (846),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 171/378 (45%), Positives = 239/378 (63%), Gaps = 8/378 (2%)
 Frame = +3

Query  141   FVLFLLADLGESAE---FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQA  311
             + + +L  LG SA    F V     SDI+  LLKA+  AC A  PS ++IPKG F++ + 
Sbjct  8     YTILVLCLLGYSANAEVFTVGGPPGSDITAALLKAFTSACQAPAPSQVLIPKGDFKLGEI  67

Query  312   LLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYG  491
              + GPCK+P+E  ++  +KA  +    + K  W+    ++ F L+G GT DG+G+     
Sbjct  68    AMTGPCKSPVEFTLQGNVKA--DGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKA  125

Query  492   QKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADS  671
                   F+  KLP ++  +F+ N+ I+DITSL++K FH NV  GKN+TF  I I APA+S
Sbjct  126   NNCHKTFECKKLPISVRFDFVDNAEIKDITSLDAKNFHFNVISGKNMTFDNIKIIAPAES  185

Query  672   HNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPG  851
              NTDGIH+ +   V I ++ I TGDDCIS+GDG++NL I+ V CGPGHGISVGSLG+   
Sbjct  186   PNTDGIHLGRCEGVKILNTKISTGDDCISVGDGMKNLLIEKVVCGPGHGISVGSLGRYGW  245

Query  852   EEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCP  1028
             E+ V  + V +    GTDNGLRIKTWP++        IH+  I +  V NPI+IDQEYCP
Sbjct  246   EQDVNDIKVINCTLEGTDNGLRIKTWPSAACTTTAAGIHFENIILNKVSNPILIDQEYCP  305

Query  1029  NNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GA  1202
              NQC+K KPS +K+ ++++ NI+GTS  ++AV + CS G PCE+V+ GDIN+ + G  G 
Sbjct  306   WNQCNKSKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGPDGP  365

Query  1203  AKTVCSNAKPKLTGKQTP  1256
                 C+N  PKL G Q P
Sbjct  366   PTFECTNVTPKLVGTQNP  383



>ref|XP_009129707.1| PREDICTED: polygalacturonase-like [Brassica rapa]
 ref|XP_009102886.1| PREDICTED: polygalacturonase-like [Brassica rapa]
Length=397

 Score =   330 bits (845),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 171/387 (44%), Positives = 246/387 (64%), Gaps = 8/387 (2%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M   F  +  FV  LLA    + EF++TA   SDI+ EL K + EAC     S ++IPKG
Sbjct  1     MGVHFGVSAFFVFCLLALSANAREFRITARPGSDITGELSKLFKEACQCVDKSTVLIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              F++ +  + GPCKAPI   ++ T++A  N N    K  W+    + +F L+G G  DG+
Sbjct  61    EFKLGEIEMMGPCKAPIIFVLQGTVRADGNVNG---KDFWVAFRRITNFRLNGGGIFDGE  117

Query  471   GDVQIYGQ--KKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQK  644
             G+         K +  +  +LP ++  +++ +  +RDITSL++K FH+NV G KNLTF+ 
Sbjct  118   GNASWRANNCHKTSLTQCKRLPISIRFDYITDGKVRDITSLDAKNFHINVIGAKNLTFED  177

Query  645   ITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGIS  824
             I I AP +S NTDGIH+ +   + I ++ I TGDDCIS+GDG++NL ++ V+CGPGHGIS
Sbjct  178   IRIVAPEESPNTDGIHVGRSDGIKIINTNIKTGDDCISVGDGMKNLLVERVSCGPGHGIS  237

Query  825   VGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNP  1001
             +GSLG    EE V GV V +     TDNG+RIKTWP++      + IH+  I + +V NP
Sbjct  238   IGSLGLYGHEEDVTGVKVVNCTLRNTDNGVRIKTWPSAACSTTASGIHFENIILHNVSNP  297

Query  1002  IVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDIN  1181
             I+IDQEYCP N+C+K KPS +K+ ++ + NIKG+S  ++AV + CS G PC++V+ GDI+
Sbjct  298   ILIDQEYCPWNRCNKNKPSSIKLVDIKFKNIKGSSGNKDAVKLLCSKGFPCKNVEIGDID  357

Query  1182  LTFKG--GAAKTVCSNAKPKLTGKQTP  1256
             +T+ G  G A   CSN  PKL GKQ P
Sbjct  358   ITYNGKDGPATFQCSNVSPKLVGKQCP  384



>ref|XP_002526191.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF36195.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=392

 Score =   330 bits (845),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 178/374 (48%), Positives = 235/374 (63%), Gaps = 8/374 (2%)
 Frame = +3

Query  135   FTFVLFLLADLGESA----EFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQM  302
             F  + FL     E       F  T    +DIS  LL AW  AC+    S I+IP+  + +
Sbjct  11    FVLLSFLFNIRAEKVFDVKSFGATPSQKNDISKALLAAWKAACSTPGASRILIPEAKYAL  70

Query  303   KQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQ  482
             +  LL+GPCK  + L+IK TL AP +P++    + W+T  +VD  T+SG G LDG+G + 
Sbjct  71    RDVLLEGPCKGSMVLQIKGTLMAPADPSEHH-SQGWITFQHVDHLTISG-GNLDGRGKIA  128

Query  483   IYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAP  662
                    T      LP NL  +F+ N+I+ ++TS +SK FH+N+ G +N T Q+I I AP
Sbjct  129   WGKNTCRTNVNCKNLPMNLRFDFVTNTIVENLTSRDSKNFHMNLIGCQNFTLQRIKIIAP  188

Query  663   ADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGK  842
              DS NTDGIHI +  +V I DS IGTGDDCISIGDG  N+ I GV CGPGHGIS+GSLGK
Sbjct  189   GDSANTDGIHIGRSNEVNIIDSKIGTGDDCISIGDGSRNIKITGVRCGPGHGISIGSLGK  248

Query  843   TPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEY  1022
                EEPV GV VK    I T NG+RIK+WP  + G  TD+H+  I M +V N I+IDQ Y
Sbjct  249   YKNEEPVSGVYVKKCDLINTSNGIRIKSWPGLYSGAATDMHFEDISMNNVSNAILIDQMY  308

Query  1023  CPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--  1196
             CP N C+ +  S VKIS V+++NIKGTS+T   V + CS G+PCE V+  +IN+ +KG  
Sbjct  309   CPWNHCNSKASSNVKISKVTFSNIKGTSSTPTIVKLLCSKGLPCEGVELNNINVVYKGPD  368

Query  1197  GAAKTVCSNAKPKL  1238
             G AK+ C+N KPK+
Sbjct  369   GPAKSECTNVKPKI  382



>emb|CDY54512.1| BnaC07g49180D [Brassica napus]
Length=397

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 171/387 (44%), Positives = 247/387 (64%), Gaps = 8/387 (2%)
 Frame = +3

Query  111   MDTIFYCAFTFVLFLLADLGESAEFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKG  290
             M   F  +  FV+ LL     + +F +TA   SDI+  LLK ++EAC   T S ++IPKG
Sbjct  1     MGVHFGISVLFVVCLLGLSANAKDFTITAPPGSDITSLLLKTFNEACQFPTKSSVLIPKG  60

Query  291   TFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQ  470
              ++++Q  + GPCKAPI + ++ T+KA  N N  +    W+    ++ F L+G G  DG+
Sbjct  61    EYKLRQIEMMGPCKAPIRITLQGTVKADGNVNGND---FWVAFRRINGFKLNGGGVFDGE  117

Query  471   GDVQIYGQK--KDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQK  644
             G+         K    +  KLP ++  +F+ ++ IR ITS++SK FH+NV G +N+T ++
Sbjct  118   GNAAWRANNCHKMALTQCKKLPISIRFDFVTDAKIRGITSMDSKNFHINVLGARNMTLEE  177

Query  645   ITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGIS  824
             ITI AP +S NTDGIH+ +   V I +S I TGDDCISIGDG  +L ++ VTCGPGHGIS
Sbjct  178   ITIIAPEESPNTDGIHVGRSVGVQIINSNIKTGDDCISIGDGTRDLLVERVTCGPGHGIS  237

Query  825   VGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNP  1001
             +GSLG    EE V G+ V +   I TDNG+RIKTWP++      + IH+  I +++V NP
Sbjct  238   IGSLGLYVKEEDVTGIRVVNCTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNP  297

Query  1002  IVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDIN  1181
             I+IDQEYCP N+C+K KPS +K+ ++S+ +I+GTS  ++AV + CS G PC++V+ GDIN
Sbjct  298   ILIDQEYCPWNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVEIGDIN  357

Query  1182  LTFKG--GAAKTVCSNAKPKLTGKQTP  1256
             + + G  G A   CSN  P L G Q P
Sbjct  358   IQYTGADGPATFQCSNVSPTLMGTQVP  384



>gb|AAM74219.1|AF518563_1 putative pollen polygalacturonase [Brassica oleracea]
Length=397

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 170/378 (45%), Positives = 239/378 (63%), Gaps = 8/378 (2%)
 Frame = +3

Query  141   FVLFLLADLGESAE---FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQA  311
             + + +L  LG SA    F V     SDI+  LLKA+  AC A  PS ++IPKG F++ + 
Sbjct  8     YTILVLCLLGYSANAEVFTVGGPPGSDITAALLKAFTSACQAPAPSQVLIPKGDFKLGEI  67

Query  312   LLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYG  491
              + GPCK+P+E  ++  +KA  +    + K  W+    ++ F L+G GT DG+G+     
Sbjct  68    AMTGPCKSPVEFTLQGNVKA--DGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKA  125

Query  492   QKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADS  671
                   F+  KLP ++  +F+ N+ I+D+TSL++K FH NV  GKN+TF  I I APA+S
Sbjct  126   NNCHKTFECKKLPISVRFDFVDNAEIKDVTSLDAKNFHFNVISGKNMTFDNIKIIAPAES  185

Query  672   HNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPG  851
              NTDGIH+ +   V I ++ I TGDDCIS+GDG++NL I+ V CGPGHGISVGSLG+   
Sbjct  186   PNTDGIHLGRCEGVKILNTKISTGDDCISVGDGMKNLLIEKVVCGPGHGISVGSLGRYGW  245

Query  852   EEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCP  1028
             E+ V  + V +    GTDNGLRIKTWP++        IH+  I +  V NPI+IDQEYCP
Sbjct  246   EQDVNDIKVINCTLEGTDNGLRIKTWPSAACTTTAAGIHFENIILNKVSNPILIDQEYCP  305

Query  1029  NNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GA  1202
              NQC+K KPS +K+ ++++ NI+GTS  ++AV + CS G PCE+V+ GDIN+ + G  G 
Sbjct  306   WNQCNKSKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGADGP  365

Query  1203  AKTVCSNAKPKLTGKQTP  1256
                 C+N  PKL G Q P
Sbjct  366   PTFECTNVTPKLVGTQNP  383



>gb|AAP42648.1| polygalacturonase [Brassica napus]
Length=397

 Score =   329 bits (844),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 170/378 (45%), Positives = 239/378 (63%), Gaps = 8/378 (2%)
 Frame = +3

Query  141   FVLFLLADLGESAE---FKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQA  311
             + + +L  LG SA    F V     SDI+  LLKA+  AC A  PS ++IPKG F++ + 
Sbjct  8     YTILVLCLLGYSANAEVFTVGGPPGSDITAALLKAFTSACQAPAPSQVLIPKGDFKLGEI  67

Query  312   LLKGPCKAPIELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYG  491
              + GPCK+P+E  ++  +KA  +    + K  W+    ++ F L+G GT DG+G+     
Sbjct  68    AMTGPCKSPVEFTLQGNVKA--DGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKA  125

Query  492   QKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADS  671
                   F+  KLP ++  +F+ N+ I+D+TSL++K FH NV  GKN+TF  I I APA+S
Sbjct  126   NNCHKTFECKKLPISVRFDFVDNAEIKDVTSLDAKNFHFNVISGKNMTFDNIKIIAPAES  185

Query  672   HNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPG  851
              NTDGIH+ +   V I ++ I TGDDCIS+GDG++NL I+ V CGPGHGISVGSLG+   
Sbjct  186   PNTDGIHLGRCEGVKILNTKISTGDDCISVGDGMKNLLIEKVVCGPGHGISVGSLGRYGW  245

Query  852   EEPVKGVTVKDSKFIGTDNGLRIKTWPNSH-PGVVTDIHYHKIEMEDVKNPIVIDQEYCP  1028
             E+ V  + V +    GTDNGLRIKTWP++        IH+  I +  V NPI+IDQEYCP
Sbjct  246   EQDVNDIKVINCTLEGTDNGLRIKTWPSAACTTTAAGIHFENIILNKVSNPILIDQEYCP  305

Query  1029  NNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GA  1202
              NQC+K KPS +K+ ++++ NI+GTS  ++AV + CS G PCE+V+ GDIN+ + G  G 
Sbjct  306   WNQCNKSKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGPDGP  365

Query  1203  AKTVCSNAKPKLTGKQTP  1256
                 C+N  PKL G Q P
Sbjct  366   PTFECTNVTPKLVGTQNP  383



>emb|CDP04342.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   324 bits (830),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 198/286 (69%), Gaps = 2/286 (1%)
 Frame = +3

Query  411   LTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLN  590
             +TI YVD  TLSG GTL+GQG       +     +  KLPN LSLNF+ N++IRD+TSLN
Sbjct  1     MTIMYVDQLTLSGGGTLEGQGAKAWTQNECRVKTECSKLPNTLSLNFVNNTVIRDLTSLN  60

Query  591   SKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDG  770
             SKLFHVN+FG  N+TFQ  TI AP DS NTDGIHI     V I DS IGTGDDCISIGDG
Sbjct  61    SKLFHVNLFGCNNVTFQHFTITAPGDSPNTDGIHIGHSTGVVITDSNIGTGDDCISIGDG  120

Query  771   LENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNSHPGV  950
              + +NI  VTCGPGHGISVGSLG+   E PV+G+ V D    GT NG+R+K+WP S  G 
Sbjct  121   AKQVNISKVTCGPGHGISVGSLGRYDNELPVEGIFVTDCIISGTLNGVRVKSWPASKSGC  180

Query  951   VTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVII  1130
              T++H+  I M++V NP++IDQEYCPNNQC+   PS VKI+ VS+ NI GTSAT   V +
Sbjct  181   ATNMHFEGIIMQNVSNPMIIDQEYCPNNQCTNTAPSSVKIAQVSFKNITGTSATPAVVTL  240

Query  1131  ACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTPPV  1262
              CS  +PCE V+  DI+L + G  G   + C+N KP L+GK  PP+
Sbjct  241   LCSKSIPCESVEVADIDLAYNGNQGNVSSNCANVKPALSGKLNPPI  286



>ref|XP_011073814.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Sesamum indicum]
Length=394

 Score =   325 bits (834),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 240/385 (62%), Gaps = 12/385 (3%)
 Frame = +3

Query  135   FTFVLFLLADLGESA------EFKVTAEGDSDISPELLKAWDEACAATTPSIIVIPKGTF  296
             + ++L +    G  A       +   A+G SD S  +L AW  AC +   S ++IPKGT+
Sbjct  5     WIWMLMMAMVAGNHAAVFDVKSYGAKADGKSDDSKAILDAWKAACNSGQASNVLIPKGTY  64

Query  297   QMKQALLKGPCKAPIELKI-KATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQG  473
              +   +++GPCKAPI ++  KA   AP NPN +  +  W+    +D F L G G  DGQG
Sbjct  65    MVGSMIMEGPCKAPITIEANKARFVAPINPNQLRARNGWINFVGIDRFGLQG-GRFDGQG  123

Query  474   DVQIYGQKKDTGFKSDKLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITI  653
             ++  +        K   +P NLS N + N++I  ITS +SK +H++V   KN+TF+ I I
Sbjct  124   ELAWHQNNCVGTGKCGSMPINLSFNRITNALIHSITSYDSKQYHIDVLSCKNVTFRSIRI  183

Query  654   KAPADSHNTDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGS  833
              AP  S NTDGIHI +   + + ++ I TGDDC+S+GDG + +NI+ V CGPGHGI++GS
Sbjct  184   SAPDQSLNTDGIHIVRSSGINVTEADIKTGDDCVSVGDGSQQVNIEKVKCGPGHGIAIGS  243

Query  834   LGKTPGEEPVKGVTVKDSKFIGTDNGLRIKTWPNS-HPGVVTDIHYHKIEMEDVKNPIVI  1010
             LGK   EEPV GVTVK+     T +G+R++TWP S   GV  D+H+  I M +V  PI I
Sbjct  244   LGKYNNEEPVVGVTVKNCTITHTMSGVRVETWPASPSEGVARDLHFQNIVMNNVSTPISI  303

Query  1011  DQEYCPNNQCSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTF  1190
             DQEYCP  +C K+ PS VKIS+VS+ +I+GTSA++ AV + CSS  PCE+V   +INL +
Sbjct  304   DQEYCP-YKCDKKVPSRVKISDVSFDDIRGTSASKVAVRLRCSSASPCENVGLSNINLAY  362

Query  1191  KG--GAAKTVCSNAKPKLTGKQTPP  1259
              G  G A + C+N KPK+TG+  PP
Sbjct  363   HGSDGKATSECANVKPKVTGQLFPP  387



>ref|XP_010668126.1| PREDICTED: exopolygalacturonase clone GBGA483-like, partial [Beta 
vulgaris subsp. vulgaris]
Length=366

 Score =   324 bits (831),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 161/354 (45%), Positives = 226/354 (64%), Gaps = 12/354 (3%)
 Frame = +3

Query  225   LLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPPNPNDMECKK  404
              L +W  ACA+  PS +++P G + +    LKGPC+ P  ++I    KAP +    + + 
Sbjct  4     FLDSWTAACASKKPSKVLVPAGNYILGAITLKGPCQTPTVIEILGNFKAPSDVAAFKKED  63

Query  405   EWLTINYVDDFTL---SGDGTLDGQGDVQIYGQKKDTGFKSDK----LPNNLSLNFLKNS  563
              W  +  VD   +    G G  DGQG     G KK+   K+      LP N+  NF+ NS
Sbjct  64    SWFKVENVDSLIIISGKGGGVFDGQGQA---GWKKNECTKNANCAFDLPYNIRFNFVSNS  120

Query  564   IIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVIGTG  743
              +  +TSLNSK FHV + G K L    +TI APADS NTDGIHI +  ++ ++   IGTG
Sbjct  121   KVSGLTSLNSKSFHVVLLGCKQLELSDMTITAPADSPNTDGIHIGRSENIIVRGWTIGTG  180

Query  744   DDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGLRIK  923
             DDC+S GDG +N+ I+GVTCGPGHG+SVGSLGK P EEPV  +T+++     TDNG+R+K
Sbjct  181   DDCVSFGDGAKNVLIEGVTCGPGHGLSVGSLGKYPNEEPVSNITIRNCTIKNTDNGVRVK  240

Query  924   TWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNIKGT  1103
             TW NS+   VT +++  I +E+V+NP+++DQEYCP N C  + PS VKIS++ + N+KG 
Sbjct  241   TWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPWNHCKAKTPSKVKISDIRFKNVKGK  300

Query  1104  SATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTPP  1259
             S+T+EAV + CS GVPC+ V+  DI++ + G  G A ++C   KP LTGKQ+PP
Sbjct  301   SSTKEAVKLICSEGVPCDKVELADIDIQYTGPDGPAVSMCKFVKPLLTGKQSPP  354



>ref|XP_010464428.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=444

 Score =   326 bits (836),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 175/357 (49%), Positives = 226/357 (63%), Gaps = 5/357 (1%)
 Frame = +3

Query  195   AEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAP  374
             A+G +D      KAW + CAA     +V+PKG + + +  LKGPCK P+ L++   LKAP
Sbjct  79    ADGKTDDCAAFSKAWTDVCAAG--GTLVVPKGEYLVGKLALKGPCKGPVTLELNGNLKAP  136

Query  375   PNPNDMECKKEWLTINYVDDFTLSGD-GTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNF  551
                   E    W+ I+ V DFTL+G+   LDGQG +           K + LP N+ L  
Sbjct  137   ATVAANEPHAGWIEIDNVCDFTLNGNNAILDGQGALAWKVNDCAKTGKCNSLPINIRLTG  196

Query  552   LKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSV  731
             L NS I  ITS NSKLFH+N+   KNLT + I I APA+S NTDGIHI +   V +  + 
Sbjct  197   LTNSKIMGITSTNSKLFHMNIINCKNLTLENIGIDAPAESLNTDGIHIGRSNGVNLIGAK  256

Query  732   IGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNG  911
             I TGDDC+SIGDG ENL I+ V CGPGHGIS+GSLG  P E+PV+GVTV+      TDNG
Sbjct  257   IRTGDDCVSIGDGTENLLIENVVCGPGHGISIGSLGLYPNEQPVRGVTVRKCTIKNTDNG  316

Query  912   LRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTN  1091
             +RIKTWP S PG+ ++I +  I M++V  P++IDQEYCP+ +C    PS VK+S+V+  N
Sbjct  317   VRIKTWPGSPPGIASNIIFEDITMDNVSTPVLIDQEYCPHGKCKAGVPSQVKLSDVTIKN  376

Query  1092  IKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTP  1256
             IKGTSAT+ AV + CS G PC ++   DINL   G  G A + CSN KP +TGK  P
Sbjct  377   IKGTSATKVAVKLMCSKGCPCTNIALSDINLVHNGKEGPAVSACSNIKPVITGKLIP  433



>ref|XP_010557773.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Tarenaya 
hassleriana]
Length=406

 Score =   325 bits (832),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 167/357 (47%), Positives = 225/357 (63%), Gaps = 3/357 (1%)
 Frame = +3

Query  195   AEGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAP  374
              +G +D +     AW +AC AT  S I + KG + + +    GPCK P+ +++   LKAP
Sbjct  39    GDGRTDDTAAFAAAWKQACGATGKSTITVGKGEYLVTRIDFNGPCKGPVTVELLGNLKAP  98

Query  375   PNPNDMECKKEWLTINYVDDFTLSGDGT-LDGQGDVQIYGQKKDTGFKSDKLPNNLSLNF  551
                   E    W+    + DFTL+G G+ LDGQG +           K + LP N+    
Sbjct  99    AEVTKTEAHGGWVNFGNLVDFTLNGHGSILDGQGALAWKKNDCAKTGKCNNLPINVRFTG  158

Query  552   LKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSV  731
             L NS IR ITS NSKLFH+N+   KN+T + I I AP +S NTDGIHI +   V +  + 
Sbjct  159   LTNSRIRSITSSNSKLFHMNILNCKNITLEDIGIDAPPESLNTDGIHIGRSNGVNLLGAH  218

Query  732   IGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNG  911
             + TGDDC+SIGDG ENL I+ V CGPGHGI++GSLG+ P E+PV+GV V+      T NG
Sbjct  219   VRTGDDCVSIGDGSENLVIENVRCGPGHGIAIGSLGRYPNEQPVRGVHVRHCTISNTMNG  278

Query  912   LRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTN  1091
             +RIKTWP S  G+ +++H+  I ME+V  PI++DQEYCP N C +  PS+VKIS+VS+ N
Sbjct  279   VRIKTWPASPAGIASNLHFEDIVMENVGTPILVDQEYCPYNHCKRGSPSMVKISDVSFKN  338

Query  1092  IKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTP  1256
             I+GTS+T+ AV + CS GVPC  V+  DINLT+ G  G A + C+N KP L+GK  P
Sbjct  339   IRGTSSTKTAVKLVCSKGVPCSKVELSDINLTYNGKDGPAVSECANVKPILSGKIIP  395



>ref|XP_004169306.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=424

 Score =   325 bits (833),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 165/366 (45%), Positives = 236/366 (64%), Gaps = 14/366 (4%)
 Frame = +3

Query  183   FKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKI  353
             F +T  G   ++DI+  L  AW +ACA+T  SI++IP G +Q+ Q++L GPCK+ I+ ++
Sbjct  44    FDITTYGAKPNTDITQALANAWKDACASTNSSILLIPIGVYQLNQSILDGPCKSTIDFRL  103

Query  354   KATLKAPPNPNDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSD--KL  527
             + TL+A PNP         +   ++D  T+SG G  DGQ   +  G K D   +    K 
Sbjct  104   EGTLQAHPNP----IGNMMVLFEHIDQLTVSGTGAFDGQR--KKGGDKNDCRLEKTCAKF  157

Query  528   PNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKIC  707
             P N+  N + NSI++DITSL+S+ FH+N+F  KN+T Q +TI +P  + N+DGIH++   
Sbjct  158   PRNVKFNSINNSIVKDITSLDSQNFHINLFDCKNVTLQNVTIISPESNPNSDGIHVSSSE  217

Query  708   DVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDS  887
             ++ I ++ I  G DC+S+GD  + + I  VTCGPG GIS+GSLG+      V GVTVK  
Sbjct  218   EINILNTQISNGADCVSVGDSSKQITITNVTCGPGDGISIGSLGRYANRTEVTGVTVKSC  277

Query  888   KFIGTDNGLRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLV  1064
             K I T NG+RIK+WP+S      +D+H+  IEM +V NP+VI+QEYCP +QC K+ PS +
Sbjct  278   KLINTWNGVRIKSWPDSASAYTASDLHFEDIEMVNVSNPVVINQEYCPFDQCDKKIPSKI  337

Query  1065  KISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKL  1238
             KISNVS+ NI+GTSAT  A+ + CS  +PCEDV+  DI+LT+ G  G   + C N  P +
Sbjct  338   KISNVSFKNIRGTSATSVAIQLICSKDLPCEDVEVADIDLTYTGTQGRITSQCRNVIPII  397

Query  1239  TGKQTP  1256
             TGKQ P
Sbjct  398   TGKQNP  403



>ref|XP_002884670.1| exopolygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60929.1| exopolygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   325 bits (834),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 170/356 (48%), Positives = 222/356 (62%), Gaps = 5/356 (1%)
 Frame = +3

Query  198   EGDSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKIKATLKAPP  377
             +G +D S   + AW EACAA   S I +PKG + ++    KGPCK P+ L++   LKAP 
Sbjct  85    DGKTDDSAAFMAAWKEACAAG--STITVPKGEYLVESLEFKGPCKGPVTLELNGNLKAPA  142

Query  378   NPNDMECKKEWLTINYVDDFTLSGD-GTLDGQGDVQIYGQKKDTGFKSDKLPNNLSLNFL  554
                  +    W+    + DFTL+G+    DGQG +           K + LP N+    L
Sbjct  143   TVKTTKPHAGWIDFENLADFTLNGNKAIFDGQGSLAWKANDCAKTGKCNSLPINIRFTGL  202

Query  555   KNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAKICDVTIKDSVI  734
              NS I+ ITS NSKLFH+N+   KN+T + I I AP +S NTDGIHI +   V +  + I
Sbjct  203   TNSKIKSITSTNSKLFHMNILNCKNITLEDIGIDAPPESLNTDGIHIGRSNGVNLIGAKI  262

Query  735   GTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVKDSKFIGTDNGL  914
              TGDDC+SIGDG ENL ++ V CGPGHGIS+GSLG+ P E+PVKGVTV+      TDNG+
Sbjct  263   KTGDDCVSIGDGTENLIVENVECGPGHGISIGSLGRYPNEQPVKGVTVRKCLIKNTDNGV  322

Query  915   RIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPSLVKISNVSYTNI  1094
             RIKTWP S PG+ ++I +  I M++V  P++IDQEYCP   C    PS VK+S+V+  NI
Sbjct  323   RIKTWPGSPPGIASNILFEDITMDNVSTPVLIDQEYCPYGHCKAGVPSKVKLSDVTIKNI  382

Query  1095  KGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKPKLTGKQTP  1256
             KGTSAT+ AV + CS GVPC ++   DINL   G  G A + CSN KP L+GK  P
Sbjct  383   KGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKPILSGKLVP  438



>ref|XP_010675916.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   323 bits (827),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/376 (43%), Positives = 235/376 (63%), Gaps = 15/376 (4%)
 Frame = +3

Query  168   GESAEFKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAP  338
             G++  F +T +G    +D++   L +W  ACA+  PS +++P G + +    LKGPC+ P
Sbjct  31    GDTIVFDITTKGAKPGADVTQAFLDSWTAACASKKPSKVLVPAGNYLLGAITLKGPCQTP  90

Query  339   IELKIKATLKAPPNPNDMECKKEWLTINYVDDFTLSGDG---TLDGQGDVQIYGQKKDTG  509
               ++I    KAP +    +    W  +  VD   + G       DGQG     G KK+  
Sbjct  91    TVIEILGNFKAPSDVAAFKKADSWFKVENVDSVIIIGGKGGGVFDGQGQA---GWKKNEC  147

Query  510   FKSDK----LPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHN  677
              K+      LP N+  NF+ NS +  +TSLNSK FH+ + G K L    +T+ APADS N
Sbjct  148   SKNANCAFDLPYNIRFNFVSNSKVSGLTSLNSKSFHIVLMGCKQLELSGMTVTAPADSPN  207

Query  678   TDGIHIAKICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEE  857
             TDGIHI +  ++ ++   IGTGDDC+S GDG +N+ I+GVTCGPGHG+SVGSLGK P EE
Sbjct  208   TDGIHIGRSENIIVRGWTIGTGDDCVSFGDGAKNVLIEGVTCGPGHGLSVGSLGKYPNEE  267

Query  858   PVKGVTVKDSKFIGTDNGLRIKTWPNSHPGVVTDIHYHKIEMEDVKNPIVIDQEYCPNNQ  1037
             PV  +T+++     TDNG+R+KTW NS+   VT +++  I +E+V+NP+++DQEYCP N 
Sbjct  268   PVSNITIRNCIIKNTDNGVRVKTWHNSYESTVTGLYFEDITLENVRNPVIVDQEYCPWNH  327

Query  1038  CSKEKPSLVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFK--GGAAKT  1211
             C    PS VKIS++ + N++G S+T+EAV + CS GVPC+ V+  DI++ +   GG A +
Sbjct  328   CKARTPSKVKISDIRFKNVRGKSSTKEAVKLICSQGVPCDKVELADIDIQYTGPGGPAVS  387

Query  1212  VCSNAKPKLTGKQTPP  1259
             +C   KP LTGKQ+PP
Sbjct  388   MCKFVKPLLTGKQSPP  403



>ref|XP_004144611.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=506

 Score =   324 bits (831),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 167/368 (45%), Positives = 238/368 (65%), Gaps = 18/368 (5%)
 Frame = +3

Query  183   FKVTAEG---DSDISPELLKAWDEACAATTPSIIVIPKGTFQMKQALLKGPCKAPIELKI  353
             F +T  G   ++DI+  L  AW +ACA+T  SI++IP G +Q+ Q++L GPCK+ I+ ++
Sbjct  126   FDITTYGAKPNTDITQALANAWKDACASTNSSILLIPIGVYQLNQSILDGPCKSTIDFRL  185

Query  354   KATLKAPPNP--NDMECKKEWLTINYVDDFTLSGDGTLDGQGDVQIYGQKKDTGFKSD--  521
             + TL+A PNP  N M      +   ++D  T+SG G  DGQ   +  G K D   +    
Sbjct  186   EGTLQAHPNPIGNMM------VLFEHIDQLTVSGTGAFDGQR--KKGGDKNDCRLEKTCA  237

Query  522   KLPNNLSLNFLKNSIIRDITSLNSKLFHVNVFGGKNLTFQKITIKAPADSHNTDGIHIAK  701
             K P N+  N + NSI++DITSL+S+ FH+N+F  KN+T Q +TI +P  + N+DGIH++ 
Sbjct  238   KFPRNVKFNSINNSIVKDITSLDSQNFHINLFDCKNVTLQNVTIISPESNPNSDGIHVSS  297

Query  702   ICDVTIKDSVIGTGDDCISIGDGLENLNIDGVTCGPGHGISVGSLGKTPGEEPVKGVTVK  881
               ++ I ++ I  G DC+S+GD  + + I  VTCGPG GIS+GSLG+      V GVTVK
Sbjct  298   SEEINILNTQISNGADCVSVGDSSKQITITNVTCGPGDGISIGSLGRYANRTEVTGVTVK  357

Query  882   DSKFIGTDNGLRIKTWPNSHPG-VVTDIHYHKIEMEDVKNPIVIDQEYCPNNQCSKEKPS  1058
               K I T NG+RIK+WP+S      +D+H+  IEM +V NP+VI+QEYCP +QC K+ PS
Sbjct  358   SCKLINTWNGVRIKSWPDSASAYTASDLHFEDIEMVNVSNPVVINQEYCPFDQCDKKIPS  417

Query  1059  LVKISNVSYTNIKGTSATEEAVIIACSSGVPCEDVKFGDINLTFKG--GAAKTVCSNAKP  1232
              +KISNVS+ NI+GTSAT  A+ + CS  +PCEDV+  DI+LT+ G  G   + C N  P
Sbjct  418   KIKISNVSFKNIRGTSATSVAIQLICSKDLPCEDVEVADIDLTYTGTQGRITSQCRNVIP  477

Query  1233  KLTGKQTP  1256
              +TGKQ P
Sbjct  478   IITGKQNP  485


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 49/82 (60%), Gaps = 11/82 (13%)
 Frame = +3

Query  138  TFVLFLLADLGESAE-----FKVTAEGD----SDISPELLKAWDEACAATTPSIIVIPKG  290
            TF++ LL+   ES       F +   G+     D++  L  AW++ACA+  PS ++IPKG
Sbjct  11   TFLMILLSFTIESRSHVDVIFHLRKYGNIVSGVDVTEALKDAWNDACASVPPSAVIIPKG  70

Query  291  TFQMKQALLKGPC--KAPIELK  350
             F++++   KGPC  K+PIE++
Sbjct  71   IFKVREGEFKGPCKSKSPIEMR  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4054079720394