BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24955_g2_i5 len=1919 path=[18667:0-1082 17089:1083-1193
11133:1194-1373 5764:1374-1443 32986:1444-1445 8516:1446-1640
33010:1641-1644 8715:1645-1918]

Length=1919
                                                                      Score     E

ref|XP_006338380.1|  PREDICTED: uncharacterized protein LOC102589...    414   2e-132   
ref|XP_004232173.1|  PREDICTED: uncharacterized protein LOC101263...    402   1e-127   
ref|XP_010316225.1|  PREDICTED: uncharacterized protein LOC101263...    397   7e-126   
ref|XP_009757448.1|  PREDICTED: uncharacterized protein LOC104210...    385   3e-121   
ref|XP_009598477.1|  PREDICTED: uncharacterized protein LOC104094...    384   1e-120   
ref|XP_009598479.1|  PREDICTED: uncharacterized protein LOC104094...    383   1e-120   
ref|XP_009757449.1|  PREDICTED: uncharacterized protein LOC104210...    380   1e-119   
ref|XP_009757445.1|  PREDICTED: uncharacterized protein LOC104210...    380   2e-119   
ref|XP_011098736.1|  PREDICTED: uncharacterized protein LOC105177319    304   6e-89    
ref|XP_009397757.1|  PREDICTED: uncharacterized protein LOC103982...    281   1e-82    
ref|XP_009397758.1|  PREDICTED: polyadenylate-binding protein, cy...    280   3e-82    
ref|XP_009397756.1|  PREDICTED: uncharacterized protein LOC103982...    280   3e-82    
emb|CBI21228.3|  unnamed protein product                                280   4e-82    
ref|XP_010660634.1|  PREDICTED: probable RNA-binding protein 46 i...    280   9e-82    
ref|XP_010660633.1|  PREDICTED: probable RNA-binding protein 46 i...    280   9e-82    
ref|XP_010660632.1|  PREDICTED: probable RNA-binding protein 46 i...    280   1e-81    
ref|XP_010660631.1|  PREDICTED: probable RNA-binding protein 46 i...    280   1e-81    
emb|CDP02304.1|  unnamed protein product                                277   1e-80    
ref|XP_010939344.1|  PREDICTED: probable RNA-binding protein 46         276   2e-80    
ref|XP_008807827.1|  PREDICTED: probable RNA-binding protein 46         268   4e-77    
ref|XP_010693188.1|  PREDICTED: uncharacterized protein LOC104906...    263   2e-75    
ref|XP_010693189.1|  PREDICTED: uncharacterized protein LOC104906...    263   3e-75    
gb|EYU44181.1|  hypothetical protein MIMGU_mgv1a008346mg                255   2e-74    
ref|XP_006837089.1|  hypothetical protein AMTR_s00110p00107430          242   1e-66    
ref|XP_004962981.1|  PREDICTED: polyadenylate-binding protein, cy...    239   4e-66    
ref|XP_004962982.1|  PREDICTED: polyadenylate-binding protein, cy...    239   5e-66    
ref|XP_010237120.1|  PREDICTED: uncharacterized protein LOC100834...    237   4e-65    
ref|XP_009397759.1|  PREDICTED: uncharacterized protein LOC103982...    232   1e-64    
ref|XP_008673161.1|  PREDICTED: uncharacterized protein LOC100191...    232   2e-63    
ref|XP_002442379.1|  hypothetical protein SORBIDRAFT_08g019140          225   1e-62    Sorghum bicolor [broomcorn]
ref|XP_008673214.1|  PREDICTED: uncharacterized protein LOC100191...    221   1e-59    
ref|NP_001130787.1|  uncharacterized protein LOC100191891               221   1e-59    Zea mays [maize]
gb|ACF86800.2|  unknown                                                 217   1e-59    Zea mays [maize]
ref|XP_010237119.1|  PREDICTED: splicing factor, proline- and glu...    218   1e-58    
ref|XP_006664137.1|  PREDICTED: uncharacterized protein LOC102706...    213   5e-57    
ref|NP_001177024.1|  Os12g0577100                                       208   1e-56    
ref|XP_006664136.1|  PREDICTED: uncharacterized protein LOC102706...    213   2e-56    
ref|XP_009397761.1|  PREDICTED: polyadenylate-binding protein, cy...    197   4e-52    
gb|EEE53482.1|  hypothetical protein OsJ_36631                          179   4e-46    Oryza sativa Japonica Group [Japonica rice]
gb|EMT11921.1|  Heterogeneous nuclear ribonucleoprotein A1              181   2e-45    
gb|EMS53186.1|  Heterogeneous nuclear ribonucleoprotein A1              166   1e-40    
gb|EEC69559.1|  hypothetical protein OsI_38857                          152   3e-37    Oryza sativa Indica Group [Indian rice]
gb|EEC69560.1|  hypothetical protein OsI_38859                        90.5    7e-17    Oryza sativa Indica Group [Indian rice]
emb|CAN79549.1|  hypothetical protein VITISV_022646                   89.4    4e-15    Vitis vinifera
ref|XP_006855084.1|  hypothetical protein AMTR_s00031p00165100        76.6    2e-11    
gb|ETN62734.1|  heterogeneous nuclear ribonucleoprotein r             76.3    4e-11    
ref|XP_001656100.1|  heterogeneous nuclear ribonucleoprotein r        75.9    4e-11    Aedes aegypti
ref|XP_003435825.1|  AGAP001419-PC                                    74.7    1e-10    
ref|XP_321714.3|  AGAP001419-PA                                       74.7    1e-10    Anopheles gambiae str. PEST
gb|KFB42190.1|  AGAP001419-PC-like protein                            74.3    2e-10    
ref|XP_008555305.1|  PREDICTED: heterogeneous nuclear ribonucleop...  73.9    2e-10    
ref|XP_008555293.1|  PREDICTED: heterogeneous nuclear ribonucleop...  73.9    2e-10    
ref|XP_008555300.1|  PREDICTED: heterogeneous nuclear ribonucleop...  73.9    2e-10    
ref|XP_008555301.1|  PREDICTED: heterogeneous nuclear ribonucleop...  73.9    2e-10    
ref|XP_006029277.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  73.6    3e-10    
ref|XP_008555302.1|  PREDICTED: heterogeneous nuclear ribonucleop...  73.6    3e-10    
ref|XP_005286430.1|  PREDICTED: RNA-binding protein 47 isoform X1     73.6    3e-10    
ref|XP_006258543.1|  PREDICTED: RNA-binding protein 47                73.6    3e-10    
ref|XP_008555304.1|  PREDICTED: heterogeneous nuclear ribonucleop...  73.6    3e-10    
ref|XP_005286433.1|  PREDICTED: RNA-binding protein 47 isoform X3     73.2    3e-10    
ref|XP_004362450.1|  RNA-binding region RNP-1 domain-containing p...  72.8    4e-10    
ref|XP_007496602.1|  PREDICTED: RNA-binding protein 47 isoform X11    73.2    4e-10    
ref|XP_005286432.1|  PREDICTED: RNA-binding protein 47 isoform X2     72.8    4e-10    
ref|XP_001365615.1|  PREDICTED: RNA-binding protein 47 isoform X2     72.8    4e-10    Monodelphis domestica
ref|XP_001365552.1|  PREDICTED: RNA-binding protein 47 isoform X1     72.8    4e-10    Monodelphis domestica
ref|XP_006129555.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  72.8    5e-10    
ref|XP_006812136.1|  PREDICTED: heterogeneous nuclear ribonucleop...  72.8    5e-10    
ref|XP_006812138.1|  PREDICTED: heterogeneous nuclear ribonucleop...  72.8    5e-10    
ref|XP_002731265.1|  PREDICTED: heterogeneous nuclear ribonucleop...  72.8    5e-10    Saccoglossus kowalevskii
ref|XP_006873290.1|  PREDICTED: RNA-binding protein 47 isoform X2     72.4    6e-10    
gb|KFM58410.1|  Heterogeneous nuclear ribonucleoprotein Q             72.4    7e-10    
ref|XP_003773344.1|  PREDICTED: RNA-binding protein 47 isoform 1      72.4    7e-10    
ref|XP_003773345.1|  PREDICTED: RNA-binding protein 47 isoform 2      72.0    8e-10    
ref|XP_006846586.1|  hypothetical protein AMTR_s00018p00254940        71.6    9e-10    
ref|XP_008564158.1|  PREDICTED: RNA-binding protein 47                72.0    9e-10    
ref|XP_002400928.1|  G-3-P dehydrogenase, putative                    71.2    9e-10    Ixodes scapularis [blacklegged tick]
ref|XP_008825459.1|  PREDICTED: RNA-binding protein 47 isoform X1     71.6    1e-09    
ref|XP_002968556.1|  hypothetical protein SELMODRAFT_169951           71.2    1e-09    
ref|XP_002157894.2|  PREDICTED: heterogeneous nuclear ribonucleop...  71.6    1e-09    
ref|XP_001362315.1|  PREDICTED: RNA-binding protein 47-like isofo...  71.6    1e-09    Monodelphis domestica
ref|XP_006873289.1|  PREDICTED: RNA-binding protein 47 isoform X1     71.6    1e-09    
ref|XP_008825460.1|  PREDICTED: RNA-binding protein 47 isoform X2     71.2    1e-09    
ref|XP_008190475.1|  PREDICTED: heterogeneous nuclear ribonucleop...  71.2    1e-09    
gb|KFO32871.1|  RNA-binding protein 47                                71.2    1e-09    
ref|XP_001772239.1|  predicted protein                                71.2    1e-09    
ref|XP_010623438.1|  PREDICTED: RNA-binding protein 47                71.2    1e-09    
ref|XP_008190474.1|  PREDICTED: heterogeneous nuclear ribonucleop...  71.2    1e-09    
ref|XP_008190470.1|  PREDICTED: heterogeneous nuclear ribonucleop...  71.2    1e-09    
ref|XP_006974680.1|  PREDICTED: RNA-binding protein 47 isoform X1     71.2    1e-09    
ref|XP_009909036.1|  PREDICTED: RNA-binding protein 47 isoform X2     71.2    2e-09    
gb|EEZ97818.1|  hypothetical protein TcasGA2_TC000185                 71.2    2e-09    
ref|XP_009916985.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  70.9    2e-09    
ref|XP_009865702.1|  PREDICTED: RNA-binding protein 47                70.9    2e-09    
gb|KFP86885.1|  RNA-binding protein 47                                70.9    2e-09    
ref|XP_010085867.1|  PREDICTED: RNA-binding protein 47                70.9    2e-09    
ref|XP_009909035.1|  PREDICTED: RNA-binding protein 47 isoform X1     70.5    2e-09    
ref|XP_007945338.1|  PREDICTED: RNA-binding protein 47 isoform X1     70.9    2e-09    
gb|KFQ03807.1|  RNA-binding protein 47                                70.9    2e-09    
ref|XP_010572765.1|  PREDICTED: RNA-binding protein 47 isoform X1     70.9    2e-09    
ref|XP_006974682.1|  PREDICTED: RNA-binding protein 47 isoform X3     70.5    2e-09    
ref|XP_009502943.1|  PREDICTED: RNA-binding protein 47 isoform X2     70.9    2e-09    
ref|XP_005074427.1|  PREDICTED: RNA-binding protein 47 isoform X1     70.9    2e-09    
gb|KFV05396.1|  RNA-binding protein 47                                70.5    2e-09    
ref|XP_008204674.1|  PREDICTED: heterogeneous nuclear ribonucleop...  70.5    2e-09    
gb|KFV50274.1|  RNA-binding protein 47                                70.5    2e-09    
gb|EFA74815.1|  RNA-binding region RNP-1 domain-containing protein    70.1    2e-09    Heterostelium album PN500
ref|XP_007945339.1|  PREDICTED: RNA-binding protein 47 isoform X2     70.5    2e-09    
gb|KFQ64269.1|  RNA-binding protein 47                                70.5    2e-09    
ref|XP_009487094.1|  PREDICTED: RNA-binding protein 47 isoform X1     70.5    2e-09    
ref|XP_005501303.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  70.5    2e-09    
ref|XP_007440203.1|  PREDICTED: RNA-binding protein 47-like isofo...  70.5    2e-09    
ref|XP_009805963.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  70.5    2e-09    
ref|XP_007440200.1|  PREDICTED: RNA-binding protein 47-like isofo...  70.5    2e-09    
ref|XP_007440204.1|  PREDICTED: RNA-binding protein 47-like isofo...  70.5    3e-09    
ref|XP_010572766.1|  PREDICTED: RNA-binding protein 47 isoform X2     70.5    3e-09    
ref|XP_005168416.1|  PREDICTED: RNA-binding protein 47 isoform X1     70.5    3e-09    
ref|XP_010196673.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  70.5    3e-09    
ref|XP_006629982.1|  PREDICTED: RNA-binding protein 47-like isofo...  70.5    3e-09    
ref|XP_009487095.1|  PREDICTED: RNA-binding protein 47 isoform X2     70.1    3e-09    
gb|EHJ68984.1|  hypothetical protein KGM_20249                        68.2    3e-09    
ref|NP_001108158.1|  RNA-binding protein 47                           70.5    3e-09    Danio rerio [leopard danio]
ref|XP_009502942.1|  PREDICTED: RNA-binding protein 47 isoform X1     70.1    3e-09    
ref|XP_007648692.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  70.1    3e-09    
ref|XP_006629983.1|  PREDICTED: RNA-binding protein 47-like isofo...  70.1    3e-09    
ref|XP_005074428.1|  PREDICTED: RNA-binding protein 47 isoform X2     70.1    3e-09    
gb|KDR22175.1|  hypothetical protein L798_02663                       70.1    3e-09    
ref|XP_009067462.1|  PREDICTED: RNA-binding protein 47                70.1    4e-09    
ref|NP_620704.1|  RNA-binding protein 47 isoform a                    70.1    4e-09    Mus musculus [mouse]
gb|KFP74715.1|  RNA-binding protein 47                                70.1    4e-09    
ref|XP_005168418.1|  PREDICTED: RNA-binding protein 47 isoform X2     69.7    4e-09    
ref|XP_011051968.1|  PREDICTED: heterogeneous nuclear ribonucleop...  70.1    4e-09    
dbj|BAC29127.1|  unnamed protein product                              69.7    4e-09    Mus musculus [mouse]
gb|EFN88129.1|  Heterogeneous nuclear ribonucleoprotein Q             70.1    4e-09    
ref|XP_005177731.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.7    4e-09    
ref|XP_011051967.1|  PREDICTED: heterogeneous nuclear ribonucleop...  70.1    4e-09    
ref|XP_005177728.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.7    4e-09    
ref|XP_011051966.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.7    4e-09    
gb|EZA48292.1|  Heterogeneous nuclear ribonucleoprotein Q             69.7    4e-09    
ref|XP_011051965.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.7    4e-09    
ref|XP_011051964.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.7    4e-09    
ref|XP_005177733.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.7    5e-09    
ref|XP_005177734.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.3    5e-09    
ref|XP_011051969.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.7    5e-09    
ref|XP_005177732.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.3    5e-09    
ref|XP_006787281.1|  PREDICTED: RNA-binding protein 47-like isofo...  69.7    5e-09    
gb|KFW83873.1|  RNA-binding protein 47                                69.7    5e-09    
ref|NP_001005882.1|  RNA-binding protein 47                           69.7    5e-09    Rattus norvegicus [brown rat]
ref|XP_006787274.1|  PREDICTED: RNA-binding protein 47-like isofo...  69.7    5e-09    
gb|EFN64303.1|  Heterogeneous nuclear ribonucleoprotein Q             69.7    5e-09    
gb|ERE91469.1|  APOBEC1 complementation factor-like protein           69.3    5e-09    
ref|XP_005490579.1|  PREDICTED: RNA-binding protein 47 isoform X2     69.3    6e-09    
ref|XP_005456969.1|  PREDICTED: RNA-binding protein 47-like isofo...  69.3    6e-09    
gb|EGI66996.1|  Heterogeneous nuclear ribonucleoprotein Q             69.7    6e-09    
ref|XP_003452186.1|  PREDICTED: RNA-binding protein 47-like isofo...  69.3    6e-09    
ref|XP_005490578.1|  PREDICTED: RNA-binding protein 47 isoform X1     69.3    6e-09    
ref|XP_009098441.1|  PREDICTED: RNA-binding protein 47 isoform X1     69.3    6e-09    
ref|XP_005456968.1|  PREDICTED: RNA-binding protein 47-like isofo...  69.3    6e-09    
ref|XP_009098448.1|  PREDICTED: RNA-binding protein 47 isoform X2     69.3    6e-09    
ref|XP_005456963.1|  PREDICTED: RNA-binding protein 47-like isofo...  69.3    6e-09    
ref|XP_003205901.2|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  69.3    6e-09    
ref|XP_005177729.1|  PREDICTED: heterogeneous nuclear ribonucleop...  69.3    6e-09    
ref|XP_005415525.1|  PREDICTED: RNA-binding protein 47 isoform X2     69.3    6e-09    
ref|XP_005415524.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.9    6e-09    
ref|NP_001278155.1|  RNA-binding protein 47 isoform b                 68.9    6e-09    
ref|XP_010020504.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  69.3    6e-09    
ref|XP_005517815.1|  PREDICTED: RNA-binding protein 47 isoform X2     69.3    6e-09    
ref|XP_002187774.1|  PREDICTED: RNA-binding protein 47 isoform 1      69.3    6e-09    Taeniopygia guttata
ref|XP_008925726.1|  PREDICTED: RNA-binding protein 47                68.9    6e-09    
gb|KFV80473.1|  RNA-binding protein 47                                68.9    6e-09    
ref|XP_001845311.1|  heterogeneous nuclear ribonucleoprotein r        68.9    6e-09    Culex quinquefasciatus
ref|XP_010400069.1|  PREDICTED: RNA-binding protein 47 isoform X4     69.3    6e-09    
ref|XP_005456971.1|  PREDICTED: RNA-binding protein 47-like isofo...  68.9    7e-09    
ref|XP_002096465.1|  GE25686                                          69.3    7e-09    Drosophila yakuba
ref|XP_010183760.1|  PREDICTED: RNA-binding protein 47                69.3    7e-09    
ref|XP_005177725.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.9    7e-09    
ref|XP_010400068.1|  PREDICTED: RNA-binding protein 47 isoform X3     69.3    7e-09    
ref|XP_005517814.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.9    7e-09    
ref|XP_005177730.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.9    7e-09    
ref|XP_010400067.1|  PREDICTED: RNA-binding protein 47 isoform X2     69.3    7e-09    
ref|XP_002072163.1|  GK22469                                          69.3    7e-09    Drosophila willistoni
ref|XP_004658723.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.9    7e-09    
ref|XP_001954532.1|  GF16693                                          69.3    7e-09    Drosophila ananassae
ref|XP_005045274.1|  PREDICTED: RNA-binding protein 47 isoform X5     68.9    7e-09    
ref|XP_008639610.1|  PREDICTED: RNA-binding protein 47 isoform X2     68.9    7e-09    
ref|XP_008639609.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.9    7e-09    
ref|XP_005177727.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.9    7e-09    
ref|XP_006787282.1|  PREDICTED: RNA-binding protein 47-like isofo...  68.9    7e-09    
ref|XP_010400066.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.9    7e-09    
ref|XP_004905764.1|  PREDICTED: RNA-binding protein 47 isoform X6     68.9    7e-09    
gb|KFQ36669.1|  RNA-binding protein 47                                68.9    7e-09    
ref|XP_004905759.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.9    7e-09    
ref|XP_005045273.1|  PREDICTED: RNA-binding protein 47 isoform X4     68.9    7e-09    
ref|XP_004396198.1|  PREDICTED: RNA-binding protein 47 isoform 3      68.9    8e-09    
ref|NP_001262781.1|  syncrip, isoform O                               68.9    8e-09    
ref|XP_005045270.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.9    8e-09    
ref|XP_005456970.1|  PREDICTED: RNA-binding protein 47-like isofo...  68.9    8e-09    
ref|XP_005392007.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.9    8e-09    
ref|XP_005392014.1|  PREDICTED: RNA-binding protein 47 isoform X8     68.9    8e-09    
ref|XP_003699450.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.9    8e-09    
ref|XP_005359335.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.9    8e-09    
ref|XP_010153888.1|  PREDICTED: RNA-binding protein 47 isoform X2     68.9    9e-09    
ref|XP_004658724.1|  PREDICTED: RNA-binding protein 47 isoform X2     68.6    9e-09    
ref|XP_002709446.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.9    9e-09    Oryctolagus cuniculus [domestic rabbit]
ref|XP_004936167.1|  PREDICTED: RNA-binding protein 47 isoform X6     68.9    9e-09    
gb|KFP50159.1|  RNA-binding protein 47                                68.6    9e-09    
ref|XP_008273521.1|  PREDICTED: RNA-binding protein 47 isoform X2     68.6    9e-09    
ref|XP_009639590.1|  PREDICTED: RNA-binding protein 47                68.6    9e-09    
ref|XP_004936165.1|  PREDICTED: RNA-binding protein 47 isoform X4     68.9    9e-09    
ref|XP_010153887.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.6    9e-09    
ref|XP_002001097.1|  GI10594                                          68.9    9e-09    Drosophila mojavensis
ref|XP_009570356.1|  PREDICTED: RNA-binding protein 47 isoform X2     68.6    9e-09    
ref|XP_004936164.1|  PREDICTED: RNA-binding protein 47 isoform X3     68.9    9e-09    
ref|XP_001979385.1|  GG24121                                          68.9    9e-09    Drosophila erecta
ref|XP_005149171.1|  PREDICTED: RNA-binding protein 47 isoform X2     68.6    9e-09    
ref|XP_009472544.1|  PREDICTED: RNA-binding protein 47                68.6    9e-09    
gb|KFW08946.1|  RNA-binding protein 47                                68.6    1e-08    
ref|XP_009671747.1|  PREDICTED: RNA-binding protein 47                68.9    1e-08    
ref|XP_004384711.1|  PREDICTED: RNA-binding protein 47 isoform 1      68.6    1e-08    
ref|NP_001262784.1|  syncrip, isoform R                               68.6    1e-08    
gb|KFR07818.1|  RNA-binding protein 47                                68.6    1e-08    
ref|XP_010114752.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  68.6    1e-08    
gb|AAO39657.1|  AT01548p                                              68.6    1e-08    Drosophila melanogaster
ref|XP_009933807.1|  PREDICTED: RNA-binding protein 47 isoform X2     68.6    1e-08    
dbj|BAE25115.1|  unnamed protein product                              67.8    1e-08    Mus musculus [mouse]
ref|XP_004936166.1|  PREDICTED: RNA-binding protein 47 isoform X5     68.6    1e-08    
ref|XP_008490018.1|  PREDICTED: RNA-binding protein 47 isoform X2     68.6    1e-08    
ref|XP_009945730.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  68.6    1e-08    
ref|XP_003641292.1|  PREDICTED: RNA-binding protein 47 isoformX2      68.6    1e-08    
ref|XP_009883253.1|  PREDICTED: RNA-binding protein 47 isoform X2     68.6    1e-08    
ref|XP_010296653.1|  PREDICTED: RNA-binding protein 47 isoform X2     68.6    1e-08    
ref|NP_001262776.1|  syncrip, isoform I                               68.6    1e-08    
ref|NP_732556.1|  syncrip, isoform D                                  68.6    1e-08    Drosophila melanogaster
ref|XP_005030905.1|  PREDICTED: RNA-binding protein 47                68.6    1e-08    
gb|EHJ70861.1|  hypothetical protein KGM_04943                        68.6    1e-08    
ref|XP_010171808.1|  PREDICTED: RNA-binding protein 47                68.6    1e-08    
ref|NP_650913.2|  syncrip, isoform B                                  68.6    1e-08    Drosophila melanogaster
gb|KFZ63682.1|  RNA-binding protein 47                                68.2    1e-08    
ref|XP_006759379.1|  PREDICTED: RNA-binding protein 47 isoform X7     68.6    1e-08    
ref|XP_009933806.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.2    1e-08    
ref|XP_002043435.1|  GM23135                                          68.6    1e-08    Drosophila sechellia
ref|XP_006759373.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.6    1e-08    
ref|XP_006759380.1|  PREDICTED: RNA-binding protein 47 isoform X8     68.2    1e-08    
gb|KFQ02577.1|  RNA-binding protein 47                                68.6    1e-08    
ref|XP_004384712.1|  PREDICTED: RNA-binding protein 47 isoform 2      68.2    1e-08    
ref|XP_004564397.1|  PREDICTED: RNA-binding protein 47-like isofo...  68.6    1e-08    
ref|XP_010296652.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.2    1e-08    
ref|XP_009883252.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.2    1e-08    
ref|XP_005928322.1|  PREDICTED: RNA-binding protein 47-like isofo...  68.6    1e-08    
ref|XP_005741168.1|  PREDICTED: RNA-binding protein 47-like isofo...  68.6    1e-08    
ref|NP_732555.1|  syncrip, isoform E                                  68.2    1e-08    Drosophila melanogaster
ref|XP_005149170.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.2    1e-08    
ref|XP_009703476.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  68.2    1e-08    
ref|NP_001262783.1|  syncrip, isoform Q                               68.6    1e-08    
ref|XP_009564856.1|  PREDICTED: RNA-binding protein 47 isoform X2     68.6    1e-08    
ref|XP_009278411.1|  PREDICTED: RNA-binding protein 47 isoform X2     68.6    1e-08    
ref|XP_005359336.1|  PREDICTED: RNA-binding protein 47 isoform X2     68.2    1e-08    
ref|XP_004396199.1|  PREDICTED: RNA-binding protein 47 isoform 4      68.2    1e-08    
ref|XP_010138935.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.6    1e-08    
gb|KFP67495.1|  RNA-binding protein 47                                68.2    1e-08    
ref|XP_004564391.1|  PREDICTED: RNA-binding protein 47-like isofo...  68.6    1e-08    
ref|XP_005928316.1|  PREDICTED: RNA-binding protein 47-like isofo...  68.6    1e-08    
ref|XP_005741160.1|  PREDICTED: RNA-binding protein 47-like isofo...  68.6    1e-08    
ref|NP_001262780.1|  syncrip, isoform N                               68.6    1e-08    
ref|XP_004564398.1|  PREDICTED: RNA-binding protein 47-like isofo...  68.2    1e-08    
ref|XP_008490017.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.2    1e-08    
ref|XP_009278410.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.2    1e-08    
ref|XP_005928323.1|  PREDICTED: RNA-binding protein 47-like isofo...  68.2    1e-08    
ref|XP_006088547.1|  PREDICTED: RNA-binding protein 47                68.2    1e-08    
ref|XP_005741169.1|  PREDICTED: RNA-binding protein 47-like isofo...  68.2    1e-08    
ref|XP_010138936.1|  PREDICTED: RNA-binding protein 47 isoform X2     68.2    1e-08    
ref|XP_009570355.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.2    1e-08    
ref|XP_004564396.1|  PREDICTED: RNA-binding protein 47-like isofo...  68.2    1e-08    
ref|XP_005741167.1|  PREDICTED: RNA-binding protein 47-like isofo...  68.2    1e-08    
gb|KFO92534.1|  RNA-binding protein 47                                68.2    1e-08    
gb|EOA93378.1|  RNA-binding protein 47                                68.2    1e-08    
ref|XP_009330718.1|  PREDICTED: RNA-binding protein 47 isoform X2     68.2    1e-08    
gb|KFQ85352.1|  RNA-binding protein 47                                68.2    1e-08    
ref|XP_010282042.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  68.2    1e-08    
ref|NP_001262777.1|  syncrip, isoform J                               68.6    1e-08    
ref|XP_010683716.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.2    1e-08    
ref|NP_732559.1|  syncrip, isoform F                                  68.2    1e-08    
ref|NP_732557.2|  syncrip, isoform A                                  68.2    1e-08    
ref|XP_009564855.1|  PREDICTED: RNA-binding protein 47 isoform X1     68.2    1e-08    
ref|NP_001097849.1|  syncrip, isoform H                               68.2    1e-08    
ref|XP_002137140.1|  GA27045, isoform A                               68.2    1e-08    
ref|XP_010004403.1|  PREDICTED: RNA-binding protein 47 isoform X2     68.2    1e-08    
ref|XP_002102678.1|  GD19374                                          67.0    1e-08    
ref|XP_001994478.1|  GH17270                                          67.8    1e-08    
ref|NP_001262779.1|  syncrip, isoform M                               68.2    1e-08    
ref|NP_732558.2|  syncrip, isoform C                                  67.8    1e-08    
ref|NP_001262778.1|  syncrip, isoform K                               68.2    1e-08    
ref|XP_004564400.1|  PREDICTED: RNA-binding protein 47-like isofo...  67.8    1e-08    
ref|XP_005928325.1|  PREDICTED: RNA-binding protein 47-like isofo...  67.8    1e-08    
ref|XP_005741171.1|  PREDICTED: RNA-binding protein 47-like isofo...  67.8    1e-08    
ref|XP_009330717.1|  PREDICTED: RNA-binding protein 47 isoform X1     67.8    1e-08    
ref|XP_009420808.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    1e-08    
ref|XP_007663058.1|  PREDICTED: RNA-binding protein 47 isoform X2     68.2    1e-08    
ref|XP_005232181.1|  PREDICTED: RNA-binding protein 47 isoform X1     67.8    1e-08    
ref|XP_006569432.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    1e-08    
ref|XP_006569433.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    1e-08    
ref|XP_006569425.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.2    2e-08    
ref|XP_010004402.1|  PREDICTED: RNA-binding protein 47 isoform X1     67.8    2e-08    
ref|XP_006611800.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.2    2e-08    
ref|XP_007892974.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.2    2e-08    
ref|XP_006569429.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.2    2e-08    
gb|ELK33614.1|  RNA-binding protein 47                                68.2    2e-08    
ref|XP_006569426.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.2    2e-08    
ref|XP_001505728.1|  PREDICTED: RNA-binding protein 47 isoform X1     67.8    2e-08    
ref|XP_002054147.1|  GJ22950                                          68.2    2e-08    
ref|XP_006611788.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.2    2e-08    
ref|XP_006611796.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-08    
ref|XP_009965077.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  67.8    2e-08    
ref|XP_006569421.1|  PREDICTED: heterogeneous nuclear ribonucleop...  68.2    2e-08    
ref|XP_002775939.1|  RNA-binding protein, putative                    67.4    2e-08    
ref|XP_004564399.1|  PREDICTED: RNA-binding protein 47-like isofo...  67.8    2e-08    
ref|XP_005928324.1|  PREDICTED: RNA-binding protein 47-like isofo...  67.8    2e-08    
ref|XP_006569424.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-08    
ref|XP_005741170.1|  PREDICTED: RNA-binding protein 47-like isofo...  67.8    2e-08    
ref|XP_006611797.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-08    
ref|XP_006569423.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-08    
ref|XP_006611789.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-08    
ref|XP_006569419.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-08    
ref|XP_006611793.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-08    
ref|XP_006611790.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-08    
ref|XP_006569420.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-08    
ref|XP_003689940.1|  PREDICTED: LOW QUALITY PROTEIN: heterogeneou...  67.8    2e-08    
ref|XP_006611791.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-08    
ref|XP_006569422.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-08    
ref|XP_003488661.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-08    
gb|ERL83718.1|  hypothetical protein D910_00926                       67.8    2e-08    
gb|ENN72368.1|  hypothetical protein YQE_11003                        67.4    2e-08    
ref|XP_006611794.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-08    
ref|XP_005877546.1|  PREDICTED: RNA-binding protein 47                67.4    2e-08    
ref|XP_003411358.1|  PREDICTED: RNA-binding protein 47 isoform X1     67.8    2e-08    
ref|XP_006569415.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-08    
ref|XP_006569431.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-08    
ref|XP_006611802.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-08    
ref|XP_006569430.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.8    2e-08    
gb|ELU17586.1|  hypothetical protein CAPTEDRAFT_178834                67.4    2e-08    
ref|XP_008933671.1|  PREDICTED: RNA-binding protein 47                67.0    2e-08    
ref|XP_006611801.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.4    2e-08    
ref|XP_003411359.1|  PREDICTED: RNA-binding protein 47 isoform X2     67.4    2e-08    
ref|XP_008185725.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.4    2e-08    
ref|XP_008109832.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  67.4    3e-08    
ref|XP_009070683.1|  PREDICTED: heterogeneous nuclear ribonucleop...  64.7    3e-08    
ref|XP_004914587.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.0    3e-08    
ref|XP_002308472.2|  RNA recognition motif-containing family protein  66.6    3e-08    
ref|XP_006922516.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  67.0    3e-08    
ref|XP_003736348.1|  GA27045, isoform B                               66.6    3e-08    
ref|XP_004914585.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.0    3e-08    
ref|XP_006444742.1|  hypothetical protein CICLE_v10019942mg           65.5    3e-08    
ref|XP_004914588.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    3e-08    
gb|AAI61767.1|  syncrip protein                                       67.0    3e-08    
ref|XP_004914586.1|  PREDICTED: heterogeneous nuclear ribonucleop...  67.0    4e-08    
ref|XP_002426671.1|  Heterogeneous nuclear ribonucleoprotein Q, p...  66.6    4e-08    
ref|XP_004914589.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    4e-08    
ref|XP_004628296.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    4e-08    
ref|XP_006870703.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    4e-08    
ref|XP_002933974.2|  PREDICTED: heterogeneous nuclear ribonucleop...  67.0    4e-08    
ref|XP_004389031.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    4e-08    
ref|XP_004044412.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    4e-08    
gb|ELK03622.1|  RNA-binding protein 47                                66.6    4e-08    
ref|XP_004888086.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    4e-08    
ref|XP_004773636.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    4e-08    
ref|XP_004914584.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    4e-08    
ref|XP_005861580.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    4e-08    
ref|XP_004533687.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    4e-08    
ref|XP_007066474.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  66.6    4e-08    
ref|XP_004580467.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    4e-08    
ref|XP_008828895.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    4e-08    
ref|NP_001153145.1|  heterogeneous nuclear ribonucleoprotein Q is...  66.2    4e-08    
ref|XP_008185726.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    4e-08    
ref|XP_004580468.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    4e-08    
ref|XP_004533692.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    4e-08    
ref|XP_006773536.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    4e-08    
ref|XP_004533685.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    4e-08    
ref|XP_004533682.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    4e-08    
ref|XP_004533691.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    4e-08    
gb|AAC62511.1|  RRM RNA binding protein GRY-RBP                       66.6    4e-08    
ref|XP_004533680.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    4e-08    
ref|XP_008777550.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    4e-08    
ref|XP_002264834.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    4e-08    
ref|XP_004533675.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    4e-08    
ref|XP_003736991.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    4e-08    
ref|XP_007484351.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
ref|XP_004533686.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
ref|XP_004533681.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    5e-08    
ref|XP_004533679.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    5e-08    
ref|XP_004533690.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
ref|XP_005005995.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
gb|EMP29556.1|  RNA-binding protein 47                                66.2    5e-08    
ref|XP_004888084.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
ref|XP_004773635.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
ref|XP_006626208.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
ref|XP_005861579.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
ref|XP_010832972.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
ref|XP_006143443.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
ref|XP_004533689.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
ref|XP_004389033.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
gb|ACU00255.1|  AT04629p                                              66.2    5e-08    
ref|XP_004580465.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
ref|XP_004533676.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.6    5e-08    
ref|XP_007467383.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    5e-08    
ref|XP_008828897.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
ref|XP_006773535.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
ref|XP_006243581.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    5e-08    
ref|XP_004580471.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
ref|XP_004605703.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    5e-08    
ref|XP_004817602.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
gb|KFO25982.1|  Heterogeneous nuclear ribonucleoprotein Q             66.2    5e-08    
ref|XP_004533674.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
ref|XP_004389032.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    5e-08    
ref|XP_006095405.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
ref|XP_004533678.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    5e-08    
ref|XP_005347585.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    5e-08    
dbj|BAD92335.1|  synaptotagmin binding, cytoplasmic RNA interacti...  66.2    5e-08    
gb|AFK42956.1|  unknown                                               63.5    5e-08    
ref|XP_006870704.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.5    6e-08    
gb|AAH40844.1|  SYNCRIP protein                                       65.5    6e-08    
ref|XP_003801335.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.5    6e-08    
ref|XP_007484348.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    6e-08    
ref|XP_006143441.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    6e-08    
ref|XP_009342734.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_007535491.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.5    6e-08    
ref|XP_007484349.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    6e-08    
ref|XP_004628293.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    6e-08    
gb|EFB18199.1|  hypothetical protein PANDA_019026                     66.2    6e-08    
ref|XP_005377769.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.5    6e-08    
ref|XP_004628297.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.5    6e-08    
ref|XP_004011347.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.5    6e-08    
ref|XP_004628294.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    6e-08    
ref|XP_009563088.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_006095406.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.5    6e-08    
ref|XP_004580470.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.5    6e-08    
ref|XP_004533683.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    6e-08    
ref|NP_001153149.1|  heterogeneous nuclear ribonucleoprotein Q is...  66.2    6e-08    
ref|XP_008562849.1|  PREDICTED: heterogeneous nuclear ribonucleop...  63.5    6e-08    
ref|XP_004389029.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
gb|EKC37135.1|  Heterogeneous nuclear ribonucleoprotein Q             66.2    6e-08    
ref|XP_006870701.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_005377765.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_004044411.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_009981735.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_006892203.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.5    6e-08    
ref|XP_004773633.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_003801333.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_004533688.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_003769303.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    6e-08    
ref|XP_004860363.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    6e-08    
ref|XP_010584688.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
gb|AAK59705.1|  hnRNP Q1                                              65.9    6e-08    
ref|XP_005377766.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_006892201.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_008071911.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    6e-08    
ref|XP_009933942.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_008638459.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_007484347.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    6e-08    
ref|XP_005861577.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|NP_001153148.1|  heterogeneous nuclear ribonucleoprotein Q is...  65.9    6e-08    
ref|XP_006931932.1|  PREDICTED: LOW QUALITY PROTEIN: heterogeneou...  66.2    6e-08    
ref|XP_008828893.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_005861576.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_006095404.1|  PREDICTED: heterogeneous nuclear ribonucleop...  66.2    6e-08    
ref|XP_005596876.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.5    6e-08    
ref|NP_001240700.1|  heterogeneous nuclear ribonucleoprotein Q is...  65.5    6e-08    
gb|AAD38198.1|AF155568_1  NSAP1 protein                               65.9    6e-08    
ref|XP_002775940.1|  RNA-binding protein, putative                    65.5    6e-08    
ref|XP_003404416.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_009870624.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_008493597.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_006870705.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_008163749.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_001366745.2|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_005596875.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_001915171.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_010284163.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_008493596.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_006773533.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_006243579.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    6e-08    
ref|XP_004817599.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    7e-08    
ref|XP_001915169.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    7e-08    
ref|XP_002923215.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    7e-08    
ref|XP_008828894.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    7e-08    
ref|XP_002928955.1|  PREDICTED: RNA-binding protein 47-like           65.9    7e-08    
ref|XP_009342736.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.5    7e-08    
ref|XP_008233063.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    7e-08    
ref|XP_008004712.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    7e-08    
ref|XP_010832968.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    7e-08    
ref|XP_004533684.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    7e-08    
ref|XP_005299742.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    7e-08    
ref|XP_004888081.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    7e-08    
gb|KCW78511.1|  hypothetical protein EUGRSUZ_D02648                   65.1    7e-08    
ref|XP_006870699.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    7e-08    
ref|XP_008163748.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    7e-08    
ref|XP_007949265.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    7e-08    
ref|XP_005299739.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    7e-08    
ref|XP_001927626.3|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    7e-08    
ref|XP_005377763.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    7e-08    
ref|XP_004628298.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    7e-08    
ref|XP_005299740.1|  PREDICTED: heterogeneous nuclear ribonucleop...  65.9    7e-08    



>ref|XP_006338380.1| PREDICTED: uncharacterized protein LOC102589697 isoform X1 [Solanum 
tuberosum]
 ref|XP_006338381.1| PREDICTED: uncharacterized protein LOC102589697 isoform X2 [Solanum 
tuberosum]
Length=605

 Score =   414 bits (1064),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 243/479 (51%), Positives = 313/479 (65%), Gaps = 49/479 (10%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLL-GNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+RA R+G+ S+FL+ GNLHP++QWAEEE E+D  ELA+I++AFVRN+P  ADE+YL++
Sbjct  142   AAARALRVGSQSDFLIAGNLHPSVQWAEEESEVDPNELAQIRVAFVRNVPPGADEDYLKK  201

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF+ FG VEKV L +KG+S +GFV+FD R DLDNAIK LN+KTV GP GGP  K+QVEVA
Sbjct  202   LFQPFGNVEKVALSRKGSSTIGFVYFDKRSDLDNAIKGLNEKTVQGPMGGPSSKIQVEVA  261

Query  1285  RPMDKSKKRVRDESQSKSSSNIQKHSK----EPE-------------EVKVSDPYEAAIV  1157
             RP DK++KR R++   K SSNI+ HSK    +P              E+   DPYEAA++
Sbjct  262   RPTDKNRKRGRED--QKLSSNIESHSKLLKDDPNVEMVGGPKSKAQPEMDYLDPYEAAVI  319

Query  1156  ALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGAY  977
             ALP ++ ERL+RI+RLGIATRYD+ V +LT LK LPES AIS+LDQ M S AD+ NKG +
Sbjct  320   ALPVLVKERLVRILRLGIATRYDIDVVNLTSLKMLPESAAISVLDQLMWSEADMPNKGGF  379

Query  976   LEGLIAKRYGKVGKQWSPSLSRVEDATLKEPDTVQYSKQIRLP-VDSYGPHVPSPGSRSG  800
             L  LI+K+  K+G +   S SR+EDA L+ P+   +S ++RLP +DSY   VP P +R+ 
Sbjct  380   LASLISKQVEKLGLKQFDSKSRIEDAALRVPEPDSFSTRVRLPDLDSYASRVPLPMARAD  439

Query  799   LYGDLYSPTLPHHLWQGRVTPG-LEETSPPLQIRSSTSAAYGRA------GPPFYS--IE  647
             +Y   YS  L  HL  GRVT   +EE S  LQ   +TS  YGR         PF+   ++
Sbjct  440   VYTSRYSAYLDPHL-SGRVTTERMEEASSHLQ---ATSLMYGRVTTRMEEAGPFHKKRMD  495

Query  646   ETSPPLQRPLSSAAAYGRVVATLRGAEEASARLPVPPSSSAAYGRVVATLRGGAEEANAR  467
             E  P LQ  LS          T R  EEAS   PV  ++S   GRV        +EA   
Sbjct  496   EAGPNLQSLLSGG-------GTTRRMEEAS---PVLQATSLPSGRV-----SRMDEAGPT  540

Query  466   LQVPPSSAAAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSS  290
              Q   S +A   R+GL+S     +DHQ TR ++RFDPFTGEP+KFDPFTGEPI+PESSS
Sbjct  541   FQASWSPSATADRIGLHSRITPTSDHQQTRPRIRFDPFTGEPYKFDPFTGEPIVPESSS  599



>ref|XP_004232173.1| PREDICTED: uncharacterized protein LOC101263365 isoform X2 [Solanum 
lycopersicum]
Length=610

 Score =   402 bits (1032),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 242/487 (50%), Positives = 310/487 (64%), Gaps = 60/487 (12%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLLG-NLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+RA R+G+ S+FL+G NLHP++QWAEEE E+D  ELA+IK+AFVRN+P  ADE+YL++
Sbjct  142   AAARALRVGSQSDFLIGGNLHPSVQWAEEESEVDPNELAQIKVAFVRNVPPGADEDYLKK  201

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF+ FG VEKV L +KG+S +GFV+FD R DLDNAIK LN+KTV GP GGP  K+QVEVA
Sbjct  202   LFQPFGNVEKVTLSRKGSSTIGFVYFDKRSDLDNAIKGLNEKTVQGPRGGPSSKIQVEVA  261

Query  1285  RPMDKSKKRVRDESQSKSSSNIQKHSK----EP-------------------EEVKVSDP  1175
             RP DK++KR R++   K SSNI+ HSK    +P                   +E+   DP
Sbjct  262   RPTDKNRKRGRED--QKMSSNIESHSKLLKDDPNVEMVGGPKSKAQPVMHLSDEMDYLDP  319

Query  1174  YEAAIVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADV  995
             YEAA++ALP ++ ERL+RI+RLGIATRYD+ V +LT LK LPES AIS+LDQ M S AD+
Sbjct  320   YEAAVIALPVLVKERLVRILRLGIATRYDIDVVNLTSLKMLPESAAISVLDQLMWSEADM  379

Query  994   QNKGAYLEGLIAKRYGKVGKQWSPSLSRVEDATLKEPDTVQYSKQIRLP-VDSYGPHVPS  818
             QNKG +L  LI+K+  K+G +   S SRVED  L+ P+   +S ++RLP +DSY   VP 
Sbjct  380   QNKGGFLASLISKQVEKLGLKQFDSKSRVEDVALRVPEPDSFSTRVRLPHLDSYASRVPL  439

Query  817   PGSRSGLYGDLYSPTL-PHHLWQGRVTPG-LEETSPPLQIRSSTSAAYGRAGPPFYS---  653
             P +R+ +Y   YS  L P+    GRVT   +EE S  LQ    TS  YG+          
Sbjct  440   PMARADVYTSRYSAYLDPYQ--SGRVTTERMEEASSHLQ---GTSLTYGQVTTRMEEAGS  494

Query  652   -----IEETSPPLQRPLSSAAAYGRVVATLRGAEEASARLPVP-PSSSAAYGRVVATLRG  491
                  +EE +P LQ  LS          T R  EE     P P  ++S   GRV      
Sbjct  495   IHKKRMEEANPTLQSFLSGG-------VTKRRMEE-----PSPLQATSLPSGRV-----S  537

Query  490   GAEEANARLQVPPSSAAAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEP  311
               +EA    Q   S +AA  RVGL+S     +DHQ TR ++RFDPFTGEP+KFDPFTGEP
Sbjct  538   RMDEAGPTFQASWSPSAAADRVGLHSRITPTSDHQQTRPRIRFDPFTGEPYKFDPFTGEP  597

Query  310   ILPESSS  290
             I+PESSS
Sbjct  598   IVPESSS  604



>ref|XP_010316225.1| PREDICTED: uncharacterized protein LOC101263365 isoform X1 [Solanum 
lycopersicum]
Length=611

 Score =   397 bits (1020),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 242/488 (50%), Positives = 310/488 (64%), Gaps = 61/488 (13%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLLG-NLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+RA R+G+ S+FL+G NLHP++QWAEEE E+D  ELA+IK+AFVRN+P  ADE+YL++
Sbjct  142   AAARALRVGSQSDFLIGGNLHPSVQWAEEESEVDPNELAQIKVAFVRNVPPGADEDYLKK  201

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF+ FG VEKV L +KG+S +GFV+FD R DLDNAIK LN+KTV GP GGP  K+QVEVA
Sbjct  202   LFQPFGNVEKVTLSRKGSSTIGFVYFDKRSDLDNAIKGLNEKTVQGPRGGPSSKIQVEVA  261

Query  1285  RPMDKSKKRVRDESQSKSSSNIQKHSK------------------EP-----EEVKVSDP  1175
             RP DK++KR R++   K SSNI+ HSK                  +P     +E+   DP
Sbjct  262   RPTDKNRKRGRED--QKMSSNIESHSKLLKDDPNVEMVGGPKSKAQPVMHLSDEMDYLDP  319

Query  1174  YEAAIVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADV  995
             YEAA++ALP ++ ERL+RI+RLGIATRYD+ V +LT LK LPES AIS+LDQ M S AD+
Sbjct  320   YEAAVIALPVLVKERLVRILRLGIATRYDIDVVNLTSLKMLPESAAISVLDQLMWSEADM  379

Query  994   QNKGAYLEGLIAK-RYGKVGKQWSPSLSRVEDATLKEPDTVQYSKQIRLP-VDSYGPHVP  821
             QNKG +L  LI+K +  K+G +   S SRVED  L+ P+   +S ++RLP +DSY   VP
Sbjct  380   QNKGGFLASLISKQQVEKLGLKQFDSKSRVEDVALRVPEPDSFSTRVRLPHLDSYASRVP  439

Query  820   SPGSRSGLYGDLYSPTL-PHHLWQGRVTPG-LEETSPPLQIRSSTSAAYGRAGPPFYS--  653
              P +R+ +Y   YS  L P+    GRVT   +EE S  LQ    TS  YG+         
Sbjct  440   LPMARADVYTSRYSAYLDPYQ--SGRVTTERMEEASSHLQ---GTSLTYGQVTTRMEEAG  494

Query  652   ------IEETSPPLQRPLSSAAAYGRVVATLRGAEEASARLPVP-PSSSAAYGRVVATLR  494
                   +EE +P LQ  LS          T R  EE     P P  ++S   GRV     
Sbjct  495   SIHKKRMEEANPTLQSFLSGG-------VTKRRMEE-----PSPLQATSLPSGRV-----  537

Query  493   GGAEEANARLQVPPSSAAAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGE  314
                +EA    Q   S +AA  RVGL+S     +DHQ TR ++RFDPFTGEP+KFDPFTGE
Sbjct  538   SRMDEAGPTFQASWSPSAAADRVGLHSRITPTSDHQQTRPRIRFDPFTGEPYKFDPFTGE  597

Query  313   PILPESSS  290
             PI+PESSS
Sbjct  598   PIVPESSS  605



>ref|XP_009757448.1| PREDICTED: uncharacterized protein LOC104210286 isoform X2 [Nicotiana 
sylvestris]
Length=606

 Score =   385 bits (989),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 238/471 (51%), Positives = 307/471 (65%), Gaps = 47/471 (10%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLL-GNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+RA+R+G+ S+FL+ G LHP++QWAEE    D  ELA+IK AFVRN+P  ADE+YL++
Sbjct  157   AAARAFRVGSQSDFLIDGKLHPSVQWAEEP---DPNELAQIKAAFVRNVPPGADEDYLKK  213

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF+ FG VE++ L +KG+S +GFV+FD R DLDNAI  LN+KTV GP GGP  KLQVEVA
Sbjct  214   LFQPFGNVERIALSRKGSSTIGFVYFDKRSDLDNAIMALNEKTVQGPMGGPSCKLQVEVA  273

Query  1285  RPMDKSKKRVRDESQSKSSSNIQKHSK----EPE-------------EVKVSDPYEAAIV  1157
             RPMDK++KR R++     SS I+ HSK    +P+             E+  SDPYEAA+V
Sbjct  274   RPMDKNRKRGREDPNM--SSTIESHSKLLKDDPDVEMIRAPKSTAQLEMDYSDPYEAAVV  331

Query  1156  ALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGAY  977
             ALP V+ ERL+RI+RLGIATRYD+ V+SLT LK LP+S AISILDQFMLSGAD+QNKG Y
Sbjct  332   ALPVVVKERLVRILRLGIATRYDIDVESLTSLKILPQSAAISILDQFMLSGADMQNKGGY  391

Query  976   LEGLIAKRYGKVGKQWSPSLSRVEDATLKEPDTVQYSKQIRLP-VDSYGPHVPSPGSRSG  800
             L  LI+K+  K+G +   S SR+ED  L+ P+  ++S ++RLP +DSY   VP P  R+ 
Sbjct  392   LASLISKQVEKLGPKQFDSRSRIEDVGLRVPEPDRFSTRVRLPDLDSYASRVPLPMPRTD  451

Query  799   LYGDLYSPTLPHHLWQGRVTPG-LEETSPPLQIRSSTSAAYGRAGPPFYSIEETSPPLQR  623
             +Y   YS  L  HL  GR+T   +EE S  LQ  S  S+           +EE    LQ 
Sbjct  452   VYTSHYSAYLDPHL-SGRMTAKRMEEASSHLQATSLLSSRVA------TRMEEAGSTLQS  504

Query  622   PLSSAAAYGRVVATLRGAEEASARLPVPPSSSAAYGRVVATLRGGAEEANARLQVPPSSA  443
              LS          T R  EEAS   P+  ++    GRV        +EA+  LQ   S +
Sbjct  505   LLSGG-------VTTRRMEEAS---PILQATLLPSGRV-----SRMDEASPNLQATWSPS  549

Query  442   AAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSS  290
                 R+GL+S+    ADHQ TR ++RFDPFTGEP+KFDPFTGEPI+P+SSS
Sbjct  550   PTNDRIGLHSHITATADHQHTRPRIRFDPFTGEPYKFDPFTGEPIVPKSSS  600



>ref|XP_009598477.1| PREDICTED: uncharacterized protein LOC104094279 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009598478.1| PREDICTED: uncharacterized protein LOC104094279 isoform X1 [Nicotiana 
tomentosiformis]
Length=607

 Score =   384 bits (985),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 240/471 (51%), Positives = 305/471 (65%), Gaps = 46/471 (10%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLL-GNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+RA+R+G+ S+FL+ G LHP++QWAEE    D  ELA+IK AFVRNLP  ADE+YL++
Sbjct  157   AAARAFRVGSQSDFLIDGKLHPSVQWAEEP---DPNELAQIKAAFVRNLPPGADEDYLKK  213

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF+ FG VE++ L +KG+S +GFV+FD R  LDNAIKELN+KTV GP GGP  KLQVEVA
Sbjct  214   LFQPFGNVERIALSRKGSSTIGFVYFDKRSGLDNAIKELNEKTVQGPMGGPSCKLQVEVA  273

Query  1285  RPMDKSKKRVRDESQSKSSSNIQKHSK----EPE-------------EVKVSDPYEAAIV  1157
             RPMDK++KR R++     SS I+ HSK    +P              E+  SDPYEAA+V
Sbjct  274   RPMDKNRKRGREDPN--ISSTIESHSKLLKDDPNVEMIRAPKSTAQLEMDYSDPYEAAVV  331

Query  1156  ALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGAY  977
             ALP V+ ERL+RI+RLGIATRYD+ V+SLT LK LPESTAISILDQFMLSGAD+QNKG Y
Sbjct  332   ALPVVVKERLVRILRLGIATRYDIDVESLTSLKMLPESTAISILDQFMLSGADMQNKGGY  391

Query  976   LEGLIAK-RYGKVGKQWSPSLSRVEDATLKEPDTVQYSKQIRLP-VDSYGPHVPSPGSRS  803
             L  LI+K +  K+G +   S SR+ED  L+ P+  ++S ++RLP +DSY   VP P  R+
Sbjct  392   LASLISKQQVEKLGLKQFDSRSRIEDVGLRVPEPDRFSTRVRLPDLDSYASRVPLPMPRA  451

Query  802   GLYGDLYSPTLPHHLWQGRVTPGLEETSPPLQIRSSTSAAYGRAGPPFYSIEETSPPLQR  623
              +Y   YS  L  HL     T  +EE S  LQ   +TS    R       +EE    LQ 
Sbjct  452   DVYTSRYSSYLDPHLSGRMTTKRMEEASSHLQ---ATSLLSNRVTT---RMEEAGSTLQS  505

Query  622   PLSSAAAYGRVVATLRGAEEASARLPVPPSSSAAYGRVVATLRGGAEEANARLQVPPSSA  443
              LS      R+       EEAS   P+  ++    GRV        +EA+  LQ   S +
Sbjct  506   LLSGGVMTRRM-------EEAS---PILQATLLPSGRV-----SRMDEASPNLQATWSPS  550

Query  442   AAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSS  290
                 R+GL+S+    ADHQ TR ++RFDPFTGEP+KFDPFTGEPI+ ESSS
Sbjct  551   PTNDRIGLHSHITATADHQHTRPRIRFDPFTGEPYKFDPFTGEPIVRESSS  601



>ref|XP_009598479.1| PREDICTED: uncharacterized protein LOC104094279 isoform X2 [Nicotiana 
tomentosiformis]
Length=592

 Score =   383 bits (983),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 240/471 (51%), Positives = 305/471 (65%), Gaps = 46/471 (10%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLL-GNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+RA+R+G+ S+FL+ G LHP++QWAEE    D  ELA+IK AFVRNLP  ADE+YL++
Sbjct  142   AAARAFRVGSQSDFLIDGKLHPSVQWAEEP---DPNELAQIKAAFVRNLPPGADEDYLKK  198

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF+ FG VE++ L +KG+S +GFV+FD R  LDNAIKELN+KTV GP GGP  KLQVEVA
Sbjct  199   LFQPFGNVERIALSRKGSSTIGFVYFDKRSGLDNAIKELNEKTVQGPMGGPSCKLQVEVA  258

Query  1285  RPMDKSKKRVRDESQSKSSSNIQKHSK----EPE-------------EVKVSDPYEAAIV  1157
             RPMDK++KR R++     SS I+ HSK    +P              E+  SDPYEAA+V
Sbjct  259   RPMDKNRKRGREDPN--ISSTIESHSKLLKDDPNVEMIRAPKSTAQLEMDYSDPYEAAVV  316

Query  1156  ALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGAY  977
             ALP V+ ERL+RI+RLGIATRYD+ V+SLT LK LPESTAISILDQFMLSGAD+QNKG Y
Sbjct  317   ALPVVVKERLVRILRLGIATRYDIDVESLTSLKMLPESTAISILDQFMLSGADMQNKGGY  376

Query  976   LEGLIAK-RYGKVGKQWSPSLSRVEDATLKEPDTVQYSKQIRLP-VDSYGPHVPSPGSRS  803
             L  LI+K +  K+G +   S SR+ED  L+ P+  ++S ++RLP +DSY   VP P  R+
Sbjct  377   LASLISKQQVEKLGLKQFDSRSRIEDVGLRVPEPDRFSTRVRLPDLDSYASRVPLPMPRA  436

Query  802   GLYGDLYSPTLPHHLWQGRVTPGLEETSPPLQIRSSTSAAYGRAGPPFYSIEETSPPLQR  623
              +Y   YS  L  HL     T  +EE S  LQ   +TS    R       +EE    LQ 
Sbjct  437   DVYTSRYSSYLDPHLSGRMTTKRMEEASSHLQ---ATSLLSNRVTT---RMEEAGSTLQS  490

Query  622   PLSSAAAYGRVVATLRGAEEASARLPVPPSSSAAYGRVVATLRGGAEEANARLQVPPSSA  443
              LS      R+       EEAS   P+  ++    GRV        +EA+  LQ   S +
Sbjct  491   LLSGGVMTRRM-------EEAS---PILQATLLPSGRV-----SRMDEASPNLQATWSPS  535

Query  442   AAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSS  290
                 R+GL+S+    ADHQ TR ++RFDPFTGEP+KFDPFTGEPI+ ESSS
Sbjct  536   PTNDRIGLHSHITATADHQHTRPRIRFDPFTGEPYKFDPFTGEPIVRESSS  586



>ref|XP_009757449.1| PREDICTED: uncharacterized protein LOC104210286 isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009757450.1| PREDICTED: uncharacterized protein LOC104210286 isoform X3 [Nicotiana 
sylvestris]
Length=592

 Score =   380 bits (976),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 238/472 (50%), Positives = 307/472 (65%), Gaps = 48/472 (10%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLL-GNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+RA+R+G+ S+FL+ G LHP++QWAEE    D  ELA+IK AFVRN+P  ADE+YL++
Sbjct  142   AAARAFRVGSQSDFLIDGKLHPSVQWAEEP---DPNELAQIKAAFVRNVPPGADEDYLKK  198

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF+ FG VE++ L +KG+S +GFV+FD R DLDNAI  LN+KTV GP GGP  KLQVEVA
Sbjct  199   LFQPFGNVERIALSRKGSSTIGFVYFDKRSDLDNAIMALNEKTVQGPMGGPSCKLQVEVA  258

Query  1285  RPMDKSKKRVRDESQSKSSSNIQKHSK----EPE-------------EVKVSDPYEAAIV  1157
             RPMDK++KR R++     SS I+ HSK    +P+             E+  SDPYEAA+V
Sbjct  259   RPMDKNRKRGREDPN--MSSTIESHSKLLKDDPDVEMIRAPKSTAQLEMDYSDPYEAAVV  316

Query  1156  ALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGAY  977
             ALP V+ ERL+RI+RLGIATRYD+ V+SLT LK LP+S AISILDQFMLSGAD+QNKG Y
Sbjct  317   ALPVVVKERLVRILRLGIATRYDIDVESLTSLKILPQSAAISILDQFMLSGADMQNKGGY  376

Query  976   LEGLIAK-RYGKVGKQWSPSLSRVEDATLKEPDTVQYSKQIRLP-VDSYGPHVPSPGSRS  803
             L  LI+K +  K+G +   S SR+ED  L+ P+  ++S ++RLP +DSY   VP P  R+
Sbjct  377   LASLISKQQVEKLGPKQFDSRSRIEDVGLRVPEPDRFSTRVRLPDLDSYASRVPLPMPRT  436

Query  802   GLYGDLYSPTLPHHLWQGRVTPG-LEETSPPLQIRSSTSAAYGRAGPPFYSIEETSPPLQ  626
              +Y   YS  L  HL  GR+T   +EE S  LQ  S  S+           +EE    LQ
Sbjct  437   DVYTSHYSAYLDPHL-SGRMTAKRMEEASSHLQATSLLSSRVA------TRMEEAGSTLQ  489

Query  625   RPLSSAAAYGRVVATLRGAEEASARLPVPPSSSAAYGRVVATLRGGAEEANARLQVPPSS  446
               LS          T R  EEAS   P+  ++    GRV        +EA+  LQ   S 
Sbjct  490   SLLSGG-------VTTRRMEEAS---PILQATLLPSGRV-----SRMDEASPNLQATWSP  534

Query  445   AAAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSS  290
             +    R+GL+S+    ADHQ TR ++RFDPFTGEP+KFDPFTGEPI+P+SSS
Sbjct  535   SPTNDRIGLHSHITATADHQHTRPRIRFDPFTGEPYKFDPFTGEPIVPKSSS  586



>ref|XP_009757445.1| PREDICTED: uncharacterized protein LOC104210286 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009757446.1| PREDICTED: uncharacterized protein LOC104210286 isoform X1 [Nicotiana 
sylvestris]
Length=607

 Score =   380 bits (976),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 238/472 (50%), Positives = 307/472 (65%), Gaps = 48/472 (10%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLL-GNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+RA+R+G+ S+FL+ G LHP++QWAEE    D  ELA+IK AFVRN+P  ADE+YL++
Sbjct  157   AAARAFRVGSQSDFLIDGKLHPSVQWAEEP---DPNELAQIKAAFVRNVPPGADEDYLKK  213

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF+ FG VE++ L +KG+S +GFV+FD R DLDNAI  LN+KTV GP GGP  KLQVEVA
Sbjct  214   LFQPFGNVERIALSRKGSSTIGFVYFDKRSDLDNAIMALNEKTVQGPMGGPSCKLQVEVA  273

Query  1285  RPMDKSKKRVRDESQSKSSSNIQKHSK----EPE-------------EVKVSDPYEAAIV  1157
             RPMDK++KR R++     SS I+ HSK    +P+             E+  SDPYEAA+V
Sbjct  274   RPMDKNRKRGREDPN--MSSTIESHSKLLKDDPDVEMIRAPKSTAQLEMDYSDPYEAAVV  331

Query  1156  ALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGAY  977
             ALP V+ ERL+RI+RLGIATRYD+ V+SLT LK LP+S AISILDQFMLSGAD+QNKG Y
Sbjct  332   ALPVVVKERLVRILRLGIATRYDIDVESLTSLKILPQSAAISILDQFMLSGADMQNKGGY  391

Query  976   LEGLIAK-RYGKVGKQWSPSLSRVEDATLKEPDTVQYSKQIRLP-VDSYGPHVPSPGSRS  803
             L  LI+K +  K+G +   S SR+ED  L+ P+  ++S ++RLP +DSY   VP P  R+
Sbjct  392   LASLISKQQVEKLGPKQFDSRSRIEDVGLRVPEPDRFSTRVRLPDLDSYASRVPLPMPRT  451

Query  802   GLYGDLYSPTLPHHLWQGRVTPG-LEETSPPLQIRSSTSAAYGRAGPPFYSIEETSPPLQ  626
              +Y   YS  L  HL  GR+T   +EE S  LQ  S  S+           +EE    LQ
Sbjct  452   DVYTSHYSAYLDPHL-SGRMTAKRMEEASSHLQATSLLSSRVA------TRMEEAGSTLQ  504

Query  625   RPLSSAAAYGRVVATLRGAEEASARLPVPPSSSAAYGRVVATLRGGAEEANARLQVPPSS  446
               LS          T R  EEAS   P+  ++    GRV        +EA+  LQ   S 
Sbjct  505   SLLSGG-------VTTRRMEEAS---PILQATLLPSGRV-----SRMDEASPNLQATWSP  549

Query  445   AAAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSS  290
             +    R+GL+S+    ADHQ TR ++RFDPFTGEP+KFDPFTGEPI+P+SSS
Sbjct  550   SPTNDRIGLHSHITATADHQHTRPRIRFDPFTGEPYKFDPFTGEPIVPKSSS  601



>ref|XP_011098736.1| PREDICTED: uncharacterized protein LOC105177319 [Sesamum indicum]
 ref|XP_011098737.1| PREDICTED: uncharacterized protein LOC105177319 [Sesamum indicum]
Length=749

 Score =   304 bits (778),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 170/281 (60%), Positives = 211/281 (75%), Gaps = 22/281 (8%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLREL  1463
             AASRA R+G+  +F LGNLHPA+QWAEEE EID KELAKIKIAFVRNLP +A+ENYL+EL
Sbjct  157   AASRAQRVGSQPDFRLGNLHPAVQWAEEEPEIDPKELAKIKIAFVRNLPVDAEENYLKEL  216

Query  1462  FERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVAR  1283
             FE FGKVEKVV+ KKG+  VGFVHF  RLDL+ AIKELN+KTV GPNG P YKLQVEVAR
Sbjct  217   FESFGKVEKVVVSKKGSFPVGFVHFAERLDLERAIKELNEKTVQGPNGAPLYKLQVEVAR  276

Query  1282  PMDKSKKRVRDESQSKSSSNIQKHSK----EP-------------EEVKVSDPYEAAIVA  1154
             PMD+S+KR+R++S+   +S++Q H K    EP             +E++ +DPYE A+++
Sbjct  277   PMDRSRKRIREDSE---NSSVQAHFKLRKEEPSLTLSIRDSSHVQKELESADPYEDAVIS  333

Query  1153  LPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGAYL  974
             LP  + ERLL I+RLGIATR+D+ ++SL  LKELPES AIS+LDQFML GA +QNKG YL
Sbjct  334   LPVAVKERLLGILRLGIATRFDIDIRSLRSLKELPESIAISVLDQFMLCGAGLQNKGEYL  393

Query  973   EGLIAKRY-GKVGKQWS-PSLSRVEDATLKEPDTVQYSKQI  857
              GLI+K    KVG+  S  SLS+V D T  EP +  +  Q+
Sbjct  394   AGLISKHLVDKVGQTPSLVSLSKVADTTRSEPSSFIFWHQM  434


 Score = 82.4 bits (202),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 72/118 (61%), Gaps = 7/118 (6%)
 Frame = -2

Query  616  SSAAAYGRV--VATLRGAEEASARLPVPPSSSAAYGRV--VATLRGGAEEANARLQVPPS  449
            SS+A+Y R+  +  LR  E   + +   PSSSA+Y R+  +  LR   E   + +Q  PS
Sbjct  633  SSSASYARLGSIGGLRAEERLLSHVQEGPSSSASYVRLGSIGGLRA-EERLLSHVQEGPS  691

Query  448  SAAAYGR--VGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSSR*F  281
            S+ +Y    +GL+   + V   Q  R Q+RFDPFTGEP+KFDPFTGEPI P +++R F
Sbjct  692  SSTSYAGAGIGLSPNISVVGGRQAPRPQIRFDPFTGEPYKFDPFTGEPIRPANATRQF  749



>ref|XP_009397757.1| PREDICTED: uncharacterized protein LOC103982534 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=520

 Score =   281 bits (719),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 189/476 (40%), Positives = 258/476 (54%), Gaps = 96/476 (20%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLL-GNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+RAYR+G+ ++FLL G  HP I WAE+E EID +EL+KIK AF+ NLP++ADE YL++
Sbjct  111   AAARAYRIGSKADFLLAGKWHPVIDWAEKEPEIDPEELSKIKAAFIGNLPNDADEEYLKK  170

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF+  GKVE+V L +KG+  VGFVHF  R DLDNAIKE++ K V GP  GP +K+QV VA
Sbjct  171   LFDPLGKVERVALSRKGHFPVGFVHFAKRADLDNAIKEMDGKIVQGPRRGPKFKIQVAVA  230

Query  1285  RPMDKSKK-----------RVRDESQSKS----SSNIQKHSKEP---EEV-KVSDPYEAA  1163
             RP++  K+           R RD+S S      S ++   SK P   ++V    DPYEAA
Sbjct  231   RPVEMGKRPRDEPKNKPLPRSRDQSDSSYDGHISDSLDHKSKAPRLADQVPDTIDPYEAA  290

Query  1162  IVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKG  983
             ++ LPAV+ E LL+++R+GIATRYD+ ++ +T L+EL ES AI++LDQFMLSGAD Q+KG
Sbjct  291   VITLPAVVKEHLLQVLRVGIATRYDLNLRCITSLRELSESAAIAVLDQFMLSGADRQDKG  350

Query  982   AYLEGLIAK----RYGKVGKQWSPSLSRVEDATLKEPDTVQYSKQIRLPVDSYGPHVPSP  815
             AY   L++K    ++G+ G     S S V   T K      +S   RL   S G  +P  
Sbjct  351   AYFASLVSKHQAEKFGQRG-----STSYVPQKTRK-----MFSLGARLC--SEGIDLPKE  398

Query  814   GSRSGLYGDLYSPTLPHHLWQGRVTPGLEETSPPLQIRSSTSAAYGRAGPPFYSIEETSP  635
                  L   L S  + H                        SA+  R  P  +    +S 
Sbjct  399   SELLSLGAQLCSEEIDH------------------------SASRNRLSPALFPSSSSSS  434

Query  634   PLQRPLSSAAAYGRVVATLRGAEEASARLPVPPSSSAAYGRVVATLRGGAEEANARLQVP  455
                RPL S +       ++R  E+ +    VP +SS  YG  + +               
Sbjct  435   LYDRPLPSRS-------SVRKLEDITPSYRVP-ASSMRYGPGIGS---------------  471

Query  454   PSSAAAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSSR  287
                          S   +  +H   R Q++FDPFTGEP+K+DPFTGEPI PE   R
Sbjct  472   -------------SSHLSPKEHPVERRQMKFDPFTGEPYKYDPFTGEPIKPEPHGR  514



>ref|XP_009397758.1| PREDICTED: polyadenylate-binding protein, cytoplasmic and nuclear-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=519

 Score =   280 bits (716),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 187/474 (39%), Positives = 259/474 (55%), Gaps = 93/474 (20%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLL-GNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+RAYR+G+ ++FLL G  HP I WAE+E EID +EL+KIK AF+ NLP++ADE YL++
Sbjct  111   AAARAYRIGSKADFLLAGKWHPVIDWAEKEPEIDPEELSKIKAAFIGNLPNDADEEYLKK  170

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF+  GKVE+V L +KG+  VGFVHF  R DLDNAIKE++ K V GP  GP +K+QV VA
Sbjct  171   LFDPLGKVERVALSRKGHFPVGFVHFAKRADLDNAIKEMDGKIVQGPRRGPKFKIQVAVA  230

Query  1285  RPMDKSKK-----------RVRDESQSKS----SSNIQKHSKEP---EEV-KVSDPYEAA  1163
             RP++  K+           R RD+S S      S ++   SK P   ++V    DPYEAA
Sbjct  231   RPVEMGKRPRDEPKNKPLPRSRDQSDSSYDGHISDSLDHKSKAPRLADQVPDTIDPYEAA  290

Query  1162  IVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKG  983
             ++ LPAV+ E LL+++R+GIATRYD+ ++ +T L+EL ES AI++LDQFMLSGAD Q+KG
Sbjct  291   VITLPAVVKEHLLQVLRVGIATRYDLNLRCITSLRELSESAAIAVLDQFMLSGADRQDKG  350

Query  982   AYLEGLIAK--RYGKVGKQWSPSLSRVEDATLKEPDTVQYSKQIRLPVDSYGPHVPSPGS  809
             AY   L++K  ++G+ G     S S V   T K      +S   RL   S G  +P    
Sbjct  351   AYFASLVSKAEKFGQRG-----STSYVPQKTRK-----MFSLGARLC--SEGIDLPKESE  398

Query  808   RSGLYGDLYSPTLPHHLWQGRVTPGLEETSPPLQIRSSTSAAYGRAGPPFYSIEETSPPL  629
                L   L S  + H                       ++++  R  P  +    +S   
Sbjct  399   LLSLGAQLCSEEIDH-----------------------SASSRNRLSPALFPSSSSSSLY  435

Query  628   QRPLSSAAAYGRVVATLRGAEEASARLPVPPSSSAAYGRVVATLRGGAEEANARLQVPPS  449
              RPL S        +++R  E+ +    V P+SS  YG  + +                 
Sbjct  436   DRPLPSR-------SSVRKLEDITPSYRV-PASSMRYGPGIGS-----------------  470

Query  448   SAAAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSSR  287
                        S   +  +H   R Q++FDPFTGEP+K+DPFTGEPI PE   R
Sbjct  471   -----------SSHLSPKEHPVERRQMKFDPFTGEPYKYDPFTGEPIKPEPHGR  513



>ref|XP_009397756.1| PREDICTED: uncharacterized protein LOC103982534 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=521

 Score =   280 bits (716),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 187/476 (39%), Positives = 259/476 (54%), Gaps = 95/476 (20%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLL-GNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+RAYR+G+ ++FLL G  HP I WAE+E EID +EL+KIK AF+ NLP++ADE YL++
Sbjct  111   AAARAYRIGSKADFLLAGKWHPVIDWAEKEPEIDPEELSKIKAAFIGNLPNDADEEYLKK  170

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF+  GKVE+V L +KG+  VGFVHF  R DLDNAIKE++ K V GP  GP +K+QV VA
Sbjct  171   LFDPLGKVERVALSRKGHFPVGFVHFAKRADLDNAIKEMDGKIVQGPRRGPKFKIQVAVA  230

Query  1285  RPMDKSKK-----------RVRDESQSKS----SSNIQKHSKEP---EEV-KVSDPYEAA  1163
             RP++  K+           R RD+S S      S ++   SK P   ++V    DPYEAA
Sbjct  231   RPVEMGKRPRDEPKNKPLPRSRDQSDSSYDGHISDSLDHKSKAPRLADQVPDTIDPYEAA  290

Query  1162  IVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKG  983
             ++ LPAV+ E LL+++R+GIATRYD+ ++ +T L+EL ES AI++LDQFMLSGAD Q+KG
Sbjct  291   VITLPAVVKEHLLQVLRVGIATRYDLNLRCITSLRELSESAAIAVLDQFMLSGADRQDKG  350

Query  982   AYLEGLIAK----RYGKVGKQWSPSLSRVEDATLKEPDTVQYSKQIRLPVDSYGPHVPSP  815
             AY   L++K    ++G+ G     S S V   T K      +S   RL   S G  +P  
Sbjct  351   AYFASLVSKHQAEKFGQRG-----STSYVPQKTRK-----MFSLGARLC--SEGIDLPKE  398

Query  814   GSRSGLYGDLYSPTLPHHLWQGRVTPGLEETSPPLQIRSSTSAAYGRAGPPFYSIEETSP  635
                  L   L S  + H                       ++++  R  P  +    +S 
Sbjct  399   SELLSLGAQLCSEEIDH-----------------------SASSRNRLSPALFPSSSSSS  435

Query  634   PLQRPLSSAAAYGRVVATLRGAEEASARLPVPPSSSAAYGRVVATLRGGAEEANARLQVP  455
                RPL S        +++R  E+ +    V P+SS  YG  + +               
Sbjct  436   LYDRPLPSR-------SSVRKLEDITPSYRV-PASSMRYGPGIGS---------------  472

Query  454   PSSAAAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSSR  287
                          S   +  +H   R Q++FDPFTGEP+K+DPFTGEPI PE   R
Sbjct  473   -------------SSHLSPKEHPVERRQMKFDPFTGEPYKYDPFTGEPIKPEPHGR  515



>emb|CBI21228.3| unnamed protein product [Vitis vinifera]
Length=533

 Score =   280 bits (716),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 186/389 (48%), Positives = 230/389 (59%), Gaps = 72/389 (19%)
 Frame = -2

Query  1621  LGTSSEFLLGN-LHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRELFERFGK  1445
             +G+ S+FLLG+  HP ++WAEE  EID +ELAKI IAFV NLP +A+E+YL++LF  FGK
Sbjct  118   MGSKSDFLLGDSWHPVVEWAEEP-EIDPEELAKITIAFVGNLPKDANEDYLKKLFGPFGK  176

Query  1444  VEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVARPMDKSK  1265
             VEKV+L KKG S VGFVHF  R DLDNAIKE+N+KTV GP+ GP +KLQV VA+P+D+ +
Sbjct  177   VEKVLLSKKGQSPVGFVHFAKRSDLDNAIKEMNEKTVQGPSRGPAFKLQVAVAKPLDRKR  236

Query  1264  KRVRDESQSKSSSNI---------QKHS-------KEP-------EEVKVSDPYEAAIVA  1154
             KR RDESQSKS+S +         Q HS       K P       E V  SDPYEAA+V+
Sbjct  237   KRARDESQSKSASKMSNPVLLRSDQSHSSPAGGQPKAPKQKYLIEEPVPDSDPYEAAVVS  296

Query  1153  LPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGAYL  974
             LPA + ERLLRI+RLGIATR+D+ +Q +T L +LPE  AIS+LDQFMLSGAD  +KGAYL
Sbjct  297   LPAAVKERLLRILRLGIATRFDIDIQCITSLHKLPELAAISVLDQFMLSGADKLDKGAYL  356

Query  973   EGLIAK----RYG----------KVGKQWSP-SLSRVEDATLKEPDTVQYSKQIRLPVDS  839
              GL++K    R G          K+G    P  L RVED    E      S ++      
Sbjct  357   AGLMSKHQVDRLGVNRIPQHQVDKLGVNRIPLHLPRVEDTAPGESVLPSLSGRV------  410

Query  838   YGPHVPSPGSRSGLYGDLYSPTLPHHLWQGRVTPGLEETSPPLQIRSSTSAAYGRAGPP-  662
             Y P   S  SR G     Y                  ETSP L    S  + Y     P 
Sbjct  411   YRPAFDSLASRLGTTAARYDGY---------------ETSPAL----SRYSTYSYTDYPL  451

Query  661   -----FYSIEETSP-PLQRPLSSAAAYGR  593
                  F  +EETSP PL R   S+++YGR
Sbjct  452   SRQLGFDKLEETSPTPLYRAAVSSSSYGR  480


 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  448  SAAAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPE  299
            S+++YGR  L+      +   P R Q+RFDPFTGEP+KFDPFTGEPI P+
Sbjct  474  SSSSYGRAELDPRLIATSVAPPARPQMRFDPFTGEPYKFDPFTGEPIEPD  523



>ref|XP_010660634.1| PREDICTED: probable RNA-binding protein 46 isoform X4 [Vitis 
vinifera]
Length=578

 Score =   280 bits (717),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 186/389 (48%), Positives = 230/389 (59%), Gaps = 72/389 (19%)
 Frame = -2

Query  1621  LGTSSEFLLGN-LHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRELFERFGK  1445
             +G+ S+FLLG+  HP ++WAEE  EID +ELAKI IAFV NLP +A+E+YL++LF  FGK
Sbjct  163   MGSKSDFLLGDSWHPVVEWAEEP-EIDPEELAKITIAFVGNLPKDANEDYLKKLFGPFGK  221

Query  1444  VEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVARPMDKSK  1265
             VEKV+L KKG S VGFVHF  R DLDNAIKE+N+KTV GP+ GP +KLQV VA+P+D+ +
Sbjct  222   VEKVLLSKKGQSPVGFVHFAKRSDLDNAIKEMNEKTVQGPSRGPAFKLQVAVAKPLDRKR  281

Query  1264  KRVRDESQSKSSSNI---------QKHS-------KEP-------EEVKVSDPYEAAIVA  1154
             KR RDESQSKS+S +         Q HS       K P       E V  SDPYEAA+V+
Sbjct  282   KRARDESQSKSASKMSNPVLLRSDQSHSSPAGGQPKAPKQKYLIEEPVPDSDPYEAAVVS  341

Query  1153  LPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGAYL  974
             LPA + ERLLRI+RLGIATR+D+ +Q +T L +LPE  AIS+LDQFMLSGAD  +KGAYL
Sbjct  342   LPAAVKERLLRILRLGIATRFDIDIQCITSLHKLPELAAISVLDQFMLSGADKLDKGAYL  401

Query  973   EGLIAK----RYG----------KVGKQWSP-SLSRVEDATLKEPDTVQYSKQIRLPVDS  839
              GL++K    R G          K+G    P  L RVED    E      S ++      
Sbjct  402   AGLMSKHQVDRLGVNRIPQHQVDKLGVNRIPLHLPRVEDTAPGESVLPSLSGRV------  455

Query  838   YGPHVPSPGSRSGLYGDLYSPTLPHHLWQGRVTPGLEETSPPLQIRSSTSAAYGRAGPP-  662
             Y P   S  SR G     Y                  ETSP L    S  + Y     P 
Sbjct  456   YRPAFDSLASRLGTTAARYDGY---------------ETSPAL----SRYSTYSYTDYPL  496

Query  661   -----FYSIEETSP-PLQRPLSSAAAYGR  593
                  F  +EETSP PL R   S+++YGR
Sbjct  497   SRQLGFDKLEETSPTPLYRAAVSSSSYGR  525


 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  448  SAAAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPE  299
            S+++YGR  L+      +   P R Q+RFDPFTGEP+KFDPFTGEPI P+
Sbjct  519  SSSSYGRAELDPRLIATSVAPPARPQMRFDPFTGEPYKFDPFTGEPIEPD  568



>ref|XP_010660633.1| PREDICTED: probable RNA-binding protein 46 isoform X3 [Vitis 
vinifera]
Length=579

 Score =   280 bits (717),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 186/389 (48%), Positives = 230/389 (59%), Gaps = 72/389 (19%)
 Frame = -2

Query  1621  LGTSSEFLLGN-LHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRELFERFGK  1445
             +G+ S+FLLG+  HP ++WAEE  EID +ELAKI IAFV NLP +A+E+YL++LF  FGK
Sbjct  164   MGSKSDFLLGDSWHPVVEWAEEP-EIDPEELAKITIAFVGNLPKDANEDYLKKLFGPFGK  222

Query  1444  VEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVARPMDKSK  1265
             VEKV+L KKG S VGFVHF  R DLDNAIKE+N+KTV GP+ GP +KLQV VA+P+D+ +
Sbjct  223   VEKVLLSKKGQSPVGFVHFAKRSDLDNAIKEMNEKTVQGPSRGPAFKLQVAVAKPLDRKR  282

Query  1264  KRVRDESQSKSSSNI---------QKHS-------KEP-------EEVKVSDPYEAAIVA  1154
             KR RDESQSKS+S +         Q HS       K P       E V  SDPYEAA+V+
Sbjct  283   KRARDESQSKSASKMSNPVLLRSDQSHSSPAGGQPKAPKQKYLIEEPVPDSDPYEAAVVS  342

Query  1153  LPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGAYL  974
             LPA + ERLLRI+RLGIATR+D+ +Q +T L +LPE  AIS+LDQFMLSGAD  +KGAYL
Sbjct  343   LPAAVKERLLRILRLGIATRFDIDIQCITSLHKLPELAAISVLDQFMLSGADKLDKGAYL  402

Query  973   EGLIAK----RYG----------KVGKQWSP-SLSRVEDATLKEPDTVQYSKQIRLPVDS  839
              GL++K    R G          K+G    P  L RVED    E      S ++      
Sbjct  403   AGLMSKHQVDRLGVNRIPQHQVDKLGVNRIPLHLPRVEDTAPGESVLPSLSGRV------  456

Query  838   YGPHVPSPGSRSGLYGDLYSPTLPHHLWQGRVTPGLEETSPPLQIRSSTSAAYGRAGPP-  662
             Y P   S  SR G     Y                  ETSP L    S  + Y     P 
Sbjct  457   YRPAFDSLASRLGTTAARYDGY---------------ETSPAL----SRYSTYSYTDYPL  497

Query  661   -----FYSIEETSP-PLQRPLSSAAAYGR  593
                  F  +EETSP PL R   S+++YGR
Sbjct  498   SRQLGFDKLEETSPTPLYRAAVSSSSYGR  526


 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  448  SAAAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPE  299
            S+++YGR  L+      +   P R Q+RFDPFTGEP+KFDPFTGEPI P+
Sbjct  520  SSSSYGRAELDPRLIATSVAPPARPQMRFDPFTGEPYKFDPFTGEPIEPD  569



>ref|XP_010660632.1| PREDICTED: probable RNA-binding protein 46 isoform X2 [Vitis 
vinifera]
Length=585

 Score =   280 bits (717),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 186/389 (48%), Positives = 230/389 (59%), Gaps = 72/389 (19%)
 Frame = -2

Query  1621  LGTSSEFLLGN-LHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRELFERFGK  1445
             +G+ S+FLLG+  HP ++WAEE  EID +ELAKI IAFV NLP +A+E+YL++LF  FGK
Sbjct  170   MGSKSDFLLGDSWHPVVEWAEEP-EIDPEELAKITIAFVGNLPKDANEDYLKKLFGPFGK  228

Query  1444  VEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVARPMDKSK  1265
             VEKV+L KKG S VGFVHF  R DLDNAIKE+N+KTV GP+ GP +KLQV VA+P+D+ +
Sbjct  229   VEKVLLSKKGQSPVGFVHFAKRSDLDNAIKEMNEKTVQGPSRGPAFKLQVAVAKPLDRKR  288

Query  1264  KRVRDESQSKSSSNI---------QKHS-------KEP-------EEVKVSDPYEAAIVA  1154
             KR RDESQSKS+S +         Q HS       K P       E V  SDPYEAA+V+
Sbjct  289   KRARDESQSKSASKMSNPVLLRSDQSHSSPAGGQPKAPKQKYLIEEPVPDSDPYEAAVVS  348

Query  1153  LPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGAYL  974
             LPA + ERLLRI+RLGIATR+D+ +Q +T L +LPE  AIS+LDQFMLSGAD  +KGAYL
Sbjct  349   LPAAVKERLLRILRLGIATRFDIDIQCITSLHKLPELAAISVLDQFMLSGADKLDKGAYL  408

Query  973   EGLIAK----RYG----------KVGKQWSP-SLSRVEDATLKEPDTVQYSKQIRLPVDS  839
              GL++K    R G          K+G    P  L RVED    E      S ++      
Sbjct  409   AGLMSKHQVDRLGVNRIPQHQVDKLGVNRIPLHLPRVEDTAPGESVLPSLSGRV------  462

Query  838   YGPHVPSPGSRSGLYGDLYSPTLPHHLWQGRVTPGLEETSPPLQIRSSTSAAYGRAGPP-  662
             Y P   S  SR G     Y                  ETSP L    S  + Y     P 
Sbjct  463   YRPAFDSLASRLGTTAARYDGY---------------ETSPAL----SRYSTYSYTDYPL  503

Query  661   -----FYSIEETSP-PLQRPLSSAAAYGR  593
                  F  +EETSP PL R   S+++YGR
Sbjct  504   SRQLGFDKLEETSPTPLYRAAVSSSSYGR  532


 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  448  SAAAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPE  299
            S+++YGR  L+      +   P R Q+RFDPFTGEP+KFDPFTGEPI P+
Sbjct  526  SSSSYGRAELDPRLIATSVAPPARPQMRFDPFTGEPYKFDPFTGEPIEPD  575



>ref|XP_010660631.1| PREDICTED: probable RNA-binding protein 46 isoform X1 [Vitis 
vinifera]
Length=586

 Score =   280 bits (717),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 186/389 (48%), Positives = 230/389 (59%), Gaps = 72/389 (19%)
 Frame = -2

Query  1621  LGTSSEFLLGN-LHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRELFERFGK  1445
             +G+ S+FLLG+  HP ++WAEE  EID +ELAKI IAFV NLP +A+E+YL++LF  FGK
Sbjct  171   MGSKSDFLLGDSWHPVVEWAEEP-EIDPEELAKITIAFVGNLPKDANEDYLKKLFGPFGK  229

Query  1444  VEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVARPMDKSK  1265
             VEKV+L KKG S VGFVHF  R DLDNAIKE+N+KTV GP+ GP +KLQV VA+P+D+ +
Sbjct  230   VEKVLLSKKGQSPVGFVHFAKRSDLDNAIKEMNEKTVQGPSRGPAFKLQVAVAKPLDRKR  289

Query  1264  KRVRDESQSKSSSNI---------QKHS-------KEP-------EEVKVSDPYEAAIVA  1154
             KR RDESQSKS+S +         Q HS       K P       E V  SDPYEAA+V+
Sbjct  290   KRARDESQSKSASKMSNPVLLRSDQSHSSPAGGQPKAPKQKYLIEEPVPDSDPYEAAVVS  349

Query  1153  LPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGAYL  974
             LPA + ERLLRI+RLGIATR+D+ +Q +T L +LPE  AIS+LDQFMLSGAD  +KGAYL
Sbjct  350   LPAAVKERLLRILRLGIATRFDIDIQCITSLHKLPELAAISVLDQFMLSGADKLDKGAYL  409

Query  973   EGLIAK----RYG----------KVGKQWSP-SLSRVEDATLKEPDTVQYSKQIRLPVDS  839
              GL++K    R G          K+G    P  L RVED    E      S ++      
Sbjct  410   AGLMSKHQVDRLGVNRIPQHQVDKLGVNRIPLHLPRVEDTAPGESVLPSLSGRV------  463

Query  838   YGPHVPSPGSRSGLYGDLYSPTLPHHLWQGRVTPGLEETSPPLQIRSSTSAAYGRAGPP-  662
             Y P   S  SR G     Y                  ETSP L    S  + Y     P 
Sbjct  464   YRPAFDSLASRLGTTAARYDGY---------------ETSPAL----SRYSTYSYTDYPL  504

Query  661   -----FYSIEETSP-PLQRPLSSAAAYGR  593
                  F  +EETSP PL R   S+++YGR
Sbjct  505   SRQLGFDKLEETSPTPLYRAAVSSSSYGR  533


 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  448  SAAAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPE  299
            S+++YGR  L+      +   P R Q+RFDPFTGEP+KFDPFTGEPI P+
Sbjct  527  SSSSYGRAELDPRLIATSVAPPARPQMRFDPFTGEPYKFDPFTGEPIEPD  576



>emb|CDP02304.1| unnamed protein product [Coffea canephora]
Length=562

 Score =   277 bits (708),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 215/314 (68%), Gaps = 25/314 (8%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLLG-NLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+RA+R+G+ ++F+LG NLHPA+QW E++ EID   LAKIKIAF+RNLP  ADENYL++
Sbjct  150   AAARAFRVGSKADFMLGGNLHPAVQWVEDQPEIDPAALAKIKIAFIRNLPFSADENYLKK  209

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LFE FG++EKVVL +KG+S VGFVHF  R DL+NAI+ +N KTV  P GGP   L +EVA
Sbjct  210   LFEPFGEIEKVVLWRKGSSPVGFVHFTKRADLENAIRGMNGKTVQWPRGGPTSMLSIEVA  269

Query  1285  RPMDKSKKRVRDESQSKSSSNIQKHSKEP-------------------EEVKVSDPYEAA  1163
             RP+D+SKKR+RD+S  K ++ +  H+                      +EV+  DPYE A
Sbjct  270   RPIDRSKKRLRDDSHEKKANKVPSHTPSANLGIPLSSDCTSGSQKVAQKEVEYEDPYEVA  329

Query  1162  IVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKG  983
             ++ LP  + ERLLRI+RLGIATR+D+ +Q+LT LK+LPES AIS+LDQFMLSGAD +N+G
Sbjct  330   VLLLPLSVRERLLRILRLGIATRFDIDIQNLTSLKKLPESAAISVLDQFMLSGADKENRG  389

Query  982   AYLEGLIAK-RYGKVGKQWSP-SLSRVEDATLKEPDTVQYSKQIRLPV-DSYGPHVPSPG  812
              YL  LI++ +  ++    SP  LSRV D    +     +S ++ LPV DS+ PHV S  
Sbjct  390   VYLAALISRHQVDQLLLGRSPGGLSRVGDLIKSDVAISSFSSRVHLPVDDSFIPHVGS--  447

Query  811   SRSGLYGDLYSPTL  770
             +RS     ++ P +
Sbjct  448   TRSSFISQVHFPVV  461


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  433  GRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSSR*F  281
            GR+ L+     +AD  P R Q+RFDP TGEP+KFDPFTGE ILP++  R F
Sbjct  512  GRLTLDPQITEMADRPPHRPQIRFDPLTGEPYKFDPFTGERILPDNPQRRF  562



>ref|XP_010939344.1| PREDICTED: probable RNA-binding protein 46 [Elaeis guineensis]
Length=559

 Score =   276 bits (706),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/270 (51%), Positives = 190/270 (70%), Gaps = 22/270 (8%)
 Frame = -2

Query  1663  LQNYQSQAASRAYRLGTSSEFLL-GNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEA  1487
             +Q +   AA+RAYRLG+  +FLL GN HP I WAE+E EID +E+AKIK+AFV NLP+  
Sbjct  154   VQFFSHAAAARAYRLGSKPDFLLAGNWHPVIDWAEKEPEIDPEEMAKIKVAFVGNLPTNT  213

Query  1486  DENYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPY  1307
             DE YL++LFE  GKVE+V L +KG+  VGFVHF SR +LDNAIK+++ KTV GP+ GP +
Sbjct  214   DEEYLKKLFEPLGKVERVALSRKGHFPVGFVHFASRSELDNAIKKMDGKTVQGPHKGPSF  273

Query  1306  KLQVEVARPMDKSKKRVRDESQSK----------SSSNIQKHSKEPEEVKV---------  1184
             K+QV VARP++K +KRV DE++S+          SS +   H     + K          
Sbjct  274   KIQVTVARPVEKDRKRVHDETKSEPVNKSRDRPDSSRDRPTHDSSDHKSKAPRLDDPVSD  333

Query  1183  -SDPYEAAIVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLS  1007
              +DPYEAA+++LP+ + ERLLR++RLGIATRYD+ ++ +T LKELPES AI++LDQFMLS
Sbjct  334   SADPYEAAVISLPSAVKERLLRVLRLGIATRYDLDIRCITSLKELPESAAIAVLDQFMLS  393

Query  1006  GADVQNKGAYLEGLIAK-RYGKVGKQWSPS  920
             G D ++KG Y   L+++ + GK G  W+ S
Sbjct  394   GGDKRDKGVYFASLVSRHQVGKFGSGWNTS  423


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -2

Query  463  QVPPSSAAAYGRVGLNSYTANVADHQPT-RSQVRFDPFTGEPFKFDPFTGEPILPE  299
            + P SS   +G  G+ S + + +  +PT R Q++FDPFTG+P+KFDPFTGEPI P+
Sbjct  495  RAPVSSNFRHG-TGIGSGSFHASAERPTERPQIKFDPFTGQPYKFDPFTGEPIQPD  549



>ref|XP_008807827.1| PREDICTED: probable RNA-binding protein 46 [Phoenix dactylifera]
Length=560

 Score =   268 bits (684),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 136/263 (52%), Positives = 184/263 (70%), Gaps = 22/263 (8%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLL-GNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+RAYRLG+  +FLL GN HP I WAE+E EID +E+AKIK+AFV NLP+  DE YL++
Sbjct  161   AAARAYRLGSKPDFLLAGNWHPVIDWAEKEPEIDPEEMAKIKVAFVGNLPTNTDEEYLKK  220

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LFE  GKVE+V L +KG+  VGFVHF SR +LDNAI+E++ KTV GP  GP +K+QV VA
Sbjct  221   LFEPLGKVERVALSRKGHFPVGFVHFASRSELDNAIREMDGKTVQGPYKGPSFKIQVTVA  280

Query  1285  RPMDKSKKRVRDESQSK----------------SSSNIQKHSKEPE----EVKVSDPYEA  1166
             RP++K +KRV D ++SK                +  +    SK P         ++PYEA
Sbjct  281   RPVEKDRKRVHDGTKSKPLNKSGDRPDSSHDRDTCDSSDHKSKAPRLDDPVSNAANPYEA  340

Query  1165  AIVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNK  986
             A+++LP+ + ERLLR++RLGIA+RYD+ +  +T LKELPES AI++LDQFMLSGAD ++K
Sbjct  341   AVISLPSAVKERLLRVLRLGIASRYDLGIHCITSLKELPESAAIAVLDQFMLSGADKRDK  400

Query  985   GAYLEGLIAK-RYGKVGKQWSPS  920
             G Y   L+++ + GK G  W+ S
Sbjct  401   GVYFASLVSRHQVGKFGLGWNTS  423


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = -2

Query  427  VGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPE  299
            +G  S+ A+ A+H   R Q++FDPFTG+P+KFDPFTGE I P+
Sbjct  509  IGSGSFHAS-AEHPTERPQIKFDPFTGQPYKFDPFTGERIQPD  550



>ref|XP_010693188.1| PREDICTED: uncharacterized protein LOC104906171 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=553

 Score =   263 bits (671),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 163/352 (46%), Positives = 226/352 (64%), Gaps = 37/352 (11%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLLG-NLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA RA+RLG+ S+F+LG   HP +QWAEEE EID ++LAK+KIAF+RNLP++ +E +L++
Sbjct  161   AAGRAFRLGSRSDFVLGIKCHPTVQWAEEEPEIDPEDLAKVKIAFIRNLPADVNEGFLKK  220

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF  +G++EKVVL KKG   VGFVH+ +R DLD+A+K ++D+TV GPN    +KLQVEVA
Sbjct  221   LFGPYGEIEKVVLSKKGQFQVGFVHYATRQDLDSAVKAMHDRTVQGPN-AVSFKLQVEVA  279

Query  1285  RPMDKSKKRVRD------------------ESQSKSSSNIQKHSKEPEEVKVSDPYEAAI  1160
             RP +KSKKR R+                  ESQS SS   +      EE  V+DPYEAA+
Sbjct  280   RPFEKSKKRDREGSSRTVTEIVSQYKVLKAESQSASSGGCKFDLH--EEHIVADPYEAAV  337

Query  1159  VALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGA  980
             V+LPA + +RLLRI+RLGIA+RYD+ ++ L  L E+PES AIS+LDQF+LSGAD  +KGA
Sbjct  338   VSLPAAVQDRLLRILRLGIASRYDIDIRCLRSLNEIPESAAISVLDQFLLSGADENDKGA  397

Query  979   YLEGLIAK-RYGKVGKQWSPSL-SRVEDATLKEPDTVQYSKQIRLP-VDSYGPHVPSPGS  809
             +L GLI K +    G    P   SR  ++     D V+   + ++P +DS+  H+ +  S
Sbjct  398   FLAGLITKYQVRSFGISQVPEYTSRANESISVRSDLVRLRSRSQVPALDSFSSHMAT--S  455

Query  808   RSGLYGDLYSPTLPHHLWQGRVTPGL-----EETSPPLQIRSSTSAAYGRAG  668
             R     + YSP LP+  +      G+     E  S P+ +  S+S +YGR G
Sbjct  456   RY----ERYSPRLPYFDYSLSPRAGITRTSEERNSSPIHLPVSSS-SYGRMG  502


 Score = 89.7 bits (221),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  487  AEEANARLQVPPSSAAAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPI  308
            +EE N+     P S+++YGR+G+ S     A HQPTRSQVRFDPFTGEP+KFDPFTGEPI
Sbjct  481  SEERNSSPIHLPVSSSSYGRMGMKSPVIQGASHQPTRSQVRFDPFTGEPYKFDPFTGEPI  540

Query  307  LPESSSR  287
             PES SR
Sbjct  541  QPESLSR  547



>ref|XP_010693189.1| PREDICTED: uncharacterized protein LOC104906171 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=552

 Score =   263 bits (671),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 163/352 (46%), Positives = 226/352 (64%), Gaps = 37/352 (11%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLLG-NLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA RA+RLG+ S+F+LG   HP +QWAEEE EID ++LAK+KIAF+RNLP++ +E +L++
Sbjct  160   AAGRAFRLGSRSDFVLGIKCHPTVQWAEEEPEIDPEDLAKVKIAFIRNLPADVNEGFLKK  219

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF  +G++EKVVL KKG   VGFVH+ +R DLD+A+K ++D+TV GPN    +KLQVEVA
Sbjct  220   LFGPYGEIEKVVLSKKGQFQVGFVHYATRQDLDSAVKAMHDRTVQGPN-AVSFKLQVEVA  278

Query  1285  RPMDKSKKRVRD------------------ESQSKSSSNIQKHSKEPEEVKVSDPYEAAI  1160
             RP +KSKKR R+                  ESQS SS   +      EE  V+DPYEAA+
Sbjct  279   RPFEKSKKRDREGSSRTVTEIVSQYKVLKAESQSASSGGCKFDLH--EEHIVADPYEAAV  336

Query  1159  VALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGA  980
             V+LPA + +RLLRI+RLGIA+RYD+ ++ L  L E+PES AIS+LDQF+LSGAD  +KGA
Sbjct  337   VSLPAAVQDRLLRILRLGIASRYDIDIRCLRSLNEIPESAAISVLDQFLLSGADENDKGA  396

Query  979   YLEGLIAK-RYGKVGKQWSPSL-SRVEDATLKEPDTVQYSKQIRLP-VDSYGPHVPSPGS  809
             +L GLI K +    G    P   SR  ++     D V+   + ++P +DS+  H+ +  S
Sbjct  397   FLAGLITKYQVRSFGISQVPEYTSRANESISVRSDLVRLRSRSQVPALDSFSSHMAT--S  454

Query  808   RSGLYGDLYSPTLPHHLWQGRVTPGL-----EETSPPLQIRSSTSAAYGRAG  668
             R     + YSP LP+  +      G+     E  S P+ +  S+S +YGR G
Sbjct  455   RY----ERYSPRLPYFDYSLSPRAGITRTSEERNSSPIHLPVSSS-SYGRMG  501


 Score = 89.7 bits (221),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -2

Query  487  AEEANARLQVPPSSAAAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPI  308
            +EE N+     P S+++YGR+G+ S     A HQPTRSQVRFDPFTGEP+KFDPFTGEPI
Sbjct  480  SEERNSSPIHLPVSSSSYGRMGMKSPVIQGASHQPTRSQVRFDPFTGEPYKFDPFTGEPI  539

Query  307  LPESSSR  287
             PES SR
Sbjct  540  QPESLSR  546



>gb|EYU44181.1| hypothetical protein MIMGU_mgv1a008346mg [Erythranthe guttata]
Length=376

 Score =   255 bits (651),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 185/412 (45%), Positives = 240/412 (58%), Gaps = 60/412 (15%)
 Frame = -2

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             +FE FGKVEKVV+ KK +  VGFVHF  R DL+ AIKE+ND+TV GP+GG  +KLQVEVA
Sbjct  1     MFEPFGKVEKVVVSKKASIPVGFVHFAERSDLERAIKEMNDRTVRGPSGGSTHKLQVEVA  60

Query  1285  RPMDKSKKRVRDESQSKSSSN----IQKHSKE----PEEVKVSDPYEAAIVALPAVITER  1130
             RPMDKSKKR  +ES+S  S      + KH+        E+  +DPYE A++ALP  + ER
Sbjct  61    RPMDKSKKRAPEESESNPSVQGHFKLLKHNDHNSYLQRELGSADPYEDAVIALPLSVKER  120

Query  1129  LLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGAYLEGLIAKRY  950
             LLRI+RLGIATR+D+ V+SL  LKELPES AIS+LDQFMLSGA +QNKGAYL+GLI+   
Sbjct  121   LLRILRLGIATRFDIDVKSLCSLKELPESIAISVLDQFMLSGAGLQNKGAYLDGLIS---  177

Query  949   GKVGKQWSPSLSRVEDATLKEPDTVQYSKQIRL---PVDSYGPHVPSPGSRSGLYGDLYS  779
                 +  S S   V D T  E  +  YS   R    PV S+  H  S  +RS ++   YS
Sbjct  178   ----RVCSISFPEVVDNTRSE--SKLYSSLHRASPPPVGSFASHAHS-AARSDIFASHYS  230

Query  778   PTLPHHLWQGRVTPGLEETSPPLQIRSSTSAAYGRAGPPFYSIEETSPPLQ--RPLSSAA  605
             P L  +               PL  R+      GR       ++  S  LQ  RP+S++ 
Sbjct  231   PLLSDY---------------PLSSRT----LLGRG------VDRDSDFLQSSRPISASG  265

Query  604   AYG--RVVATLRGAEEASAR----LPVPPSSSAAYGRVVATLRGGAEEANARLQVPPSSA  443
             ++     V  +   EE S       PVPP S  ++G     +R     ++A    P SSA
Sbjct  266   SFQIPSQVPRIGMLEERSHSPYEATPVPPLSYGSFGLRTEEVR----YSSAIQTAPNSSA  321

Query  442   AAYGRVG--LNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESS  293
             + Y R+G  L S     +  QP R Q+RFDP+TGEP+KFDPFTGEPI P+++
Sbjct  322   SPYARLGASLTSEARAGSGQQPPRQQIRFDPYTGEPYKFDPFTGEPIRPDTT  373



>ref|XP_006837089.1| hypothetical protein AMTR_s00110p00107430 [Amborella trichopoda]
 gb|ERM99942.1| hypothetical protein AMTR_s00110p00107430 [Amborella trichopoda]
Length=674

 Score =   242 bits (617),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 189/523 (36%), Positives = 249/523 (48%), Gaps = 101/523 (19%)
 Frame = -2

Query  1621  LGTSSEFLLGN-LHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRELFERFGK  1445
             +G   +FLLG   HP++ WA+ E ++D +ELAK+KIAFV NLP+  +E +L  LF  FGK
Sbjct  169   VGNQPDFLLGGKWHPSVDWADRETDVDPEELAKVKIAFVANLPNNINEEHLERLFNPFGK  228

Query  1444  VEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVARPMDKSK  1265
             + +V + +K    VGFVHF  R DLDNAI EL+ KTV GP  G  + L+V VARP ++ +
Sbjct  229   LVRVAVSRKSGVPVGFVHFAKRSDLDNAINELDGKTVEGPEKGTKFSLEVSVARPDNRDR  288

Query  1264  KRVRDESQSKSSSNIQ-----------------KHSKEPEEVKVS------DPYEAAIVA  1154
             KR RDESQ K S   +                   SK P   K S      DPYEAA+++
Sbjct  289   KRTRDESQEKISHRSEGRFKSSRDSPSYRYSDNSKSKAPRLTKGSEVPVAADPYEAAVLS  348

Query  1153  LPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGAYL  974
             LP  +TERLLRI RLGIATRYD+ +  +T L EL E  A+S+LDQFM   AD   KGAYL
Sbjct  349   LPPAVTERLLRIFRLGIATRYDLDIGCITSLGELSEVVAVSVLDQFM-QNADRPGKGAYL  407

Query  973   EGLIA----KRYG--------KVGKQWSPSLSRVEDATLKEPDTVQ-YSKQIRLPVDSYG  833
              GLI+    +R G          G+        V     + PD++  ++   R   DSY 
Sbjct  408   SGLISGHEDERPGLNRRPLQLSRGRSVERDSGSVRVGRTRSPDSLALHAASSRF--DSYI  465

Query  832   PHVPSPGSRSGLYGDLYSPTLPHHLWQGRVTPGLEETSPPLQIRSSTSAAYGRAGPPFYS  653
             P       R  LY    SP L   L + R    L     P+ + S  +A     G    S
Sbjct  466   P-------RPSLYPSYTSP-LSDELPKPRAR--LSTNGDPVSLSSYRAAQKSSGGYGGLS  515

Query  652   IEETS-------------PPLQRPLSSAAAYGRVVATLRGAEEASARLPVPPSSSAAYGR  512
             IE  S             P L+R     ++  R  + L G E         P   + + R
Sbjct  516   IERDSRFGKVAEREPHFGPGLERDAHLGSSLERETSFLSGLERE-------PRMGSGFER  568

Query  511   VVATLRGGAEEANARLQVPPSSAAAYG---------------RVGLN-------------  416
                   G   E++A       S A  G               R+GL              
Sbjct  569   EPRAGTGFERESHAGTDFERESRAGTGFERDTRIGPGYERGTRIGLGYDIEGRSLGLERE  628

Query  415   SYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSSR  287
             + T +  + QP   QV+FDPFTG P+KFDPFTGEPI P+ + R
Sbjct  629   TRTGSGTERQP---QVKFDPFTGTPYKFDPFTGEPIQPDPAPR  668



>ref|XP_004962981.1| PREDICTED: polyadenylate-binding protein, cytoplasmic and nuclear-like 
isoform X1 [Setaria italica]
Length=602

 Score =   239 bits (609),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 171/252 (68%), Gaps = 24/252 (10%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLLGN-LHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+R  R+G+ ++F+LG+ LHPAI WA++E  +D  E+AKI  AFV NLP+  +E YLR+
Sbjct  158   AAARVIRIGSRTDFMLGDVLHPAINWADKESHVDADEMAKITTAFVGNLPANVNEEYLRK  217

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LFE+FG+V ++ + +KG   VGFVHF SR +LDNAIKE++ +TV GP+ GP +K+QV VA
Sbjct  218   LFEQFGEVIRLAISRKGQCPVGFVHFASRSELDNAIKEMDGETVRGPDQGPAFKIQVSVA  277

Query  1285  RP-MDKSKKRVRDESQSKSSSNIQ-----------KHSKEPEEVK----------VSDPY  1172
             RP +D  KKR R+E +++  SNI             H     +VK           SDPY
Sbjct  278   RPAVDNEKKRSREEVRTR-RSNISGDRPDYSYGRYGHDSHDRQVKAPRLSNYVADASDPY  336

Query  1171  EAAIVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQ  992
             E+A+ +LP+ + E LLRI+RLGI TRYD+ V  +  L ELPES+A+++L++F++SG D +
Sbjct  337   ESALASLPSAVKEVLLRILRLGIGTRYDIDVHCVKSLNELPESSAVAVLNKFLISGGDKR  396

Query  991   NKGAYLEGLIAK  956
             NKG Y   LIAK
Sbjct  397   NKGDYFASLIAK  408


 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  397  ADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSSR  287
            A++   R QVRFDPFTGEP+KFDPFTGEPI PE + R
Sbjct  560  AEYSAERQQVRFDPFTGEPYKFDPFTGEPIRPEQNQR  596



>ref|XP_004962982.1| PREDICTED: polyadenylate-binding protein, cytoplasmic and nuclear-like 
isoform X2 [Setaria italica]
Length=600

 Score =   239 bits (609),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 171/252 (68%), Gaps = 24/252 (10%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLLGN-LHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+R  R+G+ ++F+LG+ LHPAI WA++E  +D  E+AKI  AFV NLP+  +E YLR+
Sbjct  158   AAARVIRIGSRTDFMLGDVLHPAINWADKESHVDADEMAKITTAFVGNLPANVNEEYLRK  217

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LFE+FG+V ++ + +KG   VGFVHF SR +LDNAIKE++ +TV GP+ GP +K+QV VA
Sbjct  218   LFEQFGEVIRLAISRKGQCPVGFVHFASRSELDNAIKEMDGETVRGPDQGPAFKIQVSVA  277

Query  1285  RP-MDKSKKRVRDESQSKSSSNIQ-----------KHSKEPEEVK----------VSDPY  1172
             RP +D  KKR R+E +++  SNI             H     +VK           SDPY
Sbjct  278   RPAVDNEKKRSREEVRTR-RSNISGDRPDYSYGRYGHDSHDRQVKAPRLSNYVADASDPY  336

Query  1171  EAAIVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQ  992
             E+A+ +LP+ + E LLRI+RLGI TRYD+ V  +  L ELPES+A+++L++F++SG D +
Sbjct  337   ESALASLPSAVKEVLLRILRLGIGTRYDIDVHCVKSLNELPESSAVAVLNKFLISGGDKR  396

Query  991   NKGAYLEGLIAK  956
             NKG Y   LIAK
Sbjct  397   NKGDYFASLIAK  408


 Score = 63.2 bits (152),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  397  ADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSSR  287
            A++   R QVRFDPFTGEP+KFDPFTGEPI PE + R
Sbjct  558  AEYSAERQQVRFDPFTGEPYKFDPFTGEPIRPEQNQR  594



>ref|XP_010237120.1| PREDICTED: uncharacterized protein LOC100834061 isoform X2 [Brachypodium 
distachyon]
Length=664

 Score =   237 bits (605),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/252 (47%), Positives = 171/252 (68%), Gaps = 22/252 (9%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLLGN-LHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+R  R+G+ ++FLLG  LHPAI WAE E  +D  E+AKIK AFV NLP+  +E+YL++
Sbjct  161   AAARVLRIGSRTDFLLGGVLHPAINWAERESNVDAGEMAKIKTAFVGNLPANVNEDYLKK  220

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF RFG+V +V + +KG   VGF+HF SR +LDNAIKE++ KTV GP+ GP +K+QV VA
Sbjct  221   LFGRFGEVVRVAVSRKGEYPVGFIHFGSRSELDNAIKEMDGKTVSGPDRGPAFKIQVSVA  280

Query  1285  RP-MDKSKKRVRDESQSKSSS----------------NIQKHSKEPE----EVKVSDPYE  1169
             RP ++   KR R+E +++ S+                ++ + +K P        V+DPYE
Sbjct  281   RPAVENDNKRSREEVKTRRSNVSGDKLDYSHSRYKHDSLDRQAKAPRLSNLVADVTDPYE  340

Query  1168  AAIVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQN  989
             AAI++LP+ + E L RI+RLGI T YD+ +  +  L ELPES A+++L+QF+++GAD +N
Sbjct  341   AAIMSLPSAVNELLRRILRLGIGTPYDIDIHCIKSLNELPESGAVAVLNQFLITGADKRN  400

Query  988   KGAYLEGLIAKR  953
             KG Y   L+AKR
Sbjct  401   KGEYFASLVAKR  412


 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -2

Query  448  SAAAYGR-VGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSSR  287
            SAA Y   +G    + + A++     Q+RFDPFTGEP+KFDPFTGEPI PE + R
Sbjct  591  SAAGYTTDIGREFSSRSSAEYSTEHQQMRFDPFTGEPYKFDPFTGEPIRPEPNPR  645



>ref|XP_009397759.1| PREDICTED: uncharacterized protein LOC103982534 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=481

 Score =   232 bits (591),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 165/436 (38%), Positives = 230/436 (53%), Gaps = 94/436 (22%)
 Frame = -2

Query  1525  IKIAFVRNLPSEADENYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELN  1346
             IK AF+ NLP++ADE YL++LF+  GKVE+V L +KG+  VGFVHF  R DLDNAIKE++
Sbjct  111   IKAAFIGNLPNDADEEYLKKLFDPLGKVERVALSRKGHFPVGFVHFAKRADLDNAIKEMD  170

Query  1345  DKTVPGPNGGPPYKLQVEVARPMDKSKK-----------RVRDESQSKS----SSNIQKH  1211
              K V GP  GP +K+QV VARP++  K+           R RD+S S      S ++   
Sbjct  171   GKIVQGPRRGPKFKIQVAVARPVEMGKRPRDEPKNKPLPRSRDQSDSSYDGHISDSLDHK  230

Query  1210  SKEP---EEV-KVSDPYEAAIVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPES  1043
             SK P   ++V    DPYEAA++ LPAV+ E LL+++R+GIATRYD+ ++ +T L+EL ES
Sbjct  231   SKAPRLADQVPDTIDPYEAAVITLPAVVKEHLLQVLRVGIATRYDLNLRCITSLRELSES  290

Query  1042  TAISILDQFMLSGADVQNKGAYLEGLIAK----RYGKVGKQWSPSLSRVEDATLKEPDTV  875
              AI++LDQFMLSGAD Q+KGAY   L++K    ++G+ G     S S V   T K     
Sbjct  291   AAIAVLDQFMLSGADRQDKGAYFASLVSKHQAEKFGQRG-----STSYVPQKTRK-----  340

Query  874   QYSKQIRLPVDSYGPHVPSPGSRSGLYGDLYSPTLPHHLWQGRVTPGLEETSPPLQIRSS  695
              +S   RL   S G  +P       L   L S  + H                       
Sbjct  341   MFSLGARLC--SEGIDLPKESELLSLGAQLCSEEIDH-----------------------  375

Query  694   TSAAYGRAGPPFYSIEETSPPLQRPLSSAAAYGRVVATLRGAEEASARLPVPPSSSAAYG  515
             ++++  R  P  +    +S    RPL S        +++R  E+ +    V P+SS  YG
Sbjct  376   SASSRNRLSPALFPSSSSSSLYDRPLPSR-------SSVRKLEDITPSYRV-PASSMRYG  427

Query  514   RVVATLRGGAEEANARLQVPPSSAAAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFK  335
                                 P        +G +S+ +   +H   R Q++FDPFTGEP+K
Sbjct  428   --------------------PG-------IGSSSHLSP-KEHPVERRQMKFDPFTGEPYK  459

Query  334   FDPFTGEPILPESSSR  287
             +DPFTGEPI PE   R
Sbjct  460   YDPFTGEPIKPEPHGR  475



>ref|XP_008673161.1| PREDICTED: uncharacterized protein LOC100191891 isoform X1 [Zea 
mays]
 tpg|DAA47174.1| TPA: hypothetical protein ZEAMMB73_366443 [Zea mays]
Length=609

 Score =   232 bits (591),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 162/496 (33%), Positives = 245/496 (49%), Gaps = 94/496 (19%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLLGN-LHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+R  R+G+ ++F+LG+ LHPAI WA++E  +D  E+AK+K AF+ NLP + +E YLR+
Sbjct  158   AAARVIRIGSRTDFMLGDILHPAINWADKESHLDPDEMAKMKSAFIGNLPEDVNEEYLRK  217

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF +FG+V +V + +KG   V FVHF  R +L+NAI+E++ KTV GP  GP +K+QV VA
Sbjct  218   LFGQFGEVVRVAISRKGQCPVAFVHFAKRSELENAIEEMDGKTVRGPGRGPSFKIQVSVA  277

Query  1285  RPM-DKSKKRVRDESQSKSSS----------------NIQKHSKEPE----EVKVSDPYE  1169
             RP  D  KKR R+E +++ S+                ++ +  K P         +DPYE
Sbjct  278   RPTADNDKKRSREEVRTRRSNASGDRRDYSHGRYGHDSLDRQVKAPRLSNYVADAADPYE  337

Query  1168  AAIVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQN  989
             +A+ +LP+ + E LLRI+RL I TRYD+ +  +  L ELPES+A+++L+QF++SG D  N
Sbjct  338   SAVNSLPSAVKEVLLRILRLRIGTRYDIDIHCVKSLDELPESSALAVLNQFLISGGDKHN  397

Query  988   KGAYLEGLIAKR-----------YGKVGKQWSPSLSRV----EDATLKEPDTVQYSKQIR  854
             KG Y   L+AK            +G      +P +       ED     P + +Y     
Sbjct  398   KGDYFASLVAKHQAETFGLTHALHGTTYLSRNPEMHSKRYPHEDYDFVTPRSSRYDSSAH  457

Query  853   LPVDSYGPHVPSPGSRSGLYGDLYS-------PTLPHHLWQGRVTPGLEETSPPLQIRSS  695
              P   Y    P   SR   Y +  S       P   +     R+ P   E   P + R +
Sbjct  458   HPSTYYEDDPPVSESRVRRYAEERSTIVRSPEPRPRYDETDIRINP---EPRLPYESRHN  514

Query  694   TSAAYGRAGPPFYSIEETSPPLQRPLSSAAAYGRVVATLRGAEEASARLPVPPSSSAAYG  515
                   R       I+E S  ++RP   A     +++  R    A+  +P P        
Sbjct  515   AEKHLDRR-----YIQEHSSNIERPAEEA-----LLSRERRFLPAAGYMPNP--------  556

Query  514   RVVATLRGGAEEANARLQVPPSSAAAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFK  335
                    GG   ++ R + P   +A   ++  + +T                   GEP+K
Sbjct  557   -------GG---SDFRSRSPAEYSAQRQQMRFDPFT-------------------GEPYK  587

Query  334   FDPFTGEPILPESSSR  287
             FDPFTGEPI P+ + R
Sbjct  588   FDPFTGEPIRPDPNQR  603



>ref|XP_002442379.1| hypothetical protein SORBIDRAFT_08g019140 [Sorghum bicolor]
 gb|EES16217.1| hypothetical protein SORBIDRAFT_08g019140 [Sorghum bicolor]
Length=441

 Score =   225 bits (574),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/237 (48%), Positives = 161/237 (68%), Gaps = 23/237 (10%)
 Frame = -2

Query  1600  LLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRELFERFGKVEKVVLPK  1421
             +LG+LHPAI WA++E  +D  E+AKIK AFV NLP + +E YLR+LFE+FG+V +V + +
Sbjct  1     MLGDLHPAINWADKESHVDPDEMAKIKSAFVGNLPEDVNEEYLRKLFEQFGEVVRVAISR  60

Query  1420  KGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVARP-MDKSKKRVRDES  1244
             KG   VGFVHF +R +L+NAI+E++ KTV GP+ GP +++QV VARP  D  KKR R+E 
Sbjct  61    KGQCPVGFVHFANRSELENAIEEMDGKTVRGPDRGPSFRIQVSVARPAADNDKKRSREEV  120

Query  1243  QSKSSSNIQ-----------KHSKEPEEVK----------VSDPYEAAIVALPAVITERL  1127
             +++  SN+             H     +VK           SDPYE+A+ +LP+ + E L
Sbjct  121   RTR-RSNVSGDRQDYSHGRYGHDSLDRQVKASRLSNYVGDASDPYESAVNSLPSAVKEVL  179

Query  1126  LRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGAYLEGLIAK  956
             LRI+RLGI TRYD+ +Q +  L ELPES+A+++L+QF++SG D +NKG Y   LIAK
Sbjct  180   LRILRLGIGTRYDIDIQCVKSLNELPESSALAVLNQFLISGGDKRNKGYYFASLIAK  236


 Score = 62.4 bits (150),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 48/82 (59%), Gaps = 12/82 (15%)
 Frame = -2

Query  505  ATLRGGAEEA---NARLQVPPSSAAAYGRVGLNS------YTANVADHQPTRSQVRFDPF  353
            + +   AEEA     R  +PP   A Y + G N+       + + A++   R QVRFDPF
Sbjct  357  SNIERSAEEAVLSRERRFLPP---AGYNKAGYNTDLGSDFCSRSPAEYSAERQQVRFDPF  413

Query  352  TGEPFKFDPFTGEPILPESSSR  287
            TGEP+KFDPFTGEPI P+ + R
Sbjct  414  TGEPYKFDPFTGEPIRPDPNPR  435



>ref|XP_008673214.1| PREDICTED: uncharacterized protein LOC100191891 isoform X2 [Zea 
mays]
Length=607

 Score =   221 bits (564),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 165/251 (66%), Gaps = 22/251 (9%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLLGN-LHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+R  R+G+ ++F+LG+ LHPAI WA++E  +D  E+AK+K AF+ NLP + +E YLR+
Sbjct  158   AAARVIRIGSRTDFMLGDILHPAINWADKESHLDPDEMAKMKSAFIGNLPEDVNEEYLRK  217

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF +FG+V +V + +KG   V FVHF  R +L+NAI+E++ KTV GP  GP +K+QV VA
Sbjct  218   LFGQFGEVVRVAISRKGQCPVAFVHFAKRSELENAIEEMDGKTVRGPGRGPSFKIQVSVA  277

Query  1285  RPM-DKSKKRVRDESQSKSSS----------------NIQKHSKEPE----EVKVSDPYE  1169
             RP  D  KKR R+E +++ S+                ++ +  K P         +DPYE
Sbjct  278   RPTADNDKKRSREEVRTRRSNASGDRRDYSHGRYGHDSLDRQVKAPRLSNYVADAADPYE  337

Query  1168  AAIVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQN  989
             +A+ +LP+ + E LLRI+RL I TRYD+ +  +  L ELPES+A+++L+QF++SG D  N
Sbjct  338   SAVNSLPSAVKEVLLRILRLRIGTRYDIDIHCVKSLDELPESSALAVLNQFLISGGDKHN  397

Query  988   KGAYLEGLIAK  956
             KG Y   L+AK
Sbjct  398   KGDYFASLVAK  408


 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  397  ADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSSR  287
            A++   R Q+RFDPFTGEP+KFDPFTGEPI P+ + R
Sbjct  565  AEYSAQRQQMRFDPFTGEPYKFDPFTGEPIRPDPNQR  601



>ref|NP_001130787.1| uncharacterized protein LOC100191891 [Zea mays]
 gb|ACF79141.1| unknown [Zea mays]
 tpg|DAA47175.1| TPA: hypothetical protein ZEAMMB73_366443 [Zea mays]
Length=605

 Score =   221 bits (564),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 165/251 (66%), Gaps = 22/251 (9%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLLGN-LHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+R  R+G+ ++F+LG+ LHPAI WA++E  +D  E+AK+K AF+ NLP + +E YLR+
Sbjct  158   AAARVIRIGSRTDFMLGDILHPAINWADKESHLDPDEMAKMKSAFIGNLPEDVNEEYLRK  217

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF +FG+V +V + +KG   V FVHF  R +L+NAI+E++ KTV GP  GP +K+QV VA
Sbjct  218   LFGQFGEVVRVAISRKGQCPVAFVHFAKRSELENAIEEMDGKTVRGPGRGPSFKIQVSVA  277

Query  1285  RPM-DKSKKRVRDESQSKSSS----------------NIQKHSKEPE----EVKVSDPYE  1169
             RP  D  KKR R+E +++ S+                ++ +  K P         +DPYE
Sbjct  278   RPTADNDKKRSREEVRTRRSNASGDRRDYSHGRYGHDSLDRQVKAPRLSNYVADAADPYE  337

Query  1168  AAIVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQN  989
             +A+ +LP+ + E LLRI+RL I TRYD+ +  +  L ELPES+A+++L+QF++SG D  N
Sbjct  338   SAVNSLPSAVKEVLLRILRLRIGTRYDIDIHCVKSLDELPESSALAVLNQFLISGGDKHN  397

Query  988   KGAYLEGLIAK  956
             KG Y   L+AK
Sbjct  398   KGDYFASLVAK  408


 Score = 59.3 bits (142),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  397  ADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSSR  287
            A++   R Q+RFDPFTGEP+KFDPFTGEPI P+ + R
Sbjct  563  AEYSAQRQQMRFDPFTGEPYKFDPFTGEPIRPDPNQR  599



>gb|ACF86800.2| unknown [Zea mays]
 tpg|DAA47176.1| TPA: hypothetical protein ZEAMMB73_366443 [Zea mays]
Length=438

 Score =   217 bits (553),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 156/482 (32%), Positives = 234/482 (49%), Gaps = 94/482 (20%)
 Frame = -2

Query  1600  LLGN-LHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRELFERFGKVEKVVLP  1424
             +LG+ LHPAI WA++E  +D  E+AK+K AF+ NLP + +E YLR+LF +FG+V +V + 
Sbjct  1     MLGDILHPAINWADKESHLDPDEMAKMKSAFIGNLPEDVNEEYLRKLFGQFGEVVRVAIS  60

Query  1423  KKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVARPM-DKSKKRVRDE  1247
             +KG   V FVHF  R +L+NAI+E++ KTV GP  GP +K+QV VARP  D  KKR R+E
Sbjct  61    RKGQCPVAFVHFAKRSELENAIEEMDGKTVRGPGRGPSFKIQVSVARPTADNDKKRSREE  120

Query  1246  SQSKSSS----------------NIQKHSKEPE----EVKVSDPYEAAIVALPAVITERL  1127
              +++ S+                ++ +  K P         +DPYE+A+ +LP+ + E L
Sbjct  121   VRTRRSNASGDRRDYSHGRYGHDSLDRQVKAPRLSNYVADAADPYESAVNSLPSAVKEVL  180

Query  1126  LRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGAYLEGLIAKR--  953
             LRI+RL I TRYD+ +  +  L ELPES+A+++L+QF++SG D  NKG Y   L+AK   
Sbjct  181   LRILRLRIGTRYDIDIHCVKSLDELPESSALAVLNQFLISGGDKHNKGDYFASLVAKHQA  240

Query  952   ---------YGKVGKQWSPSLSRV----EDATLKEPDTVQYSKQIRLPVDSYGPHVPSPG  812
                      +G      +P +       ED     P + +Y      P   Y    P   
Sbjct  241   ETFGLTHALHGTTYLSRNPEMHSKRYPHEDYDFVTPRSSRYDSSAHHPSTYYEDDPPVSE  300

Query  811   SRSGLYGDLYS-------PTLPHHLWQGRVTPGLEETSPPLQIRSSTSAAYGRAGPPFYS  653
             SR   Y +  S       P   +     R+ P   E   P + R +      R       
Sbjct  301   SRVRRYAEERSTIVRSPEPRPRYDETDIRINP---EPRLPYESRHNAEKHLDRR-----Y  352

Query  652   IEETSPPLQRPLSSAAAYGRVVATLRGAEEASARLPVPPSSSAAYGRVVATLRGGAEEAN  473
             I+E S  ++RP   A     +++  R    A+  +P P               GG   ++
Sbjct  353   IQEHSSNIERPAEEA-----LLSRERRFLPAAGYMPNP---------------GG---SD  389

Query  472   ARLQVPPSSAAAYGRVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESS  293
              R + P   +A   ++  + +T                   GEP+KFDPFTGEPI P+ +
Sbjct  390   FRSRSPAEYSAQRQQMRFDPFT-------------------GEPYKFDPFTGEPIRPDPN  430

Query  292   SR  287
              R
Sbjct  431   QR  432



>ref|XP_010237119.1| PREDICTED: splicing factor, proline- and glutamine-rich-like 
isoform X1 [Brachypodium distachyon]
Length=609

 Score =   218 bits (556),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 149/231 (65%), Gaps = 35/231 (15%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLLGN-LHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+R  R+G+ ++FLLG  LHPAI WAE E  +D  E+AKIK AFV NLP+  +E+YL++
Sbjct  161   AAARVLRIGSRTDFLLGGVLHPAINWAERESNVDAGEMAKIKTAFVGNLPANVNEDYLKK  220

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF RFG+V +V + +KG   VGF+HF SR +LDNAIKE++ KTV GP+ GP +K+QV   
Sbjct  221   LFGRFGEVVRVAVSRKGEYPVGFIHFGSRSELDNAIKEMDGKTVSGPDRGPAFKIQV---  277

Query  1285  RPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALPAVITERLLRIMRLG  1106
                                              V+DPYEAAI++LP+ + E L RI+RLG
Sbjct  278   -------------------------------ADVTDPYEAAIMSLPSAVNELLRRILRLG  306

Query  1105  IATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKGAYLEGLIAKR  953
             I T YD+ +  +  L ELPES A+++L+QF+++GAD +NKG Y   L+AKR
Sbjct  307   IGTPYDIDIHCIKSLNELPESGAVAVLNQFLITGADKRNKGEYFASLVAKR  357


 Score = 59.3 bits (142),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -2

Query  448  SAAAYGR-VGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSSR  287
            SAA Y   +G    + + A++     Q+RFDPFTGEP+KFDPFTGEPI PE + R
Sbjct  536  SAAGYTTDIGREFSSRSSAEYSTEHQQMRFDPFTGEPYKFDPFTGEPIRPEPNPR  590



>ref|XP_006664137.1| PREDICTED: uncharacterized protein LOC102706615 isoform X2 [Oryza 
brachyantha]
Length=558

 Score =   213 bits (542),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 163/249 (65%), Gaps = 20/249 (8%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLREL  1463
             AA+   R+G+ ++FLLG LHP I WA++E  +D +E+AK+K AFV NLP+   E YL +L
Sbjct  109   AAAHVLRIGSRTDFLLGGLHPEINWADKESHVDDEEMAKVKTAFVGNLPANVTEEYLIKL  168

Query  1462  FERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVAR  1283
             FE  G+V +V + +KG   VGFVHF  R +LDNAIKE++ KT+ GP+ GP +++QV VAR
Sbjct  169   FEHCGEVVRVAISRKGQYPVGFVHFACRTELDNAIKEMDGKTIKGPDRGPAFRIQVSVAR  228

Query  1282  P-MDKSKKRVRDESQSKSSS----------------NIQKHSKEP---EEVKVSDPYEAA  1163
             P ++  KKR R+E  ++ S+                +  + +K P    EV  +DPYEAA
Sbjct  229   PVVENDKKRTREEVNTRRSNLSRDKIDHSYGRHGHDSYDREAKAPRLYNEVSGTDPYEAA  288

Query  1162  IVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKG  983
             +V+LP+ + E LLRI+RLGI TRYD+ +  +  L  LPE  A ++L+QF++SGAD  NKG
Sbjct  289   VVSLPSAVKELLLRILRLGIGTRYDIDIHCVKSLNGLPEKAAAAVLNQFLISGADKHNKG  348

Query  982   AYLEGLIAK  956
              Y   LIAK
Sbjct  349   DYFASLIAK  357


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  397  ADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSSR  287
            A++   R QVRFDPFTGE +KFDPFTGEPI PES+ R
Sbjct  516  AEYSTARQQVRFDPFTGEAYKFDPFTGEPIRPESNPR  552



>ref|NP_001177024.1| Os12g0577100 [Oryza sativa Japonica Group]
 gb|ABA99057.1| RNA recognition motif family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAH95752.1| Os12g0577100 [Oryza sativa Japonica Group]
Length=414

 Score =   208 bits (529),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 161/451 (36%), Positives = 228/451 (51%), Gaps = 78/451 (17%)
 Frame = -2

Query  1534  LAKIKIAFVRNLPSEADENYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIK  1355
             +AK+K AFV NLP+   E YLR+LFE  G+V +V + +KG   VGFVHF SR +LDNAIK
Sbjct  1     MAKVKTAFVGNLPANVTEEYLRKLFEHCGEVVRVAVSRKGQYPVGFVHFASRTELDNAIK  60

Query  1354  ELNDKTVPGPNGGPPYKLQVEVARPM-DKSKKRVRDESQSKSSS----------------  1226
             E++ +TV GP+ G  +++QV VARP+ +  KKR+R+E +++ S+                
Sbjct  61    EMDGETVRGPDRGATFRIQVSVARPVVENDKKRIREEVKTRRSNVSTDKPDHSYGRRGHD  120

Query  1225  NIQKHSKEP---EEVKVSDPYEAAIVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKE  1055
             +  + +K P    EV  +DPYEAA+V+LP+ + E LLRI+RL I TRYD+ +  +  L E
Sbjct  121   SYDRQAKAPRLYNEVSDTDPYEAAVVSLPSAVKELLLRILRLRIGTRYDIDIHCIRSLNE  180

Query  1054  LPESTAISILDQFMLSGADVQNKGAYLEGLIAKRYGKVGKQWSPSLSRVEDATL--KEPD  881
             LPE  A+++L+QF++SGAD  NKG Y   LI     K   +   S  R++ +T   + P+
Sbjct  181   LPEKAAVAVLNQFLISGADKHNKGDYFASLI----AKYQAETFSSALRLQGSTYLPRNPE  236

Query  880   TVQYSKQIRLPVDSYGPHVPSPGSRSGLYGDLYSPTLPHHLWQGRVTPGLEETSPPLQIR  701
                  +  R P   Y  +  S  SR    GD                P       P   +
Sbjct  237   I----QNKRFPHQDY-EYTASGSSRYSSLGDY---------------PSSSYVDDPASSQ  276

Query  700   SSTSAAYGRAGPPFYSIEETSPPLQRPLSSAAAYGRVVATLRGAEEASARLPVPPSSSAA  521
             S                +E  P L R   S +    +V   R  E   A  P   +    
Sbjct  277   SRNR-----------RYDEYRPDLVRYPDSRSRQEEIVRIERYPEPRFAHEPRQDT----  321

Query  520   YGRVVATLRGGAEEANARL----QVPPSSAAAYGRVGLNSYTANV---------ADHQPT  380
              GR +    G  +E N+ +    QV  SS    G +  + Y  N+         A++   
Sbjct  322   -GRHLDL--GYVQERNSNIERSAQVAFSSREG-GYLSASRYNTNIVPEFSSRSSAEYSTA  377

Query  379   RSQVRFDPFTGEPFKFDPFTGEPILPESSSR  287
             R QVRFDPFTGEP+KFDP+TGEPI PES+ R
Sbjct  378   RQQVRFDPFTGEPYKFDPYTGEPIRPESNPR  408



>ref|XP_006664136.1| PREDICTED: uncharacterized protein LOC102706615 isoform X1 [Oryza 
brachyantha]
Length=611

 Score =   213 bits (541),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 163/249 (65%), Gaps = 20/249 (8%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLREL  1463
             AA+   R+G+ ++FLLG LHP I WA++E  +D +E+AK+K AFV NLP+   E YL +L
Sbjct  162   AAAHVLRIGSRTDFLLGGLHPEINWADKESHVDDEEMAKVKTAFVGNLPANVTEEYLIKL  221

Query  1462  FERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVAR  1283
             FE  G+V +V + +KG   VGFVHF  R +LDNAIKE++ KT+ GP+ GP +++QV VAR
Sbjct  222   FEHCGEVVRVAISRKGQYPVGFVHFACRTELDNAIKEMDGKTIKGPDRGPAFRIQVSVAR  281

Query  1282  P-MDKSKKRVRDESQSKSSS----------------NIQKHSKEP---EEVKVSDPYEAA  1163
             P ++  KKR R+E  ++ S+                +  + +K P    EV  +DPYEAA
Sbjct  282   PVVENDKKRTREEVNTRRSNLSRDKIDHSYGRHGHDSYDREAKAPRLYNEVSGTDPYEAA  341

Query  1162  IVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGADVQNKG  983
             +V+LP+ + E LLRI+RLGI TRYD+ +  +  L  LPE  A ++L+QF++SGAD  NKG
Sbjct  342   VVSLPSAVKELLLRILRLGIGTRYDIDIHCVKSLNGLPEKAAAAVLNQFLISGADKHNKG  401

Query  982   AYLEGLIAK  956
              Y   LIAK
Sbjct  402   DYFASLIAK  410


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  397  ADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSSR  287
            A++   R QVRFDPFTGE +KFDPFTGEPI PES+ R
Sbjct  569  AEYSTARQQVRFDPFTGEAYKFDPFTGEPIRPESNPR  605



>ref|XP_009397761.1| PREDICTED: polyadenylate-binding protein, cytoplasmic and nuclear-like 
isoform X5 [Musa acuminata subsp. malaccensis]
Length=477

 Score =   197 bits (501),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 142/205 (69%), Gaps = 20/205 (10%)
 Frame = -2

Query  1642  AASRAYRLGTSSEFLL-GNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             AA+RAYR+G+ ++FLL G  HP I WAE+E EID +EL+KIK AF+ NLP++ADE YL++
Sbjct  111   AAARAYRIGSKADFLLAGKWHPVIDWAEKEPEIDPEELSKIKAAFIGNLPNDADEEYLKK  170

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             LF+  GKVE+V L +KG+  VGFVHF  R DLDNAIKE++ K V GP  GP +K+QV VA
Sbjct  171   LFDPLGKVERVALSRKGHFPVGFVHFAKRADLDNAIKEMDGKIVQGPRRGPKFKIQVAVA  230

Query  1285  RPMDKSKK-----------RVRDESQSKS----SSNIQKHSKEP---EEV-KVSDPYEAA  1163
             RP++  K+           R RD+S S      S ++   SK P   ++V    DPYEAA
Sbjct  231   RPVEMGKRPRDEPKNKPLPRSRDQSDSSYDGHISDSLDHKSKAPRLADQVPDTIDPYEAA  290

Query  1162  IVALPAVITERLLRIMRLGIATRYD  1088
             ++ LPAV+ E LL+++R+GIATRYD
Sbjct  291   VITLPAVVKEHLLQVLRVGIATRYD  315


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -2

Query  454  PSSAAAYG-RVGLNSYTANVADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSSR  287
            P+S+  YG  +G +S+ +   +H   R Q++FDPFTGEP+K+DPFTGEPI PE   R
Sbjct  416  PASSMRYGPGIGSSSHLSP-KEHPVERRQMKFDPFTGEPYKYDPFTGEPIKPEPHGR  471



>gb|EEE53482.1| hypothetical protein OsJ_36631 [Oryza sativa Japonica Group]
Length=401

 Score =   179 bits (453),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 149/449 (33%), Positives = 220/449 (49%), Gaps = 87/449 (19%)
 Frame = -2

Query  1534  LAKIKIAFVRNLPSEADENYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIK  1355
             +AK+K AFV NLP+   E YLR+LFE  G+V +V + +KG   VGFVHF SR +LDNAIK
Sbjct  1     MAKVKTAFVGNLPANVTEEYLRKLFEHCGEVVRVAVSRKGQYPVGFVHFASRTELDNAIK  60

Query  1354  ELNDKTVPGPNGGPPYKLQVEVARPM-DKSKKRVRDESQSKSSS----------------  1226
             E++ +TV              VARP+ +  KKR+R+E +++ S+                
Sbjct  61    EMDGETV-------------SVARPVVENDKKRIREEVKTRRSNVSTDKPDHSYGRRGHD  107

Query  1225  NIQKHSKEP---EEVKVSDPYEAAIVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKE  1055
             +  + +K P    EV  +DPYEAA+V+LP+ + E LLRI+RL I TRYD+ +  +  L E
Sbjct  108   SYDRQAKAPRLYNEVSDTDPYEAAVVSLPSAVKELLLRILRLRIGTRYDIDIHCIRSLNE  167

Query  1054  LPESTAISILDQFMLSGADVQNKGAYLEGLIAKRYGKVGKQWSPSLSRVEDATLKEPDTV  875
             LPE  A+++L+QF++SGAD  NK               G  ++  +++ +  T       
Sbjct  168   LPEKAAVAVLNQFLISGADKHNK---------------GDYFASLIAKYQAET-------  205

Query  874   QYSKQIRLPVDSYGPHVPSPGSRSGLYGDLYSPTLPHHLWQGRVTPGLEETSPPLQIRSS  695
              +S  +RL   +Y P  P          ++ +   PH  ++   +     +S      SS
Sbjct  206   -FSSALRLQGSTYLPRNP----------EIQNKRFPHQDYEYTASGSSRYSSLGDYPSSS  254

Query  694   TSAAYGRAGPPFYSIEETSPPLQRPLSSAAAYGRVVATLRGAEEASARLPVPPSSSAAYG  515
                    +       +E  P L R   S +    +V   R  E   A  P   +     G
Sbjct  255   YVDDPASSQSRNRRYDEYRPDLVRYPDSRSRQEEIVRIERYPEPRFAHEPRQDT-----G  309

Query  514   RVVATLRGGAEEANARL----QVPPSSAAAYGRVGLNSYTANV---------ADHQPTRS  374
             R +    G  +E N+ +    QV  SS    G +  + Y  N+         A++   R 
Sbjct  310   RHLDL--GYVQERNSNIERSAQVAFSSREG-GYLSASRYNTNIVPEFSSRSSAEYSTARQ  366

Query  373   QVRFDPFTGEPFKFDPFTGEPILPESSSR  287
             QVRFDPFTGEP+KFDP+TGEPI PES+ R
Sbjct  367   QVRFDPFTGEPYKFDPYTGEPIRPESNPR  395



>gb|EMT11921.1| Heterogeneous nuclear ribonucleoprotein A1 [Aegilops tauschii]
Length=729

 Score =   181 bits (460),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 111/266 (42%), Positives = 163/266 (61%), Gaps = 45/266 (17%)
 Frame = -2

Query  1654  YQSQAASRAYRLGTSSEFLLGN-LHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             +  QAA+R  R+G+ ++F+LG  LHPAI WAE E  +D  E+AKIK AFV NLP+ A+E 
Sbjct  220   FVEQAAARVLRIGSRTDFMLGGILHPAINWAERESNVDADEMAKIKTAFVGNLPANANEE  279

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
             YL++LF  FG+V +V + +KG   VGF+HF SR +LDNAIKE++ KTV            
Sbjct  280   YLKKLFGHFGEVIRVAVSRKGQYPVGFIHFGSRSELDNAIKEMDGKTVS-----------  328

Query  1297  VEVARP-MDKSKKRVRDESQSKSSS----------------NIQKHSKEP----EEVKVS  1181
               VARP ++   KR R+E +++ S+                ++++ +K P        V+
Sbjct  329   --VARPAVENDNKRSREEVKTRRSNVSGGKPDYSHGRYGHDSVERQTKAPRLSNRVADVT  386

Query  1180  DPYEAAIVALPAVITERLLRIMRLGIATRYD----------VTVQSLTRLKELPESTAIS  1031
             DPYEAA+ +LP+ + E LLRI+RLGI + YD          + +  +  L ELPES A++
Sbjct  387   DPYEAALNSLPSAVNELLLRILRLGIGSAYDSIIVLYFSSQIDIHCIKSLSELPESGAVA  446

Query  1030  ILDQFMLSGADVQNKGAYLEGLIAKR  953
             +L+QF+++G+D +NKG Y   LIAKR
Sbjct  447   VLNQFLITGSDKRNKGEYFLSLIAKR  472


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 4/37 (11%)
 Frame = -2

Query  397  ADHQPTRSQVRFDPFTGEPFKFDPFTGEPILPESSSR  287
            A+HQ    Q+RFDP+TGEP+KFDPFTGEPI PE S R
Sbjct  691  AEHQ----QMRFDPYTGEPYKFDPFTGEPIRPEPSLR  723



>gb|EMS53186.1| Heterogeneous nuclear ribonucleoprotein A1 [Triticum urartu]
Length=596

 Score =   166 bits (420),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/235 (43%), Positives = 148/235 (63%), Gaps = 35/235 (15%)
 Frame = -2

Query  1657  NYQSQAASRAYRLGTSSEFLLGN-LHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             ++ SQAA+R  R+G+ ++F+LG  LHPAI WAE E  +D  E+AKIK AFV NLP+ A+E
Sbjct  267   DHTSQAAARVLRIGSRTDFMLGGILHPAINWAERESNVDADEMAKIKTAFVGNLPANANE  326

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
              YL++LF  FG+V +V + +KG   VGF+HF SR +LDNAIKE++ KTV           
Sbjct  327   EYLKKLFGHFGEVIRVAVSRKGQYPVGFIHFGSRSELDNAIKEMDGKTVS----------  376

Query  1300  QVEVARP-MDKSKKRVRDESQSKSSS----------------NIQKHSKEPEEVK----V  1184
                VARP ++   KR R+E +++ S+                +I++ +K P        V
Sbjct  377   ---VARPAVENDNKRSREEVKTRRSNVSGGKPDYSHGRYGHDSIERQTKAPRLSNRVSDV  433

Query  1183  SDPYEAAIVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQ  1019
             +DPYEAA+ +LP+ + E LLRI+RLGI + YD+ +  +  L ELPES A+++L+Q
Sbjct  434   TDPYEAAVNSLPSAVNELLLRILRLGIGSPYDIDIHCIKSLSELPESGAVAVLNQ  488


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  370  VRFDPFTGEPFKFDPFTGEPILPESSSR  287
            +RFDP+TGEP+KFDPFTGEPI PE+S R
Sbjct  563  MRFDPYTGEPYKFDPFTGEPIRPEASLR  590



>gb|EEC69559.1| hypothetical protein OsI_38857 [Oryza sativa Indica Group]
Length=378

 Score =   152 bits (384),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 145/451 (32%), Positives = 205/451 (45%), Gaps = 114/451 (25%)
 Frame = -2

Query  1534  LAKIKIAFVRNLPSEADENYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIK  1355
             +AK+K AFV NLP+   E YLR+LFE  G+                       +LDNAIK
Sbjct  1     MAKVKTAFVGNLPANVTEEYLRKLFEHCGE-----------------------ELDNAIK  37

Query  1354  ELNDKTVPGPNGGPPYKLQVEVARPM-DKSKKRVRDESQSKSSS----------------  1226
             E++ +TV              VARP+ +  KKR+R+E +++ S+                
Sbjct  38    EMDGETV-------------SVARPVVENDKKRIREEVKTRRSNVSRDKPDHSYGRRGHD  84

Query  1225  NIQKHSKEP---EEVKVSDPYEAAIVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKE  1055
             +  + +K P    EV  +DPYEAA+V+LP+ + E LLRI+RL I TRYD+ +  +  L E
Sbjct  85    SYDRQAKAPRLYNEVSDTDPYEAAVVSLPSAVKELLLRILRLRIGTRYDIDIHCIRSLNE  144

Query  1054  LPESTAISILDQFMLSGADVQNKGAYLEGLIAKRYGKVGKQWSPSLSRVEDATL--KEPD  881
             LPE  A+++L+QF++SGAD  NKG Y   LIA    K   +   S  R++ +T   + P+
Sbjct  145   LPEKAAVAVLNQFLISGADKHNKGDYFASLIA----KYQAETFSSALRLQGSTYLPRNPE  200

Query  880   TVQYSKQIRLPVDSYGPHVPSPGSRSGLYGDLYSPTLPHHLWQGRVTPGLEETSPPLQIR  701
                  +  R P   Y  +  S  SR    GD                P       P   +
Sbjct  201   I----QNKRFPHQDY-EYTASGSSRYSSLGDY---------------PSSSYVDDPASSQ  240

Query  700   SSTSAAYGRAGPPFYSIEETSPPLQRPLSSAAAYGRVVATLRGAEEASARLPVPPSSSAA  521
             S                +E  P L R   S +    +V   R  E   A  P   +    
Sbjct  241   SRNR-----------RYDEYRPDLVRYPDSRSRQEEIVRIERYPEPRFAHEPRQDT----  285

Query  520   YGRVVATLRGGAEEANARL----QVPPSSAAAYGRVGLNSYTANV---------ADHQPT  380
              GR +    G  +E N+ +    QV  SS    G +  + Y  N+         A++   
Sbjct  286   -GRHLDL--GYVQERNSNIERSAQVAFSSREG-GYLSASRYNTNIVPEFSSRSSAEYSTA  341

Query  379   RSQVRFDPFTGEPFKFDPFTGEPILPESSSR  287
             R QVRFDPFTGEP+KFDP+TGEPI PES+ R
Sbjct  342   RQQVRFDPFTGEPYKFDPYTGEPIRPESNPR  372



>gb|EEC69560.1| hypothetical protein OsI_38859 [Oryza sativa Indica Group]
Length=204

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 83/134 (62%), Gaps = 20/134 (15%)
 Frame = -2

Query  1297  VEVARPM-DKSKKRVRDESQSKSSS----------------NIQKHSKEP---EEVKVSD  1178
             V VARP+ +  KKR+R+E +++ S+                +  + +K P    EV  +D
Sbjct  31    VSVARPVVENDKKRIREEVKTRRSNVSRDKPDHSYGRRGHDSYDRQAKAPRLYNEVSDTD  90

Query  1177  PYEAAIVALPAVITERLLRIMRLGIATRYDVTVQSLTRLKELPESTAISILDQFMLSGAD  998
             PYEAA+V+LP+ + E LLRI+RL I TRYD+ +  +  L ELPE  A+++L+QF++SGAD
Sbjct  91    PYEAAVVSLPSAVKELLLRILRLRIGTRYDIDIHCIRSLNELPEKAAVAVLNQFLISGAD  150

Query  997   VQNKGAYLEGLIAK  956
               NKG Y   LIAK
Sbjct  151   KHNKGDYFASLIAK  164



>emb|CAN79549.1| hypothetical protein VITISV_022646 [Vitis vinifera]
Length=798

 Score = 89.4 bits (220),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = -2

Query  1669  TSLQNYQSQAASRAYRLGTSSEFLLGN-LHPAIQWAEEEQEIDQKELAKIKIAFVRNLPS  1493
             ++L ++   AA+RA+R+G+ S+FLLG+  HP ++WAEE  EID +ELAKI IAFV NLP 
Sbjct  723   STLVDFVGWAAARAHRMGSKSDFLLGDSWHPVVEWAEEP-EIDPEELAKITIAFVGNLPK  781

Query  1492  EADENYLRELFERFGKV  1442
             +A+E+YL++LF  FGKV
Sbjct  782   DANEDYLKKLFGPFGKV  798



>ref|XP_006855084.1| hypothetical protein AMTR_s00031p00165100 [Amborella trichopoda]
 gb|ERN16551.1| hypothetical protein AMTR_s00031p00165100 [Amborella trichopoda]
Length=489

 Score = 76.6 bits (187),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 73/137 (53%), Gaps = 11/137 (8%)
 Frame = -2

Query  1663  LQNYQSQAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEAD  1484
             L+ Y +  A  A R  ++ +F L N  P + WA+ +   +    +++K  +V+NLP    
Sbjct  247   LEYYNAACAEYAKRKMSNPKFKLDNSAPTVSWADPKNHDNSAASSQVKAVYVKNLPKGVT  306

Query  1483  ENYLRELFERFGKVEKVVLP--KKG--NSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
             +N LRELFER G++ KVVLP  KKG  N+  GF+HF  R     A+K      + G    
Sbjct  307   QNKLRELFERHGEITKVVLPSAKKGQENANYGFIHFAQRASAVRALKNTEKYEIDG----  362

Query  1315  PPYKLQVEVARP-MDKS  1268
                 L+  +A+P +DKS
Sbjct  363   --QVLECSLAKPQIDKS  377



>gb|ETN62734.1| heterogeneous nuclear ribonucleoprotein r [Anopheles darlingi]
Length=728

 Score = 76.3 bits (186),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 77/133 (58%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R   +    + N    + WA+ ++E D+K ++K+K+ +VRNL  +  E 
Sbjct  355   YESHKAASLAKRRLGTGRIKVWNCDIIVDWADPQEEPDEKTMSKVKVLYVRNLTQDTSEE  414

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE+FG+VE+V   K       FVHF+ R +   A+K+L+ K + G N      ++
Sbjct  415   KLKESFEQFGRVERVKKIKD----YAFVHFEDRDNAVKAMKDLDGKEIGGSN------IE  464

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  465   VSLAKPPSDKKKK  477



>ref|XP_001656100.1| heterogeneous nuclear ribonucleoprotein r [Aedes aegypti]
 gb|EAT45899.1| AAEL002879-PA, partial [Aedes aegypti]
Length=517

 Score = 75.9 bits (185),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 78/134 (58%), Gaps = 13/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  261   YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDTSE  319

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
               L+E FE+FGKVE+V   K       F+HF+ R    NA+KEL+ K + G N      L
Sbjct  320   EKLKESFEQFGKVERVKKIKD----YAFIHFEDRDHAVNAMKELDGKDLGGSN------L  369

Query  1300  QVEVARPMDKSKKR  1259
             +V +A+P    KK+
Sbjct  370   EVSLAKPPSDKKKK  383



>ref|XP_003435825.1| AGAP001419-PC [Anopheles gambiae str. PEST]
 gb|EGK97589.1| AGAP001419-PC [Anopheles gambiae str. PEST]
Length=532

 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 77/133 (58%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R   +    + N    + WA+ ++E D++ ++K+K+ +VRNL  +  E 
Sbjct  299   YESHKAASLAKRRLGTGRIKVWNCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDTSEE  358

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE+FG+VE+V   K       FVHF+ R +   A+K+L+ K V G N      ++
Sbjct  359   KLKESFEQFGRVERVKKIKD----YAFVHFEDRDNAVKAMKDLDGKEVGGSN------IE  408

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  409   VSLAKPPSDKKKK  421



>ref|XP_321714.3| AGAP001419-PA [Anopheles gambiae str. PEST]
 ref|XP_003435823.1| AGAP001419-PB [Anopheles gambiae str. PEST]
 ref|XP_003435824.1| AGAP001419-PD [Anopheles gambiae str. PEST]
 gb|EAA43192.3| AGAP001419-PA [Anopheles gambiae str. PEST]
 gb|EGK97588.1| AGAP001419-PB [Anopheles gambiae str. PEST]
 gb|EGK97590.1| AGAP001419-PD [Anopheles gambiae str. PEST]
Length=532

 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 77/133 (58%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R   +    + N    + WA+ ++E D++ ++K+K+ +VRNL  +  E 
Sbjct  299   YESHKAASLAKRRLGTGRIKVWNCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDTSEE  358

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE+FG+VE+V   K       FVHF+ R +   A+K+L+ K V G N      ++
Sbjct  359   KLKESFEQFGRVERVKKIKD----YAFVHFEDRDNAVKAMKDLDGKEVGGSN------IE  408

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  409   VSLAKPPSDKKKK  421



>gb|KFB42190.1| AGAP001419-PC-like protein [Anopheles sinensis]
Length=535

 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 77/133 (58%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R   +    + N    + WA+ ++E D++ ++K+K+ +VRNL  +  E 
Sbjct  299   YESHKAASLAKRRLGTGRIKVWNCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDTSEE  358

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE+FG+VE+V   K       FVHF+ R +   A+K+L+ K + G N      ++
Sbjct  359   KLKESFEQFGRVERVKKIKD----YAFVHFEDRDNAVKAMKDLDGKEIGGSN------IE  408

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  409   VSLAKPPSDKKKK  421



>ref|XP_008555305.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R isoform 
X6 [Microplitis demolitor]
Length=530

 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 77/133 (58%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R  ++    +      + WA+ ++E D++ +AK+++ +VRNL  +  E 
Sbjct  294   YESHKAASLAKRRLSTGRIKVWGCDIIVDWADPQEEPDEQTMAKVRVLYVRNLTQDCTEE  353

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE++GK+++V   K       FVHF+ R +   A++ELN K + G +      ++
Sbjct  354   KLKECFEQYGKIDRVKKIKD----YAFVHFEDRDNAVKAMRELNGKEICGSH------IE  403

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  404   VALAKPPFDKKKK  416



>ref|XP_008555293.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R isoform 
X1 [Microplitis demolitor]
 ref|XP_008555294.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R isoform 
X1 [Microplitis demolitor]
 ref|XP_008555295.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R isoform 
X1 [Microplitis demolitor]
 ref|XP_008555296.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R isoform 
X1 [Microplitis demolitor]
 ref|XP_008555297.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R isoform 
X1 [Microplitis demolitor]
 ref|XP_008555298.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R isoform 
X1 [Microplitis demolitor]
 ref|XP_008555299.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R isoform 
X1 [Microplitis demolitor]
Length=673

 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 77/133 (58%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R  ++    +      + WA+ ++E D++ +AK+++ +VRNL  +  E 
Sbjct  294   YESHKAASLAKRRLSTGRIKVWGCDIIVDWADPQEEPDEQTMAKVRVLYVRNLTQDCTEE  353

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE++GK+++V   K       FVHF+ R +   A++ELN K + G +      ++
Sbjct  354   KLKECFEQYGKIDRVKKIKD----YAFVHFEDRDNAVKAMRELNGKEICGSH------IE  403

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  404   VALAKPPFDKKKK  416



>ref|XP_008555300.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R isoform 
X2 [Microplitis demolitor]
Length=673

 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 77/133 (58%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R  ++    +      + WA+ ++E D++ +AK+++ +VRNL  +  E 
Sbjct  294   YESHKAASLAKRRLSTGRIKVWGCDIIVDWADPQEEPDEQTMAKVRVLYVRNLTQDCTEE  353

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE++GK+++V   K       FVHF+ R +   A++ELN K + G +      ++
Sbjct  354   KLKECFEQYGKIDRVKKIKD----YAFVHFEDRDNAVKAMRELNGKEICGSH------IE  403

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  404   VALAKPPFDKKKK  416



>ref|XP_008555301.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R isoform 
X3 [Microplitis demolitor]
Length=668

 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 77/133 (58%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R  ++    +      + WA+ ++E D++ +AK+++ +VRNL  +  E 
Sbjct  294   YESHKAASLAKRRLSTGRIKVWGCDIIVDWADPQEEPDEQTMAKVRVLYVRNLTQDCTEE  353

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE++GK+++V   K       FVHF+ R +   A++ELN K + G +      ++
Sbjct  354   KLKECFEQYGKIDRVKKIKD----YAFVHFEDRDNAVKAMRELNGKEICGSH------IE  403

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  404   VALAKPPFDKKKK  416



>ref|XP_006029277.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 47 [Alligator 
sinensis]
Length=589

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 83/172 (48%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   V G        
Sbjct  261   TIKKIFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGTEVEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++     +   + +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGGATTTEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_008555302.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R isoform 
X4 [Microplitis demolitor]
Length=668

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 77/133 (58%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R  ++    +      + WA+ ++E D++ +AK+++ +VRNL  +  E 
Sbjct  294   YESHKAASLAKRRLSTGRIKVWGCDIIVDWADPQEEPDEQTMAKVRVLYVRNLTQDCTEE  353

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE++GK+++V   K       FVHF+ R +   A++ELN K + G +      ++
Sbjct  354   KLKECFEQYGKIDRVKKIKD----YAFVHFEDRDNAVKAMRELNGKEICGSH------IE  403

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  404   VALAKPPFDKKKK  416



>ref|XP_005286430.1| PREDICTED: RNA-binding protein 47 isoform X1 [Chrysemys picta 
bellii]
 ref|XP_005286431.1| PREDICTED: RNA-binding protein 47 isoform X1 [Chrysemys picta 
bellii]
Length=596

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 84/172 (49%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKKIFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGATTTTEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_006258543.1| PREDICTED: RNA-binding protein 47 [Alligator mississippiensis]
Length=595

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 83/172 (48%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   V G        
Sbjct  261   TIKKIFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGTEVEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++     +   + +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGGATTTEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_008555304.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R isoform 
X5 [Microplitis demolitor]
Length=559

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 77/133 (58%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R  ++    +      + WA+ ++E D++ +AK+++ +VRNL  +  E 
Sbjct  294   YESHKAASLAKRRLSTGRIKVWGCDIIVDWADPQEEPDEQTMAKVRVLYVRNLTQDCTEE  353

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE++GK+++V   K       FVHF+ R +   A++ELN K + G +      ++
Sbjct  354   KLKECFEQYGKIDRVKKIKD----YAFVHFEDRDNAVKAMRELNGKEICGSH------IE  403

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  404   VALAKPPFDKKKK  416



>ref|XP_005286433.1| PREDICTED: RNA-binding protein 47 isoform X3 [Chrysemys picta 
bellii]
Length=527

 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 84/172 (49%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKKIFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGATTTTEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_004362450.1| RNA-binding region RNP-1 domain-containing protein [Dictyostelium 
fasciculatum]
 gb|EGG24599.1| RNA-binding region RNP-1 domain-containing protein [Dictyostelium 
fasciculatum]
Length=497

 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 79/144 (55%), Gaps = 20/144 (14%)
 Frame = -2

Query  1654  YQSQAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENY  1475
             YQ++ A + +   +   F +GN +  + WA+  QE D+  + ++++ ++RNLP    E  
Sbjct  246   YQAEKARKEF---SQPNFKIGNCNVTVNWADPIQEPDETIMNQVRVLYIRNLPDSKSEEQ  302

Query  1474  LRELFERFGKVEKVVLPKKGNSL-------VGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
             +R+LFE +G +EKV++P   N+L        GFVHF +R + +  +   +D   P    G
Sbjct  303   VRKLFEEYGVIEKVIIP---NNLPGQQRRDFGFVHFANRDEAEATLARHHD--TPITYQG  357

Query  1315  PPYKLQVEVARPMDKSKK---RVR  1253
              P  L +  A+P+DK ++   RVR
Sbjct  358   RP--LSLSFAKPIDKKQRAELRVR  379



>ref|XP_007496602.1| PREDICTED: RNA-binding protein 47 isoform X11 [Monodelphis domestica]
Length=591

 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 85/172 (49%), Gaps = 14/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTEE  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKKSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNSLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK ++  R +  +K S+  +   ++P  V   DPY  A  + P
Sbjct  311   LEVTLAKPVDK-EQYTRYQKAAKGSATAEVTPQQPNYVYSCDPYTLAYYSYP  361



>ref|XP_005286432.1| PREDICTED: RNA-binding protein 47 isoform X2 [Chrysemys picta 
bellii]
Length=534

 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 84/172 (49%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKKIFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGATTTTEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_001365615.1| PREDICTED: RNA-binding protein 47 isoform X2 [Monodelphis domestica]
Length=523

 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 86/176 (49%), Gaps = 14/176 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E  +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  257   TTEETIKKSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNSLNGTELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK ++  R +  +K S+  +   ++P  V   DPY  A  + P
Sbjct  311   ----LEVTLAKPVDK-EQYTRYQKAAKGSATAEVTPQQPNYVYSCDPYTLAYYSYP  361



>ref|XP_001365552.1| PREDICTED: RNA-binding protein 47 isoform X1 [Monodelphis domestica]
 ref|XP_007496594.1| PREDICTED: RNA-binding protein 47 isoform X3 [Monodelphis domestica]
 ref|XP_007496595.1| PREDICTED: RNA-binding protein 47 isoform X4 [Monodelphis domestica]
 ref|XP_007496596.1| PREDICTED: RNA-binding protein 47 isoform X5 [Monodelphis domestica]
 ref|XP_007496597.1| PREDICTED: RNA-binding protein 47 isoform X6 [Monodelphis domestica]
 ref|XP_007496598.1| PREDICTED: RNA-binding protein 47 isoform X7 [Monodelphis domestica]
 ref|XP_007496599.1| PREDICTED: RNA-binding protein 47 isoform X8 [Monodelphis domestica]
 ref|XP_007496600.1| PREDICTED: RNA-binding protein 47 isoform X9 [Monodelphis domestica]
 ref|XP_007496601.1| PREDICTED: RNA-binding protein 47 isoform X10 [Monodelphis domestica]
Length=592

 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 85/172 (49%), Gaps = 14/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTEE  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKKSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNSLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK ++  R +  +K S+  +   ++P  V   DPY  A  + P
Sbjct  311   LEVTLAKPVDK-EQYTRYQKAAKGSATAEVTPQQPNYVYSCDPYTLAYYSYP  361



>ref|XP_006129555.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 47 [Pelodiscus 
sinensis]
Length=649

 Score = 72.8 bits (177),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 83/172 (48%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  262   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  321

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF SR D   A+  LN   + G        
Sbjct  322   TIKKIFGQFNPGCVERV----KKIRDYAFVHFTSREDAVQAMNNLNGTEIEGSC------  371

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  372   LEVTLAKPVDKEQYTRYQKAAKGGATTTTEVTQQPSYVYSCDPYTLAYYGYP  423



>ref|XP_006812136.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform 
X2 [Saccoglossus kowalevskii]
 ref|XP_006812137.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform 
X3 [Saccoglossus kowalevskii]
Length=660

 Score = 72.8 bits (177),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 80/143 (56%), Gaps = 12/143 (8%)
 Frame = -2

Query  1645  QAASRAYRLGTSSEF-LLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLR  1469
             +AAS A R   S    + GN +  + WA+ ++E D++ +AK+K+ +VRNL  +A+E  L+
Sbjct  321   KAASLARRRLMSGRIKVWGNSNVTVDWADPQEEPDEETMAKVKVLYVRNLTPDAEEEKLK  380

Query  1468  ELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEV  1289
             E F+ FG VE+V   K       FVHF+ R     A++ELN K V G        + + +
Sbjct  381   EAFQAFGTVERVKKLKD----YCFVHFEERDAAVKAMEELNGKEVEGS------VVDISL  430

Query  1288  AR-PMDKSKKRVRDESQSKSSSN  1223
             A+ P +  KK+ R +++   SSN
Sbjct  431   AKPPSENKKKKERQQTRGGRSSN  453



>ref|XP_006812138.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform 
X4 [Saccoglossus kowalevskii]
Length=616

 Score = 72.8 bits (177),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 80/143 (56%), Gaps = 12/143 (8%)
 Frame = -2

Query  1645  QAASRAYRLGTSSEF-LLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLR  1469
             +AAS A R   S    + GN +  + WA+ ++E D++ +AK+K+ +VRNL  +A+E  L+
Sbjct  321   KAASLARRRLMSGRIKVWGNSNVTVDWADPQEEPDEETMAKVKVLYVRNLTPDAEEEKLK  380

Query  1468  ELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEV  1289
             E F+ FG VE+V   K       FVHF+ R     A++ELN K V G        + + +
Sbjct  381   EAFQAFGTVERVKKLKD----YCFVHFEERDAAVKAMEELNGKEVEGS------VVDISL  430

Query  1288  AR-PMDKSKKRVRDESQSKSSSN  1223
             A+ P +  KK+ R +++   SSN
Sbjct  431   AKPPSENKKKKERQQTRGGRSSN  453



>ref|XP_002731265.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform 
X1 [Saccoglossus kowalevskii]
Length=648

 Score = 72.8 bits (177),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 80/143 (56%), Gaps = 12/143 (8%)
 Frame = -2

Query  1645  QAASRAYRLGTSSEF-LLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLR  1469
             +AAS A R   S    + GN +  + WA+ ++E D++ +AK+K+ +VRNL  +A+E  L+
Sbjct  309   KAASLARRRLMSGRIKVWGNSNVTVDWADPQEEPDEETMAKVKVLYVRNLTPDAEEEKLK  368

Query  1468  ELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEV  1289
             E F+ FG VE+V   K       FVHF+ R     A++ELN K V G        + + +
Sbjct  369   EAFQAFGTVERVKKLKD----YCFVHFEERDAAVKAMEELNGKEVEGS------VVDISL  418

Query  1288  AR-PMDKSKKRVRDESQSKSSSN  1223
             A+ P +  KK+ R +++   SSN
Sbjct  419   AKPPSENKKKKERQQTRGGRSSN  441



>ref|XP_006873290.1| PREDICTED: RNA-binding protein 47 isoform X2 [Chrysochloris asiatica]
Length=524

 Score = 72.4 bits (176),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 61/204 (30%), Positives = 99/204 (49%), Gaps = 20/204 (10%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  196   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  255

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  256   TTEDTIKKSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC--  309

Query  1315  PPYKLQVEVARPMDKSK-KRVRDESQSKSSSNIQKHS-KEPEEVKVSDPYEAAIVALP--  1148
                 L+V +A+P+DK +  R +  ++  S S + + + ++P  V   DPY  A    P  
Sbjct  310   ----LEVTLAKPVDKEQYSRYQKAAKGASGSGVAEAAVQQPSYVYSCDPYTLAYYGYPYN  365

Query  1147  AVIT---ERLLRIMRLGIATRYDV  1085
             A+I    E  +++    I T+Y +
Sbjct  366   ALIGPNREYFVKVAIPAIGTQYSM  389



>gb|KFM58410.1| Heterogeneous nuclear ribonucleoprotein Q, partial [Stegodyphus 
mimosarum]
Length=642

 Score = 72.4 bits (176),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 72/129 (56%), Gaps = 11/129 (9%)
 Frame = -2

Query  1645  QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRE  1466
             +AAS A R  ++    +      + WA+ ++E D++ ++K+K+ + RNL ++  E  L+E
Sbjct  299   KAASLAKRRLSTGRIKVWGCDIIVDWADPQEEPDEETMSKVKVLYARNLTADVTEEKLKE  358

Query  1465  LFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVA  1286
             +FE +GKVE+V   K       F+HFD R     A+  LN K V    GG P  +QV +A
Sbjct  359   MFEAYGKVERVKKIKD----YAFIHFDDRDHAVKAMNSLNGKEV----GGAP--MQVSLA  408

Query  1285  R-PMDKSKK  1262
             + P DK KK
Sbjct  409   KPPSDKKKK  417



>ref|XP_003773344.1| PREDICTED: RNA-binding protein 47 isoform 1 [Sarcophilus harrisii]
Length=590

 Score = 72.4 bits (176),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 85/172 (49%), Gaps = 14/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTEE  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKKSFGQFNPGCVERV----KKIRDYAFVHFTSRDDAVHAMNSLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK ++  R +  +K +   +  S++P  V   DPY  A  + P
Sbjct  311   LEVTLAKPVDK-EQYTRYQKAAKGNVTAEVTSQQPNYVYSCDPYTLAYYSYP  361



>ref|XP_003773345.1| PREDICTED: RNA-binding protein 47 isoform 2 [Sarcophilus harrisii]
Length=521

 Score = 72.0 bits (175),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 85/172 (49%), Gaps = 14/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTEE  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKKSFGQFNPGCVERV----KKIRDYAFVHFTSRDDAVHAMNSLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK ++  R +  +K +   +  S++P  V   DPY  A  + P
Sbjct  311   LEVTLAKPVDK-EQYTRYQKAAKGNVTAEVTSQQPNYVYSCDPYTLAYYSYP  361



>ref|XP_006846586.1| hypothetical protein AMTR_s00018p00254940 [Amborella trichopoda]
 gb|ERN08261.1| hypothetical protein AMTR_s00018p00254940 [Amborella trichopoda]
Length=479

 Score = 71.6 bits (174),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 67/130 (52%), Gaps = 8/130 (6%)
 Frame = -2

Query  1663  LQNYQSQAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEAD  1484
             L+ Y S  A  A +  +S  F L +  P ++WA+ +   D    +++K+ +V+NLP +  
Sbjct  249   LEYYNSACADYARQKMSSPGFKLDSNTPTVRWADPKNTADHDLTSQVKVVYVKNLPEDVK  308

Query  1483  ENYLRELFERFGKVEKVVLP--KKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPP  1310
             +  L+E+FE  G+V ++VLP  K G    GF+HF  R    NA+ E     + G      
Sbjct  309   QEQLKEIFEPHGEVTRIVLPPVKPGQGAYGFIHFAKRASALNAVNETKKYEING------  362

Query  1309  YKLQVEVARP  1280
             +  +  +A+P
Sbjct  363   HAFEATMAKP  372



>ref|XP_008564158.1| PREDICTED: RNA-binding protein 47 [Galeopterus variegatus]
Length=593

 Score = 72.0 bits (175),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 85/176 (48%), Gaps = 14/176 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  257   TTEDTIKKSFGQFNPGCVERV----KKIRDYAFVHFSSREDAVHAMNNLNGTELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK ++  R +  +K  S  +  + +P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDK-EQYSRYQKAAKGGSAAEAAAPQPSYVYSCDPYTLAYYGYP  361



>ref|XP_002400928.1| G-3-P dehydrogenase, putative [Ixodes scapularis]
 gb|EEC05748.1| G-3-P dehydrogenase, putative [Ixodes scapularis]
Length=438

 Score = 71.2 bits (173),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 77/133 (58%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R  ++    + +    + WA+ ++E DQ+ +AK+K+ +VRNL ++  E 
Sbjct  298   YESHKAASLAKRRLSTGRIKVWSCDIIVDWADPQEEPDQETMAKVKVLYVRNLTADVTEE  357

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+ELFE+ G+VE+V   K       FVHF+ R   D+A+K +N        G P   ++
Sbjct  358   RLKELFEQHGRVERVKKIKD----YAFVHFEER---DHAVKAMNQLQGKDLCGAP---ME  407

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  408   VSLAKPPSDKKKK  420



>ref|XP_008825459.1| PREDICTED: RNA-binding protein 47 isoform X1 [Nannospalax galili]
Length=593

 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 84/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEMDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFASREDAVHAMNNLNGTELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++        +  +++P  +   DPY  A  + P
Sbjct  311   ----LEVTLAKPVDKEQYSRYQKAAKGGGCAAEAVTQQPSYLYSCDPYALAYYSYP  362



>ref|XP_002968556.1| hypothetical protein SELMODRAFT_169951 [Selaginella moellendorffii]
 ref|XP_002975925.1| hypothetical protein SELMODRAFT_175329 [Selaginella moellendorffii]
 gb|EFJ22830.1| hypothetical protein SELMODRAFT_175329 [Selaginella moellendorffii]
 gb|EFJ30810.1| hypothetical protein SELMODRAFT_169951 [Selaginella moellendorffii]
Length=477

 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 56/107 (52%), Gaps = 4/107 (4%)
 Frame = -2

Query  1663  LQNYQSQAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEAD  1484
             ++ Y    A  A +L + S F LGN  P + WA+     +    ++IK+ +VRNLP    
Sbjct  230   VEYYNHACADHARKLMSRSSFRLGNNVPTVSWADPRTGAEPAATSQIKVVYVRNLPEAVT  289

Query  1483  ENYLRELFERFGKVEKVVLPK----KGNSLVGFVHFDSRLDLDNAIK  1355
             E  LR LFE  G++ KVVLP+    +     GFVHF  R D   AI+
Sbjct  290   EEQLRGLFEHHGEITKVVLPQSKPGQPKRDFGFVHFADRNDALKAIE  336



>ref|XP_002157894.2| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like [Hydra 
vulgaris]
Length=623

 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 69/127 (54%), Gaps = 10/127 (8%)
 Frame = -2

Query  1624  RLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRELFERFGK  1445
             R  T    + GN+ P + WA+  +E D   ++K+K+ +VRNL    +E  L ELF+++G 
Sbjct  307   RFMTGRIKVFGNITPTVDWADPVEEPDDNVMSKVKVVYVRNLSPAIEETKLNELFKQYGA  366

Query  1444  VEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVARPMDKSK  1265
             VEKV   K       F+HF +R D   AI+ELN + +         K++V +A+P  + K
Sbjct  367   VEKVKKLKD----YAFIHFVNRDDAVRAIEELNGQDL------DDLKIEVSLAKPQTEKK  416

Query  1264  KRVRDES  1244
             +  R +S
Sbjct  417   EARRGQS  423



>ref|XP_001362315.1| PREDICTED: RNA-binding protein 47-like isoform X1 [Monodelphis 
domestica]
 ref|XP_007507148.1| PREDICTED: RNA-binding protein 47-like isoform X2 [Monodelphis 
domestica]
Length=583

 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 81/171 (47%), Gaps = 16/171 (9%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  +  E 
Sbjct  200   YESHRAAAMARRKLMPGRIQLWGQQIAVDWAEPEMDVDEDVMETVKILYVRNLMIKTSEE  259

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              +R+ F +FG VE+V    K      FVHF SR D   A+  LN   + G        L 
Sbjct  260   TIRKTFSQFGCVERV----KKIRDYAFVHFTSREDAIRAMNSLNGTELEGSC------LG  309

Query  1297  VEVARPMDKSK-KRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             V +A+P+DK +  R R   +   ++ +Q+ +     V   DPY  A  + P
Sbjct  310   VTLAKPVDKEQYARYRKAVKGSVTAEVQQLNY----VYSCDPYTLAYYSYP  356



>ref|XP_006873289.1| PREDICTED: RNA-binding protein 47 isoform X1 [Chrysochloris asiatica]
Length=593

 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 87/178 (49%), Gaps = 15/178 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  196   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  255

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  256   TTEDTIKKSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC--  309

Query  1315  PPYKLQVEVARPMDKSK-KRVRDESQSKSSSNIQKHS-KEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +  R +  ++  S S + + + ++P  V   DPY  A    P
Sbjct  310   ----LEVTLAKPVDKEQYSRYQKAAKGASGSGVAEAAVQQPSYVYSCDPYTLAYYGYP  363



>ref|XP_008825460.1| PREDICTED: RNA-binding protein 47 isoform X2 [Nannospalax galili]
Length=524

 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 84/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEMDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFASREDAVHAMNNLNGTELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++        +  +++P  +   DPY  A  + P
Sbjct  311   ----LEVTLAKPVDKEQYSRYQKAAKGGGCAAEAVTQQPSYLYSCDPYALAYYSYP  362



>ref|XP_008190475.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like isoform 
X3 [Tribolium castaneum]
Length=523

 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 77/134 (57%), Gaps = 13/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  E  E
Sbjct  295   YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQEISE  353

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
               L+E FE +GKVE+V   K       F+HF+ R +   A++EL+ K + G N      +
Sbjct  354   EKLKEAFEAYGKVERVKKIKD----YAFIHFEDRENAVKAMEELDGKEMGGSN------I  403

Query  1300  QVEVARPMDKSKKR  1259
             +V +A+P    KK+
Sbjct  404   EVSLAKPPSDKKKK  417



>gb|KFO32871.1| RNA-binding protein 47 [Fukomys damarensis]
Length=606

 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 85/176 (48%), Gaps = 14/176 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  213   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  272

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  273   TTEDTIKKSFGQFNPGCVERV----KKIRDYAFVHFSSREDAVHAMNNLNGTELEGSC--  326

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK ++  R +  +K  S  +  ++ P  V   DPY  A    P
Sbjct  327   ----LEVTLAKPVDK-EQYSRYQKAAKGGSVAEAAAQPPSYVYSCDPYTLAYYGYP  377



>ref|XP_001772239.1| predicted protein [Physcomitrella patens]
 gb|EDQ62892.1| predicted protein [Physcomitrella patens]
Length=507

 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 57/107 (53%), Gaps = 4/107 (4%)
 Frame = -2

Query  1663  LQNYQSQAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEAD  1484
             ++ Y    A  A R  + S F LG   P I WA+     D   ++++K+ +VRNLP    
Sbjct  253   VEYYNHACAEHARREMSKSSFRLGTNAPTISWADPRSGPDVSAMSQVKVVYVRNLPDSVT  312

Query  1483  ENYLRELFERFGKVEKVVLP--KKGNSL--VGFVHFDSRLDLDNAIK  1355
             E  L++LFER G++ KVVLP  K G +    GFVHF  R     AI+
Sbjct  313   EEQLQKLFERHGEIVKVVLPATKPGQAKRDFGFVHFSDRAQALKAIE  359



>ref|XP_010623438.1| PREDICTED: RNA-binding protein 47 [Fukomys damarensis]
Length=590

 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 85/176 (48%), Gaps = 14/176 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  257   TTEDTIKKSFGQFNPGCVERV----KKIRDYAFVHFSSREDAVHAMNNLNGTELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK ++  R +  +K  S  +  ++ P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDK-EQYSRYQKAAKGGSVAEAAAQPPSYVYSCDPYTLAYYGYP  361



>ref|XP_008190474.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like isoform 
X2 [Tribolium castaneum]
Length=625

 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 78/134 (58%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  E  E
Sbjct  295   YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQEISE  353

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
               L+E FE +GKVE+V   K       F+HF+ R +   A++EL+ K + G N      +
Sbjct  354   EKLKEAFEAYGKVERVKKIKD----YAFIHFEDRENAVKAMEELDGKEMGGSN------I  403

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  404   EVSLAKPPSDKKKK  417



>ref|XP_008190470.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like isoform 
X1 [Tribolium castaneum]
 ref|XP_008190472.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like isoform 
X1 [Tribolium castaneum]
 ref|XP_008190473.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like isoform 
X1 [Tribolium castaneum]
Length=626

 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 78/134 (58%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  E  E
Sbjct  295   YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQEISE  353

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
               L+E FE +GKVE+V   K       F+HF+ R +   A++EL+ K + G N      +
Sbjct  354   EKLKEAFEAYGKVERVKKIKD----YAFIHFEDRENAVKAMEELDGKEMGGSN------I  403

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  404   EVSLAKPPSDKKKK  417



>ref|XP_006974680.1| PREDICTED: RNA-binding protein 47 isoform X1 [Peromyscus maniculatus 
bairdii]
 ref|XP_006974681.1| PREDICTED: RNA-binding protein 47 isoform X2 [Peromyscus maniculatus 
bairdii]
Length=592

 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 81/172 (47%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIETTEE  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++  F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKRSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++      +++  +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYSRYQKAAKGGGGSVEAVAQQPSYVYSCDPYTLAYYGYP  362



>ref|XP_009909036.1| PREDICTED: RNA-binding protein 47 isoform X2 [Picoides pubescens]
 gb|KFV63135.1| RNA-binding protein 47 [Picoides pubescens]
Length=598

 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + S++P  +   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGATATPEVSQQPNYIYSCDPYTLAYYGYP  362



>gb|EEZ97818.1| hypothetical protein TcasGA2_TC000185 [Tribolium castaneum]
Length=638

 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 78/134 (58%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  E  E
Sbjct  308   YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQEISE  366

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
               L+E FE +GKVE+V   K       F+HF+ R +   A++EL+ K + G N      +
Sbjct  367   EKLKEAFEAYGKVERVKKIKD----YAFIHFEDRENAVKAMEELDGKEMGGSN------I  416

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  417   EVSLAKPPSDKKKK  430



>ref|XP_009916985.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 47 [Haliaeetus 
albicilla]
Length=573

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGATATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_009865702.1| PREDICTED: RNA-binding protein 47 [Apaloderma vittatum]
Length=570

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGATATPEVTQQPNYVYSCDPYTLAYYGYP  362



>gb|KFP86885.1| RNA-binding protein 47, partial [Apaloderma vittatum]
Length=541

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGATATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_010085867.1| PREDICTED: RNA-binding protein 47 [Pterocles gutturalis]
Length=604

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGTAATPEITQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_009909035.1| PREDICTED: RNA-binding protein 47 isoform X1 [Picoides pubescens]
Length=529

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + S++P  +   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGATATPEVSQQPNYIYSCDPYTLAYYGYP  362



>ref|XP_007945338.1| PREDICTED: RNA-binding protein 47 isoform X1 [Orycteropus afer 
afer]
Length=589

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 84/176 (48%), Gaps = 14/176 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  257   TTEDTIKKSFGQFKPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +   R +  +K     +  +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYS-RYQKAAKGGGTAEVVAQQPGYVYSCDPYTLAYYGYP  361



>gb|KFQ03807.1| RNA-binding protein 47, partial [Haliaeetus albicilla]
Length=550

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 84/172 (49%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G        
Sbjct  261   TIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGATATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_010572765.1| PREDICTED: RNA-binding protein 47 isoform X1 [Haliaeetus leucocephalus]
Length=597

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGATATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_006974682.1| PREDICTED: RNA-binding protein 47 isoform X3 [Peromyscus maniculatus 
bairdii]
Length=523

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 81/172 (47%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIETTEE  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++  F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKRSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++      +++  +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYSRYQKAAKGGGGSVEAVAQQPSYVYSCDPYTLAYYGYP  362



>ref|XP_009502943.1| PREDICTED: RNA-binding protein 47 isoform X2 [Phalacrocorax carbo]
Length=596

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGATATPEVAQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_005074427.1| PREDICTED: RNA-binding protein 47 isoform X1 [Mesocricetus auratus]
Length=592

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 83/173 (48%), Gaps = 14/173 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIETTEE  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++  F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKRSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSK-KRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +  R +  ++  S  + +  +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYSRYQKAAKGGSGGSAEVVAQQPSYVYSCDPYTLAYYGYP  363



>gb|KFV05396.1| RNA-binding protein 47 [Pterocles gutturalis]
Length=587

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 84/172 (49%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G        
Sbjct  261   TIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGTAATPEITQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_008204674.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like [Nasonia 
vitripennis]
Length=515

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 78/134 (58%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+++ +VRNL  +  E
Sbjct  327   YESHKAASLAKRRLGTGRMKVWG-CDIIVDWADPQEEPDEQTMSKVRVLYVRNLTQDCSE  385

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
               L+E FE++GK+E+V   K       F+HF+ R     A++ELN K + G +      +
Sbjct  386   EKLKECFEQYGKIERVKKIKD----YAFIHFEERECAVKAMRELNGKEMGGSH------I  435

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  436   EVSLAKPPSDKKKK  449



>gb|KFV50274.1| RNA-binding protein 47 [Gavia stellata]
Length=567

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 84/172 (49%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G        
Sbjct  261   TIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGATATPEVTQQPNYVYSCDPYTLAYYGYP  362



>gb|EFA74815.1| RNA-binding region RNP-1 domain-containing protein [Polysphondylium 
pallidum PN500]
Length=425

 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 75/138 (54%), Gaps = 15/138 (11%)
 Frame = -2

Query  1639  ASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRELF  1460
             A +A +   S  F +G+    + WA+  QE D+  +  +++ +VRNLP + +   L+++F
Sbjct  183   ADKARKEFASPSFRIGSSCVTVNWADPVQEPDEDVMKNVRVLYVRNLPEQRNSEDLKKVF  242

Query  1459  ERFGKVEKVV----LPKKGNSLVGFVHFDSRLDLDNAIKELNDK--TVPGPNGGPPYKLQ  1298
             E FG +EKV+    +P +     GFVHF+SR   + A+   N++  T  G +      L 
Sbjct  243   EEFGTIEKVIIPVNIPGQQRRDFGFVHFESREAAEEALVRHNNQPITYQGRD------LI  296

Query  1297  VEVARPMDKSKK---RVR  1253
             V  A+PMDK ++   RVR
Sbjct  297   VSFAKPMDKKQRAELRVR  314



>ref|XP_007945339.1| PREDICTED: RNA-binding protein 47 isoform X2 [Orycteropus afer 
afer]
Length=520

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 84/176 (48%), Gaps = 14/176 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  257   TTEDTIKKSFGQFKPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +   R +  +K     +  +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYS-RYQKAAKGGGTAEVVAQQPGYVYSCDPYTLAYYGYP  361



>gb|KFQ64269.1| RNA-binding protein 47 [Pelecanus crispus]
Length=584

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGATATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_009487094.1| PREDICTED: RNA-binding protein 47 isoform X1 [Pelecanus crispus]
Length=590

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGATATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_005501303.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 47 [Columba 
livia]
Length=590

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGATATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_007440203.1| PREDICTED: RNA-binding protein 47-like isoform X4 [Python bivittatus]
Length=593

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 83/172 (48%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKKVFGQFNPGSVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++     +   + +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGGATAAEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_009805963.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 47 [Gavia 
stellata]
Length=565

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 84/172 (49%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G        
Sbjct  261   TIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGATATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_007440200.1| PREDICTED: RNA-binding protein 47-like isoform X1 [Python bivittatus]
 ref|XP_007440201.1| PREDICTED: RNA-binding protein 47-like isoform X2 [Python bivittatus]
 ref|XP_007440202.1| PREDICTED: RNA-binding protein 47-like isoform X3 [Python bivittatus]
Length=594

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 83/172 (48%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKKVFGQFNPGSVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++     +   + +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGGATAAEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_007440204.1| PREDICTED: RNA-binding protein 47-like isoform X5 [Python bivittatus]
Length=525

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 95/198 (48%), Gaps = 18/198 (9%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKKVFGQFNPGSVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP--AVIT--  1136
             L+V +A+P+DK +     ++     +   + +++P  V   DPY  A    P  A+I   
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGGATAAEVTQQPNYVYSCDPYTLAYYGYPYNALIGPN  370

Query  1135  -ERLLRIMRLGIATRYDV  1085
              E  +++    I T+Y +
Sbjct  371   REYFVKVAIPTIGTQYSM  388



>ref|XP_010572766.1| PREDICTED: RNA-binding protein 47 isoform X2 [Haliaeetus leucocephalus]
Length=528

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGATATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_005168416.1| PREDICTED: RNA-binding protein 47 isoform X1 [Danio rerio]
 ref|XP_005168417.1| PREDICTED: RNA-binding protein 47 isoform X1 [Danio rerio]
 ref|XP_009305602.1| PREDICTED: RNA-binding protein 47 isoform X1 [Danio rerio]
Length=601

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 81/176 (46%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  208   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  267

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E  LR+ F +F  G VE+V    K      FVHF SR D   A+  LN   + G    
Sbjct  268   TSEEILRQTFGQFNPGCVERV----KKIRDYAFVHFASRDDAVVAMDNLNGTEIEGS---  320

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                +++V +A+P+DK +     ++   +++     S +   V   DPY  A    P
Sbjct  321   ---RIEVTLAKPVDKEQYTRYQKASKGTAAATTVESTQQSYVYQCDPYTLAYYGYP  373



>ref|XP_010196673.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 47 [Colius 
striatus]
Length=593

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGATVTPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_006629982.1| PREDICTED: RNA-binding protein 47-like isoform X1 [Lepisosteus 
oculatus]
Length=587

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 85/176 (48%), Gaps = 15/176 (9%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  196   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  255

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E  +R++F +F  G VE+V    K      FVHF  R D  NA+ +LN   V G    
Sbjct  256   TSEETIRKIFSQFNPGCVERV----KKIRDYAFVHFTGRDDAVNAMDKLNGSEVEGSC--  309

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 ++V +A+P+DK ++  R +  +K  +  Q+ + +   V   DPY  A    P
Sbjct  310   ----IEVTLAKPVDK-EQYTRYQKAAKGVTPTQE-TPQANYVYQCDPYTLAYYGYP  359



>ref|XP_009487095.1| PREDICTED: RNA-binding protein 47 isoform X2 [Pelecanus crispus]
Length=521

 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGATATPEVTQQPNYVYSCDPYTLAYYGYP  362



>gb|EHJ68984.1| hypothetical protein KGM_20249 [Danaus plexippus]
Length=260

 Score = 68.2 bits (165),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  E  E
Sbjct  37    YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQEITE  95

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
               L+E FER+G VE+V    K      FVHF+ R     A++E++ K + G       +L
Sbjct  96    EALKEEFERYGNVERV----KKIKDYAFVHFEDRDCAVKAMQEIDGKELGGA------RL  145

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  146   EVSLAKPPSDKKKK  159



>ref|NP_001108158.1| RNA-binding protein 47 [Danio rerio]
Length=600

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 81/176 (46%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  208   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  267

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E  LR+ F +F  G VE+V    K      FVHF SR D   A+  LN   + G    
Sbjct  268   TSEEILRQTFGQFNPGCVERV----KKIRDYAFVHFASRDDAVVAMDNLNGTEIEGS---  320

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                +++V +A+P+DK +     ++   +++     S +   V   DPY  A    P
Sbjct  321   ---RIEVTLAKPVDKEQYTRYQKASKGTAAATTVESTQQSYVYQCDPYTLAYYGYP  373



>ref|XP_009502942.1| PREDICTED: RNA-binding protein 47 isoform X1 [Phalacrocorax carbo]
Length=527

 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGATATPEVAQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_007648692.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 47 isoform 
X1 [Cricetulus griseus]
Length=591

 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 82/176 (47%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   TFVEYESHRAAAMARRKLVPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E  ++  F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  257   TTEETIKRSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++     ++ +  +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYSRYQKAAKGGGASAEVVAQQPSYVYSCDPYTLAYYGYP  362



>ref|XP_006629983.1| PREDICTED: RNA-binding protein 47-like isoform X2 [Lepisosteus 
oculatus]
Length=517

 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 85/176 (48%), Gaps = 15/176 (9%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  196   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  255

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E  +R++F +F  G VE+V    K      FVHF  R D  NA+ +LN   V G    
Sbjct  256   TSEETIRKIFSQFNPGCVERV----KKIRDYAFVHFTGRDDAVNAMDKLNGSEVEGSC--  309

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 ++V +A+P+DK ++  R +  +K  +  Q+ + +   V   DPY  A    P
Sbjct  310   ----IEVTLAKPVDK-EQYTRYQKAAKGVTPTQE-TPQANYVYQCDPYTLAYYGYP  359



>ref|XP_005074428.1| PREDICTED: RNA-binding protein 47 isoform X2 [Mesocricetus auratus]
Length=523

 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 83/173 (48%), Gaps = 14/173 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIETTEE  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++  F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKRSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSK-KRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +  R +  ++  S  + +  +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYSRYQKAAKGGSGGSAEVVAQQPSYVYSCDPYTLAYYGYP  363



>gb|KDR22175.1| hypothetical protein L798_02663 [Zootermopsis nevadensis]
Length=652

 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 75/134 (56%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D+  ++K+K+ +VRNL  +  E
Sbjct  297   YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEATMSKVKVLYVRNLTQDCSE  355

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
               L+E FE FGKVE+V   K       F+HF+ R +   A+ ELN K + G        +
Sbjct  356   EKLKESFEAFGKVERVKKIKD----YAFIHFEDRDNAMTAMSELNGKEMGGS------AI  405

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  406   EVSLAKPPSDKKKK  419



>ref|XP_009067462.1| PREDICTED: RNA-binding protein 47, partial [Acanthisitta chloris]
Length=561

 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 83/172 (48%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G        
Sbjct  261   TIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++    +    + +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGAVATSEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|NP_620704.1| RNA-binding protein 47 isoform a [Mus musculus]
 ref|NP_848541.2| RNA-binding protein 47 isoform a [Mus musculus]
 ref|NP_001120854.1| RNA-binding protein 47 isoform a [Mus musculus]
 ref|XP_006504019.1| PREDICTED: RNA-binding protein 47 isoform X1 [Mus musculus]
 ref|XP_006504020.1| PREDICTED: RNA-binding protein 47 isoform X2 [Mus musculus]
 ref|XP_006504021.1| PREDICTED: RNA-binding protein 47 isoform X3 [Mus musculus]
 ref|XP_006504022.1| PREDICTED: RNA-binding protein 47 isoform X4 [Mus musculus]
 ref|XP_006504023.1| PREDICTED: RNA-binding protein 47 isoform X5 [Mus musculus]
 ref|XP_006504024.1| PREDICTED: RNA-binding protein 47 isoform X6 [Mus musculus]
 sp|Q91WT8.1|RBM47_MOUSE RecName: Full=RNA-binding protein 47; AltName: Full=RNA-binding 
motif protein 47 [Mus musculus]
 gb|AAH13481.1| RNA binding motif protein 47 [Mus musculus]
 gb|AAH34195.1| Rbm47 protein [Mus musculus]
 dbj|BAC39524.1| unnamed protein product [Mus musculus]
 dbj|BAE41553.1| unnamed protein product [Mus musculus]
 gb|AAI12903.1| RNA binding motif protein 47 [Mus musculus]
 gb|EDL37760.1| cDNA sequence BC013481, isoform CRA_a [Mus musculus]
 gb|EDL37761.1| cDNA sequence BC013481, isoform CRA_a [Mus musculus]
Length=590

 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 81/172 (47%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIETTEE  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKKSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++      + +  +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYSRYQKAAKGGGGSAEAVAQQPSYVYSCDPYTLAYYGYP  362



>gb|KFP74715.1| RNA-binding protein 47, partial [Acanthisitta chloris]
Length=562

 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 83/172 (48%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G        
Sbjct  261   TIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++    +    + +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGAVATSEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_005168418.1| PREDICTED: RNA-binding protein 47 isoform X2 [Danio rerio]
Length=532

 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 81/176 (46%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  208   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  267

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E  LR+ F +F  G VE+V    K      FVHF SR D   A+  LN   + G    
Sbjct  268   TSEEILRQTFGQFNPGCVERV----KKIRDYAFVHFASRDDAVVAMDNLNGTEIEGS---  320

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                +++V +A+P+DK +     ++   +++     S +   V   DPY  A    P
Sbjct  321   ---RIEVTLAKPVDKEQYTRYQKASKGTAAATTVESTQQSYVYQCDPYTLAYYGYP  373



>ref|XP_011051968.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R isoform 
X5 [Acromyrmex echinatior]
Length=659

 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 76/133 (57%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R  ++    +      + WA+ ++E D++ ++K+++ +VRNL  +  E 
Sbjct  291   YESHKAASLAKRRLSTGRIKVWGCDIIVDWADPQEEPDEQTMSKVRVLYVRNLTQDCSEE  350

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE++GK+E+V   K       F+HF+ R +   A+ ELN K + G +      ++
Sbjct  351   KLKESFEQYGKIERVKKIKD----YAFIHFEDRDNAVKAMNELNGKEMGGSH------IE  400

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  401   VSLAKPPSDKKKK  413



>dbj|BAC29127.1| unnamed protein product [Mus musculus]
Length=590

 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 81/172 (47%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIETTEE  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKKSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++      + +  +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYSRYQKAAKGGGGSAEAVAQQPSYVYSCDPYTLAYYGYP  362



>gb|EFN88129.1| Heterogeneous nuclear ribonucleoprotein Q [Harpegnathos saltator]
Length=649

 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 76/133 (57%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R  ++    +      + WA+ ++E D++ ++K+++ +VRNL  +  E 
Sbjct  285   YESHKAASLAKRRLSTGRIKVWGCDIIVDWADPQEEPDEQTMSKVRVLYVRNLTQDCSEE  344

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE++GK+E+V   K       F+HF+ R +   A+ ELN K + G +      ++
Sbjct  345   KLKESFEQYGKIERVKKIKD----YAFIHFEDRDNAVRAMNELNGKEMGGSH------IE  394

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  395   VSLAKPPSDKKKK  407



>ref|XP_005177731.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform 
X7 [Musca domestica]
Length=558

 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  298   YESHKAASLAKRRLGTGRTKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVTE  356

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       FVHF+ R     A++ LN K V   N      +
Sbjct  357   DKLKEQFEQYGKVERVKKIKD----YAFVHFEDRDSAVVAMRALNGKEVGASN------M  406

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  407   EVSLAKPPSDKKKK  420



>ref|XP_011051967.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R isoform 
X4 [Acromyrmex echinatior]
Length=660

 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 76/133 (57%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R  ++    +      + WA+ ++E D++ ++K+++ +VRNL  +  E 
Sbjct  291   YESHKAASLAKRRLSTGRIKVWGCDIIVDWADPQEEPDEQTMSKVRVLYVRNLTQDCSEE  350

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE++GK+E+V   K       F+HF+ R +   A+ ELN K + G +      ++
Sbjct  351   KLKESFEQYGKIERVKKIKD----YAFIHFEDRDNAVKAMNELNGKEMGGSH------IE  400

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  401   VSLAKPPSDKKKK  413



>ref|XP_005177728.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform 
X4 [Musca domestica]
Length=566

 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 76/134 (57%), Gaps = 13/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  298   YESHKAASLAKRRLGTGRTKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVTE  356

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       FVHF+ R     A++ LN K V   N      +
Sbjct  357   DKLKEQFEQYGKVERVKKIKD----YAFVHFEDRDSAVVAMRALNGKEVGASN------M  406

Query  1300  QVEVARPMDKSKKR  1259
             +V +A+P    KK+
Sbjct  407   EVSLAKPPSDKKKK  420



>ref|XP_011051966.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R isoform 
X3 [Acromyrmex echinatior]
Length=662

 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 76/133 (57%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R  ++    +      + WA+ ++E D++ ++K+++ +VRNL  +  E 
Sbjct  291   YESHKAASLAKRRLSTGRIKVWGCDIIVDWADPQEEPDEQTMSKVRVLYVRNLTQDCSEE  350

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE++GK+E+V   K       F+HF+ R +   A+ ELN K + G +      ++
Sbjct  351   KLKESFEQYGKIERVKKIKD----YAFIHFEDRDNAVKAMNELNGKEMGGSH------IE  400

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  401   VSLAKPPSDKKKK  413



>gb|EZA48292.1| Heterogeneous nuclear ribonucleoprotein Q [Cerapachys biroi]
Length=692

 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 76/133 (57%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R  ++    +      + WA+ ++E D++ ++K+++ +VRNL  +  E 
Sbjct  328   YESHKAASLAKRRLSTGRIKVWGCDIIVDWADPQEEPDEQTMSKVRVLYVRNLTQDCSEE  387

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE++GK+E+V   K       F+HF+ R +   A+ ELN K + G +      ++
Sbjct  388   KLKESFEQYGKIERVKKIKD----YAFIHFEDRDNAVKAMNELNGKEMGGSH------IE  437

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  438   VSLAKPPSDKKKK  450



>ref|XP_011051965.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R isoform 
X2 [Acromyrmex echinatior]
Length=663

 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 76/133 (57%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R  ++    +      + WA+ ++E D++ ++K+++ +VRNL  +  E 
Sbjct  291   YESHKAASLAKRRLSTGRIKVWGCDIIVDWADPQEEPDEQTMSKVRVLYVRNLTQDCSEE  350

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE++GK+E+V   K       F+HF+ R +   A+ ELN K + G +      ++
Sbjct  351   KLKESFEQYGKIERVKKIKD----YAFIHFEDRDNAVKAMNELNGKEMGGSH------IE  400

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  401   VSLAKPPSDKKKK  413



>ref|XP_011051964.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R isoform 
X1 [Acromyrmex echinatior]
Length=663

 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 76/133 (57%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R  ++    +      + WA+ ++E D++ ++K+++ +VRNL  +  E 
Sbjct  291   YESHKAASLAKRRLSTGRIKVWGCDIIVDWADPQEEPDEQTMSKVRVLYVRNLTQDCSEE  350

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE++GK+E+V   K       F+HF+ R +   A+ ELN K + G +      ++
Sbjct  351   KLKESFEQYGKIERVKKIKD----YAFIHFEDRDNAVKAMNELNGKEMGGSH------IE  400

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  401   VSLAKPPSDKKKK  413



>ref|XP_005177733.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform 
X9 [Musca domestica]
Length=536

 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 76/134 (57%), Gaps = 13/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  298   YESHKAASLAKRRLGTGRTKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVTE  356

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       FVHF+ R     A++ LN K V   N      +
Sbjct  357   DKLKEQFEQYGKVERVKKIKD----YAFVHFEDRDSAVVAMRALNGKEVGASN------M  406

Query  1300  QVEVARPMDKSKKR  1259
             +V +A+P    KK+
Sbjct  407   EVSLAKPPSDKKKK  420



>ref|XP_005177734.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform 
X10 [Musca domestica]
Length=536

 Score = 69.3 bits (168),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 76/134 (57%), Gaps = 13/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  298   YESHKAASLAKRRLGTGRTKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVTE  356

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       FVHF+ R     A++ LN K V   N      +
Sbjct  357   DKLKEQFEQYGKVERVKKIKD----YAFVHFEDRDSAVVAMRALNGKEVGASN------M  406

Query  1300  QVEVARPMDKSKKR  1259
             +V +A+P    KK+
Sbjct  407   EVSLAKPPSDKKKK  420



>ref|XP_011051969.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R isoform 
X6 [Acromyrmex echinatior]
Length=658

 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 76/133 (57%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R  ++    +      + WA+ ++E D++ ++K+++ +VRNL  +  E 
Sbjct  291   YESHKAASLAKRRLSTGRIKVWGCDIIVDWADPQEEPDEQTMSKVRVLYVRNLTQDCSEE  350

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE++GK+E+V   K       F+HF+ R +   A+ ELN K + G +      ++
Sbjct  351   KLKESFEQYGKIERVKKIKD----YAFIHFEDRDNAVKAMNELNGKEMGGSH------IE  400

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  401   VSLAKPPSDKKKK  413



>ref|XP_005177732.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform 
X8 [Musca domestica]
Length=544

 Score = 69.3 bits (168),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 76/134 (57%), Gaps = 13/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  298   YESHKAASLAKRRLGTGRTKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVTE  356

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       FVHF+ R     A++ LN K V   N      +
Sbjct  357   DKLKEQFEQYGKVERVKKIKD----YAFVHFEDRDSAVVAMRALNGKEVGASN------M  406

Query  1300  QVEVARPMDKSKKR  1259
             +V +A+P    KK+
Sbjct  407   EVSLAKPPSDKKKK  420



>ref|XP_006787281.1| PREDICTED: RNA-binding protein 47-like isoform X8 [Neolamprologus 
brichardi]
Length=608

 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 81/172 (47%), Gaps = 15/172 (9%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  212   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETSEE  271

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +R++F +F  G VE+V    K      FVHF SR D   A+  LN   V G        
Sbjct  272   TIRQIFSQFNPGCVERV----KKIRDYAFVHFTSRDDAVLAMDNLNGTEVEGSC------  321

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             ++V +A+P+D  K++   +  SK  ++    + +   V   DPY  A    P
Sbjct  322   IEVTLAKPVD--KEQYSRQKASKGGASATSEATQQNYVYQCDPYTLAYYGYP  371



>gb|KFW83873.1| RNA-binding protein 47 [Manacus vitellinus]
Length=594

 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 84/172 (49%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G        
Sbjct  261   TIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGIELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|NP_001005882.1| RNA-binding protein 47 [Rattus norvegicus]
 ref|XP_006251011.1| PREDICTED: RNA-binding protein 47 isoform X1 [Rattus norvegicus]
 ref|XP_006251012.1| PREDICTED: RNA-binding protein 47 isoform X1 [Rattus norvegicus]
 ref|XP_006251013.1| PREDICTED: RNA-binding protein 47 isoform X1 [Rattus norvegicus]
 ref|XP_006251014.1| PREDICTED: RNA-binding protein 47 isoform X1 [Rattus norvegicus]
 ref|XP_006251016.1| PREDICTED: RNA-binding protein 47 isoform X1 [Rattus norvegicus]
 ref|XP_006251017.1| PREDICTED: RNA-binding protein 47 isoform X1 [Rattus norvegicus]
 ref|XP_008768374.1| PREDICTED: RNA-binding protein 47 isoform X1 [Rattus norvegicus]
 sp|Q66H68.1|RBM47_RAT RecName: Full=RNA-binding protein 47; AltName: Full=RNA-binding 
motif protein 47 [Rattus norvegicus]
 gb|AAH81995.1| Hypothetical RNA binding protein RGD1359713 [Rattus norvegicus]
 gb|EDL90047.1| hypothetical RNA binding protein RGD1359713, isoform CRA_a [Rattus 
norvegicus]
 gb|EDL90048.1| hypothetical RNA binding protein RGD1359713, isoform CRA_a [Rattus 
norvegicus]
Length=590

 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 80/172 (47%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIETTEE  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++  F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKRSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++      + +  +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYSRYQKAAKGGGGSAEAVAQQPSYVYSCDPYTLAYYGYP  362



>ref|XP_006787274.1| PREDICTED: RNA-binding protein 47-like isoform X1 [Neolamprologus 
brichardi]
 ref|XP_006787275.1| PREDICTED: RNA-binding protein 47-like isoform X2 [Neolamprologus 
brichardi]
 ref|XP_006787276.1| PREDICTED: RNA-binding protein 47-like isoform X3 [Neolamprologus 
brichardi]
 ref|XP_006787277.1| PREDICTED: RNA-binding protein 47-like isoform X4 [Neolamprologus 
brichardi]
 ref|XP_006787278.1| PREDICTED: RNA-binding protein 47-like isoform X5 [Neolamprologus 
brichardi]
 ref|XP_006787279.1| PREDICTED: RNA-binding protein 47-like isoform X6 [Neolamprologus 
brichardi]
 ref|XP_006787280.1| PREDICTED: RNA-binding protein 47-like isoform X7 [Neolamprologus 
brichardi]
Length=617

 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 81/172 (47%), Gaps = 15/172 (9%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  212   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETSEE  271

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +R++F +F  G VE+V    K      FVHF SR D   A+  LN   V G        
Sbjct  272   TIRQIFSQFNPGCVERV----KKIRDYAFVHFTSRDDAVLAMDNLNGTEVEGSC------  321

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             ++V +A+P+D  K++   +  SK  ++    + +   V   DPY  A    P
Sbjct  322   IEVTLAKPVD--KEQYSRQKASKGGASATSEATQQNYVYQCDPYTLAYYGYP  371



>gb|EFN64303.1| Heterogeneous nuclear ribonucleoprotein Q [Camponotus floridanus]
Length=683

 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 76/133 (57%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R  ++    +      + WA+ ++E D++ ++K+++ +VRNL  +  E 
Sbjct  291   YESHKAASLAKRRLSTGRIKVWGCDIIVDWADPQEEPDEQTMSKVRVLYVRNLTQDCSEE  350

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE++GK+E+V   K       F+HF+ R +   A+ ELN K + G +      ++
Sbjct  351   KLKESFEQYGKIERVKKIKD----YAFIHFEDRDNAVKAMNELNGKEMGGSH------IE  400

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  401   VSLAKPPSDKKKK  413



>gb|ERE91469.1| APOBEC1 complementation factor-like protein [Cricetulus griseus]
Length=538

 Score = 69.3 bits (168),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 82/176 (47%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E  ++  F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  257   TTEETIKRSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++     ++ +  +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYSRYQKAAKGGGASAEVVAQQPSYVYSCDPYTLAYYGYP  362



>ref|XP_005490579.1| PREDICTED: RNA-binding protein 47 isoform X2 [Zonotrichia albicollis]
Length=594

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_005456969.1| PREDICTED: RNA-binding protein 47-like isoform X8 [Oreochromis 
niloticus]
Length=608

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 82/175 (47%), Gaps = 21/175 (12%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  215   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETSEE  274

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +R++F +F  G VE+V    K      FVHF SR D   A+  LN   V G        
Sbjct  275   AIRQIFSQFNPGCVERV----KKIRDYAFVHFTSRDDAVLAMDNLNGTEVEGSC------  324

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEE---VKVSDPYEAAIVALP  1148
             ++V +A+P+DK +      S+ K+S      + EP +   V   DPY  A    P
Sbjct  325   IEVTLAKPVDKEQY-----SRQKASKGGASATSEPTQQNYVYQCDPYTLAYYGYP  374



>gb|EGI66996.1| Heterogeneous nuclear ribonucleoprotein Q [Acromyrmex echinatior]
Length=724

 Score = 69.7 bits (169),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 76/133 (57%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R  ++    +      + WA+ ++E D++ ++K+++ +VRNL  +  E 
Sbjct  338   YESHKAASLAKRRLSTGRIKVWGCDIIVDWADPQEEPDEQTMSKVRVLYVRNLTQDCSEE  397

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E FE++GK+E+V   K       F+HF+ R +   A+ ELN K + G +      ++
Sbjct  398   KLKESFEQYGKIERVKKIKD----YAFIHFEDRDNAVKAMNELNGKEMGGSH------IE  447

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  448   VSLAKPPSDKKKK  460



>ref|XP_003452186.1| PREDICTED: RNA-binding protein 47-like isoform X1 [Oreochromis 
niloticus]
Length=607

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 82/175 (47%), Gaps = 21/175 (12%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  215   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETSEE  274

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +R++F +F  G VE+V    K      FVHF SR D   A+  LN   V G        
Sbjct  275   AIRQIFSQFNPGCVERV----KKIRDYAFVHFTSRDDAVLAMDNLNGTEVEGSC------  324

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEE---VKVSDPYEAAIVALP  1148
             ++V +A+P+DK +      S+ K+S      + EP +   V   DPY  A    P
Sbjct  325   IEVTLAKPVDKEQY-----SRQKASKGGASATSEPTQQNYVYQCDPYTLAYYGYP  374



>ref|XP_005490578.1| PREDICTED: RNA-binding protein 47 isoform X1 [Zonotrichia albicollis]
Length=525

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_009098441.1| PREDICTED: RNA-binding protein 47 isoform X1 [Serinus canaria]
Length=525

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_005456968.1| PREDICTED: RNA-binding protein 47-like isoform X7 [Oreochromis 
niloticus]
Length=615

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 82/175 (47%), Gaps = 21/175 (12%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  215   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETSEE  274

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +R++F +F  G VE+V    K      FVHF SR D   A+  LN   V G        
Sbjct  275   AIRQIFSQFNPGCVERV----KKIRDYAFVHFTSRDDAVLAMDNLNGTEVEGSC------  324

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEE---VKVSDPYEAAIVALP  1148
             ++V +A+P+DK +      S+ K+S      + EP +   V   DPY  A    P
Sbjct  325   IEVTLAKPVDKEQY-----SRQKASKGGASATSEPTQQNYVYQCDPYTLAYYGYP  374



>ref|XP_009098448.1| PREDICTED: RNA-binding protein 47 isoform X2 [Serinus canaria]
Length=594

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_005456963.1| PREDICTED: RNA-binding protein 47-like isoform X2 [Oreochromis 
niloticus]
 ref|XP_005456964.1| PREDICTED: RNA-binding protein 47-like isoform X3 [Oreochromis 
niloticus]
 ref|XP_005456965.1| PREDICTED: RNA-binding protein 47-like isoform X4 [Oreochromis 
niloticus]
 ref|XP_005456966.1| PREDICTED: RNA-binding protein 47-like isoform X5 [Oreochromis 
niloticus]
 ref|XP_005456967.1| PREDICTED: RNA-binding protein 47-like isoform X6 [Oreochromis 
niloticus]
Length=616

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 82/175 (47%), Gaps = 21/175 (12%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  215   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETSEE  274

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +R++F +F  G VE+V    K      FVHF SR D   A+  LN   V G        
Sbjct  275   AIRQIFSQFNPGCVERV----KKIRDYAFVHFTSRDDAVLAMDNLNGTEVEGSC------  324

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEE---VKVSDPYEAAIVALP  1148
             ++V +A+P+DK +      S+ K+S      + EP +   V   DPY  A    P
Sbjct  325   IEVTLAKPVDKEQY-----SRQKASKGGASATSEPTQQNYVYQCDPYTLAYYGYP  374



>ref|XP_003205901.2| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 47 [Meleagris 
gallopavo]
Length=598

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKXRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_005177729.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform 
X5 [Musca domestica]
Length=564

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  298   YESHKAASLAKRRLGTGRTKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVTE  356

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       FVHF+ R     A++ LN K V   N      +
Sbjct  357   DKLKEQFEQYGKVERVKKIKD----YAFVHFEDRDSAVVAMRALNGKEVGASN------M  406

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  407   EVSLAKPPSDKKKK  420



>ref|XP_005415525.1| PREDICTED: RNA-binding protein 47 isoform X2 [Geospiza fortis]
Length=594

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_005415524.1| PREDICTED: RNA-binding protein 47 isoform X1 [Geospiza fortis]
Length=525

 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|NP_001278155.1| RNA-binding protein 47 isoform b [Mus musculus]
 ref|XP_006504025.1| PREDICTED: RNA-binding protein 47 isoform X7 [Mus musculus]
Length=521

 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 82/176 (47%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E  +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  257   TTEETIKKSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++      + +  +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYSRYQKAAKGGGGSAEAVAQQPSYVYSCDPYTLAYYGYP  362



>ref|XP_010020504.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 47 [Nestor 
notabilis]
Length=592

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_005517815.1| PREDICTED: RNA-binding protein 47 isoform X2 [Pseudopodoces humilis]
Length=594

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_002187774.1| PREDICTED: RNA-binding protein 47 isoform 1 [Taeniopygia guttata]
Length=594

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 84/172 (49%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G        
Sbjct  261   TIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_008925726.1| PREDICTED: RNA-binding protein 47 [Manacus vitellinus]
Length=552

 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 84/172 (49%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G        
Sbjct  261   TIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGIELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  362



>gb|KFV80473.1| RNA-binding protein 47, partial [Struthio camelus australis]
Length=558

 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGAELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_001845311.1| heterogeneous nuclear ribonucleoprotein r [Culex quinquefasciatus]
 gb|EDS39987.1| heterogeneous nuclear ribonucleoprotein r [Culex quinquefasciatus]
Length=542

 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 62/106 (58%), Gaps = 10/106 (9%)
 Frame = -2

Query  1576  IQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLRELFERFGKVEKVVLPKKGNSLVGF  1397
             + WA+ ++E D++ ++K+K+ +VRNL  +  E  L+E FE FGKVE+V   K       F
Sbjct  247   VDWADPQEEPDEQTMSKVKVLYVRNLTQDTSEEKLKESFEAFGKVERVKKIKD----YAF  302

Query  1396  VHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEVARPMDKSKKR  1259
             VHF+ R    NA+K+L+ K + G        ++V +A+P    KK+
Sbjct  303   VHFEDRDHAVNAMKDLDGKDINGS------AIEVSLAKPPSDKKKK  342



>ref|XP_010400069.1| PREDICTED: RNA-binding protein 47 isoform X4 [Corvus cornix cornix]
 gb|KFO64960.1| RNA-binding protein 47 [Corvus brachyrhynchos]
Length=597

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_005456971.1| PREDICTED: RNA-binding protein 47-like isoform X10 [Oreochromis 
niloticus]
Length=538

 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 82/175 (47%), Gaps = 21/175 (12%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  215   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETSEE  274

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +R++F +F  G VE+V    K      FVHF SR D   A+  LN   V G        
Sbjct  275   AIRQIFSQFNPGCVERV----KKIRDYAFVHFTSRDDAVLAMDNLNGTEVEGSC------  324

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEE---VKVSDPYEAAIVALP  1148
             ++V +A+P+DK +      S+ K+S      + EP +   V   DPY  A    P
Sbjct  325   IEVTLAKPVDKEQY-----SRQKASKGGASATSEPTQQNYVYQCDPYTLAYYGYP  374



>ref|XP_002096465.1| GE25686 [Drosophila yakuba]
 gb|EDW96177.1| GE25686 [Drosophila yakuba]
Length=747

 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRAYR-LGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A R LGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  333   YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSE  391

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       F+HF+ R     A++ LN K +   N      +
Sbjct  392   DKLKEQFEQYGKVERVKKIKD----YAFIHFEDRDSAVEAMRGLNGKEIGASN------I  441

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  442   EVSLAKPPSDKKKK  455



>ref|XP_010183760.1| PREDICTED: RNA-binding protein 47 [Mesitornis unicolor]
Length=595

 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_005177725.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform 
X1 [Musca domestica]
 ref|XP_005177726.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform 
X2 [Musca domestica]
Length=572

 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 76/134 (57%), Gaps = 13/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  298   YESHKAASLAKRRLGTGRTKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVTE  356

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       FVHF+ R     A++ LN K V   N      +
Sbjct  357   DKLKEQFEQYGKVERVKKIKD----YAFVHFEDRDSAVVAMRALNGKEVGASN------M  406

Query  1300  QVEVARPMDKSKKR  1259
             +V +A+P    KK+
Sbjct  407   EVSLAKPPSDKKKK  420



>ref|XP_010400068.1| PREDICTED: RNA-binding protein 47 isoform X3 [Corvus cornix cornix]
Length=616

 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  217   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  276

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  277   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  330

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  331   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  382



>ref|XP_005517814.1| PREDICTED: RNA-binding protein 47 isoform X1 [Pseudopodoces humilis]
Length=525

 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_005177730.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform 
X6 [Musca domestica]
Length=564

 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  298   YESHKAASLAKRRLGTGRTKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVTE  356

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       FVHF+ R     A++ LN K V   N      +
Sbjct  357   DKLKEQFEQYGKVERVKKIKD----YAFVHFEDRDSAVVAMRALNGKEVGASN------M  406

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  407   EVSLAKPPSDKKKK  420



>ref|XP_010400067.1| PREDICTED: RNA-binding protein 47 isoform X2 [Corvus cornix cornix]
Length=616

 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  216   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  275

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  276   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  329

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  330   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  381



>ref|XP_002072163.1| GK22469 [Drosophila willistoni]
 gb|EDW83149.1| GK22469 [Drosophila willistoni]
Length=731

 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 88/167 (53%), Gaps = 13/167 (8%)
 Frame = -2

Query  1645  QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLR  1469
             +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E+ L+
Sbjct  302   KAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLK  360

Query  1468  ELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEV  1289
             E FE++GKVE+V   K       F+HF+ R     A++ LN K +   N      ++V +
Sbjct  361   EQFEQYGKVERVKKIKD----YAFIHFEDRDSAVEAMRGLNGKEIGASN------IEVSL  410

Query  1288  ARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             A+P    KK+  +  +++    +Q     P  V    P   +++++P
Sbjct  411   AKPPSDKKKK-EEILRARERRMMQMMQTRPGLVGNLSPTHPSMMSMP  456



>ref|XP_004658723.1| PREDICTED: RNA-binding protein 47 isoform X1 [Jaculus jaculus]
Length=600

 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 82/176 (47%), Gaps = 14/176 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  205   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  264

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  265   TTEDTIKKSFGQFNPGCVERV----KKIRDYAFVHFASREDAVHAMNNLNGTELDGSC--  318

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +   R +  +K         ++P  V   DPY  A    P
Sbjct  319   ----LEVTLAKPVDKEQYS-RYQKAAKGGGAADVSPQQPSYVYSCDPYTLAYYGYP  369



>ref|XP_001954532.1| GF16693 [Drosophila ananassae]
 gb|EDV43093.1| GF16693 [Drosophila ananassae]
Length=710

 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  298   YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSE  356

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       F+HF+ R     A++ LN K +   N      +
Sbjct  357   DKLKEHFEQYGKVERVKKIKD----YAFIHFEDRDSAVEAMRGLNGKEIGASN------I  406

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  407   EVSLAKPPSDKKKK  420



>ref|XP_005045274.1| PREDICTED: RNA-binding protein 47 isoform X5 [Ficedula albicollis]
 ref|XP_005045275.1| PREDICTED: RNA-binding protein 47 isoform X6 [Ficedula albicollis]
 ref|XP_005045276.1| PREDICTED: RNA-binding protein 47 isoform X7 [Ficedula albicollis]
 ref|XP_005045277.1| PREDICTED: RNA-binding protein 47 isoform X8 [Ficedula albicollis]
 ref|XP_005045278.1| PREDICTED: RNA-binding protein 47 isoform X9 [Ficedula albicollis]
 ref|XP_005045279.1| PREDICTED: RNA-binding protein 47 isoform X10 [Ficedula albicollis]
Length=595

 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_008639610.1| PREDICTED: RNA-binding protein 47 isoform X2 [Corvus brachyrhynchos]
Length=528

 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_008639609.1| PREDICTED: RNA-binding protein 47 isoform X1 [Corvus brachyrhynchos]
Length=617

 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 84/172 (49%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  221   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  280

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G        
Sbjct  281   TIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC------  330

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  331   LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  382



>ref|XP_005177727.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform 
X3 [Musca domestica]
Length=572

 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  298   YESHKAASLAKRRLGTGRTKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVTE  356

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       FVHF+ R     A++ LN K V   N      +
Sbjct  357   DKLKEQFEQYGKVERVKKIKD----YAFVHFEDRDSAVVAMRALNGKEVGASN------M  406

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  407   EVSLAKPPSDKKKK  420



>ref|XP_006787282.1| PREDICTED: RNA-binding protein 47-like isoform X9 [Neolamprologus 
brichardi]
Length=547

 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 81/172 (47%), Gaps = 15/172 (9%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  212   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETSEE  271

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +R++F +F  G VE+V    K      FVHF SR D   A+  LN   V G        
Sbjct  272   TIRQIFSQFNPGCVERV----KKIRDYAFVHFTSRDDAVLAMDNLNGTEVEGSC------  321

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             ++V +A+P+D  K++   +  SK  ++    + +   V   DPY  A    P
Sbjct  322   IEVTLAKPVD--KEQYSRQKASKGGASATSEATQQNYVYQCDPYTLAYYGYP  371



>ref|XP_010400066.1| PREDICTED: RNA-binding protein 47 isoform X1 [Corvus cornix cornix]
Length=617

 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  217   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  276

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  277   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  330

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  331   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  382



>ref|XP_004905764.1| PREDICTED: RNA-binding protein 47 isoform X6 [Heterocephalus 
glaber]
Length=584

 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 84/176 (48%), Gaps = 14/176 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  193   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  252

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  253   TTEDTIKKSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMSNLNGTELEGSC--  306

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK ++  R +  +K     +  ++ P  V   DPY  A    P
Sbjct  307   ----LEVTLAKPVDK-EQYSRYQKAAKGGGVAEAVAQPPSYVYSCDPYTLAYYGYP  357



>gb|KFQ36669.1| RNA-binding protein 47, partial [Mesitornis unicolor]
Length=559

 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 84/172 (49%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G        
Sbjct  261   TIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_004905759.1| PREDICTED: RNA-binding protein 47 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004905760.1| PREDICTED: RNA-binding protein 47 isoform X2 [Heterocephalus 
glaber]
 ref|XP_004905761.1| PREDICTED: RNA-binding protein 47 isoform X3 [Heterocephalus 
glaber]
 ref|XP_004905762.1| PREDICTED: RNA-binding protein 47 isoform X4 [Heterocephalus 
glaber]
 ref|XP_004905763.1| PREDICTED: RNA-binding protein 47 isoform X5 [Heterocephalus 
glaber]
 gb|EHB16200.1| RNA-binding protein 47 [Heterocephalus glaber]
Length=585

 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 84/176 (48%), Gaps = 14/176 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  193   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  252

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  253   TTEDTIKKSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMSNLNGTELEGSC--  306

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK ++  R +  +K     +  ++ P  V   DPY  A    P
Sbjct  307   ----LEVTLAKPVDK-EQYSRYQKAAKGGGVAEAVAQPPSYVYSCDPYTLAYYGYP  357



>ref|XP_005045273.1| PREDICTED: RNA-binding protein 47 isoform X4 [Ficedula albicollis]
Length=610

 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  212   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  271

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  272   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  325

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  326   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  377



>ref|XP_004396198.1| PREDICTED: RNA-binding protein 47 isoform 3 [Odobenus rosmarus 
divergens]
Length=544

 Score = 68.9 bits (167),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 83/176 (47%), Gaps = 14/176 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  159   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  218

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  219   TTEDTIKKSFGQFNPGCVERV----KKIRDYAFVHFVSREDAVHAMNNLNGTELEGSC--  272

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +   R +  +K     +   ++P  V   DPY  A    P
Sbjct  273   ----LEVTLAKPVDKEQYS-RYQKAAKGGGAAEVAVQQPSYVYSCDPYTLAYYGYP  323



>ref|NP_001262781.1| syncrip, isoform O [Drosophila melanogaster]
 gb|AGB96161.1| syncrip, isoform O [Drosophila melanogaster]
Length=611

 Score = 68.9 bits (167),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  337   YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSE  395

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       F+HF+ R     A++ LN K +   N      +
Sbjct  396   DKLKEQFEQYGKVERVKKIKD----YAFIHFEDRDSAVEAMRGLNGKEIGASN------I  445

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  446   EVSLAKPPSDKKKK  459



>ref|XP_005045270.1| PREDICTED: RNA-binding protein 47 isoform X1 [Ficedula albicollis]
 ref|XP_005045271.1| PREDICTED: RNA-binding protein 47 isoform X2 [Ficedula albicollis]
 ref|XP_005045272.1| PREDICTED: RNA-binding protein 47 isoform X3 [Ficedula albicollis]
Length=615

 Score = 68.9 bits (167),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  217   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  276

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  277   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  330

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  331   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATSEVTQQPNYVYSCDPYTLAYYGYP  382



>ref|XP_005456970.1| PREDICTED: RNA-binding protein 47-like isoform X9 [Oreochromis 
niloticus]
Length=546

 Score = 68.9 bits (167),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 82/175 (47%), Gaps = 21/175 (12%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  215   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETSEE  274

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +R++F +F  G VE+V    K      FVHF SR D   A+  LN   V G        
Sbjct  275   AIRQIFSQFNPGCVERV----KKIRDYAFVHFTSRDDAVLAMDNLNGTEVEGSC------  324

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEE---VKVSDPYEAAIVALP  1148
             ++V +A+P+DK +      S+ K+S      + EP +   V   DPY  A    P
Sbjct  325   IEVTLAKPVDKEQY-----SRQKASKGGASATSEPTQQNYVYQCDPYTLAYYGYP  374



>ref|XP_005392007.1| PREDICTED: RNA-binding protein 47 isoform X1 [Chinchilla lanigera]
 ref|XP_005392008.1| PREDICTED: RNA-binding protein 47 isoform X2 [Chinchilla lanigera]
 ref|XP_005392009.1| PREDICTED: RNA-binding protein 47 isoform X3 [Chinchilla lanigera]
 ref|XP_005392010.1| PREDICTED: RNA-binding protein 47 isoform X4 [Chinchilla lanigera]
 ref|XP_005392011.1| PREDICTED: RNA-binding protein 47 isoform X5 [Chinchilla lanigera]
 ref|XP_005392012.1| PREDICTED: RNA-binding protein 47 isoform X6 [Chinchilla lanigera]
 ref|XP_005392013.1| PREDICTED: RNA-binding protein 47 isoform X7 [Chinchilla lanigera]
Length=591

 Score = 68.9 bits (167),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 82/176 (47%), Gaps = 14/176 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ +++ F +F  G VE+V    K      FVHF SR D   A+  LN   + G    
Sbjct  257   TTEDTIKKSFGQFNPGCVERV----KKIRDYAFVHFASREDAVQAMNNLNGTELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +   R +  +K     +  ++ P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYS-RYQKAAKGGGVAEAAAQSPSYVYSCDPYTLAYYGYP  361



>ref|XP_005392014.1| PREDICTED: RNA-binding protein 47 isoform X8 [Chinchilla lanigera]
Length=590

 Score = 68.9 bits (167),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 82/176 (47%), Gaps = 14/176 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ +++ F +F  G VE+V    K      FVHF SR D   A+  LN   + G    
Sbjct  257   TTEDTIKKSFGQFNPGCVERV----KKIRDYAFVHFASREDAVQAMNNLNGTELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +   R +  +K     +  ++ P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYS-RYQKAAKGGGVAEAAAQSPSYVYSCDPYTLAYYGYP  361



>ref|XP_003699450.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like [Megachile 
rotundata]
Length=664

 Score = 68.9 bits (167),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 76/133 (57%), Gaps = 12/133 (9%)
 Frame = -2

Query  1654  YQS-QAASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S +AAS A R  ++    +      + WA+ ++E D++ ++K+++ +V+NL  +  E 
Sbjct  294   YESHKAASLAKRRLSTGRIKVWGCDIIVDWADPQEEPDEQTMSKVRVLYVKNLTQDCSEE  353

Query  1477  YLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQ  1298
              L+E+FE++G +E+V   K       FVHF+ R +   A+ ELN K + G +      ++
Sbjct  354   KLKEVFEQYGNIERVKKIKD----YAFVHFEERDNAVKAMNELNGKEIGGSH------IE  403

Query  1297  VEVAR-PMDKSKK  1262
             V +A+ P DK KK
Sbjct  404   VSLAKPPSDKKKK  416



>ref|XP_005359335.1| PREDICTED: RNA-binding protein 47 isoform X1 [Microtus ochrogaster]
Length=591

 Score = 68.9 bits (167),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 79/172 (46%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIETTEE  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++  F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKRSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++        +  +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYSRYQKAAKGGGGTAEVVAQQPSYVYSCDPYTLAYYGYP  362



>ref|XP_010153888.1| PREDICTED: RNA-binding protein 47 isoform X2 [Eurypyga helias]
Length=594

 Score = 68.9 bits (167),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_004658724.1| PREDICTED: RNA-binding protein 47 isoform X2 [Jaculus jaculus]
Length=531

 Score = 68.6 bits (166),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 82/176 (47%), Gaps = 14/176 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  205   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  264

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  265   TTEDTIKKSFGQFNPGCVERV----KKIRDYAFVHFASREDAVHAMNNLNGTELDGSC--  318

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +   R +  +K         ++P  V   DPY  A    P
Sbjct  319   ----LEVTLAKPVDKEQYS-RYQKAAKGGGAADVSPQQPSYVYSCDPYTLAYYGYP  369



>ref|XP_002709446.1| PREDICTED: RNA-binding protein 47 isoform X1 [Oryctolagus cuniculus]
 ref|XP_008273509.1| PREDICTED: RNA-binding protein 47 isoform X1 [Oryctolagus cuniculus]
 ref|XP_008273515.1| PREDICTED: RNA-binding protein 47 isoform X1 [Oryctolagus cuniculus]
Length=591

 Score = 68.9 bits (167),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 83/176 (47%), Gaps = 14/176 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  198   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  257

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ +++ F +F  G VE+V    K      FVHF SR D   A+  LN   + G    
Sbjct  258   TTEDTIKKSFGQFNPGCVERV----KKIRDYAFVHFASREDAVRAMNSLNGTELEGSC--  311

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +   R +  +K  +  +  ++ P  V   DPY  A    P
Sbjct  312   ----LEVTLAKPVDKEQYS-RYQKAAKGGAVAEAAAQPPSYVYSCDPYTLAYYGYP  362



>ref|XP_004936167.1| PREDICTED: RNA-binding protein 47 isoform X6 [Gallus gallus]
Length=645

 Score = 68.9 bits (167),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  245   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  304

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  305   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  358

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  359   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  410



>gb|KFP50159.1| RNA-binding protein 47 [Cathartes aura]
Length=575

 Score = 68.6 bits (166),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_008273521.1| PREDICTED: RNA-binding protein 47 isoform X2 [Oryctolagus cuniculus]
Length=590

 Score = 68.6 bits (166),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 83/176 (47%), Gaps = 14/176 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  198   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  257

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ +++ F +F  G VE+V    K      FVHF SR D   A+  LN   + G    
Sbjct  258   TTEDTIKKSFGQFNPGCVERV----KKIRDYAFVHFASREDAVRAMNSLNGTELEGSC--  311

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +   R +  +K  +  +  ++ P  V   DPY  A    P
Sbjct  312   ----LEVTLAKPVDKEQYS-RYQKAAKGGAVAEAAAQPPSYVYSCDPYTLAYYGYP  362



>ref|XP_009639590.1| PREDICTED: RNA-binding protein 47 [Egretta garzetta]
Length=541

 Score = 68.6 bits (166),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_004936165.1| PREDICTED: RNA-binding protein 47 isoform X4 [Gallus gallus]
Length=675

 Score = 68.9 bits (167),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  276   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  335

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  336   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  389

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  390   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  441



>ref|XP_010153887.1| PREDICTED: RNA-binding protein 47 isoform X1 [Eurypyga helias]
Length=525

 Score = 68.6 bits (166),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_002001097.1| GI10594 [Drosophila mojavensis]
 gb|EDW16558.1| GI10594 [Drosophila mojavensis]
Length=721

 Score = 68.9 bits (167),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 74/130 (57%), Gaps = 13/130 (10%)
 Frame = -2

Query  1645  QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADENYLR  1469
             +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E+ L+
Sbjct  358   KAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVTEDKLK  416

Query  1468  ELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKLQVEV  1289
             E FE++GKVE+V   K       F+HF+ R     A++ LN K V   N      ++V +
Sbjct  417   EQFEQYGKVERVKKIKD----YAFIHFEDRDSAVEAMRGLNGKEVGASN------IEVSL  466

Query  1288  AR-PMDKSKK  1262
             A+ P DK KK
Sbjct  467   AKPPSDKKKK  476



>ref|XP_009570356.1| PREDICTED: RNA-binding protein 47 isoform X2 [Fulmarus glacialis]
 gb|KFV99614.1| RNA-binding protein 47 [Fulmarus glacialis]
Length=589

 Score = 68.6 bits (166),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_004936164.1| PREDICTED: RNA-binding protein 47 isoform X3 [Gallus gallus]
Length=676

 Score = 68.9 bits (167),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  276   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  335

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  336   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  389

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  390   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  441



>ref|XP_001979385.1| GG24121 [Drosophila erecta]
 gb|EDV48343.1| GG24121 [Drosophila erecta]
Length=666

 Score = 68.9 bits (167),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  300   YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSE  358

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       F+HF+ R     A++ LN K +   N      +
Sbjct  359   DKLKEQFEQYGKVERVKKIKD----YAFIHFEDRDSAVEAMRGLNGKEIGASN------I  408

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  409   EVSLAKPPSDKKKK  422



>ref|XP_005149171.1| PREDICTED: RNA-binding protein 47 isoform X2 [Melopsittacus undulatus]
Length=596

 Score = 68.6 bits (166),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_009472544.1| PREDICTED: RNA-binding protein 47, partial [Nipponia nippon]
Length=566

 Score = 68.6 bits (166),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>gb|KFW08946.1| RNA-binding protein 47 [Eurypyga helias]
Length=591

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_009671747.1| PREDICTED: RNA-binding protein 47 [Struthio camelus australis]
Length=703

 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 84/172 (49%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  228   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  287

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G        
Sbjct  288   TIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGAELEGSC------  337

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  338   LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  389



>ref|XP_004384711.1| PREDICTED: RNA-binding protein 47 isoform 1 [Trichechus manatus 
latirostris]
Length=592

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 84/176 (48%), Gaps = 14/176 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  196   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  255

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  256   TTEDTIKKSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC--  309

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +   R +  +K     +  +++P  V   DPY  A    P
Sbjct  310   ----LEVTLAKPVDKEQYS-RYQKAAKGGGGAEAATQQPSYVYSCDPYTLAYYGYP  360



>ref|NP_001262784.1| syncrip, isoform R [Drosophila melanogaster]
 gb|AGB96164.1| syncrip, isoform R [Drosophila melanogaster]
Length=569

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  295   YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSE  353

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       F+HF+ R     A++ LN K +   N      +
Sbjct  354   DKLKEQFEQYGKVERVKKIKD----YAFIHFEDRDSAVEAMRGLNGKEIGASN------I  403

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  404   EVSLAKPPSDKKKK  417



>gb|KFR07818.1| RNA-binding protein 47, partial [Nipponia nippon]
Length=544

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_010114752.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 47 [Chlamydotis 
macqueenii]
Length=601

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYALAYYGYP  362



>gb|AAO39657.1| AT01548p, partial [Drosophila melanogaster]
Length=626

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  256   YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSE  314

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       F+HF+ R     A++ LN K +   N      +
Sbjct  315   DKLKEQFEQYGKVERVKKIKD----YAFIHFEDRDSAVEAMRGLNGKEIGASN------I  364

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  365   EVSLAKPPSDKKKK  378



>ref|XP_009933807.1| PREDICTED: RNA-binding protein 47 isoform X2 [Opisthocomus hoazin]
 gb|KFR11437.1| RNA-binding protein 47 [Opisthocomus hoazin]
Length=593

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>dbj|BAE25115.1| unnamed protein product [Mus musculus]
Length=377

 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 81/172 (47%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIETTEE  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G        
Sbjct  261   TIKKSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++      + +  +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYSRYQKAAKGGGGSAEAVAQQPSYVYSCDPYTLAYYGYP  362



>ref|XP_004936166.1| PREDICTED: RNA-binding protein 47 isoform X5 [Gallus gallus]
Length=658

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 84/172 (49%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  262   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  321

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G        
Sbjct  322   TIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC------  371

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  372   LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  423



>ref|XP_008490018.1| PREDICTED: RNA-binding protein 47 isoform X2 [Calypte anna]
 gb|KFO99321.1| RNA-binding protein 47 [Calypte anna]
Length=595

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 84/172 (49%), Gaps = 13/172 (8%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E+
Sbjct  201   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTED  260

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G        
Sbjct  261   TIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC------  310

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_009945730.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 47 [Leptosomus 
discolor]
Length=597

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVAQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_003641292.1| PREDICTED: RNA-binding protein 47 isoformX2 [Gallus gallus]
 ref|XP_004936168.1| PREDICTED: RNA-binding protein 47 isoform X7 [Gallus gallus]
Length=597

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_009883253.1| PREDICTED: RNA-binding protein 47 isoform X2 [Charadrius vociferus]
 gb|KGL93201.1| RNA-binding protein 47 [Charadrius vociferus]
Length=597

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_010296653.1| PREDICTED: RNA-binding protein 47 isoform X2 [Balearica regulorum 
gibbericeps]
 gb|KFO04188.1| RNA-binding protein 47 [Balearica regulorum gibbericeps]
Length=597

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|NP_001262776.1| syncrip, isoform I [Drosophila melanogaster]
 gb|AGB96156.1| syncrip, isoform I [Drosophila melanogaster]
Length=603

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  329   YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSE  387

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       F+HF+ R     A++ LN K +   N      +
Sbjct  388   DKLKEQFEQYGKVERVKKIKD----YAFIHFEDRDSAVEAMRGLNGKEIGASN------I  437

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  438   EVSLAKPPSDKKKK  451



>ref|NP_732556.1| syncrip, isoform D [Drosophila melanogaster]
 gb|AAF55805.2| syncrip, isoform D [Drosophila melanogaster]
Length=707

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  337   YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSE  395

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       F+HF+ R     A++ LN K +   N      +
Sbjct  396   DKLKEQFEQYGKVERVKKIKD----YAFIHFEDRDSAVEAMRGLNGKEIGASN------I  445

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  446   EVSLAKPPSDKKKK  459



>ref|XP_005030905.1| PREDICTED: RNA-binding protein 47 [Anas platyrhynchos]
Length=626

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  245   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  304

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  305   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  358

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  359   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVAQQPNYVYSCDPYTLAYYGYP  410



>gb|EHJ70861.1| hypothetical protein KGM_04943 [Danaus plexippus]
Length=668

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  E  E
Sbjct  348   YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQEITE  406

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
               L+E FER+G VE+V   K       FVHF+ R     A++E++ K + G       +L
Sbjct  407   EALKEEFERYGNVERVKKIKD----YAFVHFEDRDCAVKAMQEIDGKELGGA------RL  456

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  457   EVSLAKPPSDKKKK  470



>ref|XP_010171808.1| PREDICTED: RNA-binding protein 47 [Caprimulgus carolinensis]
Length=535

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|NP_650913.2| syncrip, isoform B [Drosophila melanogaster]
 ref|NP_001097848.2| syncrip, isoform L [Drosophila melanogaster]
 gb|AAN13835.2| syncrip, isoform B [Drosophila melanogaster]
 gb|ABW08710.2| syncrip, isoform L [Drosophila melanogaster]
Length=711

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  295   YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSE  353

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       F+HF+ R     A++ LN K +   N      +
Sbjct  354   DKLKEQFEQYGKVERVKKIKD----YAFIHFEDRDSAVEAMRGLNGKEIGASN------I  403

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  404   EVSLAKPPSDKKKK  417



>gb|KFZ63682.1| RNA-binding protein 47, partial [Caprimulgus carolinensis]
Length=531

 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_006759379.1| PREDICTED: RNA-binding protein 47 isoform X7 [Myotis davidii]
Length=590

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 85/177 (48%), Gaps = 14/177 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFASREDAVHAMNHLNGTELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSK-KRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +  R +  ++   ++      ++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYSRYQKAAKGGGAAEAAAVQQQPSYVYSCDPYTLAYYGYP  363



>ref|XP_009933806.1| PREDICTED: RNA-binding protein 47 isoform X1 [Opisthocomus hoazin]
Length=524

 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_002043435.1| GM23135 [Drosophila sechellia]
 gb|EDW49619.1| GM23135 [Drosophila sechellia]
Length=745

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  337   YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSE  395

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       F+HF+ R     A++ LN K +   N      +
Sbjct  396   DKLKEQFEQYGKVERVKKIKD----YAFIHFEDRDSAVEAMRGLNGKEIGASN------I  445

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  446   EVSLAKPPSDKKKK  459



>ref|XP_006759373.1| PREDICTED: RNA-binding protein 47 isoform X1 [Myotis davidii]
 ref|XP_006759374.1| PREDICTED: RNA-binding protein 47 isoform X2 [Myotis davidii]
 ref|XP_006759375.1| PREDICTED: RNA-binding protein 47 isoform X3 [Myotis davidii]
 ref|XP_006759376.1| PREDICTED: RNA-binding protein 47 isoform X4 [Myotis davidii]
 ref|XP_006759377.1| PREDICTED: RNA-binding protein 47 isoform X5 [Myotis davidii]
 ref|XP_006759378.1| PREDICTED: RNA-binding protein 47 isoform X6 [Myotis davidii]
Length=591

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 85/177 (48%), Gaps = 14/177 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFASREDAVHAMNHLNGTELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSK-KRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +  R +  ++   ++      ++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYSRYQKAAKGGGAAEAAAVQQQPSYVYSCDPYTLAYYGYP  363



>ref|XP_006759380.1| PREDICTED: RNA-binding protein 47 isoform X8 [Myotis davidii]
Length=522

 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 85/177 (48%), Gaps = 14/177 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFASREDAVHAMNHLNGTELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSK-KRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +  R +  ++   ++      ++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYSRYQKAAKGGGAAEAAAVQQQPSYVYSCDPYTLAYYGYP  363



>gb|KFQ02577.1| RNA-binding protein 47 [Leptosomus discolor]
Length=587

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVAQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_004384712.1| PREDICTED: RNA-binding protein 47 isoform 2 [Trichechus manatus 
latirostris]
Length=523

 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 84/176 (48%), Gaps = 14/176 (8%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  196   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  255

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ +++ F +F  G VE+V    K      FVHF SR D  +A+  LN   + G    
Sbjct  256   TTEDTIKKSFGQFNPGCVERV----KKIRDYAFVHFTSREDAVHAMNNLNGTELEGSC--  309

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +   R +  +K     +  +++P  V   DPY  A    P
Sbjct  310   ----LEVTLAKPVDKEQYS-RYQKAAKGGGGAEAATQQPSYVYSCDPYTLAYYGYP  360



>ref|XP_004564397.1| PREDICTED: RNA-binding protein 47-like isoform X7 [Maylandia 
zebra]
Length=608

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 80/172 (47%), Gaps = 15/172 (9%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  212   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETSEE  271

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +R++F +F  G VE+V    K      FVHF SR D   A+  LN   V G        
Sbjct  272   TIRQIFSQFNPGCVERV----KKIRDYAFVHFTSRDDAVLAMDNLNGTEVEGSC------  321

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             ++V +A+P+D  K++   +  SK  +     + +   V   DPY  A    P
Sbjct  322   IEVTLAKPVD--KEQYSRQKASKGGAPATSEATQQNYVYQCDPYTLAYYGYP  371



>ref|XP_010296652.1| PREDICTED: RNA-binding protein 47 isoform X1 [Balearica regulorum 
gibbericeps]
Length=528

 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_009883252.1| PREDICTED: RNA-binding protein 47 isoform X1 [Charadrius vociferus]
Length=528

 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 13/176 (7%)
 Frame = -2

Query  1666  SLQNYQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSE  1490
             +   Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E
Sbjct  197   AFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIE  256

Query  1489  ADENYLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGG  1316
               E+ ++++F +F  G VE+V    K      FVHF +R D  +A+  LN   + G    
Sbjct  257   TTEDTIKKVFGQFNPGCVERV----KKIRDYAFVHFTTREDAIHAMNNLNGVELEGSC--  310

Query  1315  PPYKLQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
                 L+V +A+P+DK +     ++    ++   + +++P  V   DPY  A    P
Sbjct  311   ----LEVTLAKPVDKEQYTRYQKAAKGGAAATPEVTQQPNYVYSCDPYTLAYYGYP  362



>ref|XP_005928322.1| PREDICTED: RNA-binding protein 47-like isoform X7 [Haplochromis 
burtoni]
Length=610

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 80/172 (47%), Gaps = 15/172 (9%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  212   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETSEE  271

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +R++F +F  G VE+V    K      FVHF SR D   A+  LN   V G        
Sbjct  272   TIRQIFSQFNPGCVERV----KKIRDYAFVHFTSRDDAVLAMDNLNGTEVEGSC------  321

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             ++V +A+P+D  K++   +  SK  +     + +   V   DPY  A    P
Sbjct  322   IEVTLAKPVD--KEQYSRQKASKGGAPATSEATQQNYVYQCDPYTLAYYGYP  371



>ref|XP_005741168.1| PREDICTED: RNA-binding protein 47-like isoform X9 [Pundamilia 
nyererei]
Length=611

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 80/172 (47%), Gaps = 15/172 (9%)
 Frame = -2

Query  1654  YQSQ-AASRAYRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADEN  1478
             Y+S  AA+ A R        L     A+ WAE E ++D+  +  +KI +VRNL  E  E 
Sbjct  212   YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETSEE  271

Query  1477  YLRELFERF--GKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYK  1304
              +R++F +F  G VE+V    K      FVHF SR D   A+  LN   V G        
Sbjct  272   TIRQIFSQFNPGCVERV----KKIRDYAFVHFTSRDDAVLAMDNLNGTEVEGSC------  321

Query  1303  LQVEVARPMDKSKKRVRDESQSKSSSNIQKHSKEPEEVKVSDPYEAAIVALP  1148
             ++V +A+P+D  K++   +  SK  +     + +   V   DPY  A    P
Sbjct  322   IEVTLAKPVD--KEQYSRQKASKGGAPATSEATQQNYVYQCDPYTLAYYGYP  371



>ref|NP_732555.1| syncrip, isoform E [Drosophila melanogaster]
 gb|AAN13831.1| syncrip, isoform E [Drosophila melanogaster]
Length=571

 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -2

Query  1654  YQS-QAASRA-YRLGTSSEFLLGNLHPAIQWAEEEQEIDQKELAKIKIAFVRNLPSEADE  1481
             Y+S +AAS A  RLGT    + G     + WA+ ++E D++ ++K+K+ +VRNL  +  E
Sbjct  337   YESHKAASLAKRRLGTGRIKVWG-CDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSE  395

Query  1480  NYLRELFERFGKVEKVVLPKKGNSLVGFVHFDSRLDLDNAIKELNDKTVPGPNGGPPYKL  1301
             + L+E FE++GKVE+V   K       F+HF+ R     A++ LN K +   N      +
Sbjct  396   DKLKEQFEQYGKVERVKKIKD----YAFIHFEDRDSAVEAMRGLNGKEIGASN------I  445

Query  1300  QVEVAR-PMDKSKK  1262
             +V +A+ P DK KK
Sbjct  446   EVSLAKPPSDKKKK  459



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5658462699372