BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24942_g1_i6 len=1307 path=[14472:0-203 18444:204-207 18448:208-208
12680:209-263 14812:264-279 14828:280-330 14879:331-346
14895:347-426 14975:427-512 15061:513-591 15139:592-610
12812:611-653 15200:654-673 15220:674-723 15269:724-877
12235:878-905 15450:906-938 15483:939-994 15538:995-1306]

Length=1307
                                                                      Score     E

ref|XP_009591545.1|  PREDICTED: glutathione S-transferase TCHQD i...    434   8e-148   
ref|XP_009591543.1|  PREDICTED: glutathione S-transferase TCHQD i...    434   8e-148   
ref|XP_009782495.1|  PREDICTED: glutathione S-transferase TCHQD         432   2e-147   
ref|XP_006357337.1|  PREDICTED: glutathione S-transferase TCHQD-like    426   6e-145   
ref|XP_004237364.1|  PREDICTED: glutathione S-transferase TCHQD         422   2e-143   
emb|CDP11933.1|  unnamed protein product                                410   1e-138   
ref|XP_006434293.1|  hypothetical protein CICLE_v10002166mg             396   5e-133   
ref|XP_011002441.1|  PREDICTED: glutathione S-transferase TCHQD         393   7e-132   
ref|XP_006472858.1|  PREDICTED: glutathione S-transferase TCHQD-l...    392   2e-131   
gb|KDP32864.1|  hypothetical protein JCGZ_12156                         391   3e-131   
ref|XP_002306652.1|  tetrachloro-p-hydroquinone reductive dehalog...    389   2e-130   Populus trichocarpa [western balsam poplar]
ref|XP_008444209.1|  PREDICTED: glutathione S-transferase TCHQD         389   3e-130   
ref|XP_002520306.1|  ganglioside-induced differentiation-associat...    388   6e-130   Ricinus communis
ref|XP_004142639.1|  PREDICTED: glutathione S-transferase TCHQD-l...    386   3e-129   
ref|XP_011102151.1|  PREDICTED: glutathione S-transferase TCHQD         384   3e-128   
gb|KEH35352.1|  glutathione S-transferase, amino-terminal domain ...    380   6e-127   
ref|XP_010055964.1|  PREDICTED: glutathione S-transferase TCHQD-l...    379   1e-126   
ref|XP_007019224.1|  Glutathione S-transferase family protein           379   2e-126   
ref|XP_010087184.1|  Glutathione S-transferase TCHQD                    378   4e-126   
ref|XP_004502542.1|  PREDICTED: glutathione S-transferase TCHQD-like    378   5e-126   
ref|XP_010678905.1|  PREDICTED: glutathione S-transferase TCHQD i...    377   2e-125   
ref|XP_007137478.1|  hypothetical protein PHAVU_009G130200g             376   2e-125   
ref|XP_003526655.1|  PREDICTED: glutathione S-transferase TCHQD-like    374   1e-124   
ref|XP_007223128.1|  hypothetical protein PRUPE_ppa010018mg             373   5e-124   
ref|XP_002285883.1|  PREDICTED: glutathione S-transferase TCHQD         372   2e-123   Vitis vinifera
ref|XP_010537355.1|  PREDICTED: glutathione S-transferase TCHQD         370   6e-123   
ref|XP_010023524.1|  PREDICTED: glutathione S-transferase TCHQD-l...    367   2e-121   
ref|XP_010070592.1|  PREDICTED: glutathione S-transferase TCHQD-l...    366   5e-121   
gb|EYU32495.1|  hypothetical protein MIMGU_mgv1a026583mg                365   6e-121   
ref|XP_003542060.1|  PREDICTED: glutathione S-transferase TCHQD-l...    365   6e-121   
ref|XP_007161431.1|  hypothetical protein PHAVU_001G068100g             364   1e-120   
ref|NP_177853.1|  glutathione S-transferase TCHQD                       364   1e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009591546.1|  PREDICTED: glutathione S-transferase TCHQD i...    362   3e-120   
ref|XP_010046842.1|  PREDICTED: glutathione S-transferase TCHQD-like    363   3e-120   
ref|XP_010416662.1|  PREDICTED: glutathione S-transferase TCHQD-like    362   5e-120   
emb|CDX88356.1|  BnaC06g38000D                                          362   7e-120   
ref|XP_009106393.1|  PREDICTED: glutathione S-transferase TCHQD         362   1e-119   
ref|XP_010428802.1|  PREDICTED: glutathione S-transferase TCHQD i...    362   1e-119   
ref|XP_010471916.1|  PREDICTED: glutathione S-transferase TCHQD-like    361   1e-119   
ref|XP_006300361.1|  hypothetical protein CARUB_v10022136mg             359   1e-118   
emb|CDX87528.1|  BnaA07g33450D                                          362   2e-118   
ref|XP_002887675.1|  hypothetical protein ARALYDRAFT_476892             358   3e-118   
gb|KHN38977.1|  Glutathione S-transferase TCHQD                         358   4e-118   
ref|XP_010269081.1|  PREDICTED: glutathione S-transferase TCHQD         357   5e-118   
ref|XP_009355836.1|  PREDICTED: glutathione S-transferase TCHQD-like    357   8e-118   
ref|XP_006390103.1|  hypothetical protein EUTSA_v10019613mg             356   1e-117   
ref|XP_004290917.1|  PREDICTED: glutathione S-transferase TCHQD-like    352   7e-116   
ref|XP_008394167.1|  PREDICTED: glutathione S-transferase TCHQD         350   5e-115   
ref|XP_010270300.1|  PREDICTED: glutathione S-transferase TCHQD-like    343   3e-112   
ref|XP_010930689.1|  PREDICTED: glutathione S-transferase TCHQD         340   2e-111   
ref|XP_009416928.1|  PREDICTED: glutathione S-transferase TCHQD         339   6e-111   
ref|XP_008781627.1|  PREDICTED: glutathione S-transferase TCHQD-like    336   1e-109   
ref|XP_006652308.1|  PREDICTED: glutathione S-transferase TCHQD-like    335   2e-109   
ref|XP_008799056.1|  PREDICTED: glutathione S-transferase TCHQD-like    335   3e-109   
ref|XP_002447864.1|  hypothetical protein SORBIDRAFT_06g017110          335   3e-109   Sorghum bicolor [broomcorn]
ref|NP_001052848.1|  Os04g0435500                                       334   5e-109   Oryza sativa Japonica Group [Japonica rice]
emb|CAZ68077.1|  tetrachlorohydroquinone dehalogenase                   334   7e-109   
dbj|BAJ98512.1|  predicted protein                                      333   1e-108   
ref|XP_004975660.1|  PREDICTED: glutathione S-transferase TCHQD-l...    332   3e-108   
ref|XP_003579787.1|  PREDICTED: glutathione S-transferase TCHQD         332   5e-108   
ref|XP_010908829.1|  PREDICTED: glutathione S-transferase TCHQD-like    332   7e-108   
gb|EMS53824.1|  Tetrachloro-P-hydroquinone reductive dehalogenase       330   2e-107   
gb|EMT26928.1|  hypothetical protein F775_28473                         327   2e-106   
ref|XP_009406137.1|  PREDICTED: glutathione S-transferase TCHQD-like    326   1e-105   
ref|NP_001132463.1|  Tetrachloro-P-hydroquinone reductive dehalog...    326   1e-105   Zea mays [maize]
ref|XP_008219713.1|  PREDICTED: glutathione S-transferase TCHQD         323   4e-105   
emb|CAN65319.1|  hypothetical protein VITISV_036321                     317   4e-102   Vitis vinifera
ref|XP_006847165.1|  hypothetical protein AMTR_s00017p00243750          313   7e-101   
gb|KEH35353.1|  glutathione S-transferase, amino-terminal domain ...    310   4e-100   
gb|AHC03514.1|  TCHQD class glutathione S-transferase                   292   1e-92    
gb|AGC13148.1|  TCHQD class glutathione S-transferase                   290   9e-92    
gb|KCW85228.1|  hypothetical protein EUGRSUZ_B02072                     287   4e-91    
ref|XP_010055969.1|  PREDICTED: glutathione S-transferase TCHQD-l...    275   8e-87    
ref|XP_010678910.1|  PREDICTED: glutathione S-transferase TCHQD i...    273   1e-85    
gb|KCW89669.1|  hypothetical protein EUGRSUZ_A01942                     268   1e-82    
ref|XP_010070595.1|  PREDICTED: glutathione S-transferase TCHQD-l...    265   2e-82    
gb|KCW51823.1|  hypothetical protein EUGRSUZ_J01273                     268   2e-82    
ref|XP_010070444.1|  PREDICTED: glutathione S-transferase TCHQD-like    267   3e-82    
ref|XP_010023525.1|  PREDICTED: glutathione S-transferase TCHQD-l...    263   1e-81    
ref|XP_010032429.1|  PREDICTED: glutathione S-transferase TCHQD-like    254   5e-79    
gb|KCW89670.1|  hypothetical protein EUGRSUZ_A01942                     250   6e-76    
gb|AFF18818.1|  glutathione transferase                                 235   7e-72    
ref|XP_001771860.1|  predicted protein                                  233   2e-69    
ref|XP_002970046.1|  hypothetical protein SELMODRAFT_267328             232   2e-69    
ref|XP_002985236.1|  hypothetical protein SELMODRAFT_446164             232   3e-69    
gb|EPS67396.1|  hypothetical protein M569_07387                         229   3e-69    
gb|ADE77247.1|  unknown                                                 200   4e-57    
gb|KCW51825.1|  hypothetical protein EUGRSUZ_J01273                     163   2e-43    
gb|KCW51824.1|  hypothetical protein EUGRSUZ_J01273                     162   1e-42    
gb|ACU19273.1|  unknown                                                 147   6e-39    Glycine max [soybeans]
ref|XP_001758858.1|  predicted protein                                  130   5e-31    
gb|AFZ39139.1|  TCHQD class glutathione S-transferase                   131   6e-31    
ref|XP_001776499.1|  predicted protein                                  129   8e-31    
gb|AFZ39140.1|  TCHQD class glutathione S-transferase                   129   2e-30    
gb|AFK37371.1|  unknown                                                 115   4e-28    
ref|XP_009362356.1|  PREDICTED: glutathione S-transferase TCHQD-like    110   5e-26    
ref|XP_001766396.1|  predicted protein                                  111   2e-24    
gb|EPS63842.1|  hypothetical protein M569_10943                         105   3e-24    
gb|AFZ39141.1|  TCHQD class glutathione S-transferase                   111   7e-24    
ref|XP_001764050.1|  predicted protein                                  112   7e-24    
gb|AFZ39138.1|  TCHQD class glutathione S-transferase                   110   1e-23    
ref|WP_037457245.1|  hypothetical protein                             90.1    4e-17    
ref|WP_013849830.1|  tetrachloro-P-hydroquinone reductive dehalog...  90.1    4e-17    
gb|AAL24440.1|  tetrachlorohydroquinone reductive dehalogenase        89.4    7e-17    Sphingomonas sp. UG30
pir||A40625  tetrachloro-p-hydroquinone reductive dehalogenase (E...  88.2    2e-16 
ref|WP_036523909.1|  hypothetical protein                             86.3    9e-16    
ref|WP_023403009.1|  hypothetical protein                             79.3    3e-13    
ref|WP_028601129.1|  hypothetical protein                             73.9    1e-11    
ref|XP_011082484.1|  PREDICTED: glutathione S-transferase-like        73.9    2e-11    
ref|XP_002283209.1|  PREDICTED: glutathione S-transferase F9          70.9    1e-10    Vitis vinifera
ref|WP_027858192.1|  glutathione S-transferase                        71.2    1e-10    
ref|WP_039474341.1|  hypothetical protein                             71.2    1e-10    
ref|WP_035898147.1|  hypothetical protein                             70.9    1e-10    
ref|XP_007215956.1|  hypothetical protein PRUPE_ppa011337mg           70.5    1e-10    
ref|XP_008229579.1|  PREDICTED: glutathione S-transferase F9-like...  70.5    2e-10    
ref|XP_005096784.1|  PREDICTED: ganglioside-induced differentiati...  71.6    2e-10    
ref|XP_006437116.1|  hypothetical protein CICLE_v10032743mg           69.7    3e-10    
ref|NP_001106075.1|  glutathione S-transferase 3                      68.6    6e-10    Zea mays [maize]
ref|NP_001267983.1|  glutathione S-transferase 3                      68.6    7e-10    
ref|WP_017030963.1|  hypothetical protein                             68.6    9e-10    
ref|WP_028865904.1|  hypothetical protein                             68.6    9e-10    
gb|AIO36271.1|  tetrachloro-P-hydroquinone reductive dehalogenase     68.6    1e-09    
gb|ABW34390.1|  glutathione S-transferase 5                           68.2    1e-09    Vitis vinifera
gb|KDP20539.1|  hypothetical protein JCGZ_04912                       67.8    1e-09    
ref|WP_017243900.1|  hypothetical protein                             68.6    1e-09    
ref|XP_008305824.1|  PREDICTED: ganglioside-induced differentiati...  69.7    1e-09    
gb|KFK31251.1|  hypothetical protein AALP_AA6G088300                  67.8    1e-09    
gb|KDP22743.1|  hypothetical protein JCGZ_02402                       67.8    1e-09    
ref|WP_017029633.1|  hypothetical protein                             68.2    1e-09    
ref|XP_010469787.1|  PREDICTED: glutathione S-transferase F10         67.8    1e-09    
ref|XP_009377060.1|  PREDICTED: glutathione S-transferase F9-like     67.4    1e-09    
ref|XP_007260150.1|  PREDICTED: ganglioside-induced differentiati...  69.3    2e-09    
emb|CAN75964.1|  hypothetical protein VITISV_036241                   67.4    2e-09    Vitis vinifera
ref|WP_011042729.1|  glutathione S-transferase                        67.8    2e-09    
ref|XP_002530205.1|  glutathione-s-transferase theta, gst, putative   67.4    2e-09    Ricinus communis
ref|XP_004081067.1|  PREDICTED: ganglioside-induced differentiati...  68.9    2e-09    
ref|WP_007105984.1|  glutathione S-transferase 2                      67.8    2e-09    
ref|XP_008805761.1|  PREDICTED: probable glutathione S-transferas...  67.0    2e-09    
ref|XP_009336611.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  69.3    2e-09    
gb|ACF85374.1|  unknown                                               67.0    3e-09    Zea mays [maize]
ref|XP_006001128.1|  PREDICTED: ganglioside-induced differentiati...  68.6    3e-09    
ref|NP_001105111.1|  Glutathione transferase III(b)                   66.6    3e-09    Zea mays [maize]
ref|XP_006001127.1|  PREDICTED: ganglioside-induced differentiati...  68.6    3e-09    
ref|XP_007223949.1|  hypothetical protein PRUPE_ppa011153mg           66.6    3e-09    
ref|XP_009377051.1|  PREDICTED: glutathione S-transferase F9-like     66.2    4e-09    
ref|NP_001018511.1|  ganglioside-induced differentiation-associat...  68.2    4e-09    Danio rerio [leopard danio]
ref|XP_010510278.1|  PREDICTED: glutathione S-transferase F10-like    66.2    4e-09    
ref|XP_006410185.1|  hypothetical protein EUTSA_v10017227mg           66.2    4e-09    
ref|XP_009033291.1|  hypothetical protein AURANDRAFT_19775            66.2    5e-09    
gb|AAG34812.1|AF243377_1  glutathione S-transferase GST 22            65.9    5e-09    Glycine max [soybeans]
ref|NP_001239642.1|  glutathione S-transferase GST 22                 65.9    5e-09    
ref|XP_007215954.1|  hypothetical protein PRUPE_ppa011337mg           65.5    6e-09    
ref|WP_019620049.1|  hypothetical protein                             66.2    6e-09    
ref|XP_010414208.1|  PREDICTED: glutathione S-transferase F10-like    65.5    6e-09    
emb|CAB38118.1|  Glutathione transferase III(a)                       65.5    7e-09    Zea mays [maize]
gb|ACF82527.1|  unknown                                               65.5    7e-09    Zea mays [maize]
emb|CAA12269.1|  ORF 3                                                65.9    7e-09    Sphingomonas sp. RW5
gb|AIC33066.1|  glutathione s-transferase                             65.5    7e-09    
ref|XP_004499970.1|  PREDICTED: glutathione S-transferase F9-like     65.5    8e-09    
ref|XP_010904819.1|  PREDICTED: probable glutathione S-transferas...  65.1    8e-09    
ref|XP_008342336.1|  PREDICTED: glutathione S-transferase F9-like     65.5    9e-09    
ref|NP_001237836.1|  uncharacterized protein LOC100499911             64.7    1e-08    
ref|XP_003977399.1|  PREDICTED: ganglioside-induced differentiati...  66.6    1e-08    
pdb|1AW9|A  Chain A, Structure Of Glutathione S-Transferase Iii I...  64.7    1e-08    
gb|KHN13182.1|  Glutathione S-transferase F9                          64.7    1e-08    
ref|XP_002611064.1|  hypothetical protein BRAFLDRAFT_205905           66.2    1e-08    Branchiostoma floridae
ref|XP_002531867.1|  glutathione-s-transferase theta, gst, putative   64.7    1e-08    Ricinus communis
dbj|BAJ85232.1|  predicted protein                                    64.7    1e-08    
ref|XP_007215944.1|  hypothetical protein PRUPE_ppa011246mg           64.3    2e-08    
ref|WP_029639183.1|  hypothetical protein                             65.1    2e-08    
ref|XP_008229578.1|  PREDICTED: glutathione S-transferase F9-like...  64.3    2e-08    
ref|NP_180644.1|  glutathione S-transferase PHI 10                    63.9    2e-08    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009384404.1|  PREDICTED: glutathione S-transferase 3-like      63.9    2e-08    
ref|XP_006294907.1|  hypothetical protein CARUB_v10023958mg           64.3    2e-08    
ref|XP_007215955.1|  hypothetical protein PRUPE_ppa011337mg           63.5    3e-08    
ref|XP_002510614.1|  glutathione-s-transferase theta, gst, putative   63.5    3e-08    Ricinus communis
ref|XP_006484982.1|  PREDICTED: glutathione S-transferase F9-like     63.5    3e-08    
ref|XP_007048950.1|  Glutathione S-transferase PHI 9                  63.5    3e-08    
ref|XP_010873506.1|  PREDICTED: ganglioside-induced differentiati...  65.1    3e-08    
ref|XP_010035935.1|  PREDICTED: glutathione S-transferase F9-like     63.2    4e-08    
ref|XP_004303893.1|  PREDICTED: glutathione S-transferase F9-like...  63.2    4e-08    
ref|WP_026006160.1|  glutathione S-transferase                        63.9    4e-08    
ref|XP_003567436.2|  PREDICTED: glutathione S-transferase 3           63.2    4e-08    
ref|XP_007146992.1|  hypothetical protein PHAVU_006G087500g           63.2    4e-08    
ref|XP_007048951.1|  Glutathione S-transferase PHI 9 isoform 1        63.2    4e-08    
ref|XP_006484981.1|  PREDICTED: glutathione S-transferase F9-like     62.8    4e-08    
gb|KEH33687.1|  glutathione S-transferase, amino-terminal domain ...  62.8    5e-08    
gb|AFK37527.1|  unknown                                               62.8    5e-08    
ref|XP_010269470.1|  PREDICTED: glutathione S-transferase F13-like    62.8    5e-08    
gb|ADE76351.1|  unknown                                               62.8    5e-08    
gb|EYU46696.1|  hypothetical protein MIMGU_mgv1a013633mg              62.8    5e-08    
ref|XP_002879283.1|  early dehydration-induced 13                     62.8    5e-08    
ref|XP_008348377.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...  62.4    6e-08    
gb|KDP36862.1|  hypothetical protein JCGZ_08153                       62.8    6e-08    
ref|XP_009132757.1|  PREDICTED: glutathione S-transferase F10         62.0    8e-08    
ref|XP_009365718.1|  PREDICTED: glutathione S-transferase F13         62.0    8e-08    
ref|XP_002593983.1|  hypothetical protein BRAFLDRAFT_57407            63.9    9e-08    Branchiostoma floridae
ref|XP_008380180.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...  62.0    9e-08    
ref|XP_008229577.1|  PREDICTED: glutathione S-transferase F9-like     62.0    9e-08    
ref|XP_009377092.1|  PREDICTED: glutathione S-transferase F9-like     62.0    9e-08    
gb|KDO84982.1|  hypothetical protein CISIN_1g027634mg                 62.0    9e-08    
gb|AHA46522.1|  phi class glutathione S-transferase                   62.0    1e-07    
ref|XP_006473732.1|  PREDICTED: glutathione S-transferase-like        62.0    1e-07    
ref|XP_007885195.1|  PREDICTED: ganglioside-induced differentiati...  63.5    1e-07    
ref|XP_007885194.1|  PREDICTED: ganglioside-induced differentiati...  63.5    1e-07    
ref|XP_011098390.1|  PREDICTED: glutathione S-transferase F9-like     61.6    1e-07    
emb|CDX84815.1|  BnaA03g14150D                                        61.6    1e-07    
ref|XP_002937122.1|  PREDICTED: ganglioside-induced differentiati...  63.2    1e-07    
gb|KHG21992.1|  Glutathione S-transferase F9 -like protein            61.2    2e-07    
ref|XP_009628525.1|  PREDICTED: glutathione S-transferase-like        61.6    2e-07    
ref|XP_004971178.1|  PREDICTED: glutathione S-transferase 3-like      61.2    2e-07    
gb|ADE76600.1|  unknown                                               60.8    2e-07    
ref|XP_004585882.1|  PREDICTED: ganglioside-induced differentiati...  62.0    2e-07    
ref|XP_010272271.1|  PREDICTED: glutathione S-transferase F10-like    60.8    2e-07    
ref|WP_033335810.1|  glutathione S-transferase                        58.9    3e-07    
gb|KDR11132.1|  Ganglioside-induced differentiation-associated pr...  62.0    3e-07    
gb|AFK48087.1|  unknown                                               60.5    3e-07    
ref|XP_006435273.1|  hypothetical protein CICLE_v10002119mg           61.6    3e-07    
emb|CAN69111.1|  hypothetical protein VITISV_031837                   60.5    3e-07    Vitis vinifera
ref|XP_008451606.1|  PREDICTED: glutathione S-transferase-like        60.5    3e-07    
ref|XP_002734706.1|  PREDICTED: ganglioside-induced differentiati...  61.6    3e-07    Saccoglossus kowalevskii
emb|CDY23979.1|  BnaC03g17120D                                        60.5    3e-07    
gb|EYU33954.1|  hypothetical protein MIMGU_mgv1a013692mg              60.5    4e-07    
gb|KDP28123.1|  hypothetical protein JCGZ_13894                       60.5    4e-07    
ref|XP_008229575.1|  PREDICTED: glutathione S-transferase F9-like     60.1    4e-07    
ref|XP_007146198.1|  hypothetical protein PHAVU_006G020800g           60.5    5e-07    
ref|XP_011079699.1|  PREDICTED: glutathione S-transferase-like        60.1    5e-07    
ref|XP_011098399.1|  PREDICTED: glutathione S-transferase F9-like     59.7    5e-07    
gb|ABI79308.1|  glutathione S-transferase                             59.7    5e-07    Pyrus communis
emb|CDQ72002.1|  unnamed protein product                              61.6    5e-07    
dbj|BAM14585.1|  putative glutathione S-transferase                   59.7    5e-07    
ref|XP_007464827.1|  PREDICTED: ganglioside-induced differentiati...  61.2    6e-07    
ref|XP_004858252.1|  PREDICTED: ganglioside-induced differentiati...  61.2    6e-07    
ref|XP_010069962.1|  PREDICTED: glutathione S-transferase-like        59.7    6e-07    
ref|XP_007035561.1|  Phi class glutathione transferase GSTF7          59.7    6e-07    
gb|KDO84983.1|  hypothetical protein CISIN_1g027634mg                 58.9    6e-07    
ref|XP_004612542.1|  PREDICTED: ganglioside-induced differentiati...  61.2    6e-07    
ref|XP_005002835.1|  PREDICTED: ganglioside-induced differentiati...  60.8    6e-07    
ref|XP_007017931.1|  Ubiquitin-like superfamily protein isoform 3     60.1    6e-07    
ref|XP_004630982.1|  PREDICTED: ganglioside-induced differentiati...  60.8    6e-07    
ref|WP_011042500.1|  glutathione S-transferase                        60.1    7e-07    
ref|XP_007123082.1|  PREDICTED: ganglioside-induced differentiati...  60.8    7e-07    
ref|WP_017057666.1|  glutathione S-transferase                        60.1    7e-07    
ref|XP_004253135.1|  PREDICTED: glutathione S-transferase             59.7    7e-07    
ref|XP_007146224.1|  hypothetical protein PHAVU_006G022600g           59.3    7e-07    
gb|EYU34184.1|  hypothetical protein MIMGU_mgv1a013345mg              59.7    7e-07    
ref|XP_004161070.1|  PREDICTED: glutathione S-transferase F8, chl...  59.3    7e-07    
gb|KGN62277.1|  hypothetical protein Csa_2G348150                     59.3    8e-07    
ref|XP_006132293.1|  PREDICTED: ganglioside-induced differentiati...  60.5    8e-07    
ref|XP_010259661.1|  PREDICTED: glutathione S-transferase F13         59.3    8e-07    
gb|KHN46581.1|  Glutathione S-transferase F13                         59.3    8e-07    
ref|XP_010269471.1|  PREDICTED: glutathione S-transferase F13-like    59.3    8e-07    
ref|XP_008348130.1|  PREDICTED: glutathione S-transferase F9-like     59.3    8e-07    
gb|AFK35789.1|  unknown                                               59.3    9e-07    
ref|XP_003617377.1|  Glutathione S-transferase                        59.3    9e-07    
ref|XP_006193561.1|  PREDICTED: ganglioside-induced differentiati...  60.5    9e-07    
ref|XP_008380181.1|  PREDICTED: glutathione S-transferase F9-like     59.3    9e-07    
ref|XP_005392542.1|  PREDICTED: ganglioside-induced differentiati...  60.5    9e-07    
gb|AEX37999.1|  glutathione transferase                               58.9    9e-07    
ref|XP_010069958.1|  PREDICTED: glutathione S-transferase-like        58.9    9e-07    
gb|ABX65441.1|  glutathione S-transferase                             58.9    9e-07    Chimonanthus praecox [wintersweet]
ref|XP_005363024.1|  PREDICTED: ganglioside-induced differentiati...  60.5    1e-06    
ref|XP_007193159.1|  PREDICTED: ganglioside-induced differentiati...  60.5    1e-06    
ref|XP_004272923.1|  PREDICTED: ganglioside-induced differentiati...  60.1    1e-06    
gb|KCW47449.1|  hypothetical protein EUGRSUZ_K01234                   58.9    1e-06    
ref|XP_003558871.1|  PREDICTED: glutathione S-transferase F11-like    58.9    1e-06    
ref|XP_007146233.1|  hypothetical protein PHAVU_006G023400g           58.9    1e-06    
ref|XP_006734556.1|  PREDICTED: ganglioside-induced differentiati...  60.1    1e-06    
ref|XP_007067348.1|  PREDICTED: ganglioside-induced differentiati...  60.1    1e-06    
ref|XP_003617376.1|  Glutathione S-transferase GST                    58.5    1e-06    
ref|XP_007137174.1|  hypothetical protein PHAVU_009G105900g           58.5    1e-06    
gb|AGC13153.1|  phi class glutathione S-transferase                   58.5    1e-06    
dbj|BAF56180.1|  glutathione S-transferase                            58.5    1e-06    Allium cepa
ref|XP_009356599.1|  PREDICTED: glutathione S-transferase F9-like     58.5    1e-06    
gb|AAL61612.1|AF401623_1  glutathione S-transferase                   58.5    1e-06    Allium cepa
ref|XP_005903254.1|  PREDICTED: ganglioside-induced differentiati...  59.7    1e-06    
gb|AFK45563.1|  unknown                                               58.5    2e-06    
ref|XP_008445310.1|  PREDICTED: glutathione S-transferase F11-like    58.5    2e-06    
ref|XP_009785538.1|  PREDICTED: glutathione S-transferase-like        58.5    2e-06    
ref|XP_003360052.1|  PREDICTED: ganglioside-induced differentiati...  59.7    2e-06    
ref|XP_004687455.1|  PREDICTED: ganglioside-induced differentiati...  59.3    2e-06    
gb|KGM48644.1|  hypothetical protein ATO9_13570                       58.5    2e-06    
gb|KHN13181.1|  Glutathione S-transferase F9                          58.2    2e-06    
ref|XP_004746459.1|  PREDICTED: ganglioside-induced differentiati...  59.3    2e-06    
ref|XP_687373.1|  PREDICTED: ganglioside-induced differentiation-...  59.7    2e-06    
gb|EMT08743.1|  hypothetical protein F775_32323                       58.2    2e-06    
ref|XP_004370383.1|  PREDICTED: ganglioside-induced differentiati...  59.3    2e-06    
ref|NP_180643.1|  glutathione S-transferase PHI 9                     58.2    2e-06    
ref|XP_007420891.1|  PREDICTED: ganglioside-induced differentiati...  59.7    2e-06    
ref|XP_003433319.1|  PREDICTED: ganglioside induced differentiati...  59.3    2e-06    
ref|XP_006921890.1|  PREDICTED: ganglioside-induced differentiati...  59.3    2e-06    
ref|XP_010557150.1|  PREDICTED: glutathione S-transferase F9-like     58.2    2e-06    
ref|XP_010590002.1|  PREDICTED: ganglioside-induced differentiati...  59.3    2e-06    
ref|XP_010035942.1|  PREDICTED: glutathione S-transferase F9-like     58.2    2e-06    
ref|WP_013540554.1|  glutathione S-transferase                        58.5    2e-06    
ref|XP_008156832.1|  PREDICTED: ganglioside-induced differentiati...  59.3    2e-06    
ref|XP_004414148.1|  PREDICTED: ganglioside-induced differentiati...  59.3    2e-06    
ref|XP_006816451.1|  PREDICTED: ganglioside-induced differentiati...  59.3    2e-06    
ref|XP_007530947.1|  PREDICTED: ganglioside-induced differentiati...  59.3    2e-06    
ref|XP_006091488.1|  PREDICTED: ganglioside-induced differentiati...  59.3    2e-06    
ref|XP_003787663.1|  PREDICTED: ganglioside-induced differentiati...  59.3    2e-06    
ref|XP_007146234.1|  hypothetical protein PHAVU_006G023500g           57.8    2e-06    
ref|XP_006410183.1|  hypothetical protein EUTSA_v10017228mg           57.8    2e-06    
ref|XP_006971094.1|  PREDICTED: ganglioside-induced differentiati...  59.3    2e-06    
ref|XP_006437115.1|  hypothetical protein CICLE_v10033001mg           57.0    2e-06    
ref|XP_008342338.1|  PREDICTED: glutathione S-transferase F9-like     57.8    2e-06    
ref|XP_011079702.1|  PREDICTED: glutathione S-transferase-like        57.8    2e-06    
ref|XP_007999110.1|  PREDICTED: ganglioside-induced differentiati...  58.9    3e-06    
ref|XP_010035939.1|  PREDICTED: glutathione S-transferase F9-like...  58.9    3e-06    
ref|XP_418303.3|  PREDICTED: ganglioside-induced differentiation-...  59.3    3e-06    
gb|KFK37760.1|  hypothetical protein AALP_AA3G026300                  57.8    3e-06    
ref|XP_007160612.1|  hypothetical protein PHAVU_001G002000g           57.8    3e-06    
ref|XP_010035938.1|  PREDICTED: glutathione S-transferase F9-like...  58.9    3e-06    
ref|XP_004939972.1|  PREDICTED: ganglioside-induced differentiati...  58.9    3e-06    
ref|NP_001243668.1|  ganglioside-induced differentiation-associat...  58.9    3e-06    
ref|XP_010935200.1|  PREDICTED: glutathione S-transferase F8, chl...  57.8    3e-06    
ref|XP_006342558.1|  PREDICTED: glutathione S-transferase-like        57.8    3e-06    
ref|XP_010382589.1|  PREDICTED: ganglioside-induced differentiati...  58.9    3e-06    
gb|KHG23493.1|  Glutathione S-transferase F8, chloroplastic -like...  57.4    3e-06    
gb|AHA46523.1|  phi class glutathione S-transferase                   57.4    3e-06    
ref|XP_010754105.1|  PREDICTED: ganglioside-induced differentiati...  58.9    3e-06    
gb|EMT15957.1|  hypothetical protein F775_26917                       58.2    3e-06    
ref|XP_006881609.1|  PREDICTED: ganglioside-induced differentiati...  58.5    4e-06    
gb|AAM34480.1|  putative glutathione S-transferase                    57.4    4e-06    
ref|XP_006016747.1|  PREDICTED: ganglioside-induced differentiati...  58.5    4e-06    
ref|XP_007647734.1|  PREDICTED: ganglioside-induced differentiati...  58.5    4e-06    
ref|XP_006853524.1|  hypothetical protein AMTR_s00032p00224770        57.4    4e-06    
ref|XP_001503019.3|  PREDICTED: ganglioside-induced differentiati...  58.5    4e-06    
gb|KHG05656.1|  Glutathione S-transferase F6 -like protein            57.0    4e-06    
ref|XP_008353665.1|  PREDICTED: glutathione S-transferase F9-like     56.2    4e-06    
ref|XP_009565849.1|  PREDICTED: ganglioside-induced differentiati...  58.5    4e-06    
ref|XP_008373435.1|  PREDICTED: glutathione S-transferase F13-like    57.0    4e-06    
ref|XP_007141437.1|  hypothetical protein PHAVU_008G195500g           57.0    4e-06    
ref|XP_010884306.1|  PREDICTED: LOW QUALITY PROTEIN: ganglioside-...  58.9    4e-06    
ref|XP_007936601.1|  PREDICTED: ganglioside-induced differentiati...  58.5    4e-06    
ref|XP_006016749.1|  PREDICTED: ganglioside-induced differentiati...  58.5    4e-06    
gb|EMS66136.1|  Glutathione S-transferase                             57.8    4e-06    
ref|XP_003220657.1|  PREDICTED: ganglioside-induced differentiati...  58.5    4e-06    
ref|XP_011010721.1|  PREDICTED: glutathione S-transferase F13-like    57.0    4e-06    
ref|XP_006386755.1|  glutathione S-transferase family protein         57.0    4e-06    
ref|XP_006839341.1|  PREDICTED: ganglioside-induced differentiati...  58.2    4e-06    
ref|XP_009803671.1|  PREDICTED: glutathione S-transferase-like        57.0    4e-06    
gb|EPS73710.1|  hypothetical protein M569_01048                       57.0    5e-06    
ref|XP_004430436.1|  PREDICTED: ganglioside-induced differentiati...  58.2    5e-06    
ref|XP_006649352.1|  PREDICTED: glutathione S-transferase F11-like    57.0    5e-06    
gb|KDO40903.1|  hypothetical protein CISIN_1g042826mg                 56.2    5e-06    
ref|XP_010684411.1|  PREDICTED: glutathione S-transferase-like        57.0    5e-06    
ref|XP_004985806.1|  PREDICTED: glutathione S-transferase F11-like    57.0    5e-06    
ref|XP_004136042.1|  PREDICTED: glutathione S-transferase-like        57.0    5e-06    
ref|XP_004160544.1|  PREDICTED: glutathione S-transferase-like        56.6    5e-06    
ref|XP_010035937.1|  PREDICTED: glutathione S-transferase F9-like     56.6    6e-06    
ref|XP_009132756.1|  PREDICTED: glutathione S-transferase F9          56.6    6e-06    
gb|AHA46525.1|  phi class glutathione S-transferase                   56.6    6e-06    
ref|XP_010101286.1|  Glutathione S-transferase F8                     56.6    7e-06    
ref|XP_010035936.1|  PREDICTED: glutathione S-transferase F9-like     56.2    8e-06    
ref|XP_009381929.1|  PREDICTED: probable glutathione S-transferas...  56.2    8e-06    
gb|AAG32477.1|AF309384_1  putative glutathione S-transferase OsGSTF3  56.2    8e-06    
gb|AGC13154.1|  phi class glutathione S-transferase                   56.2    8e-06    
ref|XP_007487003.1|  PREDICTED: ganglioside-induced differentiati...  57.4    9e-06    
ref|XP_011033572.1|  PREDICTED: glutathione S-transferase F13-like    56.2    9e-06    
gb|KEH33682.1|  glutathione S-transferase                             56.2    9e-06    
ref|WP_020737585.1|  glutathione S-transferase                        55.8    9e-06    
ref|XP_009586784.1|  PREDICTED: glutathione S-transferase             56.2    9e-06    
ref|XP_010126282.1|  PREDICTED: ganglioside-induced differentiati...  57.4    9e-06    
gb|ACF80172.1|  unknown                                               55.8    9e-06    
gb|ADB11335.1|  phi class glutathione transferase GSTF7               56.2    1e-05    
ref|XP_006437117.1|  hypothetical protein CICLE_v10032737mg           55.8    1e-05    
ref|XP_004291321.1|  PREDICTED: glutathione S-transferase F8, chl...  56.2    1e-05    
emb|CDG17230.1|  Uncharacterized GST-like protein yliJ                55.8    1e-05    
ref|XP_003532087.1|  PREDICTED: glutathione S-transferase F9-like     55.8    1e-05    
gb|ACJ86198.1|  unknown                                               55.8    1e-05    
dbj|BAG14300.1|  glutathione S-transferase                            55.8    1e-05    
ref|XP_006132291.1|  PREDICTED: ganglioside-induced differentiati...  57.4    1e-05    
ref|XP_006855531.1|  hypothetical protein AMTR_s00057p00211800        55.5    1e-05    
gb|EYF01001.1|  Glutathione S-transferase, phi                        55.5    1e-05    
ref|NP_001048886.1|  Os03g0135300                                     55.8    1e-05    
gb|EAY88429.1|  hypothetical protein OsI_09893                        55.8    1e-05    
ref|XP_002321020.2|  glutathione S-transferase family protein         55.8    1e-05    
ref|XP_011079696.1|  PREDICTED: glutathione S-transferase-like        55.5    1e-05    
gb|ACJ84570.1|  unknown                                               55.5    1e-05    
tpg|DAA43225.1|  TPA: hypothetical protein ZEAMMB73_702565            55.8    1e-05    
gb|EMS46511.1|  Glutathione S-transferase                             56.2    2e-05    
ref|WP_012237381.1|  glutathione S-transferase                        55.1    2e-05    
gb|ADB85090.1|  glutathione S-transferase                             55.1    2e-05    
ref|XP_008847127.1|  PREDICTED: ganglioside-induced differentiati...  57.0    2e-05    
emb|CDP07334.1|  unnamed protein product                              55.5    2e-05    
gb|KIG12091.1|  Glutathione S-transferase family protein              56.6    2e-05    
ref|XP_002008142.1|  GI13331                                          56.6    2e-05    
ref|XP_007141438.1|  hypothetical protein PHAVU_008G195600g           55.1    2e-05    
ref|XP_008342339.1|  PREDICTED: glutathione S-transferase F9-like     54.3    2e-05    
ref|XP_004300542.1|  PREDICTED: glutathione S-transferase F13-like    55.1    2e-05    
ref|XP_002878475.1|  hypothetical protein ARALYDRAFT_486776           55.1    2e-05    
ref|XP_009624108.1|  PREDICTED: glutathione S-transferase-like        55.1    2e-05    
emb|CDX97788.1|  BnaC04g41510D                                        55.1    2e-05    
ref|XP_006575642.1|  PREDICTED: glutathione S-transferase F9-like     55.1    2e-05    
ref|XP_007067346.1|  PREDICTED: ganglioside-induced differentiati...  56.6    2e-05    
ref|XP_008648145.1|  PREDICTED: glutathione transferase10 isoform X1  55.1    2e-05    
ref|XP_004240537.1|  PREDICTED: glutathione S-transferase-like        55.1    2e-05    
ref|XP_006855528.1|  hypothetical protein AMTR_s00057p00211000        54.7    2e-05    
emb|CCM05619.1|  predicted protein                                    54.7    3e-05    
ref|XP_009635618.1|  PREDICTED: ganglioside-induced differentiati...  55.8    3e-05    
ref|XP_006355800.1|  PREDICTED: glutathione S-transferase-like        54.7    3e-05    
ref|XP_010943498.1|  PREDICTED: glutathione S-transferase F10-like    54.7    3e-05    
ref|NP_191835.1|  glutathione S-transferase F13                       54.7    3e-05    
ref|XP_010069961.1|  PREDICTED: glutathione S-transferase-like        54.3    3e-05    
gb|AGH14254.1|  glutathione S-transferase                             54.7    3e-05    
ref|XP_002465909.1|  hypothetical protein SORBIDRAFT_01g047970        54.7    3e-05    
ref|XP_010542711.1|  PREDICTED: glutathione S-transferase F9          54.3    3e-05    
ref|XP_006639465.1|  PREDICTED: ganglioside-induced differentiati...  55.8    3e-05    
ref|XP_009471569.1|  PREDICTED: ganglioside-induced differentiati...  55.5    3e-05    
ref|XP_009486562.1|  PREDICTED: ganglioside-induced differentiati...  55.5    4e-05    
ref|NP_001065199.1|  Os10g0543800                                     55.5    4e-05    
gb|EPS58503.1|  hypothetical protein M569_16312                       54.3    4e-05    
ref|WP_003239884.1|  glutathione S-transferase                        54.3    4e-05    
ref|XP_005146786.1|  PREDICTED: ganglioside-induced differentiati...  55.5    4e-05    
ref|XP_009863734.1|  PREDICTED: ganglioside-induced differentiati...  55.5    4e-05    
gb|ABQ96852.1|  glutathione S-transferase                             54.3    4e-05    
ref|XP_009280476.1|  PREDICTED: ganglioside-induced differentiati...  55.5    4e-05    
ref|XP_008362360.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...  54.7    4e-05    
ref|XP_006295885.1|  hypothetical protein CARUB_v10025015mg           54.3    4e-05    
ref|XP_002024716.1|  GL22618                                          55.5    4e-05    
ref|XP_001983961.1|  GH16180                                          55.5    4e-05    
ref|XP_010152654.1|  PREDICTED: ganglioside-induced differentiati...  55.5    4e-05    
ref|XP_001354279.2|  GA18310                                          55.5    4e-05    
ref|NP_001267869.1|  glutathione S-transferase                        54.3    4e-05    
ref|XP_009932100.1|  PREDICTED: ganglioside-induced differentiati...  55.5    4e-05    
gb|ACN38271.1|  glutathione S-transferase                             53.9    4e-05    
ref|XP_004503099.1|  PREDICTED: glutathione S-transferase F11-like    53.9    5e-05    
ref|XP_005180866.1|  PREDICTED: ganglioside-induced differentiati...  55.1    5e-05    
ref|XP_009906918.1|  PREDICTED: ganglioside-induced differentiati...  55.1    5e-05    
ref|XP_005180865.1|  PREDICTED: ganglioside-induced differentiati...  55.1    5e-05    
ref|XP_002068631.1|  GK20321                                          55.1    6e-05    
ref|XP_003538377.1|  PREDICTED: glutathione S-transferase F11-like    53.5    6e-05    
ref|XP_008170357.1|  PREDICTED: ganglioside-induced differentiati...  55.1    6e-05    
gb|KDO40902.1|  hypothetical protein CISIN_1g027956mg                 53.1    6e-05    
gb|EYU33332.1|  hypothetical protein MIMGU_mgv1a013599mg              53.5    7e-05    
ref|XP_006355799.1|  PREDICTED: glutathione S-transferase-like        53.5    7e-05    
gb|AFK48920.1|  unknown                                               53.5    7e-05    
ref|XP_008813666.1|  PREDICTED: glutathione S-transferase F10-like    52.8    7e-05    
ref|XP_006067918.1|  PREDICTED: ganglioside-induced differentiati...  54.7    7e-05    
ref|XP_010754106.1|  PREDICTED: ganglioside-induced differentiati...  55.1    7e-05    
ref|WP_030089913.1|  glutathione S-transferase                        54.3    7e-05    
ref|WP_016744615.1|  hypothetical protein                             54.3    8e-05    
ref|XP_009111277.1|  PREDICTED: glutathione S-transferase F3-like     53.1    8e-05    
ref|XP_003757767.1|  PREDICTED: ganglioside-induced differentiati...  54.7    8e-05    
ref|XP_010940257.1|  PREDICTED: glutathione S-transferase F12-like    53.5    9e-05    
ref|WP_012049267.1|  MULTISPECIES: glutathione S-transferase doma...  53.9    9e-05    
ref|XP_009377080.1|  PREDICTED: glutathione S-transferase F9-like     53.1    9e-05    
ref|XP_004519073.1|  PREDICTED: ganglioside-induced differentiati...  54.3    9e-05    
ref|XP_004240536.1|  PREDICTED: glutathione S-transferase             53.1    9e-05    
ref|XP_001369676.1|  PREDICTED: ganglioside induced differentiati...  54.3    1e-04    
ref|XP_009397596.1|  PREDICTED: glutathione S-transferase F10-like    53.1    1e-04    
ref|XP_006410184.1|  hypothetical protein EUTSA_v10017228mg           52.4    1e-04    
ref|XP_006016746.1|  PREDICTED: ganglioside-induced differentiati...  54.3    1e-04    
ref|XP_007141436.1|  hypothetical protein PHAVU_008G195400g           52.8    1e-04    
gb|AAY86780.1|  putative glutathione S-transferase                    52.8    1e-04    
ref|XP_001764210.1|  predicted protein                                52.8    1e-04    
gb|EXX75827.1|  Cam1p                                                 52.8    1e-04    
gb|ADB97493.1|  glutathione S-transferase 4                           52.8    1e-04    
ref|XP_002046939.1|  GJ13158                                          53.5    1e-04    
ref|XP_006634040.1|  PREDICTED: ganglioside-induced differentiati...  53.5    2e-04    
ref|XP_008363707.1|  PREDICTED: glutathione S-transferase-like        52.4    2e-04    
gb|ESA14626.1|  hypothetical protein GLOINDRAFT_346416                52.4    2e-04    
ref|WP_030430178.1|  hypothetical protein                             52.4    2e-04    
ref|WP_029888498.1|  hypothetical protein                             50.8    2e-04    
ref|XP_004288578.1|  PREDICTED: glutathione S-transferase F11-like    52.4    2e-04    
gb|ABQ96853.1|  glutathione S-transferase                             52.4    2e-04    
gb|EXX77120.1|  hypothetical protein RirG_026760                      50.8    2e-04    
gb|KHN08780.1|  Glutathione S-transferase F11                         52.0    2e-04    
ref|XP_007215953.1|  hypothetical protein PRUPE_ppa011307mg           52.0    2e-04    
ref|XP_003600650.1|  Glutathione S-transferase                        52.0    2e-04    
ref|XP_002465002.1|  hypothetical protein SORBIDRAFT_01g030240        52.4    2e-04    
ref|XP_006132292.1|  PREDICTED: ganglioside-induced differentiati...  53.5    2e-04    
ref|XP_003589566.1|  Glutathione S-transferase                        52.0    2e-04    
ref|XP_007714807.1|  hypothetical protein COCCADRAFT_102666           52.0    2e-04    
gb|AAB65163.1|  glutathione S-transferase, class-phi                  52.0    2e-04    
ref|WP_015347055.1|  glutathione S-transferase                        51.6    2e-04    
ref|XP_009255428.1|  hypothetical protein FPSE_04035                  52.0    2e-04    
ref|NP_001241411.1|  uncharacterized protein LOC100812502             52.0    2e-04    
ref|WP_012018381.1|  glutathione S-transferase                        52.0    3e-04    
gb|KHN45181.1|  Glutathione S-transferase F9                          50.8    3e-04    
ref|XP_006372485.1|  putative glutathione S-transferase family pr...  51.6    3e-04    
gb|ADB11336.1|  phi class glutathione transferase GSTF8               51.6    3e-04    
ref|XP_006639466.1|  PREDICTED: ganglioside-induced differentiati...  52.8    3e-04    
gb|KFK37761.1|  hypothetical protein AALP_AA3G026400                  51.6    3e-04    
gb|AGC13155.1|  phi class glutathione S-transferase                   51.6    3e-04    
gb|ADM74357.1|  glutathione S-transferase-like protein                50.8    3e-04    
gb|ACT82511.1|  glutathione S-transferase                             51.6    3e-04    
ref|XP_002272053.1|  PREDICTED: glutathione S-transferase F11         51.6    3e-04    
dbj|BAM14584.1|  glutathione S-transferase for anthocyanin accumu...  51.6    3e-04    
ref|XP_009412358.1|  PREDICTED: glutathione S-transferase F8, chl...  51.6    3e-04    
gb|ADM74397.1|  glutathione S-transferase-like protein                50.8    3e-04    
gb|EUN23652.1|  hypothetical protein COCVIDRAFT_40716                 51.6    3e-04    
gb|KDO51859.1|  hypothetical protein CISIN_1g031084mg                 50.4    4e-04    
gb|ADM74367.1|  glutathione S-transferase-like protein                50.8    4e-04    
gb|ADM74365.1|  glutathione S-transferase-like protein                50.8    4e-04    
gb|AHX04886.1|  glutaredoxin family protein                           51.6    4e-04    
emb|CAI78906.1|  putative glutathione S-transferase                   50.1    4e-04    
gb|ADM74359.1|  glutathione S-transferase-like protein                50.8    4e-04    
gb|EXX69369.1|  Cam1p                                                 51.2    4e-04    



>ref|XP_009591545.1| PREDICTED: glutathione S-transferase TCHQD isoform X2 [Nicotiana 
tomentosiformis]
Length=268

 Score =   434 bits (1115),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 217/268 (81%), Positives = 246/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHP SLDS KVRL LEEKGIDYTSHHVNP+TGKN+DTFFF +NPSAK+PVFQNGSH
Sbjct  1     MQLYHHPLSLDSQKVRLTLEEKGIDYTSHHVNPLTGKNMDTFFFSMNPSAKIPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             IIYDT+EIIQYIERIAEKVSSGG +LN+S+++VVEWMHKIQEWD  YFTL+HVP KYRLY
Sbjct  61    IIYDTVEIIQYIERIAEKVSSGGNNLNLSSREVVEWMHKIQEWDSMYFTLFHVPDKYRLY  120

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLRRVIIARMAE PDLAS+YH KLR+AY+T++KL NA V+R+ E+HLV+LLDEVE K
Sbjct  121   VSKFLRRVIIARMAESPDLASAYHCKLRDAYDTDDKLKNADVLRRCEDHLVRLLDEVEVK  180

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L E SYL GEEFSLADV+LIP+LARLQ+LNLE E+IN+RPN  DYW LVKQRPSYKKVIG
Sbjct  181   LGETSYLAGEEFSLADVVLIPVLARLQLLNLEDEYINSRPNTADYWMLVKQRPSYKKVIG  240

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYFDGWKR+KTLLKTWCF++ RSMLR+Y
Sbjct  241   RYFDGWKRRKTLLKTWCFIRIRSMLRKY  268



>ref|XP_009591543.1| PREDICTED: glutathione S-transferase TCHQD isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009591544.1| PREDICTED: glutathione S-transferase TCHQD isoform X1 [Nicotiana 
tomentosiformis]
Length=276

 Score =   434 bits (1115),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 217/268 (81%), Positives = 246/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHP SLDS KVRL LEEKGIDYTSHHVNP+TGKN+DTFFF +NPSAK+PVFQNGSH
Sbjct  9     MQLYHHPLSLDSQKVRLTLEEKGIDYTSHHVNPLTGKNMDTFFFSMNPSAKIPVFQNGSH  68

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             IIYDT+EIIQYIERIAEKVSSGG +LN+S+++VVEWMHKIQEWD  YFTL+HVP KYRLY
Sbjct  69    IIYDTVEIIQYIERIAEKVSSGGNNLNLSSREVVEWMHKIQEWDSMYFTLFHVPDKYRLY  128

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLRRVIIARMAE PDLAS+YH KLR+AY+T++KL NA V+R+ E+HLV+LLDEVE K
Sbjct  129   VSKFLRRVIIARMAESPDLASAYHCKLRDAYDTDDKLKNADVLRRCEDHLVRLLDEVEVK  188

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L E SYL GEEFSLADV+LIP+LARLQ+LNLE E+IN+RPN  DYW LVKQRPSYKKVIG
Sbjct  189   LGETSYLAGEEFSLADVVLIPVLARLQLLNLEDEYINSRPNTADYWMLVKQRPSYKKVIG  248

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYFDGWKR+KTLLKTWCF++ RSMLR+Y
Sbjct  249   RYFDGWKRRKTLLKTWCFIRIRSMLRKY  276



>ref|XP_009782495.1| PREDICTED: glutathione S-transferase TCHQD [Nicotiana sylvestris]
Length=268

 Score =   432 bits (1112),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 216/268 (81%), Positives = 246/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHP SLDS KVRL LEEKGIDYTSHHVNP+TGKN+D FFF +NPSAK+PVFQNGSH
Sbjct  1     MQLYHHPLSLDSQKVRLTLEEKGIDYTSHHVNPLTGKNMDAFFFSMNPSAKIPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             IIYDT+EIIQYIERIAEKVSSGG +LN+S+++VVEWMHKIQEWD  YFTL+HVP KYRLY
Sbjct  61    IIYDTVEIIQYIERIAEKVSSGGNNLNLSSREVVEWMHKIQEWDSMYFTLFHVPEKYRLY  120

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLRRVIIARMAE PDLAS+YH KLREAY+T++KL NA V+R+SE+HLV+LLDEVE K
Sbjct  121   VSKFLRRVIIARMAESPDLASAYHCKLREAYDTDDKLKNADVLRRSEDHLVRLLDEVEVK  180

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L E SYL GEEFSLADV+LIP+LARL++LNLE E+IN+RPN  DYW LVKQRPSYKKVIG
Sbjct  181   LGETSYLAGEEFSLADVVLIPVLARLELLNLEDEYINSRPNTADYWMLVKQRPSYKKVIG  240

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYFDGW+R+KTLLKTWCF++ RSMLR+Y
Sbjct  241   RYFDGWRRRKTLLKTWCFIRIRSMLRKY  268



>ref|XP_006357337.1| PREDICTED: glutathione S-transferase TCHQD-like [Solanum tuberosum]
Length=268

 Score =   426 bits (1096),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 211/268 (79%), Positives = 247/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHP+SL+S KVRL LEEKGIDYTSHHVNP+TGKN+D FFF +NPSAK+PVFQNGSH
Sbjct  1     MQLYHHPFSLNSQKVRLTLEEKGIDYTSHHVNPLTGKNMDAFFFSMNPSAKVPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             IIYDTIEIIQYIERIAEKVSSGG +LN+S+++V+ WMHKIQEWD  YFTL+HVP KYRL 
Sbjct  61    IIYDTIEIIQYIERIAEKVSSGGNNLNLSSREVIGWMHKIQEWDAMYFTLFHVPEKYRLC  120

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLRRVIIARMAE PDLAS+YH KLR+AY+T++KL NA+V+R+SE HLV+LLDEVE K
Sbjct  121   VSKFLRRVIIARMAESPDLASAYHCKLRQAYDTDDKLKNAEVLRRSENHLVRLLDEVELK  180

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L E SYL+GEEFSLADVMLIP+LAR+++LNLE E+IN+RPN+ DYW LVKQRPSYKKVIG
Sbjct  181   LGETSYLSGEEFSLADVMLIPVLARIELLNLEDEYINSRPNIADYWVLVKQRPSYKKVIG  240

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YFDGW+R+KTLLKTWCF++ RSMLR+Y
Sbjct  241   KYFDGWRRRKTLLKTWCFIRVRSMLRKY  268



>ref|XP_004237364.1| PREDICTED: glutathione S-transferase TCHQD [Solanum lycopersicum]
 ref|XP_004237365.1| PREDICTED: glutathione S-transferase TCHQD [Solanum lycopersicum]
Length=268

 Score =   422 bits (1086),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 210/268 (78%), Positives = 245/268 (91%), Gaps = 0/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHP+SL+S KVRL LEEKGIDYTSHHVNP+TGKN+D FFF +NPSAK+PVFQNGSH
Sbjct  1     MQLYHHPFSLNSQKVRLTLEEKGIDYTSHHVNPLTGKNMDAFFFSMNPSAKVPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             IIYDTIEIIQYIERIAEKVSSGG +LN+S+++V+ WMHKIQEWD  YFTL+HVP KYRL 
Sbjct  61    IIYDTIEIIQYIERIAEKVSSGGNNLNLSSREVIGWMHKIQEWDSMYFTLFHVPEKYRLC  120

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLRRVIIARMAE PDLAS+YH KLR+AY+T++KL NA V+R+SE HLV+LLDEVE K
Sbjct  121   VSKFLRRVIIARMAESPDLASAYHCKLRQAYDTDDKLKNADVLRRSENHLVRLLDEVELK  180

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L E SYL GEEFSLADVMLIP+LAR+++LNLE E+IN+RPN+ DYW LVKQRPSYKKVIG
Sbjct  181   LGETSYLAGEEFSLADVMLIPLLARIELLNLENEYINSRPNIADYWVLVKQRPSYKKVIG  240

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YFDGW+R+KTLLKTWCF++ RS+LR+Y
Sbjct  241   KYFDGWRRRKTLLKTWCFIRVRSVLRKY  268



>emb|CDP11933.1| unnamed protein product [Coffea canephora]
Length=267

 Score =   410 bits (1054),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 203/268 (76%), Positives = 239/268 (89%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVRLALEEKG+DYTSH VNPITGKN+D+FFFR+NPSA LPVFQNG+H
Sbjct  1     MQLYHHPYSLDSQKVRLALEEKGVDYTSHRVNPITGKNMDSFFFRLNPSANLPVFQNGAH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II+DT+EII+YIERIA  VSS G +  +SNQ+V+EWM+KIQ WDPKYFTL+H+PVKYR++
Sbjct  61    IIFDTVEIIKYIERIA-LVSSRGDNAELSNQEVIEWMNKIQAWDPKYFTLFHIPVKYRVF  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLRRVIIARM E PDLAS+YHRKLREAYETEEKL N +V+R+ EEHLV+LLDEVE K
Sbjct  120   VSKFLRRVIIARMTESPDLASAYHRKLREAYETEEKLRNVEVLRRCEEHLVRLLDEVETK  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L E SYL GEEF+LADVMLIP+LARL +LNL   +IN RPN+ +YW +V+QRPSYKKVIG
Sbjct  180   LGETSYLVGEEFTLADVMLIPVLARLVLLNLGESYINCRPNIAEYWNIVQQRPSYKKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYF+GW++Q TL++TWCF+  RSMLRRY
Sbjct  240   RYFNGWRQQITLMRTWCFLHIRSMLRRY  267



>ref|XP_006434293.1| hypothetical protein CICLE_v10002166mg [Citrus clementina]
 gb|ESR47533.1| hypothetical protein CICLE_v10002166mg [Citrus clementina]
Length=267

 Score =   396 bits (1017),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 194/268 (72%), Positives = 240/268 (90%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVRLALEEK IDYTS+HVNPITGKN+DT FFR+NP AKLPV +NG+H
Sbjct  1     MQLYHHPYSLDSQKVRLALEEKNIDYTSYHVNPITGKNMDTSFFRMNPRAKLPVLKNGAH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II++TIEIIQYIERI+  VSSG  D+N+S+++VV+WMHKIQ+WDPK+FTL H+P KYRLY
Sbjct  61    IIFNTIEIIQYIERIS-VVSSGADDMNLSSREVVQWMHKIQQWDPKFFTLDHIPEKYRLY  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
              SKF+RRV+IARMAE PDLAS+YHRKLREAYE E+KL N +V++ S+EHLV+LLDEVE K
Sbjct  120   TSKFIRRVVIARMAESPDLASAYHRKLREAYEIEDKLKNPEVLKWSKEHLVRLLDEVETK  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L++ +YL GEEF++ADVMLIP+ +RL++L+LE E+I+ RPN+ +YW L++QRPSYK VIG
Sbjct  180   LNDTAYLAGEEFTMADVMLIPVFSRLKLLDLEDEYISCRPNIAEYWVLMQQRPSYKMVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YFDGW++ KTLLKTWCFV+ RSMLRRY
Sbjct  240   KYFDGWRKYKTLLKTWCFVRIRSMLRRY  267



>ref|XP_011002441.1| PREDICTED: glutathione S-transferase TCHQD [Populus euphratica]
 ref|XP_011002442.1| PREDICTED: glutathione S-transferase TCHQD [Populus euphratica]
Length=266

 Score =   393 bits (1009),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 200/268 (75%), Positives = 240/268 (90%), Gaps = 2/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVRLALEEKGIDYTS+HVNPITGKN+D  FF IN SAKLPVFQNGSH
Sbjct  1     MQLYHHPYSLDSQKVRLALEEKGIDYTSNHVNPITGKNMDASFFGINQSAKLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II+DTIEIIQYIERIA  VS GG D + S+++VVEWM KIQEW+PKYFTL HVP KYR+ 
Sbjct  61    IIFDTIEIIQYIERIA--VSLGGGDSSFSSREVVEWMCKIQEWNPKYFTLSHVPEKYRIS  118

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+R+VIIARMAE P+LASSYH KL++AYETE++LGN +V+++SEEHLV+LLDEVE K
Sbjct  119   VSKFIRQVIIARMAESPELASSYHCKLKDAYETEDRLGNPEVLKRSEEHLVRLLDEVETK  178

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L E ++L GEEFS+ADVMLIP+LAR+ +LNLE E+I++RPN+ +YW L++QRPSYKKVIG
Sbjct  179   LKETAFLAGEEFSMADVMLIPVLARIVLLNLEDEYISSRPNIAEYWVLMQQRPSYKKVIG  238

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF+GW+R KTL+KTWCFV+ RS+LRRY
Sbjct  239   KYFNGWRRYKTLVKTWCFVRFRSLLRRY  266



>ref|XP_006472858.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472859.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X2 [Citrus 
sinensis]
 ref|XP_006472860.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X3 [Citrus 
sinensis]
 gb|KDO80474.1| hypothetical protein CISIN_1g024495mg [Citrus sinensis]
 gb|KDO80475.1| hypothetical protein CISIN_1g024495mg [Citrus sinensis]
Length=267

 Score =   392 bits (1006),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 193/268 (72%), Positives = 238/268 (89%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVRLALEEK IDYTS+HVNPITGKN+DT FFR+NP AKLPV +NG+H
Sbjct  1     MQLYHHPYSLDSQKVRLALEEKNIDYTSYHVNPITGKNMDTSFFRMNPRAKLPVLKNGAH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II++TIEIIQYIERI+  VSSG  D+N+S+++VV+WMHKIQ+WDPK+FTL  +P KYRLY
Sbjct  61    IIFNTIEIIQYIERIS-VVSSGADDMNLSSREVVQWMHKIQQWDPKFFTLDRIPEKYRLY  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
              SKF+RRV+IARMAE PDLAS+YHRKLREAYE E+KL N +V++ S+EHLV+LLDEVE K
Sbjct  120   TSKFIRRVVIARMAESPDLASAYHRKLREAYEIEDKLKNPEVLKWSKEHLVRLLDEVETK  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L++ +YL GEEF++ADVMLIP+ +RL++L+LE E+I+ RPN+ +YW L++QRPSYK VIG
Sbjct  180   LNDTAYLAGEEFTMADVMLIPVFSRLKLLDLEDEYISCRPNIAEYWVLMQQRPSYKMVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
              YFDGW++ KTLLKTWCFV+ RSMLRRY
Sbjct  240   NYFDGWRKYKTLLKTWCFVRIRSMLRRY  267



>gb|KDP32864.1| hypothetical protein JCGZ_12156 [Jatropha curcas]
Length=266

 Score =   391 bits (1005),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 197/268 (74%), Positives = 241/268 (90%), Gaps = 2/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHP+SLDS KVRLALEEKG+DYTSHHVNPITGKN+D+ FFR NPSAKLPVFQNGSH
Sbjct  1     MQLYHHPFSLDSQKVRLALEEKGVDYTSHHVNPITGKNMDSSFFRKNPSAKLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II+DTIEIIQYIERIA  VS+G  + + S+++VVEWMHKIQEW+PK+FT  H+P KYRL 
Sbjct  61    IIFDTIEIIQYIERIA-VVSAGADEASFSSREVVEWMHKIQEWNPKFFT-SHIPQKYRLT  118

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV+IARMAE PDLAS+YHRKL+EAYETE+KL + +V+++S+EHLV+LLDEVE K
Sbjct  119   VSKFIRRVVIARMAESPDLASAYHRKLKEAYETEDKLKDPEVLKRSKEHLVRLLDEVETK  178

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L+  SYLTGEEFS+AD MLIP+LARL +LNLE E+I++RPN+ +YW LV+QRPSY+KVIG
Sbjct  179   LNGTSYLTGEEFSMADAMLIPVLARLVLLNLENEYISSRPNIAEYWILVQQRPSYRKVIG  238

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF+GW++ KTL KTWCFV+ RS+LR+Y
Sbjct  239   KYFNGWRKYKTLTKTWCFVRFRSLLRKY  266



>ref|XP_002306652.1| tetrachloro-p-hydroquinone reductive dehalogenase-related family 
protein [Populus trichocarpa]
 ref|XP_006383591.1| hypothetical protein POPTR_0005s20450g [Populus trichocarpa]
 gb|EEE93648.1| tetrachloro-p-hydroquinone reductive dehalogenase-related family 
protein [Populus trichocarpa]
 gb|ADB11385.1| TCHQD class glutathione transferase TCHOD1 [Populus trichocarpa]
 gb|ERP61388.1| hypothetical protein POPTR_0005s20450g [Populus trichocarpa]
Length=267

 Score =   389 bits (1000),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 199/268 (74%), Positives = 237/268 (88%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVRLALEEKGIDYTS+HVNPITGKN+D  FF IN SAKLPVFQNGSH
Sbjct  1     MQLYHHPYSLDSQKVRLALEEKGIDYTSNHVNPITGKNMDASFFGINQSAKLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II+DTIEIIQYIERI   VS GG D + S+++VVEWM KIQEW+PKYFTL HVP KYR+ 
Sbjct  61    IIFDTIEIIQYIERIV-VVSLGGGDSSFSSREVVEWMCKIQEWNPKYFTLSHVPEKYRIS  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+R+VIIARMAE P+LAS+YHRKL+ AYETE++LGN +V+++S+EHLV+LLDEVE K
Sbjct  120   VSKFIRQVIIARMAESPELASAYHRKLKAAYETEDRLGNPEVLKRSKEHLVRLLDEVETK  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L E +YL GEEFS+ADVMLIP+LARL +L LE E+I++RPN+  YW L++QRPSYKKVIG
Sbjct  180   LKETAYLAGEEFSMADVMLIPVLARLVLLKLEDEYISSRPNIAAYWVLMQQRPSYKKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF+GW+R KTL+KTWCFV+ RS+LRRY
Sbjct  240   KYFNGWRRYKTLVKTWCFVRFRSLLRRY  267



>ref|XP_008444209.1| PREDICTED: glutathione S-transferase TCHQD [Cucumis melo]
 ref|XP_008444210.1| PREDICTED: glutathione S-transferase TCHQD [Cucumis melo]
 ref|XP_008444211.1| PREDICTED: glutathione S-transferase TCHQD [Cucumis melo]
 ref|XP_008444212.1| PREDICTED: glutathione S-transferase TCHQD [Cucumis melo]
Length=267

 Score =   389 bits (998),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 191/268 (71%), Positives = 234/268 (87%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVRLALEE+ IDYTS+HVNPIT KN+D+ FF+INPSAKLPVFQNGSH
Sbjct  1     MQLYHHPYSLDSQKVRLALEEQSIDYTSYHVNPITAKNMDSSFFKINPSAKLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II+DTIEIIQYIERIA  VSSG  D+  S+++VVEWMHKIQ+W+PK+FTL H+P KYRL 
Sbjct  61    IIFDTIEIIQYIERIA-IVSSGTDDIMPSSREVVEWMHKIQQWNPKFFTLSHIPEKYRLT  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             V++F+RRV+IARMAE P++A++YHRKLREAY+TE+KL N  VV+QS +HLV LLDEVE K
Sbjct  120   VTRFIRRVVIARMAETPEMAAAYHRKLREAYDTEDKLKNKSVVKQSTDHLVALLDEVESK  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LSE SYL GEEF++AD + IP+LARL++L L  E+I +RPN+ +YW LV+QRPSYKKVIG
Sbjct  180   LSETSYLAGEEFTMADAIFIPVLARLELLKLADEYIGSRPNIAEYWTLVQQRPSYKKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF GW++ KTLLKTWCF+  R++LRRY
Sbjct  240   KYFKGWRKHKTLLKTWCFIHIRTLLRRY  267



>ref|XP_002520306.1| ganglioside-induced differentiation-associated protein 1, 2 gdap, 
putative [Ricinus communis]
 gb|EEF42092.1| ganglioside-induced differentiation-associated protein 1, 2 gdap, 
putative [Ricinus communis]
Length=267

 Score =   388 bits (996),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 191/268 (71%), Positives = 239/268 (89%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQ YHHPYSLDS KVRLALEEKGIDYTSH +NPITGKN+D  FFRINP AKLPVFQNG+H
Sbjct  1     MQFYHHPYSLDSQKVRLALEEKGIDYTSHRINPITGKNMDASFFRINPRAKLPVFQNGTH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II+DTIEIIQYIERIA  VS+G  + + S+++VVEWMHKIQEW+PK+FTL H+P KYR  
Sbjct  61    IIFDTIEIIQYIERIA-VVSAGADESSFSSREVVEWMHKIQEWNPKFFTLSHIPEKYRRT  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV+IARMAE PDLAS+YHRKL+EAYETE+KL N++V+++S+EHL+++LDEVE K
Sbjct  120   VSKFIRRVVIARMAESPDLASAYHRKLKEAYETEDKLKNSEVLKRSKEHLIRILDEVETK  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L E +YL+GEEFS+AD MLIP+LARL +LNLE E+I++RPN+ +YW LV+QRPSY+KVIG
Sbjct  180   LHETAYLSGEEFSMADAMLIPVLARLVLLNLEDEYISSRPNIAEYWVLVQQRPSYRKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF+GW++ KTL++TW FV+ RS+LR+Y
Sbjct  240   KYFNGWRKYKTLIRTWYFVRLRSLLRKY  267



>ref|XP_004142639.1| PREDICTED: glutathione S-transferase TCHQD-like isoform 1 [Cucumis 
sativus]
 ref|XP_004142640.1| PREDICTED: glutathione S-transferase TCHQD-like isoform 2 [Cucumis 
sativus]
 ref|XP_004161158.1| PREDICTED: glutathione S-transferase TCHQD-like isoform 1 [Cucumis 
sativus]
 ref|XP_004161159.1| PREDICTED: glutathione S-transferase TCHQD-like isoform 2 [Cucumis 
sativus]
 gb|KGN54538.1| hypothetical protein Csa_4G358760 [Cucumis sativus]
Length=267

 Score =   386 bits (992),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 191/268 (71%), Positives = 234/268 (87%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVRLALEE+ IDYTS+HVNPIT KN+D+ FF+INPSAKLPVFQNGSH
Sbjct  1     MQLYHHPYSLDSQKVRLALEEQSIDYTSYHVNPITAKNMDSSFFKINPSAKLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II+DTIEIIQYIERIA  VSSG  ++  S+++VVEWMHKIQEW+PKYFTL H+P KYRL 
Sbjct  61    IIFDTIEIIQYIERIA-VVSSGTDEIMPSSREVVEWMHKIQEWNPKYFTLAHIPEKYRLT  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             V++F+RRV+I+RMAE P++A++YHRKLREAYETE+KL N  VV+QS +HLV LLDE+E K
Sbjct  120   VTRFIRRVVISRMAETPEMAAAYHRKLREAYETEDKLKNKSVVKQSTDHLVALLDEIELK  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LSE SY+ GEEF++AD + IP+LARL++L L  E+I +RPN+ +YW LV+QRPSYKKVIG
Sbjct  180   LSETSYIAGEEFTMADAVFIPVLARLELLKLADEYIGSRPNISEYWILVQQRPSYKKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF GW++ KTLLKTWCFV  R++LRRY
Sbjct  240   KYFKGWRKHKTLLKTWCFVHIRTLLRRY  267



>ref|XP_011102151.1| PREDICTED: glutathione S-transferase TCHQD [Sesamum indicum]
Length=267

 Score =   384 bits (985),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 193/268 (72%), Positives = 237/268 (88%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVR+ALEEK IDYTS HVNPITGKN D+ FFR+NPSAKLPVFQNGSH
Sbjct  1     MQLYHHPYSLDSQKVRIALEEKNIDYTSFHVNPITGKNFDSSFFRMNPSAKLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             I+YDT+EIIQYIERIA  VSSGG +  +S+ +VVEW++KIQ+W+PK+FTL HVP KYRL 
Sbjct  61    ILYDTVEIIQYIERIA-MVSSGGDESTLSSGEVVEWIYKIQQWNPKFFTLSHVPPKYRLS  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             V+KFLRRVIIARMAECP+LAS+YHRKL+EAYETEEKL + +V+R SEEHL ++LDE E K
Sbjct  120   VTKFLRRVIIARMAECPELASAYHRKLKEAYETEEKLKDPEVLRWSEEHLERILDEAERK  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LSE++YL GEEF+LADV  IP+L+RL ++NLE ++INTR N+ +YW +V++RPSY+KVIG
Sbjct  180   LSESTYLVGEEFTLADVAFIPLLSRLALMNLEEKYINTRLNVAEYWNVVQERPSYRKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF GW+R KTLLKTWCFV+ RS+L++Y
Sbjct  240   KYFHGWRRHKTLLKTWCFVRIRSLLKQY  267



>gb|KEH35352.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=267

 Score =   380 bits (976),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 186/268 (69%), Positives = 230/268 (86%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHP+ LDS KVRLALEEKGIDYTS H NP+TGKNLD+ FF++NPS  LPVFQNGSH
Sbjct  1     MQLYHHPFDLDSQKVRLALEEKGIDYTSFHTNPVTGKNLDSLFFQMNPSGSLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             IIY TI+IIQYIERIA  VS+G  D++ +  +V+EWM +IQEWDPKYF+L H+P K+R+Y
Sbjct  61    IIYKTIDIIQYIERIA-VVSAGSEDISSNRSEVIEWMKRIQEWDPKYFSLSHIPEKHRVY  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLRRV+IARM+E P+LA +YHRKLREAY+TEEKL +  V+R+SEEHLV+LLD+ E +
Sbjct  120   VSKFLRRVVIARMSESPELAGAYHRKLREAYQTEEKLKDPHVLRRSEEHLVRLLDDAERQ  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LSE  YL GEEFS+ADVMLIPILARL++L+LE E++  RPN+ +YW LV+QRPSY+KVI 
Sbjct  180   LSETPYLAGEEFSMADVMLIPILARLKLLDLENEYVTVRPNIAEYWILVQQRPSYRKVIA  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             ++FDGW++ KTL KTWCFV  RS+L+RY
Sbjct  240   KHFDGWRKHKTLFKTWCFVHIRSLLKRY  267



>ref|XP_010055964.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010055965.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010055966.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010055967.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010055968.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW72538.1| hypothetical protein EUGRSUZ_E01005 [Eucalyptus grandis]
Length=267

 Score =   379 bits (974),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 190/268 (71%), Positives = 231/268 (86%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVRLALEEKGIDYTS H+NPITGKNL   FFR+NP+AKLPVFQNGSH
Sbjct  1     MQLYHHPYSLDSQKVRLALEEKGIDYTSFHMNPITGKNLRPSFFRMNPTAKLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +I+DTIEIIQYIERIA  VS     +  S+ +V++WMH+IQEW+PK+FTL HVP KYR  
Sbjct  61    VIFDTIEIIQYIERIA-VVSVNNDSIAFSSDEVIQWMHRIQEWNPKFFTLSHVPEKYRQA  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF RRV+IARMAE PDLASSYHRKL+EAY TEEKL + +VVR+S+EHL++LLDE+E +
Sbjct  120   VSKFNRRVLIARMAESPDLASSYHRKLKEAYHTEEKLRDPEVVRRSQEHLIRLLDEIEDR  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LSE +Y+ GEEFS+ADVM IP+LARL +LNLE E+IN+RPN+ +YW+ V+QRPSYKKVIG
Sbjct  180   LSETAYIAGEEFSMADVMFIPVLARLALLNLEDEYINSRPNMAEYWSSVQQRPSYKKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYF GW++ KTL KTWCF++ R+ L++Y
Sbjct  240   RYFGGWRKYKTLAKTWCFIRLRNTLKKY  267



>ref|XP_007019224.1| Glutathione S-transferase family protein [Theobroma cacao]
 gb|EOY16449.1| Glutathione S-transferase family protein [Theobroma cacao]
Length=267

 Score =   379 bits (973),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 188/268 (70%), Positives = 232/268 (87%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHP+SLDS KVRLALEEKGIDYTS HVNPI GKN+D+ FFR+N SAKLPVF+NGSH
Sbjct  1     MQLYHHPFSLDSQKVRLALEEKGIDYTSFHVNPIVGKNMDSSFFRMNSSAKLPVFKNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
              I+DTIEII YIERIA  VS G   +  S+++V+EWM KIQEW+PKYFTL H+P KYR +
Sbjct  61    TIFDTIEIILYIERIA-VVSVGNNGIAFSSEEVIEWMRKIQEWNPKYFTLSHIPDKYRTF  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+R+V+IARMAE PDLAS+YH KLREAYETEEKL NA V+R+S+EHLV+LLDEVE K
Sbjct  120   VSKFIRKVVIARMAESPDLASAYHCKLREAYETEEKLKNADVLRRSKEHLVQLLDEVETK  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L+E +YL G+EF++ADVMLIP+LARL +L+LE E+I +RPN+  YW LV+QRPSYKKVIG
Sbjct  180   LNETTYLVGDEFTMADVMLIPVLARLVLLDLEDEYIFSRPNIAGYWGLVQQRPSYKKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF+GW+++KTL+K WC +  R++L+RY
Sbjct  240   KYFNGWRKRKTLVKAWCILHIRNLLKRY  267



>ref|XP_010087184.1| Glutathione S-transferase TCHQD [Morus notabilis]
 gb|EXB28441.1| Glutathione S-transferase TCHQD [Morus notabilis]
Length=267

 Score =   378 bits (971),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 187/268 (70%), Positives = 234/268 (87%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSL+S +VRLALEEKGIDYTS HVNPITGKN+D  FFR+NPSAKLPVFQNG H
Sbjct  1     MQLYHHPYSLNSQRVRLALEEKGIDYTSFHVNPITGKNMDATFFRMNPSAKLPVFQNGGH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II++TIEIIQY+ERIA  VSSGG ++  S+++V+EWM KI+EW+PK+ TL H+P KYR Y
Sbjct  61    IIFNTIEIIQYVERIA-VVSSGGDNITCSSREVIEWMQKIKEWNPKFLTLAHIPDKYRDY  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRVIIARMAE PDLAS+YH KL+EAYETEEKL N  V+ + +E L +LLDEVE +
Sbjct  120   VSKFIRRVIIARMAEFPDLASAYHNKLKEAYETEEKLKNPDVLERDKERLTRLLDEVETQ  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L+E +YL GEEF++ADVMLIP+L+RL +LNLE E+I+TRPN+ +YW LV QRPSY+KVIG
Sbjct  180   LNETAYLVGEEFTMADVMLIPVLSRLVLLNLEEEYISTRPNISEYWILVLQRPSYEKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             ++F+GW++ KTL+KTWCFV+ R++LRR+
Sbjct  240   KHFNGWRKYKTLIKTWCFVRVRTVLRRF  267



>ref|XP_004502542.1| PREDICTED: glutathione S-transferase TCHQD-like [Cicer arietinum]
Length=267

 Score =   378 bits (970),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 189/268 (71%), Positives = 229/268 (85%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQL+HHP+ LDS KVRLALEEKGIDYTS+HVNPITGKN D+ FF++NPS  LPVFQNGSH
Sbjct  1     MQLHHHPFDLDSQKVRLALEEKGIDYTSYHVNPITGKNFDSLFFQMNPSGSLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             IIY TI+IIQYIERIA  VS+G  D++ S  +V+ WM KIQEWDPKYF+L H+P KYR+ 
Sbjct  61    IIYKTIDIIQYIERIA-VVSTGSEDISSSRSEVIGWMQKIQEWDPKYFSLSHIPEKYRVS  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRVIIARM+E P+LA +YHRKLREAY+TEEKL +  V+R+S+EHLV+LLDE E +
Sbjct  120   VSKFIRRVIIARMSESPELAGAYHRKLREAYQTEEKLKDPDVLRRSKEHLVRLLDEAERQ  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LSEA YL GEEFS+ADVMLIP+LARL +L+LE E+I  RPN+ +YW LV+QRPSY KVI 
Sbjct  180   LSEAPYLAGEEFSMADVMLIPVLARLVLLDLENEYITGRPNIAEYWVLVQQRPSYIKVIA  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             ++FDGW++ KTLLKTWCFV  RS+L+RY
Sbjct  240   KHFDGWRKHKTLLKTWCFVCVRSLLKRY  267



>ref|XP_010678905.1| PREDICTED: glutathione S-transferase TCHQD isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010678908.1| PREDICTED: glutathione S-transferase TCHQD isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=267

 Score =   377 bits (967),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 183/268 (68%), Positives = 234/268 (87%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHP+SLDS KVRLALEE GIDYTS+H+NPIT KN+D  FFR+NPS KLPVFQNGSH
Sbjct  1     MQLYHHPFSLDSQKVRLALEENGIDYTSYHINPITAKNMDASFFRMNPSGKLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             IIY+TIEI+QY+ERIA  VSS G  + +S+++V+EWMHKIQEW+PKYFTL HVP K+RLY
Sbjct  61    IIYNTIEIVQYLERIA-AVSSVGDGITLSSREVIEWMHKIQEWNPKYFTLSHVPEKHRLY  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             V+KF R+V+IARMAE PDLAS+YH +LR+AY+TEEKL + +V  +S+EHLV+LLD VE +
Sbjct  120   VTKFTRQVVIARMAEFPDLASAYHLRLRDAYDTEEKLQDPEVTLRSQEHLVRLLDAVETQ  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L++ SYL GE+F++ADVMLIP+LARL +L LE E+I+ RPN+ +YW +V+QRPSYK+VIG
Sbjct  180   LNDNSYLAGEKFTMADVMLIPVLARLVLLKLEHEYIDNRPNISEYWKMVQQRPSYKRVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YFDGW+RQKTL KTWC++  R++L++Y
Sbjct  240   KYFDGWRRQKTLTKTWCYIHMRNLLKKY  267



>ref|XP_007137478.1| hypothetical protein PHAVU_009G130200g [Phaseolus vulgaris]
 ref|XP_007137479.1| hypothetical protein PHAVU_009G130200g [Phaseolus vulgaris]
 gb|ESW09472.1| hypothetical protein PHAVU_009G130200g [Phaseolus vulgaris]
 gb|ESW09473.1| hypothetical protein PHAVU_009G130200g [Phaseolus vulgaris]
Length=267

 Score =   376 bits (966),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 184/268 (69%), Positives = 230/268 (86%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHH + LDS KVRLALEEK IDYTSHHVNP+TGKNLD+ FF++NP  +LPVFQNGSH
Sbjct  1     MQLYHHAFDLDSQKVRLALEEKSIDYTSHHVNPVTGKNLDSSFFKMNPGGRLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             I+Y TI+IIQYIERIA   SSG  ++  SN++V+EWM K+QEW+PKYF+L HVP KYR+Y
Sbjct  61    ILYKTIDIIQYIERIA-VFSSGSENITSSNKEVIEWMQKVQEWNPKYFSLSHVPEKYRIY  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLRRV IARM+E P+LA +YHRKL+EAY+TEEKL  + V+ +S+EHL++LLDE E +
Sbjct  120   VSKFLRRVAIARMSESPELAGAYHRKLKEAYQTEEKLKESDVLIRSKEHLIRLLDEAERQ  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LSE  YL G+EF++ADVMLIP+L+RL +L+LE E+I  RPN+ +YW LV+QRPSY+KVIG
Sbjct  180   LSETPYLAGQEFTMADVMLIPVLSRLVLLDLENEYITGRPNIAEYWVLVQQRPSYRKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYFDGWK+ KTLLKTWCFV+ RS+L+R+
Sbjct  240   RYFDGWKKHKTLLKTWCFVRLRSLLKRF  267



>ref|XP_003526655.1| PREDICTED: glutathione S-transferase TCHQD-like [Glycine max]
 gb|KHN46983.1| Glutathione S-transferase TCHQD [Glycine soja]
Length=267

 Score =   374 bits (961),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 189/268 (71%), Positives = 232/268 (87%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHP+ LDS KVRLALEEKGIDYTSHH NPITGKNLD+ FF +NP  +LPVFQNGSH
Sbjct  1     MQLYHHPFDLDSQKVRLALEEKGIDYTSHHANPITGKNLDSSFFNMNPGGRLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             I+Y TI+IIQYIERIA   SSG  +++ S+++V+EWM KIQEWDPKYF+L H+P KYR+Y
Sbjct  61    ILYKTIDIIQYIERIA-VFSSGSENISSSSREVIEWMQKIQEWDPKYFSLSHIPEKYRIY  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLRRV+IARM+E P+LA +YH+KL+EAY+TEEKL  A V+R+S+EHL++LLDE E +
Sbjct  120   VSKFLRRVVIARMSESPELAGAYHKKLKEAYQTEEKLKEAAVLRRSKEHLIRLLDEAERQ  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LSE  YL GEEF++ADVMLIP+LARL +L+LE E+I  RPN+ +YW  V+QRPSY+KVIG
Sbjct  180   LSETPYLAGEEFTMADVMLIPVLARLVLLDLENEYITGRPNIAEYWVFVQQRPSYRKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYFDGWK+ KTLLKTWCFV+ RS+L+RY
Sbjct  240   RYFDGWKKHKTLLKTWCFVRIRSLLKRY  267



>ref|XP_007223128.1| hypothetical protein PRUPE_ppa010018mg [Prunus persica]
 gb|EMJ24327.1| hypothetical protein PRUPE_ppa010018mg [Prunus persica]
Length=267

 Score =   373 bits (957),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 181/268 (68%), Positives = 231/268 (86%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHP+SLDS +VRLALEEKGIDYTS HVNP+TGKN+D  FFR+N +AKLPVFQNG H
Sbjct  1     MQLYHHPFSLDSQRVRLALEEKGIDYTSFHVNPVTGKNMDASFFRMNSTAKLPVFQNGGH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +I+DTIEIIQY+E+IA KVSSG  ++ +S+ +V+EWMHKIQ+W+PK+FTL H+P K+R Y
Sbjct  61    VIFDTIEIIQYLEKIA-KVSSGDENIPLSSSEVIEWMHKIQKWNPKFFTLCHIPEKHRRY  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLR+V+IARMAE PDLA+ YH+KL+EAYETEEKL N  V++Q +EHL++LLDEVE +
Sbjct  120   VSKFLRQVLIARMAETPDLAADYHKKLKEAYETEEKLKNPDVLKQDKEHLIRLLDEVETQ  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L+E +YL G+EF +ADVMLIP+LARL +LNLE E+I  RPN+  YW +V+QRPSYKKVIG
Sbjct  180   LNETAYLAGKEFGMADVMLIPVLARLVILNLEDEYIGGRPNMAKYWIMVQQRPSYKKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             ++F GW++ KT +KTWC V  R+MLR++
Sbjct  240   KHFCGWRKHKTFVKTWCIVHIRTMLRKF  267



>ref|XP_002285883.1| PREDICTED: glutathione S-transferase TCHQD [Vitis vinifera]
 ref|XP_010664161.1| PREDICTED: glutathione S-transferase TCHQD [Vitis vinifera]
 emb|CBI18963.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   372 bits (954),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/268 (69%), Positives = 229/268 (85%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVRL LEE GIDYTS+ VNPITGKN++  FFR+NPSAKLPVFQNGSH
Sbjct  1     MQLYHHPYSLDSQKVRLTLEENGIDYTSYRVNPITGKNMEPSFFRLNPSAKLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II+DTI+I+QYIERIA   + G  ++ +S+Q+V+EWM +IQ WDPKYFTL+H+P KYR  
Sbjct  61    IIFDTIDIMQYIERIA-VFTLGSENVTLSSQEVIEWMQRIQAWDPKYFTLFHIPEKYRFT  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV+IARMAE PDLA SYH KL E YETE+KL +  V++QS+E L ++LDEVE K
Sbjct  120   VSKFIRRVVIARMAESPDLAGSYHLKLDEVYETEDKLRDPDVLKQSKEQLAEILDEVERK  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L+E++YL G+EF++ADVMLIP+LAR+ +L+LE E+I +RPN+ +YW LV+QRPSYKKVIG
Sbjct  180   LNESTYLAGDEFTMADVMLIPVLARIVLLDLEEEYICSRPNIAEYWNLVQQRPSYKKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
              YF GW++ KTLLKTWCFV+ RSML+RY
Sbjct  240   NYFSGWRKYKTLLKTWCFVRVRSMLKRY  267



>ref|XP_010537355.1| PREDICTED: glutathione S-transferase TCHQD [Tarenaya hassleriana]
 ref|XP_010537356.1| PREDICTED: glutathione S-transferase TCHQD [Tarenaya hassleriana]
 ref|XP_010537357.1| PREDICTED: glutathione S-transferase TCHQD [Tarenaya hassleriana]
 ref|XP_010537358.1| PREDICTED: glutathione S-transferase TCHQD [Tarenaya hassleriana]
Length=267

 Score =   370 bits (950),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 185/269 (69%), Positives = 233/269 (87%), Gaps = 3/269 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS +VRLALEE+GIDYTS+HVNPITGK++D+ FFR+NP+AKLPVF+NGSH
Sbjct  1     MQLYHHPYSLDSQRVRLALEERGIDYTSYHVNPITGKHMDSSFFRMNPNAKLPVFKNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +I DTIEII+Y+ERIA  V S G +    +++V+EWM KI+EWDPK FTL H+P K+RLY
Sbjct  61    VILDTIEIIEYLERIA--VVSSGTEGTTFSREVLEWMRKIREWDPKLFTLSHIPEKHRLY  118

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLRRV+IARMAE PD+AS+YHRKLREAYETE+KL + + VR+SE+HL +LLDEVE K
Sbjct  119   VSKFLRRVVIARMAESPDMASAYHRKLREAYETEDKLKDPEAVRRSEQHLTRLLDEVENK  178

Query  780   LSEAS-YLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
             LSE S YL G+EFS+ADVML+P+LAR+ +LNLE E+IN R +L +YW +V++RPSYK VI
Sbjct  179   LSETSGYLVGDEFSMADVMLVPVLARVSLLNLEEEYINVRQSLSEYWRMVQKRPSYKVVI  238

Query  957   GRYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             GR+F GW+R +TL+KTW FV+ RS+LR+Y
Sbjct  239   GRHFTGWRRYRTLVKTWFFVKIRSLLRKY  267



>ref|XP_010023524.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW59815.1| hypothetical protein EUGRSUZ_H02561 [Eucalyptus grandis]
 gb|KCW59816.1| hypothetical protein EUGRSUZ_H02561 [Eucalyptus grandis]
Length=283

 Score =   367 bits (942),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 188/284 (66%), Positives = 230/284 (81%), Gaps = 17/284 (6%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVRLALEEKGIDYTS H+NPITGKNL   FFR+NP+AKLPVFQNGSH
Sbjct  1     MQLYHHPYSLDSQKVRLALEEKGIDYTSFHMNPITGKNLRPSFFRMNPTAKLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +I+DTIEIIQYI+RIA  VS     +  S+ +V++WMHKIQEW+PK+FTL HVP KYR  
Sbjct  61    VIFDTIEIIQYIKRIA-VVSVNNDSIAFSSDEVIQWMHKIQEWNPKFFTLSHVPEKYRQA  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVE--  773
             VSKF RRV+IARMAE PDLASSYHRKL+EAY TEEKL + +VVR+S+EHL++LLDE+E  
Sbjct  120   VSKFFRRVLIARMAESPDLASSYHRKLKEAYHTEEKLRDPEVVRRSKEHLIRLLDEIEDS  179

Query  774   --------------GKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFD  911
                            +LS+ +Y+ GEEFS+ADVM IP+LARL +LNLE E+IN+RPN+  
Sbjct  180   LSKTYIAGEEFSMADRLSKTAYIAGEEFSMADVMFIPVLARLALLNLEDEYINSRPNMAK  239

Query  912   YWALVKQRPSYKKVIGRYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
              W+LV+QRPSYKKVIGRYF GW++ +TL KTWCF++ R+ L++Y
Sbjct  240   DWSLVQQRPSYKKVIGRYFGGWRKYRTLAKTWCFIRLRNTLKKY  283



>ref|XP_010070592.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010070593.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010070594.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW59454.1| hypothetical protein EUGRSUZ_H02194 [Eucalyptus grandis]
 gb|KCW59455.1| hypothetical protein EUGRSUZ_H02194 [Eucalyptus grandis]
Length=283

 Score =   366 bits (939),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 189/284 (67%), Positives = 229/284 (81%), Gaps = 17/284 (6%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVRLALEEKGIDYTS H+NPITGKNL   FFR+NP+AKLPVFQNGSH
Sbjct  1     MQLYHHPYSLDSQKVRLALEEKGIDYTSFHMNPITGKNLRPSFFRMNPTAKLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +I+DTIEIIQYIER A  VS     +  S+ +V++WMHKIQEW+PK+FTL HVP KYR  
Sbjct  61    VIFDTIEIIQYIERNA-VVSVNNDSIAFSSDEVIQWMHKIQEWNPKFFTLSHVPEKYRQA  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVE--  773
             VSKF RRV+IARMAE PDLASSYHRKL+EAY TEEKL + +VVR+S+EHL++LLDE+E  
Sbjct  120   VSKFFRRVLIARMAESPDLASSYHRKLKEAYHTEEKLRDPEVVRRSKEHLIRLLDEIEDS  179

Query  774   --------------GKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFD  911
                            +LS+ +Y+ GEEFS+ADVM IP+LARL +LNLE E+IN+RPN+  
Sbjct  180   LSKTYIAGEEFSMADRLSKTAYIAGEEFSMADVMFIPVLARLALLNLEDEYINSRPNMAK  239

Query  912   YWALVKQRPSYKKVIGRYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             YW+LV+QRPSYKKVIGRYF GW++ +TL KTWCF+  R+ L++Y
Sbjct  240   YWSLVQQRPSYKKVIGRYFGGWRKYRTLAKTWCFIWLRNTLKKY  283



>gb|EYU32495.1| hypothetical protein MIMGU_mgv1a026583mg [Erythranthe guttata]
Length=267

 Score =   365 bits (937),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 192/268 (72%), Positives = 227/268 (85%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVR+ALEEK IDYTS HVNPITGKN D+ FFR NPSAKLPVFQNGSH
Sbjct  1     MQLYHHPYSLDSQKVRIALEEKNIDYTSFHVNPITGKNFDSRFFRKNPSAKLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             I YDTIEIIQYIERIA  VSSG  +  +S+ ++VEWM++IQ W+PK FTL +VP KYRL 
Sbjct  61    IFYDTIEIIQYIERIA-MVSSGFDESTLSSGEIVEWMYEIQRWNPKIFTLSNVPPKYRLS  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLR VIIARMAECP+LASSYH KL+EAYETE+KL + QV+ +SEE L ++LDE E K
Sbjct  120   VSKFLRGVIIARMAECPELASSYHLKLKEAYETEDKLRDPQVIVRSEEQLERILDEAERK  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LSE  YL GEEF+LADV+ +P+L+RL VLNLE ++I TRPNL +YW LV++RPSYKKVIG
Sbjct  180   LSERKYLIGEEFTLADVVFVPVLSRLAVLNLEEKYIETRPNLREYWNLVQKRPSYKKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYF GW++ +TLLKTW FVQ RS+L++Y
Sbjct  240   RYFHGWRKHRTLLKTWYFVQIRSLLKQY  267



>ref|XP_003542060.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X1 [Glycine 
max]
 ref|XP_006593807.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X2 [Glycine 
max]
 ref|XP_006593808.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X3 [Glycine 
max]
 ref|XP_006593809.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X4 [Glycine 
max]
 gb|KHN05160.1| Glutathione S-transferase TCHQD [Glycine soja]
Length=267

 Score =   365 bits (937),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 184/268 (69%), Positives = 228/268 (85%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHP  LDS +VR ALEE+G+DYTSHHVNPITGKNLD+ FF++N   ++PVFQNGSH
Sbjct  1     MQLYHHPLDLDSQRVRFALEEEGVDYTSHHVNPITGKNLDSSFFKMNRHGRVPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             IIY+TI+IIQYIERIA  VSSG   ++ S+++VVEWM KI +WDPK+FTL H+P KYRLY
Sbjct  61    IIYNTIDIIQYIERIA-VVSSGVESISASSREVVEWMQKIHDWDPKFFTLSHIPEKYRLY  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+R+V IARM+E P+LAS YHRKL+EAYETEEKL  A V+R+S+EHLV LLDEVE +
Sbjct  120   VSKFIRQVAIARMSESPELASDYHRKLKEAYETEEKLKEADVLRRSKEHLVILLDEVERQ  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LSE  YL G+EF++ADVMLIP+L RL++L+LE E+I  RPN+ +YW LV+QRPSYKKVIG
Sbjct  180   LSETPYLAGQEFTMADVMLIPVLVRLKLLDLENEYITGRPNIAEYWILVQQRPSYKKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF+GW++ KTLLKTW  V+ RS L+RY
Sbjct  240   KYFNGWRKHKTLLKTWFLVRIRSFLKRY  267



>ref|XP_007161431.1| hypothetical protein PHAVU_001G068100g [Phaseolus vulgaris]
 ref|XP_007161432.1| hypothetical protein PHAVU_001G068100g [Phaseolus vulgaris]
 gb|ESW33425.1| hypothetical protein PHAVU_001G068100g [Phaseolus vulgaris]
 gb|ESW33426.1| hypothetical protein PHAVU_001G068100g [Phaseolus vulgaris]
Length=267

 Score =   364 bits (935),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/268 (66%), Positives = 229/268 (85%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHP  LDS +VR++LEE+G+DYTSHHVNPITGKNLD+ FF++N   ++PVFQNGSH
Sbjct  1     MQLYHHPLDLDSQRVRISLEEEGVDYTSHHVNPITGKNLDSSFFKMNRRGRVPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             IIY+TI+IIQYIERIA  VSSG   ++ SN++V+EWM KIQEWDPK+FTL H+P KYR+Y
Sbjct  61    IIYNTIDIIQYIERIA-VVSSGAESISTSNREVMEWMQKIQEWDPKFFTLAHIPEKYRIY  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+R+V+IARM+E P+LA  YHRKLREAYETEEKL  A V+R+S+EHL +LLDEVE +
Sbjct  120   VSKFIRQVVIARMSESPELAGDYHRKLREAYETEEKLKEADVLRRSKEHLFRLLDEVERQ  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L E  +L G++F++ADVMLIP+LAR+++L+LE E+I  RPN+ +YW LV+QRPSYK+VIG
Sbjct  180   LCETPFLAGQDFTMADVMLIPVLARIKLLDLENEYITGRPNIAEYWLLVQQRPSYKRVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF GW++ KT LKTW  V+ RS+L+RY
Sbjct  240   KYFSGWRKHKTFLKTWFLVRIRSLLKRY  267



>ref|NP_177853.1| glutathione S-transferase TCHQD [Arabidopsis thaliana]
 ref|NP_001031292.1| glutathione S-transferase TCHQD [Arabidopsis thaliana]
 sp|O80662.1|TCHQD_ARATH RecName: Full=Glutathione S-transferase TCHQD; AltName: Full=Protein 
tetrachlorohydroquinone dehalogenase-homolog [Arabidopsis 
thaliana]
 gb|AAC34354.1| Hypothetical protein [Arabidopsis thaliana]
 gb|AAL36390.1| unknown protein [Arabidopsis thaliana]
 gb|AAT71992.1| At1g77290 [Arabidopsis thaliana]
 dbj|BAH19914.1| AT1G77290 [Arabidopsis thaliana]
 gb|AEE35958.1| glutathione S-transferase TCHQD [Arabidopsis thaliana]
 gb|AEE35959.1| glutathione S-transferase TCHQD [Arabidopsis thaliana]
Length=266

 Score =   364 bits (934),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 186/268 (69%), Positives = 230/268 (86%), Gaps = 2/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYS+DS +VRLALEEKGIDYTS+HVNPITGK++D  FFR+NP+AKLPVF+NGSH
Sbjct  1     MQLYHHPYSIDSQRVRLALEEKGIDYTSYHVNPITGKHMDPSFFRMNPNAKLPVFRNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II DTIEII+Y+ERIAE VSSG  D    N++VVEWM KI+EW+ K FTL H+P   RLY
Sbjct  61    IILDTIEIIEYLERIAE-VSSGIEDATF-NREVVEWMRKIREWESKLFTLAHIPDNRRLY  118

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLR V+IARMAE PDLAS+YHRKLREAY+TE+KL +   +R+S++HL++LLDEVE K
Sbjct  119   VSKFLRMVVIARMAESPDLASAYHRKLREAYDTEDKLKDPGALRRSKDHLLRLLDEVETK  178

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L   +YL G EFS+ADVMLIP+LARL +L+LE E+I++R NL +YWALV++RPSYKKVIG
Sbjct  179   LEGTTYLAGNEFSMADVMLIPVLARLSLLDLEEEYISSRKNLAEYWALVRRRPSYKKVIG  238

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYF+GW++  TL+KTW FV+ RS+LR+Y
Sbjct  239   RYFNGWRKYATLVKTWMFVRVRSLLRKY  266



>ref|XP_009591546.1| PREDICTED: glutathione S-transferase TCHQD isoform X3 [Nicotiana 
tomentosiformis]
Length=230

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 183/230 (80%), Positives = 211/230 (92%), Gaps = 0/230 (0%)
 Frame = +3

Query  354   LDTFFFRINPSAKLPVFQNGSHiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMH  533
             +DTFFF +NPSAK+PVFQNGSHIIYDT+EIIQYIERIAEKVSSGG +LN+S+++VVEWMH
Sbjct  1     MDTFFFSMNPSAKIPVFQNGSHIIYDTVEIIQYIERIAEKVSSGGNNLNLSSREVVEWMH  60

Query  534   KIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLG  713
             KIQEWD  YFTL+HVP KYRLYVSKFLRRVIIARMAE PDLAS+YH KLR+AY+T++KL 
Sbjct  61    KIQEWDSMYFTLFHVPDKYRLYVSKFLRRVIIARMAESPDLASAYHCKLRDAYDTDDKLK  120

Query  714   NAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINT  893
             NA V+R+ E+HLV+LLDEVE KL E SYL GEEFSLADV+LIP+LARLQ+LNLE E+IN+
Sbjct  121   NADVLRRCEDHLVRLLDEVEVKLGETSYLAGEEFSLADVVLIPVLARLQLLNLEDEYINS  180

Query  894   RPNLFDYWALVKQRPSYKKVIGRYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RPN  DYW LVKQRPSYKKVIGRYFDGWKR+KTLLKTWCF++ RSMLR+Y
Sbjct  181   RPNTADYWMLVKQRPSYKKVIGRYFDGWKRRKTLLKTWCFIRIRSMLRKY  230



>ref|XP_010046842.1| PREDICTED: glutathione S-transferase TCHQD-like [Eucalyptus grandis]
 gb|KCW78568.1| hypothetical protein EUGRSUZ_C00041 [Eucalyptus grandis]
Length=266

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 184/268 (69%), Positives = 227/268 (85%), Gaps = 2/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVRL LEEKGIDYTS  +NPITGKNL   FFR+NP+AKLPVFQNGSH
Sbjct  1     MQLYHHPYSLDSQKVRLDLEEKGIDYTSFQMNPITGKNLRHSFFRMNPTAKLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +I+DTIEIIQYIERIA  VS     +  S+ +V++WMHKIQEW+PK+F L HVP KYR  
Sbjct  61    VIFDTIEIIQYIERIA-VVSVNNDSIAFSSDEVIQWMHKIQEWNPKFFKLSHVPEKYRQA  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF RRV+IA+MAE PDLASSYHRK++EAY TEEKL + +VV++S+EHL++LLDE+E  
Sbjct  120   VSKFFRRVLIAQMAESPDLASSYHRKVKEAYHTEEKLRDPEVVKRSKEHLIRLLDEIEDS  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LS+ +Y+ GEEFS+ADVM IP+LARL +LNLE E+IN+RPN+  YW+LV+QRPSYKKVIG
Sbjct  180   LSK-TYIAGEEFSMADVMFIPVLARLALLNLEDEYINSRPNMAKYWSLVQQRPSYKKVIG  238

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYF GW++ +TL KTWCF++ R+ L++Y
Sbjct  239   RYFGGWRKYRTLAKTWCFIRLRNTLKKY  266



>ref|XP_010416662.1| PREDICTED: glutathione S-transferase TCHQD-like [Camelina sativa]
 ref|XP_010416664.1| PREDICTED: glutathione S-transferase TCHQD-like [Camelina sativa]
Length=266

 Score =   362 bits (930),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 185/268 (69%), Positives = 229/268 (85%), Gaps = 2/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS +VRLALEEKGIDYTS+HVNPITGK++D  FFR+NP+AKLPVF+NGSH
Sbjct  1     MQLYHHPYSLDSQRVRLALEEKGIDYTSYHVNPITGKHMDPSFFRMNPNAKLPVFRNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II DTIEII+Y+ERIAE VSSG  D     ++V+EWM KI+EWDPK FTL H+P   RLY
Sbjct  61    IILDTIEIIEYLERIAE-VSSGVEDATF-GREVLEWMRKIREWDPKLFTLAHIPDNRRLY  118

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLR V+IARMAE PDLAS+YHRKLREAY+TE+KL +   +R+S++HL++LLDEVE K
Sbjct  119   VSKFLRMVVIARMAESPDLASAYHRKLREAYDTEDKLKDPGALRRSKDHLLRLLDEVETK  178

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L   +YL G EFS+ADVMLIP+LARL +L+LE E+I++R NL +YW +V++RPSYKKVIG
Sbjct  179   LEGTTYLAGNEFSMADVMLIPVLARLSLLDLEDEYISSRKNLAEYWIVVRRRPSYKKVIG  238

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYF+GW++  TL+KTW FV+ RS+LR+Y
Sbjct  239   RYFNGWRKYATLVKTWMFVRVRSLLRKY  266



>emb|CDX88356.1| BnaC06g38000D [Brassica napus]
Length=266

 Score =   362 bits (929),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 183/268 (68%), Positives = 229/268 (85%), Gaps = 2/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS +VRLALEEKGIDYTS+HVNPITGK++D+ FFR+NP+AKLPVF+NGSH
Sbjct  1     MQLYHHPYSLDSQRVRLALEEKGIDYTSYHVNPITGKHMDSTFFRMNPNAKLPVFRNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II DTIEII+Y+ERIAE VSSG  D     ++V+EWM KI+EWD K FTL H+P   RLY
Sbjct  61    IILDTIEIIEYLERIAE-VSSGVEDATF-GREVLEWMRKIREWDSKLFTLAHIPDNRRLY  118

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLR V+IARMAE PDLAS+YHRKLREAY+TE+KL + + +R+S++HL++LLDEVE K
Sbjct  119   VSKFLRMVMIARMAESPDLASAYHRKLREAYDTEDKLKDPEALRRSKDHLLRLLDEVESK  178

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L   SY+ G EFS+ADVML+P+LARL +L+LE E+I++R NL +YW +V+ RPSYKKV+G
Sbjct  179   LEGTSYVAGNEFSMADVMLVPVLARLSLLDLEEEYISSRKNLAEYWVVVRSRPSYKKVVG  238

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYF+GW++  TLLKTW FV+ RS+LR+Y
Sbjct  239   RYFNGWRKYVTLLKTWMFVRVRSLLRKY  266



>ref|XP_009106393.1| PREDICTED: glutathione S-transferase TCHQD [Brassica rapa]
 ref|XP_009106394.1| PREDICTED: glutathione S-transferase TCHQD [Brassica rapa]
Length=266

 Score =   362 bits (928),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/268 (68%), Positives = 229/268 (85%), Gaps = 2/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS +VRLALEEKGIDYTS+HVNPITGK++D+ FFR+NP+AKLPVF+NGSH
Sbjct  1     MQLYHHPYSLDSQRVRLALEEKGIDYTSYHVNPITGKHMDSSFFRMNPNAKLPVFRNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II DTIEII+Y+ERIAE VSSG  D     ++V+EWM KI+EWD K FTL H+P   RLY
Sbjct  61    IILDTIEIIEYLERIAE-VSSGVEDATF-GREVLEWMRKIREWDSKLFTLAHIPDNRRLY  118

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLR V+IARMAE PDLAS+YHRKLREAY+TE+KL + + +R+S++HL++LLDEVE K
Sbjct  119   VSKFLRMVMIARMAESPDLASAYHRKLREAYDTEDKLKDPEALRRSKDHLLRLLDEVETK  178

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L   SY+ G EFS+ADVML+P+LARL +L+LE E+I++R NL +YW +V+ RPSYKKV+G
Sbjct  179   LEGTSYVAGNEFSMADVMLVPVLARLSLLDLEEEYISSRRNLAEYWVVVRSRPSYKKVVG  238

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYF+GW++  TLLKTW FV+ RS+LR+Y
Sbjct  239   RYFNGWRKYATLLKTWMFVRVRSLLRKY  266



>ref|XP_010428802.1| PREDICTED: glutathione S-transferase TCHQD isoform X1 [Camelina 
sativa]
 ref|XP_010428803.1| PREDICTED: glutathione S-transferase TCHQD isoform X2 [Camelina 
sativa]
 ref|XP_010428804.1| PREDICTED: glutathione S-transferase TCHQD isoform X1 [Camelina 
sativa]
 ref|XP_010428805.1| PREDICTED: glutathione S-transferase TCHQD isoform X1 [Camelina 
sativa]
Length=266

 Score =   362 bits (928),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 184/268 (69%), Positives = 229/268 (85%), Gaps = 2/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS +VRLALEEKGIDYTS+HVNPITGK++D  FFR+NP+AKLPVF+NGSH
Sbjct  1     MQLYHHPYSLDSQRVRLALEEKGIDYTSYHVNPITGKHMDPSFFRMNPNAKLPVFRNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II DTIEII+Y+ERIAE VSSG  D     ++V+EWM KI+EWDPK FTL H+P   RLY
Sbjct  61    IILDTIEIIEYLERIAE-VSSGIEDATF-GREVLEWMRKIREWDPKLFTLAHIPDNRRLY  118

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLR V+IARMAE PDLAS+YHRKLREAY+TE+KL +   +R+S++HL++LLDEVE K
Sbjct  119   VSKFLRMVVIARMAESPDLASAYHRKLREAYDTEDKLKDPGALRRSKDHLLRLLDEVETK  178

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L   +YL G EFS+ADVMLIP+LARL +L+LE E+I++R NL +YW +V++RPSYKKVIG
Sbjct  179   LEGTTYLAGNEFSMADVMLIPVLARLSLLDLEEEYISSRKNLAEYWTVVRRRPSYKKVIG  238

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             R+F+GW++  TL+KTW FV+ RS+LR+Y
Sbjct  239   RFFNGWRKYATLVKTWMFVRVRSLLRKY  266



>ref|XP_010471916.1| PREDICTED: glutathione S-transferase TCHQD-like [Camelina sativa]
 ref|XP_010471917.1| PREDICTED: glutathione S-transferase TCHQD-like [Camelina sativa]
Length=266

 Score =   361 bits (927),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 185/268 (69%), Positives = 226/268 (84%), Gaps = 2/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS +VRLALEEKGIDYTS+HVNPITGK++D  FFR+NP+AKLPVF+NGSH
Sbjct  1     MQLYHHPYSLDSQRVRLALEEKGIDYTSYHVNPITGKHMDPSFFRMNPNAKLPVFRNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II DTIEII+Y+ERIAE VSSG  D     ++V+EWM KI+EWDPK FTL H+P   RLY
Sbjct  61    IILDTIEIIEYLERIAE-VSSGIEDATF-GREVLEWMRKIREWDPKLFTLAHIPDNRRLY  118

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLR V+IARMAE PDLAS+YHRKLREAY+TE+KL +   +R+S +HL++LLDEVE K
Sbjct  119   VSKFLRMVVIARMAESPDLASAYHRKLREAYDTEDKLKDPGALRRSTDHLLRLLDEVETK  178

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L   +YL G EFS+ADVMLIP+LARL +L+LE E+I +R NL +YW +V+ RPSYKKVIG
Sbjct  179   LEGTTYLAGNEFSMADVMLIPVLARLSLLDLEDEYITSRKNLAEYWIVVRSRPSYKKVIG  238

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYF+GW++  TL+KTW FV+ RS+LR+Y
Sbjct  239   RYFNGWRKYATLVKTWMFVRVRSLLRKY  266



>ref|XP_006300361.1| hypothetical protein CARUB_v10022136mg [Capsella rubella]
 gb|EOA33259.1| hypothetical protein CARUB_v10022136mg [Capsella rubella]
Length=266

 Score =   359 bits (921),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/268 (68%), Positives = 228/268 (85%), Gaps = 2/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS +VRLALEEKGIDYTS+HVNPITGK++D  FFR+NP+AKLPVF+NGSH
Sbjct  1     MQLYHHPYSLDSQRVRLALEEKGIDYTSYHVNPITGKHMDPSFFRMNPNAKLPVFRNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II DTIEII+Y+ERIAE VSSG  D     ++V+EWM KI+EWD K FTL H+P   RLY
Sbjct  61    IILDTIEIIEYLERIAE-VSSGVEDATF-GREVLEWMRKIREWDSKLFTLAHIPDNRRLY  118

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLR V+IARMAE PDLAS+YHRKLREAY+TE+KL +   +R+S++HL++LLDEVE K
Sbjct  119   VSKFLRMVVIARMAESPDLASAYHRKLREAYDTEDKLKDPGALRRSKDHLLRLLDEVETK  178

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L   +Y+ G EFS+ADVMLIP+LARL +L+LE E+I++R NL +YW +V++RPSYKKVIG
Sbjct  179   LEGTTYVAGNEFSMADVMLIPVLARLSLLDLEDEYISSRKNLAEYWIIVRKRPSYKKVIG  238

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYF+GW++  TL+KTW FV+ RS+LR+Y
Sbjct  239   RYFNGWRKYATLVKTWMFVRVRSLLRKY  266



>emb|CDX87528.1| BnaA07g33450D [Brassica napus]
Length=369

 Score =   362 bits (930),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/272 (67%), Positives = 230/272 (85%), Gaps = 2/272 (1%)
 Frame = +3

Query  228   ADDIMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQ  407
               + MQLYHHPYSLDS +VRLALEEKGIDYTS+HVNPITGK++D+ FFR+NP+AKLPVF+
Sbjct  100   GSEAMQLYHHPYSLDSQRVRLALEEKGIDYTSYHVNPITGKHMDSSFFRMNPNAKLPVFR  159

Query  408   NGSHiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVK  587
             NGSHII DTIEII+Y+ERIAE VSSG  D     ++V+EWM KI+EWD K FTL H+P  
Sbjct  160   NGSHIILDTIEIIEYLERIAE-VSSGVEDATF-GREVLEWMRKIREWDSKLFTLAHIPDN  217

Query  588   YRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDE  767
              RLYVSKFLR V+IARMAE PDLAS+YHRKLREAY+TE+KL + + +R+S++HL++LLDE
Sbjct  218   RRLYVSKFLRMVMIARMAESPDLASAYHRKLREAYDTEDKLKDPEALRRSKDHLLRLLDE  277

Query  768   VEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYK  947
             VE KL   SY+ G EFS+ADVML+P+LARL +L+LE E+I++R NL +YW +V+ RPSYK
Sbjct  278   VETKLEGTSYVAGNEFSMADVMLVPVLARLSLLDLEEEYISSRRNLAEYWVVVRSRPSYK  337

Query  948   KVIGRYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             KV+GRYF+GW++  TLLKTW FV+ RS+LR+Y
Sbjct  338   KVVGRYFNGWRKYATLLKTWMFVRVRSLLRKY  369



>ref|XP_002887675.1| hypothetical protein ARALYDRAFT_476892 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63934.1| hypothetical protein ARALYDRAFT_476892 [Arabidopsis lyrata subsp. 
lyrata]
Length=266

 Score =   358 bits (919),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/268 (68%), Positives = 228/268 (85%), Gaps = 2/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS +VRLALEEKGIDYTS+HVNPITGK++D  FFR+NP+AKLPVF+NGSH
Sbjct  1     MQLYHHPYSLDSQRVRLALEEKGIDYTSYHVNPITGKHMDPSFFRMNPNAKLPVFRNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II DTIEII+Y+ERIAE VSSG  D     ++V+EWM KI+EWD K FTL H+P   RLY
Sbjct  61    IILDTIEIIEYLERIAE-VSSGIEDATF-GREVLEWMRKIREWDSKLFTLAHIPDNRRLY  118

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLR V+IARMAE PDLAS+YHRKLREAY+TE+KL +   +R+S++HL++LLDEVE K
Sbjct  119   VSKFLRMVVIARMAESPDLASAYHRKLREAYDTEDKLKDPGALRRSKDHLLRLLDEVETK  178

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L   +YL G EFS+ADVMLIP+LARL +L+LE E+I++R NL +YWA+V++RP YK+VIG
Sbjct  179   LEGTTYLAGNEFSMADVMLIPVLARLSLLDLEEEYISSRKNLGEYWAVVRRRPCYKRVIG  238

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYF+GW++  TL+KTW FV+ RS+LR+Y
Sbjct  239   RYFNGWRKYATLVKTWMFVRVRSLLRKY  266



>gb|KHN38977.1| Glutathione S-transferase TCHQD [Glycine soja]
Length=267

 Score =   358 bits (918),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 178/268 (66%), Positives = 229/268 (85%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHP  L+S +VRLALEE+G+DYTSHHVNPIT KNLD+ FF++N   ++PVFQNGSH
Sbjct  1     MQLYHHPLDLESQRVRLALEEEGVDYTSHHVNPITAKNLDSTFFKMNRHGRVPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             IIY+TI+IIQYIERIA  VSSG   ++ S+++V+EWM KIQ+WDPK FTL H+P KYRLY
Sbjct  61    IIYNTIDIIQYIERIA-VVSSGAESISASSREVIEWMQKIQDWDPKIFTLSHIPEKYRLY  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+R+V IARM+E P+LAS YHRKL+EAYETEEKL  A V+R+S++HLV+LLDEVE +
Sbjct  120   VSKFIRQVAIARMSESPELASDYHRKLKEAYETEEKLKEADVLRRSKDHLVRLLDEVERQ  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LSE  +L G+EF++ADVML+P+LARL++L+LE E+I  RPN+ +YW LV+QR SYKKVIG
Sbjct  180   LSETPHLAGQEFTMADVMLVPVLARLELLDLENEYIIGRPNIAEYWILVQQRLSYKKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF+GW++ +TLLK W  V+ RS+L+RY
Sbjct  240   KYFNGWRKHRTLLKAWFLVRIRSLLKRY  267



>ref|XP_010269081.1| PREDICTED: glutathione S-transferase TCHQD [Nelumbo nucifera]
 ref|XP_010269082.1| PREDICTED: glutathione S-transferase TCHQD [Nelumbo nucifera]
 ref|XP_010269083.1| PREDICTED: glutathione S-transferase TCHQD [Nelumbo nucifera]
Length=267

 Score =   357 bits (917),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 179/268 (67%), Positives = 226/268 (84%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVRLALEE GIDYTSHHVNP+TGKN+++ FFR+NPSAKLPVFQNGS 
Sbjct  1     MQLYHHPYSLDSQKVRLALEEYGIDYTSHHVNPLTGKNMESSFFRMNPSAKLPVFQNGSQ  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II++TI+IIQYIER+A  VSS   ++   +++V EWMHKIQEW+PK FTL H+P KY L+
Sbjct  61    IIFNTIDIIQYIERVA-LVSSSINNITTGSREVEEWMHKIQEWNPKIFTLSHIPEKYHLF  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV+IARMAE PDLAS YH KLR+AY+ E+KL ++ +++QSEE LV+LLDEVE +
Sbjct  120   VSKFIRRVVIARMAESPDLASVYHLKLRDAYDMEDKLKDSNILKQSEEQLVRLLDEVEMQ  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LS ++YL GE+F+LAD MLIPILA + +LNLE E+I +RP + +YW  VK RPSY+KVIG
Sbjct  180   LSNSAYLAGEQFTLADAMLIPILAHIMLLNLEDEYIGSRPKISEYWNKVKHRPSYRKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYF GW++ +TL KT+CF+  R++LRRY
Sbjct  240   RYFVGWRKYRTLSKTFCFICIRTVLRRY  267



>ref|XP_009355836.1| PREDICTED: glutathione S-transferase TCHQD-like [Pyrus x bretschneideri]
Length=267

 Score =   357 bits (916),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 177/268 (66%), Positives = 226/268 (84%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS +VRLALEEKGIDYTS HVNP+T KN+D  FFR NPSAKLPVFQNG H
Sbjct  1     MQLYHHPYSLDSQRVRLALEEKGIDYTSFHVNPVTVKNMDASFFRRNPSAKLPVFQNGHH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             IIY+TIEIIQY+ERIA  VSSG  ++  S  +V  WMH+I++W+PK+FTL H+P K+R Y
Sbjct  61    IIYNTIEIIQYVERIA-LVSSGKENIPSSGGEVTAWMHRIKQWNPKFFTLSHIPKKHRDY  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+R+VIIARMAE  DLA++YH KL + YETE+KL +  V++QS+E L++LLD+VE K
Sbjct  120   VSKFIRQVIIARMAEATDLAAAYHAKLVQVYETEDKLKDPAVLKQSKEQLIRLLDQVEKK  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L+E++YL GEEFS+ADVML+P+LARL +LNL+ E+I++RPN   YW +V+QRPSYKKVIG
Sbjct  180   LNESAYLAGEEFSMADVMLVPVLARLVLLNLKEEYIDSRPNTAKYWIMVQQRPSYKKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF GW++ KT ++TWCFV  R++LRR+
Sbjct  240   KYFSGWRKHKTFIRTWCFVHIRTILRRF  267



>ref|XP_006390103.1| hypothetical protein EUTSA_v10019613mg [Eutrema salsugineum]
 gb|ESQ27389.1| hypothetical protein EUTSA_v10019613mg [Eutrema salsugineum]
Length=266

 Score =   356 bits (914),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/268 (68%), Positives = 226/268 (84%), Gaps = 2/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS +VRLALEEKGIDYTS+HVNPITGK++D+ FFR+NP+AKLPVF+NGSH
Sbjct  1     MQLYHHPYSLDSQRVRLALEEKGIDYTSYHVNPITGKHMDSSFFRMNPNAKLPVFKNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II DTIEII+Y+ERIAE VSSG  D     ++V+EWM KI+EWD K FTL H+P K RLY
Sbjct  61    IILDTIEIIEYLERIAE-VSSGIEDATF-GREVLEWMRKIREWDSKLFTLAHIPDKRRLY  118

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLR V+IARMAE PDLAS+YHRKLREAY+TE+KL +   + +S++HL++LLDEVE K
Sbjct  119   VSKFLRMVVIARMAESPDLASAYHRKLREAYDTEDKLKDPGALTRSKDHLLRLLDEVETK  178

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L   +Y+ G EFS+ADVML+P+LARL +L+LE E+I++R NL  YW +VK R SYKKVIG
Sbjct  179   LGVTTYVAGNEFSMADVMLVPVLARLSLLDLEEEYISSRKNLAGYWVVVKSRSSYKKVIG  238

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYF+GW++  TL+KTW FV+ RS+LR+Y
Sbjct  239   RYFNGWRKYATLVKTWMFVRVRSLLRKY  266



>ref|XP_004290917.1| PREDICTED: glutathione S-transferase TCHQD-like [Fragaria vesca 
subsp. vesca]
Length=267

 Score =   352 bits (903),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 170/268 (63%), Positives = 222/268 (83%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYS+DS +VRLALEEKGIDYTS H+NP+TGKN++  FFR+NPSA LPVFQNG H
Sbjct  1     MQLYHHPYSIDSQRVRLALEEKGIDYTSFHLNPVTGKNMNASFFRMNPSATLPVFQNGEH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
              I++TIEIIQY+ERIA  VS+G  ++  S ++V  WMH+IQ+W+PKYFTL H+P KY   
Sbjct  61    KIFNTIEIIQYVERIA-SVSTGAENMTFSGREVTGWMHRIQQWNPKYFTLAHIPEKYFRS  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLRRV++ARM E PDLA +YH KL+E Y+TE+KL N+ V+ Q +EHL++LLDEVE +
Sbjct  120   VSKFLRRVVMARMEESPDLAGAYHSKLQEVYDTEDKLKNSSVMIQDKEHLIRLLDEVEKQ  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L+E +YL G+EF++ADVMLIP+LARL +L+LE E+I +RPN+  YW +V+QRPSYKKVI 
Sbjct  180   LNETTYLVGDEFTMADVMLIPVLARLVLLDLEDEYIGSRPNIAKYWIMVQQRPSYKKVIA  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
              +F+GW++ +TL KTWC +  RS+LRR+
Sbjct  240   SHFNGWRKYRTLWKTWCSIHIRSILRRF  267



>ref|XP_008394167.1| PREDICTED: glutathione S-transferase TCHQD [Malus domestica]
 ref|XP_008394168.1| PREDICTED: glutathione S-transferase TCHQD [Malus domestica]
Length=267

 Score =   350 bits (897),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 175/268 (65%), Positives = 223/268 (83%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS +VRLALEEKGIDYTS HVNP+T KN+D  FFR NPSAKLPVFQNG H
Sbjct  1     MQLYHHPYSLDSQRVRLALEEKGIDYTSFHVNPVTVKNMDASFFRRNPSAKLPVFQNGHH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             IIY+TIEIIQY+ERIA  VSSG  ++  S  +V  WMH+I++W+PK+FTL H+P K+R Y
Sbjct  61    IIYNTIEIIQYVERIA-LVSSGEENIPSSGGEVTAWMHRIKQWNPKFFTLSHIPKKHRDY  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             V KF+R+VIIARMAE  DLA++YH KL + YETE+KL +  V+ QS+E L++LLD+VE K
Sbjct  120   VYKFIRQVIIARMAEATDLAAAYHAKLVQVYETEDKLKDPAVLNQSKEQLIRLLDQVEKK  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L+E++YL GEEFS+ADVML+P+LARL +LNL+ E+I+ RPN   YW +V+QRPSYKKVIG
Sbjct  180   LNESAYLAGEEFSMADVMLVPVLARLVLLNLKEEYIDGRPNTAKYWIMVQQRPSYKKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             ++F GW++ KT ++TWCFV  R++LRR+
Sbjct  240   KHFSGWRKHKTFIRTWCFVHIRTILRRF  267



>ref|XP_010270300.1| PREDICTED: glutathione S-transferase TCHQD-like [Nelumbo nucifera]
Length=267

 Score =   343 bits (879),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 175/268 (65%), Positives = 223/268 (83%), Gaps = 1/268 (0%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVRLALEE  IDYTS+HVNP+TGKN+++ FFR+NPSA+LPVFQNGSH
Sbjct  1     MQLYHHPYSLDSQKVRLALEEYNIDYTSYHVNPLTGKNMESSFFRMNPSARLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II++TIEIIQYIERIA  VSS   +   +N++V EWMHKIQ+W+PK FTL H+P +YRL+
Sbjct  61    IIFNTIEIIQYIERIA-LVSSSIDNTTTNNREVDEWMHKIQDWNPKIFTLSHIPERYRLF  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV+IARMAE P+LAS YH KLR+AYETE+KL +  V++Q+EE L++LLDEVE +
Sbjct  120   VSKFIRRVVIARMAESPNLASIYHLKLRDAYETEDKLKDPDVLKQNEECLIRLLDEVEMQ  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LS ++YL GE F++AD  LIP+LAR+ +LNLE E+I  RP + +YW  +KQRPSY+KVIG
Sbjct  180   LSNSAYLAGEHFTMADATLIPVLARIMLLNLEHEYIFIRPKVAEYWKTMKQRPSYRKVIG  239

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYF GW++ K L KT  F+  RS+L++Y
Sbjct  240   RYFTGWRKYKILSKTIFFLCIRSVLKKY  267



>ref|XP_010930689.1| PREDICTED: glutathione S-transferase TCHQD [Elaeis guineensis]
Length=265

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/268 (63%), Positives = 216/268 (81%), Gaps = 3/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYS+DS KVRLALEEKGIDYTS+HVNP+TGKN+D  FFR+NP+AKLPVFQNG+H
Sbjct  1     MQLYHHPYSMDSQKVRLALEEKGIDYTSYHVNPLTGKNMDASFFRMNPTAKLPVFQNGAH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II+  I+I+QYI+R+   +S  G D  +SN+ V+EWM KI+ W  K FTL HVP KYRL+
Sbjct  61    IIFRAIDIVQYIDRLT--ISLNGEDKPISNE-VMEWMQKIEGWSSKIFTLSHVPDKYRLF  117

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV IARMAE PDLAS YH KLREAY+ E+KL +  +V+QSEE L +LLD+ E +
Sbjct  118   VSKFIRRVTIARMAEAPDLASVYHVKLREAYDIEDKLRDPDIVKQSEEKLARLLDDAEMQ  177

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L++  YL G+E ++AD M +P+LAR+ +L+LE EFIN RP + +Y+ LVK+RPSYK VIG
Sbjct  178   LNKTKYLAGDELTIADSMFVPVLARITLLDLEEEFINCRPKIVEYYNLVKRRPSYKVVIG  237

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF GW++ +TLLKT  F+  RSMLRRY
Sbjct  238   KYFSGWRKHRTLLKTLFFLGIRSMLRRY  265



>ref|XP_009416928.1| PREDICTED: glutathione S-transferase TCHQD [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   339 bits (870),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 171/268 (64%), Positives = 216/268 (81%), Gaps = 3/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYS+DS KVRLALEEK IDYTS+HVNP+TGKN+D  FFR NPSAKLP+FQNGSH
Sbjct  1     MQLYHHPYSMDSQKVRLALEEKVIDYTSYHVNPLTGKNMDVSFFRTNPSAKLPIFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +I+  I+IIQYIE+++  VS  G D  +S++ V+EWM KI++W PK FTL H+P K RL+
Sbjct  61    VIFRAIDIIQYIEKLS--VSLSGEDNPISSK-VMEWMEKIEDWSPKIFTLAHIPAKCRLF  117

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV+IARMA+ PDLAS YH KLREAYETE+KL + + ++QSEE L  LLD+ E +
Sbjct  118   VSKFVRRVVIARMAQAPDLASVYHVKLREAYETEDKLKDPKNLKQSEEELSSLLDDAEAQ  177

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LS  +YL GE F++AD M +PILAR+ +LNLE E+I+ RP +  Y+ LVK+RPSYKKVIG
Sbjct  178   LSVTTYLAGEYFTMADSMFVPILARIALLNLEEEYISCRPKIAAYYNLVKRRPSYKKVIG  237

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYF GW++ +TL KT CF+  RSM R+Y
Sbjct  238   RYFSGWRKYRTLSKTSCFLCIRSMFRKY  265



>ref|XP_008781627.1| PREDICTED: glutathione S-transferase TCHQD-like [Phoenix dactylifera]
Length=265

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/268 (62%), Positives = 211/268 (79%), Gaps = 3/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHP+S+DS KVRL LEEKGIDYTS+HVNP+TGKN+D  FFR+NP+AKLPVFQNG+H
Sbjct  1     MQLYHHPFSMDSQKVRLVLEEKGIDYTSYHVNPLTGKNMDASFFRMNPTAKLPVFQNGAH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II+  I+IIQYI R+   VS  G D  +SN+ V+EWM KI+ W  K FTL HVP KYRL+
Sbjct  61    IIFRAIDIIQYIHRLT--VSLNGEDKPISNE-VMEWMQKIEGWSSKIFTLSHVPDKYRLF  117

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV IARMAE PD+AS YH KLREAY+TE+KL +  +V+QSEE L +LLD+ E +
Sbjct  118   VSKFIRRVAIARMAEAPDMASVYHGKLREAYDTEDKLKDPDIVKQSEEKLARLLDDAEMQ  177

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L+E  YL G+EF++AD M +P+LAR+ +L LE E IN+RP + +Y+  +K RPSYK VIG
Sbjct  178   LNETKYLAGDEFTIADTMFVPVLARITLLGLEEELINSRPKIAEYYNFIKHRPSYKVVIG  237

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF GW+R +T LKT  F+  RS+ RRY
Sbjct  238   KYFSGWRRHQTFLKTMFFLGIRSLFRRY  265



>ref|XP_006652308.1| PREDICTED: glutathione S-transferase TCHQD-like [Oryza brachyantha]
Length=265

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 214/268 (80%), Gaps = 3/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVR+ALEEKGIDYTS+H+NP+TGKN++  FFR+NPSAKLPVFQNG+H
Sbjct  1     MQLYHHPYSLDSQKVRMALEEKGIDYTSYHLNPLTGKNMNVAFFRMNPSAKLPVFQNGAH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +IY   +IIQYI+R+A  +S    ++   N +V +WM K+  W+PK FTL H P+KYR +
Sbjct  61    VIYRAFDIIQYIDRLAVHLSG---EIVPVNTEVYQWMQKVDSWNPKMFTLTHTPIKYRTF  117

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV+IARMAE PDLAS YH KLREAYETE++L +  +++QSEE L +LLD+VE +
Sbjct  118   VSKFIRRVLIARMAESPDLASMYHVKLREAYETEDRLKDPDIMKQSEEELSELLDDVEAQ  177

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L+   YL G+EFS AD M IPILAR+ +L+L+ E+IN RP L +Y+ALVKQRPSYK V+G
Sbjct  178   LNNGKYLAGDEFSPADSMFIPILARITLLDLDEEYINCRPRLLEYYALVKQRPSYKVVVG  237

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             ++F GWK+ +TL KT  F+  R++ R+Y
Sbjct  238   KFFSGWKKYRTLFKTSFFLCVRTLFRKY  265



>ref|XP_008799056.1| PREDICTED: glutathione S-transferase TCHQD-like [Phoenix dactylifera]
Length=265

 Score =   335 bits (859),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 166/268 (62%), Positives = 212/268 (79%), Gaps = 3/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYS+DS KVRLALEEKGIDYTS+HVNP+TGKN+D  FFR+NPSAKLPVFQNG+H
Sbjct  1     MQLYHHPYSMDSQKVRLALEEKGIDYTSYHVNPLTGKNMDASFFRMNPSAKLPVFQNGAH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II+   +IIQYI+R+   VS  G D  +S++ VVEWMHKI+ W  K FTL HVP KYRL+
Sbjct  61    IIFQASDIIQYIDRLT--VSLNGEDKPISSE-VVEWMHKIEGWSSKIFTLSHVPDKYRLF  117

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV+IARMAE PDLA+ YH KL + Y+ E+K+ +  +V++SEE L +LLD  E +
Sbjct  118   VSKFVRRVVIARMAEAPDLATMYHLKLLDVYDAEDKVKDPDIVKRSEEKLAELLDNAEMQ  177

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L+E  YL G+EF++AD M IP+LAR+ +LNLE ++IN RPN+ +Y+ LVK RPSYK VIG
Sbjct  178   LNETKYLAGDEFTMADSMFIPVLARITLLNLEKKYINCRPNIAEYYNLVKHRPSYKAVIG  237

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF GW++ +T +KT   +  RSM RRY
Sbjct  238   KYFSGWRKHRTFMKTLFILAIRSMFRRY  265



>ref|XP_002447864.1| hypothetical protein SORBIDRAFT_06g017110 [Sorghum bicolor]
 gb|EES12192.1| hypothetical protein SORBIDRAFT_06g017110 [Sorghum bicolor]
Length=265

 Score =   335 bits (859),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 168/268 (63%), Positives = 213/268 (79%), Gaps = 3/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVR+ALEEKGIDYTS+HVNP+TGKN++  FFR+NPSAKLPVFQNG+H
Sbjct  1     MQLYHHPYSLDSQKVRMALEEKGIDYTSYHVNPLTGKNMNVDFFRMNPSAKLPVFQNGAH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +IY  I+IIQYI+R+A  +S    ++   N +V +WM K+  W+PK FTL H PVKYR +
Sbjct  61    VIYRAIDIIQYIDRLAVHLSG---EIAPVNTEVHQWMQKVDAWNPKMFTLTHTPVKYRAF  117

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV+IARMA+ PDLAS YH KLREAYETE+K+ +  +++QSEE L KLLDEVE +
Sbjct  118   VSKFIRRVLIARMADAPDLASMYHVKLREAYETEDKVKDPDIMKQSEEELSKLLDEVESQ  177

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LS   YL G+EFS AD MLIPILAR+ +L+L+ E+IN RP + +Y+ LVK RPSYK  IG
Sbjct  178   LSRTKYLAGDEFSPADSMLIPILARITLLDLDDEYINCRPKILEYYNLVKLRPSYKIAIG  237

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF GWK+ +TL KT  F+  R++ R+Y
Sbjct  238   KYFSGWKKYRTLFKTSFFLCVRTLFRKY  265



>ref|NP_001052848.1| Os04g0435500 [Oryza sativa Japonica Group]
 emb|CAD41018.1| OSJNBb0086G13.14 [Oryza sativa Japonica Group]
 gb|AAP13014.1| putative brown planthopper-inducible protein BpHi006A [Oryza 
sativa Indica Group]
 dbj|BAF14762.1| Os04g0435500 [Oryza sativa Japonica Group]
 emb|CAH67304.1| OSIGBa0102D10.7 [Oryza sativa Indica Group]
 gb|EAY94199.1| hypothetical protein OsI_15974 [Oryza sativa Indica Group]
 gb|EAZ30815.1| hypothetical protein OsJ_14885 [Oryza sativa Japonica Group]
 dbj|BAG96432.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94709.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87331.1| unnamed protein product [Oryza sativa Japonica Group]
Length=265

 Score =   334 bits (857),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 163/268 (61%), Positives = 212/268 (79%), Gaps = 3/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVR+ALEEKGIDYTS+HVNP+TGKN++  FFR+NPSAKLPVFQNG+H
Sbjct  1     MQLYHHPYSLDSQKVRMALEEKGIDYTSYHVNPLTGKNMNVAFFRMNPSAKLPVFQNGAH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +IY   +IIQY++R++  +S    ++   N +V +WM K+  W+PK FTL H P+KYR +
Sbjct  61    VIYRAFDIIQYLDRLSVHLSG---EIVPVNTEVYQWMQKVDSWNPKMFTLTHTPIKYRTF  117

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV+IARMAE PDLAS YH KLREAYETE+KL +  +++QSEE L KLLD+VE +
Sbjct  118   VSKFIRRVLIARMAEAPDLASMYHAKLREAYETEDKLKDPDIMKQSEEELSKLLDDVEAQ  177

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L+   YL G+EFS AD + IPILAR+ +L+L+ E+IN RP L +Y+ LVKQRPSYK  IG
Sbjct  178   LNNGKYLAGDEFSPADSVFIPILARITLLDLDEEYINCRPRLLEYYTLVKQRPSYKVAIG  237

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             ++F GWK+ +TL KT  F+  R++ R+Y
Sbjct  238   KFFGGWKKYRTLFKTSFFLCVRTLFRKY  265



>emb|CAZ68077.1| tetrachlorohydroquinone dehalogenase [Oryza sativa Indica Group]
Length=265

 Score =   334 bits (856),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 163/268 (61%), Positives = 212/268 (79%), Gaps = 3/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVR+ALEEKGIDYTS+HVNP+TGKN++  FFR+NPSAKLPVFQNG+H
Sbjct  1     MQLYHHPYSLDSQKVRMALEEKGIDYTSYHVNPLTGKNMNVAFFRMNPSAKLPVFQNGAH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +IY   +IIQY++R++  +S    ++   N +V +WM K+  W+PK FTL H P+KYR +
Sbjct  61    VIYRAFDIIQYLDRLSVHLSG---EIVPVNTEVYQWMQKVDSWNPKMFTLTHTPIKYRTF  117

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV+IARMAE PDLAS YH KLREAYETE+KL +  +++QSEE L KLLD+VE +
Sbjct  118   VSKFIRRVLIARMAEAPDLASMYHVKLREAYETEDKLKDPDIMKQSEEELSKLLDDVEAQ  177

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L+   YL G+EFS AD + IPILAR+ +L+L+ E+IN RP L +Y+ LVKQRPSYK  IG
Sbjct  178   LNNGKYLAGDEFSPADSVFIPILARITLLDLDEEYINCRPRLLEYYTLVKQRPSYKVAIG  237

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             ++F GWK+ +TL KT  F+  R++ R+Y
Sbjct  238   KFFGGWKKYRTLFKTSFFLCVRTLFRKY  265



>dbj|BAJ98512.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93422.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=265

 Score =   333 bits (855),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 216/268 (81%), Gaps = 3/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVR+ALEEKGIDYTS+HVNP+TGKN++  FFR+NPSAKLPVFQNG+H
Sbjct  1     MQLYHHPYSLDSQKVRIALEEKGIDYTSYHVNPLTGKNMNVAFFRMNPSAKLPVFQNGAH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +I+  I+IIQYI+R+A  +S    ++   N +V++WM K+  W+PK FTL H P+KYR +
Sbjct  61    VIFRAIDIIQYIDRLAVHLSG---EIQPVNTEVLQWMQKVDGWNPKMFTLTHTPLKYRSF  117

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV+IARMAE PDLAS YH KLR+AYETE++L + + +RQSEE L KLLD+VE +
Sbjct  118   VSKFIRRVLIARMAEAPDLASMYHVKLRDAYETEDRLKDPETMRQSEEELSKLLDDVEAQ  177

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L++  YL G+EFS AD M IPILAR+ +L+L  E+I++RP + +Y  LVKQRPSYK VIG
Sbjct  178   LNKTKYLAGDEFSPADSMFIPILARIALLDLHEEYISSRPRVLEYHTLVKQRPSYKVVIG  237

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF+GWK+ +TL +T  F+  R++ R+Y
Sbjct  238   KYFNGWKKYRTLFRTSFFLCVRTLFRKY  265



>ref|XP_004975660.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X1 [Setaria 
italica]
 ref|XP_004975661.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X2 [Setaria 
italica]
Length=265

 Score =   332 bits (852),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 213/268 (79%), Gaps = 3/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVR+ALEEKGIDYTS+H+NP+TGKN++  FFR+NPSAKLPVFQNG+H
Sbjct  1     MQLYHHPYSLDSQKVRMALEEKGIDYTSYHINPLTGKNMNVDFFRMNPSAKLPVFQNGAH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +IY  I+IIQY++R+A  +S    ++   N +V +WM K+  W+PK FTL H PVKYR +
Sbjct  61    VIYRAIDIIQYLDRLAVHLSG---EIPPVNTEVHQWMQKVDAWNPKMFTLTHTPVKYRAF  117

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV+IARMAE PDLAS YH KLREAYETE+K+ +  +++QSEE L KLLD+VE +
Sbjct  118   VSKFIRRVLIARMAEAPDLASMYHVKLREAYETEDKVKDPDIMKQSEEELSKLLDDVEAQ  177

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LS+  YL G+EFS AD M +PILAR+ +L+L+ E+I+ RP + DY+ LVK R SYK  IG
Sbjct  178   LSKTKYLAGDEFSPADSMFVPILARITLLDLDEEYISCRPKILDYYNLVKHRSSYKIAIG  237

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF+GWK+ +TL KT  F+  R++ RRY
Sbjct  238   KYFNGWKKYRTLFKTSFFLCVRTLFRRY  265



>ref|XP_003579787.1| PREDICTED: glutathione S-transferase TCHQD [Brachypodium distachyon]
 ref|XP_010239929.1| PREDICTED: glutathione S-transferase TCHQD [Brachypodium distachyon]
Length=265

 Score =   332 bits (851),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 165/268 (62%), Positives = 213/268 (79%), Gaps = 3/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVR+ALEEKGIDYTS+HVNP+TGKN++  FFR+NPSAKLPVFQNG+H
Sbjct  1     MQLYHHPYSLDSQKVRIALEEKGIDYTSYHVNPLTGKNMNVAFFRMNPSAKLPVFQNGAH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +I+  I+IIQYI+R+A  +S    ++   N +V +WM K+  W+PK FTL H PVKYR +
Sbjct  61    VIFRAIDIIQYIDRLAVHLSG---EITPVNTEVHKWMQKVDSWNPKMFTLTHTPVKYRAF  117

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF RRV+IARMAE PDLAS YH KLREAYETE++L +  +++QSEE L KLLD+VE +
Sbjct  118   VSKFKRRVLIARMAEAPDLASMYHVKLREAYETEDRLKDPDIMKQSEEDLSKLLDDVEAQ  177

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L++  YL G+EFS AD M IPILAR+ +L+L  E+I+ RP + +Y  LVKQRPSYK VIG
Sbjct  178   LNKTKYLAGDEFSTADAMFIPILARIILLDLHEEYISCRPRVLEYHTLVKQRPSYKVVIG  237

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF+GWK+ +TL +T  F+  R++ R+Y
Sbjct  238   KYFNGWKKYRTLFRTSFFLCVRTLFRKY  265



>ref|XP_010908829.1| PREDICTED: glutathione S-transferase TCHQD-like [Elaeis guineensis]
 ref|XP_010908830.1| PREDICTED: glutathione S-transferase TCHQD-like [Elaeis guineensis]
Length=265

 Score =   332 bits (850),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 166/268 (62%), Positives = 215/268 (80%), Gaps = 3/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYS++S KVRLALEEKGIDYTS++VNP+TGKN+D  FF +NPSAKLPVFQNG+H
Sbjct  1     MQLYHHPYSMESQKVRLALEEKGIDYTSYNVNPLTGKNMDASFFHMNPSAKLPVFQNGAH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II+  I+I+QYI+R+A  VS  G D  +S++ V+EWM KI+ W  K FTL HVP K RL+
Sbjct  61    IIFRAIDIVQYIDRLA--VSLNGEDKPISSE-VMEWMQKIEGWSSKIFTLSHVPDKCRLF  117

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV+IARMAE PDLAS YH KL+EAY+TE+K+ N  +V+QSEE L +LLD  E +
Sbjct  118   VSKFVRRVVIARMAEAPDLASMYHLKLQEAYDTEDKVKNPDIVKQSEEKLAELLDNAEMQ  177

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L+E  Y+ G+EF++AD M IP+LAR+ +LNLE E+I+ RPN+ +Y+ LVK RPSYK VIG
Sbjct  178   LNETKYIAGDEFTMADSMFIPVLARITLLNLEKEYISCRPNIAEYYNLVKHRPSYKVVIG  237

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF GW++ +T +KT  F+  RS+ RRY
Sbjct  238   KYFSGWRKHRTFMKTLFFLGIRSLFRRY  265



>gb|EMS53824.1| Tetrachloro-P-hydroquinone reductive dehalogenase [Triticum urartu]
Length=265

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/268 (60%), Positives = 214/268 (80%), Gaps = 3/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVR+ALEEKGIDYTS+HVNP+TGKN++  FFR+NPSAKLPVFQNG+H
Sbjct  1     MQLYHHPYSLDSQKVRIALEEKGIDYTSYHVNPLTGKNMNVAFFRMNPSAKLPVFQNGAH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +I+  I+IIQY++R+A  +S    ++   N +V++WM K+  W+PK FTL H P+KYR +
Sbjct  61    VIFRAIDIIQYLDRLAVHLSG---EIQPVNTEVLQWMQKVDGWNPKMFTLTHTPLKYRAF  117

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV+IARMAE PDLAS YH KLR+ YETE++L + + +RQSEE L KLLD+VE +
Sbjct  118   VSKFIRRVLIARMAEAPDLASMYHVKLRDGYETEDRLKDPETMRQSEEELSKLLDDVEAQ  177

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L++  YL G+EFS AD M IPILAR+ +L+L  E+I++RP + +Y  LVKQRPSYK VIG
Sbjct  178   LNKTKYLAGDEFSPADSMFIPILARIALLDLYEEYISSRPRVLEYHTLVKQRPSYKVVIG  237

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF+GWK+  TL +T  F+  R++ R+Y
Sbjct  238   KYFNGWKKYHTLFRTSFFLCVRTLFRKY  265



>gb|EMT26928.1| hypothetical protein F775_28473 [Aegilops tauschii]
Length=265

 Score =   327 bits (839),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/268 (60%), Positives = 213/268 (79%), Gaps = 3/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVR+ALEEKGIDYTS+HVNP+TGKN++  FFR+NPSAKLPVFQNG+H
Sbjct  1     MQLYHHPYSLDSQKVRIALEEKGIDYTSYHVNPLTGKNMNVTFFRMNPSAKLPVFQNGAH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +I+  I+IIQYI+R+A  +S    ++   N +V++WM K+  W+PK FTL H P+K R +
Sbjct  61    VIFRAIDIIQYIDRLAVHLSG---EIQPVNTEVLQWMQKVDGWNPKMFTLTHTPLKCRAF  117

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV+IARMAE PDLAS YH KLR+ YETE++L + + +RQSEE L KLLD+VE +
Sbjct  118   VSKFIRRVLIARMAEAPDLASMYHVKLRDGYETEDRLKDPETMRQSEEELSKLLDDVEAQ  177

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L++  YL G+EFS AD M IPILAR+ +L+L  E+I++RP + +Y  LVKQRPSYK VIG
Sbjct  178   LNKTKYLAGDEFSPADSMFIPILARIALLDLHEEYISSRPRVLEYHTLVKQRPSYKVVIG  237

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF+GWK+  TL +T  F+  R++ R+Y
Sbjct  238   KYFNGWKKYHTLFRTSFFLCVRTLFRKY  265



>ref|XP_009406137.1| PREDICTED: glutathione S-transferase TCHQD-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406138.1| PREDICTED: glutathione S-transferase TCHQD-like [Musa acuminata 
subsp. malaccensis]
Length=265

 Score =   326 bits (835),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/268 (62%), Positives = 213/268 (79%), Gaps = 3/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYS+DS KVR+ALEEKGIDYTS+HVNP+TGKN+D  FFRINPSAKLPVFQNGSH
Sbjct  1     MQLYHHPYSMDSQKVRIALEEKGIDYTSYHVNPLTGKNMDVPFFRINPSAKLPVFQNGSH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II+  I+IIQYIER++  VS  G + N  + +V+EW+ +I+ W+PK FTL H+P KYRL+
Sbjct  61    IIFHAIDIIQYIERLS--VSLNG-EENPISSKVMEWVERIESWNPKLFTLTHIPDKYRLF  117

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV+I+RM E PDLA  YH KLREAYETE+ L     +++SEE L  LLD+ E +
Sbjct  118   VSKFIRRVVISRMVEAPDLACLYHVKLREAYETEDNLKGPMNLQRSEEKLSSLLDDAEIQ  177

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LS  +YL GE+F+ AD M +PILAR+ +L+LE ++I+ RP +  Y+ LVK+RPSYKKVIG
Sbjct  178   LSATTYLVGEDFTTADSMFVPILARITLLDLEEKYISCRPKITAYYDLVKRRPSYKKVIG  237

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF GW++ +TLLKT CF+  RSM  +Y
Sbjct  238   KYFAGWRKYRTLLKTMCFLCIRSMFGKY  265



>ref|NP_001132463.1| Tetrachloro-P-hydroquinone reductive dehalogenase [Zea mays]
 ref|XP_008667233.1| PREDICTED: tetrachloro-P-hydroquinone reductive dehalogenase 
isoform X1 [Zea mays]
 ref|XP_008667234.1| PREDICTED: tetrachloro-P-hydroquinone reductive dehalogenase 
isoform X1 [Zea mays]
 ref|XP_008667235.1| PREDICTED: tetrachloro-P-hydroquinone reductive dehalogenase 
isoform X1 [Zea mays]
 ref|XP_008667236.1| PREDICTED: tetrachloro-P-hydroquinone reductive dehalogenase 
isoform X1 [Zea mays]
 ref|XP_008667237.1| PREDICTED: tetrachloro-P-hydroquinone reductive dehalogenase 
isoform X1 [Zea mays]
 ref|XP_008667238.1| PREDICTED: tetrachloro-P-hydroquinone reductive dehalogenase 
isoform X1 [Zea mays]
 ref|XP_008667239.1| PREDICTED: tetrachloro-P-hydroquinone reductive dehalogenase 
isoform X1 [Zea mays]
 ref|XP_008667240.1| PREDICTED: tetrachloro-P-hydroquinone reductive dehalogenase 
isoform X1 [Zea mays]
 ref|XP_008667241.1| PREDICTED: tetrachloro-P-hydroquinone reductive dehalogenase 
isoform X1 [Zea mays]
 ref|XP_008667242.1| PREDICTED: tetrachloro-P-hydroquinone reductive dehalogenase 
isoform X1 [Zea mays]
 ref|XP_008667243.1| PREDICTED: tetrachloro-P-hydroquinone reductive dehalogenase 
isoform X1 [Zea mays]
 ref|XP_008667244.1| PREDICTED: tetrachloro-P-hydroquinone reductive dehalogenase 
isoform X1 [Zea mays]
 gb|ACF81312.1| unknown [Zea mays]
 gb|ACG27029.1| tetrachloro-P-hydroquinone reductive dehalogenase [Zea mays]
 tpg|DAA37725.1| TPA: Tetrachloro-P-hydroquinone reductive dehalogenase [Zea mays]
Length=265

 Score =   326 bits (835),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/268 (60%), Positives = 211/268 (79%), Gaps = 3/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVR+ALEEKGIDYTS+HVNP+TGKN++  FFR+NPSAKLPVFQNG+H
Sbjct  1     MQLYHHPYSLDSQKVRMALEEKGIDYTSYHVNPLTGKNMNVDFFRMNPSAKLPVFQNGAH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +IY  I+IIQYI+R+A  +S    ++   N +V +WM K+  W+P+ FTL H P K+R +
Sbjct  61    VIYRAIDIIQYIDRLAVHLSG---EIPPVNTEVHQWMQKVDAWNPEMFTLTHTPAKHRAF  117

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKF+RRV+IARMA+ PDLAS YH KLREAYET++K+ +  +++QSEE L KLLD+VE +
Sbjct  118   VSKFIRRVLIARMAQAPDLASMYHVKLREAYETDDKVKDPDIMKQSEEELSKLLDDVEAQ  177

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L +  YL G+EFS AD M +P+LAR+ +L+L+ E+IN RP + +Y+ LVK RPSYK  IG
Sbjct  178   LGKTKYLAGDEFSPADSMFVPVLARITILDLDDEYINCRPKILEYYNLVKLRPSYKITIG  237

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             RYF GWK+ +TL KT  F+  R++ R+Y
Sbjct  238   RYFSGWKKYRTLFKTSFFLCVRTLFRKY  265



>ref|XP_008219713.1| PREDICTED: glutathione S-transferase TCHQD [Prunus mume]
Length=243

 Score =   323 bits (829),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 165/268 (62%), Positives = 210/268 (78%), Gaps = 25/268 (9%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHP+SLDS +VR ALEEKGIDYTS HVNP+TGKN+D  FFR+NP+AKLPVFQNG H
Sbjct  1     MQLYHHPFSLDSQRVRFALEEKGIDYTSFHVNPVTGKNMDASFFRMNPTAKLPVFQNGGH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +I+DTIEIIQY+E+IA KVSSG  ++ +S+ +V+EWMHKIQ+W+PK+FTL H+P K+R Y
Sbjct  61    VIFDTIEIIQYLEKIA-KVSSGDENIPLSSSEVIEWMHKIQKWNPKFFTLCHIPEKHRRY  119

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLR+V+IARMAE PDLA+ YH+KL+EAYETEEKL N  V++Q +EHLV+LLDEVE +
Sbjct  120   VSKFLRQVLIARMAETPDLAADYHKKLKEAYETEEKLKNPDVLKQDKEHLVRLLDEVETQ  179

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L+                         +LNLE E+I  RPN+  YW +V+QRPSYKKVIG
Sbjct  180   LN------------------------VILNLEDEYIGGRPNMAKYWIMVQQRPSYKKVIG  215

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             ++F GW++ KT +KTWC V  R+MLR++
Sbjct  216   KHFCGWRKHKTFVKTWCIVHIRTMLRKF  243



>emb|CAN65319.1| hypothetical protein VITISV_036321 [Vitis vinifera]
Length=267

 Score =   317 bits (812),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 159/239 (67%), Positives = 201/239 (84%), Gaps = 1/239 (0%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            MQLYHHPYSLDS KVRL LEE GIDYTS+ VNPITGKN++  FFR+NPSAKLPVFQNGSH
Sbjct  1    MQLYHHPYSLDSQKVRLTLEENGIDYTSYRVNPITGKNMEPSFFRLNPSAKLPVFQNGSH  60

Query  420  iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
            II+DTI+ +QYIERIA   + G  ++ +S+Q+V+EWM +IQ WDPKYFTL+H+P KYR  
Sbjct  61   IIFDTIDXMQYIERIA-VFTLGSENVTLSSQEVIEWMQRIQAWDPKYFTLFHIPEKYRFT  119

Query  600  VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             SKF+RRV+IARMAE PDLA SYH KL E Y TE+KL +  V++QS+E L ++LDEVE K
Sbjct  120  XSKFIRRVVIARMAESPDLAGSYHLKLDEVYATEDKLRDPDVLKQSKEQLAEILDEVERK  179

Query  780  LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
            L+E++Y+ G+EF++ADVMLIP+LAR+ +L+LE E+I +RPN+ +YW LV+QRPSYKKVI
Sbjct  180  LNESTYIAGDEFTMADVMLIPVLARIVLLDLEEEYICSRPNIAEYWNLVQQRPSYKKVI  238



>ref|XP_006847165.1| hypothetical protein AMTR_s00017p00243750 [Amborella trichopoda]
 gb|ERN08746.1| hypothetical protein AMTR_s00017p00243750 [Amborella trichopoda]
Length=266

 Score =   313 bits (803),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 161/268 (60%), Positives = 209/268 (78%), Gaps = 2/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHPYSLDS KVRLALEE+GIDYTS+ VNP+  +N+D  FFR+NPSAKLPVF+NG  
Sbjct  1     MQLYHHPYSLDSQKVRLALEERGIDYTSYQVNPLKARNMDATFFRLNPSAKLPVFRNGEC  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +IY+T+EII+YIERI E  S+ GF  + + ++V EWM KIQ W  K FTL H+P K+RL+
Sbjct  61    VIYETLEIIRYIERIVE--STQGFCEDSNQEKVEEWMKKIQAWSAKTFTLAHIPDKHRLF  118

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VS+F RRV+IARMAE PDLAS YH KLREAYETEEKL +A +VR+SEE L  LLDEVE +
Sbjct  119   VSRFTRRVVIARMAESPDLASLYHMKLREAYETEEKLKDAALVRRSEEQLDHLLDEVERQ  178

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L E  +L G+ FS+AD M +P+LAR+++L L  ++I+ RP + +YW +VK R SY+ VIG
Sbjct  179   LRETHFLCGDAFSMADAMFVPVLARIELLGLGEKYISCRPGIEEYWKVVKSRHSYRVVIG  238

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             ++F GW++ KTL  T+  V  R++L+RY
Sbjct  239   KFFSGWRKYKTLFSTFSIVFIRNVLKRY  266



>gb|KEH35353.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=236

 Score =   310 bits (795),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 161/268 (60%), Positives = 202/268 (75%), Gaps = 32/268 (12%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLYHHP+ LDS K                               +NPS  LPVFQNGSH
Sbjct  1     MQLYHHPFDLDSQK-------------------------------MNPSGSLPVFQNGSH  29

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             IIY TI+IIQYIERIA  VS+G  D++ +  +V+EWM +IQEWDPKYF+L H+P K+R+Y
Sbjct  30    IIYKTIDIIQYIERIA-VVSAGSEDISSNRSEVIEWMKRIQEWDPKYFSLSHIPEKHRVY  88

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             VSKFLRRV+IARM+E P+LA +YHRKLREAY+TEEKL +  V+R+SEEHLV+LLD+ E +
Sbjct  89    VSKFLRRVVIARMSESPELAGAYHRKLREAYQTEEKLKDPHVLRRSEEHLVRLLDDAERQ  148

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LSE  YL GEEFS+ADVMLIPILARL++L+LE E++  RPN+ +YW LV+QRPSY+KVI 
Sbjct  149   LSETPYLAGEEFSMADVMLIPILARLKLLDLENEYVTVRPNIAEYWILVQQRPSYRKVIA  208

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             ++FDGW++ KTL KTWCFV  RS+L+RY
Sbjct  209   KHFDGWRKHKTLFKTWCFVHIRSLLKRY  236



>gb|AHC03514.1| TCHQD class glutathione S-transferase [Larix kaempferi]
Length=264

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/268 (56%), Positives = 191/268 (71%), Gaps = 4/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLY HPYSLDS KVRLALEEKG+DY  + +NP+  KNLD+ FFR+NP+ KLPVF NG H
Sbjct  1     MQLYQHPYSLDSQKVRLALEEKGLDYWPYSINPLKAKNLDSKFFRMNPTGKLPVFLNGQH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II+DT+ I+QYI+ I E +     D     ++++ WM  I  W+PK FTL HVP KYRL+
Sbjct  61    IIFDTLSILQYIDSINEPLGGDAVD----REKMLAWMRWIDLWNPKLFTLSHVPQKYRLF  116

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
              SKF RR  IARMAECPDLAS YH KLR AY TEE+L +  ++  S E L+K+LD  E +
Sbjct  117   FSKFQRRSAIARMAECPDLASKYHLKLRSAYATEEQLKDKDMINSSNELLMKILDAAEDQ  176

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LS  ++L GE FS+AD   IPILAR+ +LNLE E+I +R +L DYW  VK+RPSY  VIG
Sbjct  177   LSSTNFLAGEAFSMADATFIPILARINLLNLEEEYIGSRSHLLDYWNRVKKRPSYHAVIG  236

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF GW + KTL  T+  V  R++ R+Y
Sbjct  237   KYFSGWTKYKTLYATYSSVWLRNLFRKY  264



>gb|AGC13148.1| TCHQD class glutathione S-transferase [Pinus tabuliformis]
Length=264

 Score =   290 bits (742),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 188/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQLY HPYSLDS KVRLALEEKG+DY  + +NP+  KNLD+  FR+NP+ KLPVF NG H
Sbjct  1     MQLYQHPYSLDSQKVRLALEEKGLDYWPYSINPLKAKNLDSRIFRMNPTGKLPVFLNGQH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             II DT+ I+QYI+ I E +     D     ++++ WM  I  W+PK FTL HVP KYRL+
Sbjct  61    IILDTLSILQYIDSIHEPLGGDAVD----REKMLLWMRSIDSWNPKLFTLSHVPQKYRLF  116

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
              S+F RR  IARMAECPDLA  YH KL  AY TEE+L + +++  S E L+K+LD  E +
Sbjct  117   FSRFQRRAAIARMAECPDLAGKYHLKLHSAYATEEELKDKELINSSNELLIKILDAAEDQ  176

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             LS   +L G  FS+AD M IPILAR+ +LNLE E+I +R +L DYW  VK+RPSY  VIG
Sbjct  177   LSSTDFLAGGAFSMADAMFIPILARINLLNLEEEYIGSRSHLLDYWNRVKKRPSYHAVIG  236

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             +YF GW++ KTL  T+  V  R++ RRY
Sbjct  237   KYFSGWRKYKTLYATYSSVWVRNLFRRY  264



>gb|KCW85228.1| hypothetical protein EUGRSUZ_B02072 [Eucalyptus grandis]
Length=221

 Score =   287 bits (734),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 148/223 (66%), Positives = 187/223 (84%), Gaps = 2/223 (1%)
 Frame = +3

Query  375   INPSAKLPVFQNGSHiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDP  554
             +NP+AKLPVFQNGSH+I+DTIEIIQYIERIA  VS     +  S+ +V++WMHKIQEW+P
Sbjct  1     MNPTAKLPVFQNGSHVIFDTIEIIQYIERIA-VVSVNNDSIAFSSDEVIQWMHKIQEWNP  59

Query  555   KYFTLYHVPVKYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQ  734
             K+FTL HVP KYR  VSKF RRV+IARMAE PDLA SY  KL+EAY TEEKL + +VVR+
Sbjct  60    KFFTLSHVPEKYRQAVSKFFRRVLIARMAESPDLAISYQCKLKEAYHTEEKLRDPEVVRR  119

Query  735   SEEHLVKLLDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDY  914
             S+EHL++LLDE+E  LS+ +Y+ GEEFS+ADVM IP+LARL +LNLE E+IN+RPN+  Y
Sbjct  120   SKEHLIRLLDEIEDSLSK-TYIAGEEFSMADVMFIPVLARLALLNLEDEYINSRPNMAKY  178

Query  915   WALVKQRPSYKKVIGRYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             W+LV+QRPSYKKVIGRYF GW++ +TL KTWCF++ R+ L++Y
Sbjct  179   WSLVQQRPSYKKVIGRYFGGWRKYRTLAKTWCFIRLRNTLKKY  221



>ref|XP_010055969.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X2 [Eucalyptus 
grandis]
Length=214

 Score =   275 bits (704),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +3

Query  474   VSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARMAECPD  653
             VS     +  S+ +V++WMH+IQEW+PK+FTL HVP KYR  VSKF RRV+IARMAE PD
Sbjct  25    VSVNNDSIAFSSDEVIQWMHRIQEWNPKFFTLSHVPEKYRQAVSKFNRRVLIARMAESPD  84

Query  654   LASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFSLADVM  833
             LASSYHRKL+EAY TEEKL + +VVR+S+EHL++LLDE+E +LSE +Y+ GEEFS+ADVM
Sbjct  85    LASSYHRKLKEAYHTEEKLRDPEVVRRSQEHLIRLLDEIEDRLSETAYIAGEEFSMADVM  144

Query  834   LIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRYFDGWKRQKTLLKTWCF  1013
              IP+LARL +LNLE E+IN+RPN+ +YW+ V+QRPSYKKVIGRYF GW++ KTL KTWCF
Sbjct  145   FIPVLARLALLNLEDEYINSRPNMAEYWSSVQQRPSYKKVIGRYFGGWRKYKTLAKTWCF  204

Query  1014  VQARSMLRRY  1043
             ++ R+ L++Y
Sbjct  205   IRLRNTLKKY  214



>ref|XP_010678910.1| PREDICTED: glutathione S-transferase TCHQD isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=216

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 167/195 (86%), Gaps = 1/195 (1%)
 Frame = +3

Query  459   RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
             RIA  VSS G  + +S+++V+EWMHKIQEW+PKYFTL HVP K+RLYV+KF R+V+IARM
Sbjct  23    RIA-AVSSVGDGITLSSREVIEWMHKIQEWNPKYFTLSHVPEKHRLYVTKFTRQVVIARM  81

Query  639   AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
             AE PDLAS+YH +LR+AY+TEEKL + +V  +S+EHLV+LLD VE +L++ SYL GE+F+
Sbjct  82    AEFPDLASAYHLRLRDAYDTEEKLQDPEVTLRSQEHLVRLLDAVETQLNDNSYLAGEKFT  141

Query  819   LADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRYFDGWKRQKTLL  998
             +ADVMLIP+LARL +L LE E+I+ RPN+ +YW +V+QRPSYK+VIG+YFDGW+RQKTL 
Sbjct  142   MADVMLIPVLARLVLLKLEHEYIDNRPNISEYWKMVQQRPSYKRVIGKYFDGWRRQKTLT  201

Query  999   KTWCFVQARSMLRRY  1043
             KTWC++  R++L++Y
Sbjct  202   KTWCYIHMRNLLKKY  216



>gb|KCW89669.1| hypothetical protein EUGRSUZ_A01942 [Eucalyptus grandis]
Length=313

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 160/206 (78%), Gaps = 16/206 (8%)
 Frame = +3

Query  474   VSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARMAECPD  653
             VS     +  S+ +V++WMHKIQEW+PK+FTL HVP KYR  VSKF RRV+IARMAE PD
Sbjct  108   VSVNNDSIAFSSDEVIQWMHKIQEWNPKFFTLSHVPEKYRQAVSKFFRRVLIARMAESPD  167

Query  654   LASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVE----------------GKLS  785
             LASSYHRKL+EAY TEEKL + +VVR+S+EHL++LLDE+E                 +LS
Sbjct  168   LASSYHRKLKEAYHTEEKLRDPEVVRRSKEHLIRLLDEIEDSLSKTYIAGEEFSMADRLS  227

Query  786   EASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
             + +Y+ GEEFS+ADVM IP+LARL +LNLE E+IN+RPN+  YW+LV+QRPSYKKVIGRY
Sbjct  228   KTAYIAGEEFSMADVMFIPVLARLALLNLEDEYINSRPNMAKYWSLVQQRPSYKKVIGRY  287

Query  966   FDGWKRQKTLLKTWCFVQARSMLRRY  1043
             F GW++ +TL KTWCF++ R+ L++Y
Sbjct  288   FGGWRKYRTLAKTWCFIRLRNTLKKY  313



>ref|XP_010070595.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW59456.1| hypothetical protein EUGRSUZ_H02194 [Eucalyptus grandis]
Length=230

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 159/206 (77%), Gaps = 16/206 (8%)
 Frame = +3

Query  474   VSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARMAECPD  653
             VS     +  S+ +V++WMHKIQEW+PK+FTL HVP KYR  VSKF RRV+IARMAE PD
Sbjct  25    VSVNNDSIAFSSDEVIQWMHKIQEWNPKFFTLSHVPEKYRQAVSKFFRRVLIARMAESPD  84

Query  654   LASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVE----------------GKLS  785
             LASSYHRKL+EAY TEEKL + +VVR+S+EHL++LLDE+E                 +LS
Sbjct  85    LASSYHRKLKEAYHTEEKLRDPEVVRRSKEHLIRLLDEIEDSLSKTYIAGEEFSMADRLS  144

Query  786   EASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
             + +Y+ GEEFS+ADVM IP+LARL +LNLE E+IN+RPN+  YW+LV+QRPSYKKVIGRY
Sbjct  145   KTAYIAGEEFSMADVMFIPVLARLALLNLEDEYINSRPNMAKYWSLVQQRPSYKKVIGRY  204

Query  966   FDGWKRQKTLLKTWCFVQARSMLRRY  1043
             F GW++ +TL KTWCF+  R+ L++Y
Sbjct  205   FGGWRKYRTLAKTWCFIWLRNTLKKY  230



>gb|KCW51823.1| hypothetical protein EUGRSUZ_J01273 [Eucalyptus grandis]
Length=313

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 160/206 (78%), Gaps = 16/206 (8%)
 Frame = +3

Query  474   VSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARMAECPD  653
             VS     +  S+ +V++WMHKIQEW+PK+FTL HVP KYR  VSKF RRV+IARMAE PD
Sbjct  108   VSVNNDSIAFSSDEVIQWMHKIQEWNPKFFTLSHVPEKYRQAVSKFFRRVLIARMAESPD  167

Query  654   LASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVE----------------GKLS  785
             LASSYHRKL+EAY TEEKL + +VVR+S+EHL++LLDE+E                 +LS
Sbjct  168   LASSYHRKLKEAYHTEEKLRDPEVVRRSKEHLIRLLDEIEDSLSKTYIAGEEFSMADRLS  227

Query  786   EASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
             + +Y+ GEEFS+ADVM IP+LARL +LNLE E+IN+RPN+  YW+LV+QRPSYKKVIGRY
Sbjct  228   KTAYIAGEEFSMADVMFIPVLARLALLNLEDEYINSRPNMAKYWSLVQQRPSYKKVIGRY  287

Query  966   FDGWKRQKTLLKTWCFVQARSMLRRY  1043
             F GW++ +TL KTWCF++ R+ L++Y
Sbjct  288   FGGWRKYRTLAKTWCFIRLRNTLKKY  313



>ref|XP_010070444.1| PREDICTED: glutathione S-transferase TCHQD-like [Eucalyptus grandis]
Length=301

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 160/206 (78%), Gaps = 16/206 (8%)
 Frame = +3

Query  474   VSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARMAECPD  653
             VS     +  S+ +V++WMHKIQEW+PK+FTL HVP KYR  VSKF RRV+IARMAE PD
Sbjct  96    VSVNNDSIAFSSDEVIQWMHKIQEWNPKFFTLSHVPEKYRQAVSKFFRRVLIARMAESPD  155

Query  654   LASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVE----------------GKLS  785
             LASSYHRKL+EAY TEEKL + +VVR+S+EHL++LLDE+E                 +LS
Sbjct  156   LASSYHRKLKEAYHTEEKLRDPEVVRRSKEHLIRLLDEIEDSLSKTYIAGEEFSMADRLS  215

Query  786   EASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
             + +Y+ GEEFS+ADVM IP+LARL +LNLE E+IN+RPN+  YW+LV+QRPSYKKVIGRY
Sbjct  216   KTAYIAGEEFSMADVMFIPVLARLALLNLEDEYINSRPNMAKYWSLVQQRPSYKKVIGRY  275

Query  966   FDGWKRQKTLLKTWCFVQARSMLRRY  1043
             F GW++ +TL KTWCF++ R+ L++Y
Sbjct  276   FGGWRKYRTLAKTWCFIRLRNTLKKY  301



>ref|XP_010023525.1| PREDICTED: glutathione S-transferase TCHQD-like isoform X2 [Eucalyptus 
grandis]
Length=230

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 159/206 (77%), Gaps = 16/206 (8%)
 Frame = +3

Query  474   VSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARMAECPD  653
             VS     +  S+ +V++WMHKIQEW+PK+FTL HVP KYR  VSKF RRV+IARMAE PD
Sbjct  25    VSVNNDSIAFSSDEVIQWMHKIQEWNPKFFTLSHVPEKYRQAVSKFFRRVLIARMAESPD  84

Query  654   LASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVE----------------GKLS  785
             LASSYHRKL+EAY TEEKL + +VVR+S+EHL++LLDE+E                 +LS
Sbjct  85    LASSYHRKLKEAYHTEEKLRDPEVVRRSKEHLIRLLDEIEDSLSKTYIAGEEFSMADRLS  144

Query  786   EASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
             + +Y+ GEEFS+ADVM IP+LARL +LNLE E+IN+RPN+   W+LV+QRPSYKKVIGRY
Sbjct  145   KTAYIAGEEFSMADVMFIPVLARLALLNLEDEYINSRPNMAKDWSLVQQRPSYKKVIGRY  204

Query  966   FDGWKRQKTLLKTWCFVQARSMLRRY  1043
             F GW++ +TL KTWCF++ R+ L++Y
Sbjct  205   FGGWRKYRTLAKTWCFIRLRNTLKKY  230



>ref|XP_010032429.1| PREDICTED: glutathione S-transferase TCHQD-like [Eucalyptus grandis]
Length=188

 Score =   254 bits (650),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 150/188 (80%), Gaps = 16/188 (9%)
 Frame = +3

Query  528   MHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEK  707
             MHKIQEW+PK+FTL HVP KYR  VSKF RRV+IARMAE PDLASSYHRKL+EAY TEEK
Sbjct  1     MHKIQEWNPKFFTLSHVPEKYRQAVSKFFRRVLIARMAESPDLASSYHRKLKEAYHTEEK  60

Query  708   LGNAQVVRQSEEHLVKLLDEVE----------------GKLSEASYLTGEEFSLADVMLI  839
             L + +VVR+S+EHL++LLDE+E                 +LS+ +Y+ GEEFS+ADVM I
Sbjct  61    LRDPEVVRRSKEHLIRLLDEIEDSLSKTYIAGEEFSMADRLSKTAYIAGEEFSMADVMFI  120

Query  840   PILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRYFDGWKRQKTLLKTWCFVQ  1019
             P+LARL +LNLE E+IN+RPN+  YW+LV+QRPSYKKVIGRYF GW++ +TL KTWCF++
Sbjct  121   PVLARLALLNLEDEYINSRPNMAKYWSLVQQRPSYKKVIGRYFGGWRKYRTLAKTWCFIR  180

Query  1020  ARSMLRRY  1043
              R+ L++Y
Sbjct  181   LRNTLKKY  188



>gb|KCW89670.1| hypothetical protein EUGRSUZ_A01942 [Eucalyptus grandis]
Length=294

 Score =   250 bits (639),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 148/189 (78%), Gaps = 16/189 (8%)
 Frame = +3

Query  525   WMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEE  704
             W+  + EW+PK+FTL HVP KYR  VSKF RRV+IARMAE PDLASSYHRKL+EAY TEE
Sbjct  106   WVDTLSEWNPKFFTLSHVPEKYRQAVSKFFRRVLIARMAESPDLASSYHRKLKEAYHTEE  165

Query  705   KLGNAQVVRQSEEHLVKLLDEVEG----------------KLSEASYLTGEEFSLADVML  836
             KL + +VVR+S+EHL++LLDE+E                 +LS+ +Y+ GEEFS+ADVM 
Sbjct  166   KLRDPEVVRRSKEHLIRLLDEIEDSLSKTYIAGEEFSMADRLSKTAYIAGEEFSMADVMF  225

Query  837   IPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRYFDGWKRQKTLLKTWCFV  1016
             IP+LARL +LNLE E+IN+RPN+  YW+LV+QRPSYKKVIGRYF GW++ +TL KTWCF+
Sbjct  226   IPVLARLALLNLEDEYINSRPNMAKYWSLVQQRPSYKKVIGRYFGGWRKYRTLAKTWCFI  285

Query  1017  QARSMLRRY  1043
             + R+ L++Y
Sbjct  286   RLRNTLKKY  294



>gb|AFF18818.1| glutathione transferase, partial [Dimocarpus longan]
Length=165

 Score =   235 bits (600),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            MQLYHHP+SLDS KVRL LEEKGIDYTS HVNPIT KN+D  FFR+NPSA+LPVFQNG+H
Sbjct  1    MQLYHHPFSLDSQKVRLTLEEKGIDYTSFHVNPITAKNMDCSFFRMNPSARLPVFQNGAH  60

Query  420  iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
            II++TI+IIQYIERIA  VSS   D+  S+++VVEWMHKIQ+W+PK+FTL H+P KYRLY
Sbjct  61   IIFNTIDIIQYIERIA-VVSSAADDMTFSSREVVEWMHKIQDWNPKFFTLTHIPAKYRLY  119

Query  600  VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQS  737
            +SKF RRV+IARMAE P+LA++YHRKL+ AYETE+KL N  VV++S
Sbjct  120  ISKFTRRVVIARMAESPELANAYHRKLKAAYETEDKLKNPDVVKRS  165



>ref|XP_001771860.1| predicted protein [Physcomitrella patens]
 gb|EDQ63289.1| predicted protein [Physcomitrella patens]
 gb|AFZ39137.1| TCHQD class glutathione S-transferase [Physcomitrella patens]
Length=264

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/268 (45%), Positives = 177/268 (66%), Gaps = 4/268 (1%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQ YHHP S++S KVRLALEEK IDYT+  VNP+  +NLD  FFR NP+  LP+ + G+H
Sbjct  1     MQFYHHPLSMNSQKVRLALEEKNIDYTAFRVNPLKARNLDAEFFRQNPNGTLPMLKIGAH  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             ++ +++ I+Q+I+++ E +     +     ++  EW+ KI EWD K FTL HVP +   +
Sbjct  61    VLCESLPILQHIDKLNEPLG----EYKDYRERAEEWIKKIDEWDAKPFTLTHVPDRMIRF  116

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
               KF RRV+IARMA+ PDLA+ YH KL   +  EE+L + Q V  + + LV +LD+ E +
Sbjct  117   FGKFKRRVLIARMAKNPDLANKYHSKLNSMHAMEEQLKDTQAVDSNRKELVLMLDDAEHQ  176

Query  780   LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
             L+   ++ G+ FS+AD   IP+LAR+++L L  E++  RP L DYW  +K RPSYKKVIG
Sbjct  177   LAGTEFMAGDVFSVADAAFIPVLARIELLKLSEEYLRPRPKLLDYWERMKCRPSYKKVIG  236

Query  960   RYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
              Y    K+ K ++ + C V  R++L+R+
Sbjct  237   GYSSQLKQLKLVVPSICNVGIRNVLKRF  264



>ref|XP_002970046.1| hypothetical protein SELMODRAFT_267328 [Selaginella moellendorffii]
 gb|EFJ29170.1| hypothetical protein SELMODRAFT_267328 [Selaginella moellendorffii]
Length=265

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/269 (46%), Positives = 174/269 (65%), Gaps = 5/269 (2%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQ YHHP SL S + R+ALEEKG+DY  + +NP+  +NLD  FFR +P+ ++PV  NG+ 
Sbjct  1     MQFYHHPLSLQSQQARMALEEKGLDYWDYSINPLKARNLDAEFFREHPNGRIPVLINGNR  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +   ++ I+QYI++  + +    FD   S    ++W  K+  WDPK FTL   P KY  Y
Sbjct  61    VTRGSLAIVQYIDKFDKALGGDKFDCEKS----LQWQRKVDAWDPKLFTLSATPPKYLQY  116

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
              S+F R+V+IARMAE PDLA+ YH KL + +  EE L +   ++ + EHLV LL++ E +
Sbjct  117   HSRFKRQVLIARMAENPDLANKYHAKLHDMHALEELLKDTDAIQANREHLVGLLEDAEAE  176

Query  780   LSEA-SYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
             L+   +YL GE FS+ADVM  P+LAR++++  E E I+TRP+L  YWA VK R SYK  I
Sbjct  177   LAATNNYLAGESFSMADVMFSPLLARIELMKQEKEMIHTRPHLMVYWAKVKTRESYKVCI  236

Query  957   GRYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             G+Y  G  +   LL +   V AR+ML+RY
Sbjct  237   GKYSKGLGKINLLLSSVLNVVARTMLKRY  265



>ref|XP_002985236.1| hypothetical protein SELMODRAFT_446164 [Selaginella moellendorffii]
 gb|EFJ13730.1| hypothetical protein SELMODRAFT_446164 [Selaginella moellendorffii]
Length=265

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/269 (46%), Positives = 174/269 (65%), Gaps = 5/269 (2%)
 Frame = +3

Query  240   MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
             MQ YHHP SL S + R+ALEEKG+DY  + +NP+  +NLD  FFR +P+ ++PV  NG+ 
Sbjct  1     MQFYHHPLSLQSQQARMALEEKGLDYWDYSINPLKARNLDAEFFREHPNGRIPVLINGNR  60

Query  420   iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             +   ++ I+QYI++  + +    FD   S    ++W  K+  WDPK FTL   P KY  Y
Sbjct  61    VTRGSLGIVQYIDKFDKALGGDKFDCEKS----LQWQRKVDAWDPKLFTLSATPPKYLQY  116

Query  600   VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
              S+F R+V+IARMAE PDLA+ YH KL + +  EE L +   ++ + EHLV LL++ E +
Sbjct  117   HSRFKRQVLIARMAENPDLANKYHAKLHDMHALEELLKDTDAIQANREHLVGLLEDAEAE  176

Query  780   LSEA-SYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
             L+   +YL GE FS+ADVM  P+LAR++++  E E I+TRP+L  YWA VK R SYK  I
Sbjct  177   LAATNNYLAGESFSMADVMFSPLLARIELMKQEKEMIHTRPHLMVYWAKVKTRESYKVCI  236

Query  957   GRYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             G+Y  G  +   LL +   V AR+ML+RY
Sbjct  237   GKYSKGLGKINLLLSSVLNVVARTMLKRY  265



>gb|EPS67396.1| hypothetical protein M569_07387, partial [Genlisea aurea]
Length=200

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 153/197 (78%), Gaps = 2/197 (1%)
 Frame = +3

Query  459   RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
             R+A   S GG     +++++++W++ IQ+W+ K+FTL HVP KYRL +SKFLRRVIIARM
Sbjct  4     RVAMVSSGGGNASTFNDEEIIQWVNTIQQWNSKFFTLSHVPSKYRLLLSKFLRRVIIARM  63

Query  639   AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSE--ASYLTGEE  812
             AECP+LA+ YH KL++ YE +E L + +++RQSE+ L  +LDE E +L++   +YL GEE
Sbjct  64    AECPELATLYHSKLKQEYEIDETLRDPEILRQSEQQLNAILDEAERRLNDKKTTYLFGEE  123

Query  813   FSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRYFDGWKRQKT  992
             F+LADV  +P+L+RL VL+LE ++I  RPN+  YW++V++RP+YK+VIG+YF  W++  T
Sbjct  124   FTLADVAFVPVLSRLAVLDLEEKYITARPNVAVYWSVVQRRPTYKRVIGKYFRSWRKHVT  183

Query  993   LLKTWCFVQARSMLRRY  1043
             LLKTW FVQ RS+L++Y
Sbjct  184   LLKTWFFVQLRSLLKQY  200



>gb|ADE77247.1| unknown [Picea sitchensis]
Length=266

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 105/270 (39%), Positives = 161/270 (60%), Gaps = 5/270 (2%)
 Frame = +3

Query  237   IMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS  416
             +M+ ++HP SLD  KV L +EEK   Y  H VNP   +NLD  FFR +P+ ++PV     
Sbjct  1     MMEFHYHPLSLDCQKVCLVMEEKNTKYIPHLVNPFKARNLDAEFFRQSPNGRIPVLVTAD  60

Query  417   HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRL  596
              +  D++ +I+++++I + +     D  V   +V EW+ KI  WD K FTL H P  + L
Sbjct  61    QVFCDSLTMIRHLDKIGKPLG----DKRVDQSKVQEWLEKIDSWDSKLFTLNHCPSGHAL  116

Query  597   -YVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVE  773
              + SKF R+V+I R+ E PDLA  YH KL+  +  EE L + + +  +   L+ LL++ E
Sbjct  117   HFYSKFKRQVVITRLVENPDLAEKYHNKLQTMHAMEEMLKDQEALASNTNELISLLNDAE  176

Query  774   GKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKV  953
              +L++  +L G +FS+AD   IP+LAR++VL L+ E+   RP L  Y+  +K+RPSYK V
Sbjct  177   KQLTDTEFLAGAQFSVADCAFIPVLARIEVLKLDKEYFRKRPRLIYYFEQMKERPSYKTV  236

Query  954   IGRYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             IG Y   +   K LL + C +  R +L +Y
Sbjct  237   IGPYSTIFGNMKILLPSICNMSIRRLLHKY  266



>gb|KCW51825.1| hypothetical protein EUGRSUZ_J01273 [Eucalyptus grandis]
Length=244

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 94/108 (87%), Gaps = 1/108 (1%)
 Frame = +3

Query  504  SNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARMAECPDLASSYHRKLR  683
            S+ +V++WMHKIQEW+PK+FTL HVP KYR  VSKF RRV+IARMAE PDLASSYHRKL+
Sbjct  118  SSDEVIQWMHKIQEWNPKFFTLSHVPEKYRQAVSKFFRRVLIARMAESPDLASSYHRKLK  177

Query  684  EAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFSLAD  827
            EAY TEEKL + +VVR+S+EHL++LLDE+E  LS+ +Y+ GEEFS+AD
Sbjct  178  EAYHTEEKLRDPEVVRRSKEHLIRLLDEIEDSLSK-TYIAGEEFSMAD  224



>gb|KCW51824.1| hypothetical protein EUGRSUZ_J01273 [Eucalyptus grandis]
Length=282

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 94/108 (87%), Gaps = 1/108 (1%)
 Frame = +3

Query  504  SNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARMAECPDLASSYHRKLR  683
            S+ +V++WMHKIQEW+PK+FTL HVP KYR  VSKF RRV+IARMAE PDLASSYHRKL+
Sbjct  118  SSDEVIQWMHKIQEWNPKFFTLSHVPEKYRQAVSKFFRRVLIARMAESPDLASSYHRKLK  177

Query  684  EAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFSLAD  827
            EAY TEEKL + +VVR+S+EHL++LLDE+E  LS+ +Y+ GEEFS+AD
Sbjct  178  EAYHTEEKLRDPEVVRRSKEHLIRLLDEIEDSLSK-TYIAGEEFSMAD  224



>gb|ACU19273.1| unknown [Glycine max]
Length=112

 Score =   147 bits (370),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +3

Query  708   LGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFI  887
             +  A V+R+S++HLV+LLDEVE +LSE  +L G+EF++ADVML+P+LARL++L+LE E+I
Sbjct  1     MKEADVLRRSKDHLVRLLDEVERQLSETPHLAGQEFTMADVMLVPVLARLELLDLENEYI  60

Query  888   NTRPNLFDYWALVKQRPSYKKVIGRYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
               RPN+ +YW LV+QR SYKKVIG+YF+GW++ +TLLK W  V+ RS+L+RY
Sbjct  61    IGRPNIAEYWILVQQRLSYKKVIGKYFNGWRKHRTLLKAWFLVRIRSLLKRY  112



>ref|XP_001758858.1| predicted protein [Physcomitrella patens]
 gb|EDQ76364.1| predicted protein [Physcomitrella patens]
Length=281

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 82/273 (30%), Positives = 140/273 (51%), Gaps = 5/273 (2%)
 Frame = +3

Query  228   ADDIMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQ  407
             A D +  Y++P + +  K +LALEEKGI YT   ++   G++L+ ++ ++NP+A  P   
Sbjct  13    ARDSIIFYNYPLAFNPAKAKLALEEKGIKYTEKKIDLFNGQSLEPWYLKLNPAASSPTLV  72

Query  408   NGSHiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVK  587
              G   I ++ +II    R A+   +     +V    V EW+ K+  WD   F   +    
Sbjct  73    VGDEKIVESADII----RWADSQGAPLGGDSVDRAFVKEWLEKVDAWDGNLFAAANSSSS  128

Query  588   YRL-YVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLD  764
               + + +K   +V  A M   PD+A  Y +K+        +  N + V Q+   L  LLD
Sbjct  129   GAIKFGTKHKIKVAEANMKRNPDMAELYKKKIATMEAQLAEPDNREAVEQNLRQLAGLLD  188

Query  765   EVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSY  944
             E E +LS   +L G+ +S AD +  P++ RL ++  + EF+  RPN+  Y+  +K+RPSY
Sbjct  189   EAEARLSTNKFLAGDSYSAADCIFTPVIYRLFMVKKDKEFLEPRPNIQRYYDELKKRPSY  248

Query  945   KKVIGRYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
             KKV G    G+   +T+L  +  +  + +  +Y
Sbjct  249   KKVFGVADSGFCTAQTILPAFGKILLQKVTGKY  281



>gb|AFZ39139.1| TCHQD class glutathione S-transferase [Physcomitrella patens]
Length=317

 Score =   131 bits (329),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 86/291 (30%), Positives = 148/291 (51%), Gaps = 6/291 (2%)
 Frame = +3

Query  177   CSVVL*ISRK*QALVVH-ADDIMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKN  353
             C+ V+  + +  A  V  A D +  Y++P + +  K +LALEEKGI YT   ++   G++
Sbjct  31    CTTVMAETAQPSATGVGLARDSIIFYNYPLAFNPAKAKLALEEKGIKYTEKKIDLFNGQS  90

Query  354   LDTFFFRINPSAKLPVFQNGSHiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMH  533
             L+ ++ ++NP+A  P    G   I ++ +II    R A+   +     +V    V EW+ 
Sbjct  91    LEPWYLKLNPAASSPTLVVGDEKIVESADII----RWADSQGAPLGGDSVDRAFVKEWLE  146

Query  534   KIQEWDPKYFTLYHVPVKYRL-YVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKL  710
             K+  WD   F   +      + + +K   +V  A M   PD+A  Y +K+        + 
Sbjct  147   KVDAWDGNLFAAANSSSSGAIKFGTKHKIKVAEANMKRNPDMAELYKKKIATMEAQLAEP  206

Query  711   GNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFIN  890
              N + V Q+   L  LLDE E +LS   +L G+ +S AD +  P++ RL ++  + EF+ 
Sbjct  207   DNREAVEQNLRQLAGLLDEAEARLSTNKFLAGDSYSAADCIFTPVIYRLFMVKKDKEFLE  266

Query  891   TRPNLFDYWALVKQRPSYKKVIGRYFDGWKRQKTLLKTWCFVQARSMLRRY  1043
              RPN+  Y+  +K+RPSYKKV G    G+   +T+L  +  +  + +  +Y
Sbjct  267   PRPNIQRYYDELKKRPSYKKVFGVADSGFCTAQTILPAFGKILLQKVTGKY  317



>ref|XP_001776499.1| predicted protein [Physcomitrella patens]
 gb|EDQ58632.1| predicted protein [Physcomitrella patens]
Length=272

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 131/243 (54%), Gaps = 5/243 (2%)
 Frame = +3

Query  234  DIMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNG  413
            +I + Y++P + +  KV+LALEEK + YT  H++   G++L   + R+NP    P     
Sbjct  6    EIPEFYNYPLAFNPAKVKLALEEKSLTYTEKHIDIFNGQSLTPGYMRLNPHGWSPTLVTK  65

Query  414  SHiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYR  593
              I+ ++++I+++ +R    +     D       V EW+ K+  WD   F +++ P +  
Sbjct  66   EEILTESLDIVKWADRQGSSLGGDAVDRTF----VSEWLTKVNAWDGNLFAMFNSPARGM  121

Query  594  L-YVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEV  770
              YV+KF  +   +     PDLA  Y +K+    +   ++ +A+ V  +   LV LLDE 
Sbjct  122  FRYVTKFKIKTAESYAQRFPDLADVYRKKVVSMKQVLREVDDAETVNANMAQLVALLDEA  181

Query  771  EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKK  950
            E +L    +L G ++S+ADV+  P++ RL     + E++N+RP++  Y+  +K R SYKK
Sbjct  182  EMRLRNFKFLAGNQYSVADVIFTPVVYRLFSTKKDQEYLNSRPHIRTYYQDLKTRSSYKK  241

Query  951  VIG  959
            V G
Sbjct  242  VFG  244



>gb|AFZ39140.1| TCHQD class glutathione S-transferase [Physcomitrella patens]
Length=300

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 135/243 (56%), Gaps = 5/243 (2%)
 Frame = +3

Query  234  DIMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNG  413
            +I + Y++P + +  KV+LALEEK + YT  H++   G++L   + R+NP    P     
Sbjct  34   EIPEFYNYPLAFNPAKVKLALEEKSLTYTEKHIDIFNGQSLTPGYMRLNPHGWSPTLVTK  93

Query  414  SHiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYR  593
              I+ ++++I+++ +R   + SS G D  V    V EW+ K+  WD   F +++ P +  
Sbjct  94   EEILTESLDIVKWADR---QGSSLGGDA-VDRTFVSEWLTKVNAWDGNLFAMFNSPARGM  149

Query  594  L-YVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEV  770
              YV+KF  +   +     PDLA  Y +K+    +   ++ +A+ V  +   LV LLDE 
Sbjct  150  FRYVTKFKIKTAESYAQRFPDLADVYRKKVVSMKQVLREVDDAETVNANMAQLVALLDEA  209

Query  771  EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKK  950
            E +L    +L G ++S+ADV+  P++ RL     + E++N+RP++  Y+  +K R SYKK
Sbjct  210  EMRLRNFKFLAGNQYSVADVIFTPVVYRLFSTKKDQEYLNSRPHIRTYYQDLKTRSSYKK  269

Query  951  VIG  959
            V G
Sbjct  270  VFG  272



>gb|AFK37371.1| unknown [Medicago truncatula]
Length=75

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +3

Query  819   LADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRYFDGWKRQKTLL  998
             +ADVMLIPILARL++L+LE E++  RPN+ +YW LV+QRPSY+KVI ++FDGW++ KTL 
Sbjct  1     MADVMLIPILARLKLLDLENEYVTVRPNIAEYWILVQQRPSYRKVIAKHFDGWRKHKTLF  60

Query  999   KTWCFVQARSMLRRY  1043
             KTWCFV  RS+L+RY
Sbjct  61    KTWCFVHIRSLLKRY  75



>ref|XP_009362356.1| PREDICTED: glutathione S-transferase TCHQD-like [Pyrus x bretschneideri]
Length=97

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            MQLYHHPYSLDS +VRLALEEKGIDYTS HVN +TGKN+D  FFR+NPSAKLPVFQNG H
Sbjct  1    MQLYHHPYSLDSQRVRLALEEKGIDYTSFHVNSVTGKNMDASFFRMNPSAKLPVFQNGHH  60



>ref|XP_001766396.1| predicted protein [Physcomitrella patens]
 gb|EDQ68724.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 126/239 (53%), Gaps = 10/239 (4%)
 Frame = +3

Query  249  YHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiy  428
            Y++  + +  K RLALEEK I Y    ++   G++L+ ++ R+NPSA  P    G   I 
Sbjct  1    YNYALAFNPAKSRLALEEKNIKYVETKIDLFNGQSLEPWYLRLNPSASAPTLVVGDEKIT  60

Query  429  dtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRL-YVS  605
            +++EII++ +R    +     D       V EW++K+  WD   F   + P    L Y +
Sbjct  61   ESVEIIRWADRQGAPLGGDSVDRAF----VDEWLNKVDAWDGNLFAAANSPAGAALKYST  116

Query  606  KFLRRVIIARMAECPDLASSYHRK---LREAYETEEKLGNAQVVRQSEEHLVKLLDEVEG  776
            ++  +V  A     PD+A  Y  K   L++ Y  E    +  V   + + L  LLDE E 
Sbjct  117  EYKFKVAEANAKRNPDMAELYKEKISTLKKNYIDEP--NDEAVCDANRQQLRVLLDEAET  174

Query  777  KLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKV  953
            +L+   +L G  +S AD +  P++ R+ +L  + E++++RPN+  Y+  +K+RPSYKKV
Sbjct  175  RLATNKFLAGPAYSAADAIFTPVIYRIYLLKKDGEYLSSRPNIKRYYEEIKKRPSYKKV  233



>gb|EPS63842.1| hypothetical protein M569_10943, partial [Genlisea aurea]
Length=69

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS  416
            MQLYHHPYSLDS KVRLALEEK IDYTS H+NP+TGKNL++ FFR NP+A+LP+FQNGS
Sbjct  1    MQLYHHPYSLDSQKVRLALEEKNIDYTSFHLNPLTGKNLNSAFFRRNPTARLPLFQNGS  59



>gb|AFZ39141.1| TCHQD class glutathione S-transferase [Physcomitrella patens]
Length=387

 Score =   111 bits (278),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 130/239 (54%), Gaps = 9/239 (4%)
 Frame = +3

Query  246  LYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHii  425
            LY++  + +  K +LALEEKGI YT   ++   G++L+ ++ ++NP+   P    GS  I
Sbjct  125  LYNYSLAFNPAKAKLALEEKGIKYTEEKIDLFNGQSLEPWYLKLNPAGSSPTLVVGSEKI  184

Query  426  ydtieiiqyieRIAEK--VSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             ++ +II    R A+K  +  GG   +V    V EW+ K+  WD   F   +      + 
Sbjct  185  VESADII----RWADKQGIPLGGD--SVDRAFVNEWLQKVDAWDGNLFAEGNSSSGAAVK  238

Query  600  VS-KFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEG  776
            +S ++  +V  A     PDLA  Y +KL    ++ E+  N+    ++ + L  LLDE E 
Sbjct  239  LSTEYKIKVAEANATRYPDLAELYKKKLVSLKKSIERPSNSDAREKNLKQLSDLLDEAEA  298

Query  777  KLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKV  953
            +LS   +L G+ +S AD++  P+L R+  +  + E +++RPN+  Y+  +K+RPS+K V
Sbjct  299  RLSSTKFLAGDAYSAADIIFTPVLFRVYQVKKDAELLDSRPNIKLYYEELKKRPSFKPV  357



>ref|XP_001764050.1| predicted protein [Physcomitrella patens]
 gb|EDQ71189.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   112 bits (279),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 76/246 (31%), Positives = 131/246 (53%), Gaps = 9/246 (4%)
 Frame = +3

Query  246  LYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHii  425
            LY++  + +  K +LALEEKGI YT   ++   G++L+ ++ ++NP+   P    GS  I
Sbjct  153  LYNYSLAFNPAKAKLALEEKGIKYTEEKIDLFNGQSLEPWYLKLNPAGSSPTLVVGSEKI  212

Query  426  ydtieiiqyieRIAEK--VSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
             ++ +II    R A+K  +  GG   +V    V EW+ K+  WD   F   +      + 
Sbjct  213  VESADII----RWADKQGIPLGGD--SVDRAFVNEWLQKVDAWDGNLFAEGNSSSGAAVK  266

Query  600  VS-KFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEG  776
            +S ++  +V  A     PDLA  Y +KL    ++ E+  N+    ++ + L  LLDE E 
Sbjct  267  LSTEYKIKVAEANATRYPDLAELYKKKLVSLKKSIERPSNSDAREKNLKQLSDLLDEAEA  326

Query  777  KLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
            +LS   +L G+ +S AD++  P+L R+  +  + E +++RPN+  Y+  +K+RPS+K V 
Sbjct  327  RLSSTKFLAGDAYSAADIIFTPVLFRVYQVKKDAELLDSRPNIKLYYEELKKRPSFKPVF  386

Query  957  GRYFDG  974
                 G
Sbjct  387  AAAESG  392



>gb|AFZ39138.1| TCHQD class glutathione S-transferase [Physcomitrella patens]
Length=358

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 129/240 (54%), Gaps = 10/240 (4%)
 Frame = +3

Query  246  LYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHii  425
             Y++  + +  K RLALEEK I Y    ++   G++L+ ++ R+NPSA  P    G   I
Sbjct  95   FYNYALAFNPAKSRLALEEKNIKYVETKIDLFNGQSLEPWYLRLNPSASAPTLVVGDEKI  154

Query  426  ydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRL-YV  602
             +++EII++ +R    +   G D +V    V EW++K+  WD   F   + P    L Y 
Sbjct  155  TESVEIIRWADRQGAPL---GGD-SVDRAFVDEWLNKVDAWDGNLFAAANSPAGAALKYS  210

Query  603  SKFLRRVIIARMAECPDLASSYHRK---LREAYETEEKLGNAQVVRQSEEHLVKLLDEVE  773
            +++  +V  A     PD+A  Y  K   L++ Y  E    +  V   + + L  LLDE E
Sbjct  211  TEYKFKVAEANAKRNPDMAELYKEKISTLKKNYIDEPN--DEAVCDANRQQLRVLLDEAE  268

Query  774  GKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKV  953
             +L+   +L G  +S AD +  P++ R+ +L  + E++++RPN+  Y+  +K+RPSYKKV
Sbjct  269  TRLATNKFLAGPAYSAADAIFTPVIYRIYLLKKDGEYLSSRPNIKRYYEEIKKRPSYKKV  328



>ref|WP_037457245.1| hypothetical protein [Sphingobium chlorophenolicum]
Length=250

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 72/251 (29%), Positives = 125/251 (50%), Gaps = 13/251 (5%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVN-PITGKNLDTFFFRINPSAKLPVFQNGS  416
            + LY++  S+ S+K RLA+EE G+DY    V+     +N +  + R+N  A +P    G 
Sbjct  6    VSLYNYTMSICSMKTRLAMEEFGVDYDDKQVDIGFALENFEPDYVRLNEKAVVPTLVVGD  65

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLN-VSNQQVVEWMHKIQEWDPKYFTLYH--VPVK  587
             ++ ++  I+      A K+   G   + V N+  ++W  K  + + +  T  H  VP  
Sbjct  66   RVVTNSYNIVLE----AAKLGKVGIPADPVENKAALDWFQKGDQVNFQVITYGHKGVPRG  121

Query  588  YRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDE  767
              L +++  R    A   + P+L S Y        E      +A  V Q+E  L K LDE
Sbjct  122  DELLIARRERAKEYAE--KYPELRSIYQAAHDRIVEHGNCAYDADTVAQAEVDLQKRLDE  179

Query  768  VEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYK  947
            ++  L++  ++ G  +S+AD+M   +LAR+++LN+   +I+ RPNL  Y+  +K R S++
Sbjct  180  LDAHLADKPFIAGSNYSIADIMWTVLLARIEMLNM-TAWISERPNLLAYYQRMKARRSFE  238

Query  948  KVIGRYFDGWK  980
                R    WK
Sbjct  239  --TARVMPNWK  247



>ref|WP_013849830.1| tetrachloro-P-hydroquinone reductive dehalogenase [Sphingobium 
chlorophenolicum]
 ref|YP_004556113.1| glutathione S-transferase domain-containing protein [Sphingobium 
chlorophenolicum L-1]
 sp|Q03520.3|PCPC_SPHCR RecName: Full=Tetrachloro-P-hydroquinone reductive dehalogenase 
[Sphingobium chlorophenolicum]
 gb|AAM96673.1| tetrachloro-p-hydroquinone reductive dehalogenase [Sphingobium 
chlorophenolicum L-1]
 gb|AEG51607.1| Glutathione S-transferase domain protein [Sphingobium chlorophenolicum 
L-1]
 gb|KEQ51350.1| Tetrachloro-P-hydroquinone reductive dehalogenase [Sphingobium 
chlorophenolicum]
Length=248

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 72/251 (29%), Positives = 125/251 (50%), Gaps = 13/251 (5%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVN-PITGKNLDTFFFRINPSAKLPVFQNGS  416
            + LY++  S+ S+K RLA+EE G+DY    V+     +N +  + R+N  A +P    G 
Sbjct  4    VSLYNYTMSICSMKTRLAMEEFGVDYDDKQVDIGFALENFEPDYVRLNEKAVVPTLVVGD  63

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLN-VSNQQVVEWMHKIQEWDPKYFTLYH--VPVK  587
             ++ ++  I+      A K+   G   + V N+  ++W  K  + + +  T  H  VP  
Sbjct  64   RVVTNSYNIVLE----AAKLGKVGIPADPVENKAALDWFQKGDQVNFQVITYGHKGVPRG  119

Query  588  YRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDE  767
              L +++  R    A   + P+L S Y        E      +A  V Q+E  L K LDE
Sbjct  120  DELLIARRERAKEYAE--KYPELRSIYQAAHDRIVEHGNCAYDADTVAQAEVDLQKRLDE  177

Query  768  VEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYK  947
            ++  L++  ++ G  +S+AD+M   +LAR+++LN+   +I+ RPNL  Y+  +K R S++
Sbjct  178  LDAHLADKPFIAGSNYSIADIMWTVLLARIEMLNM-TAWISERPNLLAYYQRMKARRSFE  236

Query  948  KVIGRYFDGWK  980
                R    WK
Sbjct  237  --TARVMPNWK  245



>gb|AAL24440.1| tetrachlorohydroquinone reductive dehalogenase [Sphingomonas 
sp. UG30]
Length=248

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 72/251 (29%), Positives = 126/251 (50%), Gaps = 13/251 (5%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVN-PITGKNLDTFFFRINPSAKLPVFQNGS  416
            + LY++  S+ S+K RLA+EE G+DY    V+     +N +  + R+N  A +P    G 
Sbjct  4    VSLYNYTMSICSMKTRLAMEEFGVDYNDKQVDIGFALENFEPDYVRLNERAVVPTLVVGD  63

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLN-VSNQQVVEWMHKIQEWDPKYFTLYH--VPVK  587
             ++ ++  I+      A K+ + G   + V N+  ++W  K  + + +  T  H  VP  
Sbjct  64   RVVTNSYNIVLE----AAKLGNVGIPADPVENKAALDWFEKGDQVNFQVITYGHKGVPRG  119

Query  588  YRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDE  767
              L +++  R    A   + P+L S Y        E      +A VV Q+E  L   LDE
Sbjct  120  DELLIARRERAREYAE--KYPELRSIYQAAHDRIVEHGNCAYDADVVAQAEIDLQARLDE  177

Query  768  VEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYK  947
            ++  L++  ++ G  +S+AD+M   +LAR+++LN+   +I+ RPNL  Y+  +K R S++
Sbjct  178  LDAHLADKPFIAGNTYSIADIMWTVLLARIEMLNM-TAWISERPNLLAYYQRMKARRSFE  236

Query  948  KVIGRYFDGWK  980
                R    WK
Sbjct  237  T--ARVMPNWK  245



>pir||A40625 tetrachloro-p-hydroquinone reductive dehalogenase (EC 1.-.-.-) 
- Flavobacterium sp
Length=248

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 72/251 (29%), Positives = 124/251 (49%), Gaps = 13/251 (5%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVN-PITGKNLDTFFFRINPSAKLPVFQNGS  416
            + LY++  S+ S+K RLA+EE G+DY    V+     +N +  + R+N  A +P    G 
Sbjct  4    VSLYNYTMSICSMKTRLAMEEFGVDYDDKQVDIGFALENFEPDYVRLNEKAVVPTLVVGD  63

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLN-VSNQQVVEWMHKIQEWDPKYFTLYH--VPVK  587
             ++ ++  I+      A  V   G   + V N+  ++W  K  + + +  T  H  VP  
Sbjct  64   RVVTNSYNIVLE----AANVGKVGIPADPVENKAALDWFQKGDQVNFQVITYGHKGVPRG  119

Query  588  YRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDE  767
              L +++  R    A   + P+L S Y        E      +A  V Q+E  L K LDE
Sbjct  120  DELLIARRERAKEYAE--KYPELRSIYQAAHDRIVEHGNCAYDADTVAQAEVDLQKRLDE  177

Query  768  VEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYK  947
            ++  L++  ++ G  +S+AD+M   +LAR+++LN+   +I+ RPNL  Y+  +K R S++
Sbjct  178  LDVHLADKPFIAGSNYSIADIMWTVLLARIEMLNM-TAWISERPNLLAYYQRMKARRSFE  236

Query  948  KVIGRYFDGWK  980
                R    WK
Sbjct  237  --TARVMPNWK  245



>ref|WP_036523909.1| hypothetical protein [Novosphingobium resinovorum]
 gb|EZP83943.1| Tetrachloro-P-hydroquinone reductive dehalogenase [Novosphingobium 
resinovorum]
Length=248

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 72/258 (28%), Positives = 132/258 (51%), Gaps = 27/258 (10%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVN-PITGKNLDTFFFRINPSAKLPVFQNGS  416
            ++L+++  S+ S+K RLA+EE G+DY  + V+     +N +  + R+N    +P    G 
Sbjct  4    VELFNYTMSICSMKTRLAMEEFGVDYNDNQVDIGFALENFEPDYVRLNNKCVVPTLVVGD  63

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYH--VPVKY  590
             ++ ++  I+      AE  S+G      +    + W  K  E + +  T  H  VP   
Sbjct  64   KVVTNSYNIVL---EAAELASTGLPADPAARDTALVWFKKGDEVNFQVITYGHKGVPRGD  120

Query  591  RLYVSKFLRRVIIARMAECPDLASSYHRKLREAY-ETEEKL---GN----AQVVRQSEEH  746
             L         +IAR A   + A  Y  +LR+ Y    +++   GN    AQ V  +E  
Sbjct  121  DL---------LIARRARAKEYADKYP-ELRDIYLAAHDRIVEHGNCAYDAQTVADAEAG  170

Query  747  LVKLLDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALV  926
            L   LDE++  +++ +++ G+E+S+AD+M   +LAR+++LN+  + I+ RP++  Y+  +
Sbjct  171  LAARLDELDVHMTDRTFIAGDEYSVADIMWTVLLARVEMLNMGAQ-ISDRPSVLAYYQRM  229

Query  927  KQRPSYKKVIGRYFDGWK  980
            K RPS+++   R    WK
Sbjct  230  KARPSFEQ--ARVMPNWK  245



>ref|WP_023403009.1| hypothetical protein [Vibrio halioticoli]
 dbj|GAD88626.1| hypothetical protein VHA01S_008_00220 [Vibrio halioticoli NBRC 
102217]
Length=259

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 120/250 (48%), Gaps = 22/250 (9%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            + LYH  +S  +++VR+ALEEKG+++ SH ++   G+NL   +F INP+  +P   +   
Sbjct  17   LHLYHTGFSNCAMRVRIALEEKGLEWESHALDLQKGENLTAEYFGINPNGVVPTLVDDG-  75

Query  420  iiydtieiiqyieRIAEKVSSGGFDLNVSN----QQVVEWMHKIQEWDPKYFTLYHVPVK  587
                 I+    I+ I +K +     L  SN    QQ+ EWM+  ++      T  +  VK
Sbjct  76   --VVIIDSADIIDYIDQKFTPNS--LRPSNECDLQQMYEWMYLARDNHLSIKTYMYSNVK  131

Query  588  YRLYVSKFLRRVIIARMAECPDLA-SSYHRKLR--EAYETEEKLGNAQVVRQSEEHLVKL  758
                + +  + +   R  +  D A  ++H +      +  EEK     ++ Q        
Sbjct  132  NPQGMKRNEQEMADYREKQTFDSALLAFHERFNSHNGFSAEEKAQATAIIDQ-------C  184

Query  759  LDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRP  938
              +++ +LS+  +L GE FSLAD+  IP L  L+  N   E     PNL  +   + QRP
Sbjct  185  FSKMDKRLSDHQWLVGENFSLADITWIPQLVVLKAANYPFE---NYPNLEQWKNAIIQRP  241

Query  939  SYKKVIGRYF  968
            S+++ + ++ 
Sbjct  242  SFERAVKQWL  251



>ref|WP_028601129.1| hypothetical protein [Ottowia thiooxydans]
Length=246

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/247 (24%), Positives = 113/247 (46%), Gaps = 21/247 (9%)
 Frame = +3

Query  237  IMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS  416
            ++ LYH  +S  S KVR+ L EKG+ +T HH+N      L   F  +N +  +PV  +G 
Sbjct  1    MITLYHSTHSTCSQKVRICLAEKGLTWTGHHLNLRAFDQLKPEFLALNSAGLVPVLVDGG  60

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRL  596
             ++ ++        RI  +     +     + +      +++ W      +    VK   
Sbjct  61   QVLTES--------RIINEYLEDAYAQPRLSPESAHARARMRLWTKYADDVASEAVKLPS  112

Query  597  YV-------SKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVK  755
            +V        +  R   +A +A  P+     H + R      E + +A  ++ S   L +
Sbjct  113  FVKNIQPGLQRMPREEALATIARIPN----EHIRARWRKAATEGI-SADDLKPSIGRLTE  167

Query  756  LLDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQR  935
            +++ ++  L +A +L GEE+SLAD+ + P + RL  ++L    +  RP + D++A +  R
Sbjct  168  MVERMDDALQDAPWLAGEEYSLADIDIAPFVQRLVRIDL-FGLVAARPRVNDWYARITSR  226

Query  936  PSYKKVI  956
            P+Y   +
Sbjct  227  PTYASAM  233



>ref|XP_011082484.1| PREDICTED: glutathione S-transferase-like [Sesamum indicum]
Length=265

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/243 (27%), Positives = 117/243 (48%), Gaps = 39/243 (16%)
 Frame = +3

Query  237  IMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS  416
            +M+L+ HP+S  + +V   LEEKG++Y   H++  TG++    F  +NP  ++P  ++G 
Sbjct  54   VMKLHGHPFSPATHRVMACLEEKGLEYEFVHIDLSTGQHKKEPFLSLNPFGQVPALEDGD  113

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRL  596
                          ++ E  +   +  N+   +    + +    DPK   + +V ++   
Sbjct  114  -------------LKLFESRAITQYLANIYADKGTPLVPQ----DPKEKAIVYVWMEVES  156

Query  597  YVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLG---NAQVVRQSEEHLVKLLDE  767
            +  KF             D A++   KL     T+  LG   +  VV + +E L K+LD 
Sbjct  157  H--KF-------------DAAAA---KLSYELVTKPMLGMTTDDAVVEEHQEKLGKVLDV  198

Query  768  VEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYK  947
             E +L+ + YL GE FSLAD   +PI++ L     +  F + RPN+  + A +  RP+++
Sbjct  199  YESRLTGSKYLGGEAFSLADFHHLPIVSSLFGTKTKALF-DARPNVSGWCAGILARPAWQ  257

Query  948  KVI  956
            KV+
Sbjct  258  KVV  260



>ref|XP_002283209.1| PREDICTED: glutathione S-transferase F9 [Vitis vinifera]
 emb|CBI22080.3| unnamed protein product [Vitis vinifera]
Length=216

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/229 (29%), Positives = 114/229 (50%), Gaps = 33/229 (14%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK I++ +  V+ I G++ D  + ++ P   +PV Q+G + +Y++  II+Y  
Sbjct  15   RVLICLVEKEIEFETVPVDIIKGEHKDPEYLKLQPFGVVPVIQDGDYTLYESRAIIRYY-  73

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK  S G DL     + +E    +++W       YH P+ Y L +      V+ +  
Sbjct  74   --AEKYKSQGTDL---LGKTIEERGTVEQWLEVEAQNYHPPI-YNLVL-----HVLFSDK  122

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               P                     +A+V+ +SE++L K+LD  E +LS++ YL G+ FS
Sbjct  123  MGFP--------------------ADAKVIEESEKNLGKVLDIYEERLSKSKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
            LAD+  IP    L  +  ++  I  R ++  +W  +  RPS+KKV+  Y
Sbjct  163  LADLSHIPFTNYLGAMG-KMYLIKEREHVSAWWDDISSRPSWKKVLELY  210



>ref|WP_027858192.1| glutathione S-transferase [Marinobacterium jannaschii]
Length=255

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 123/252 (49%), Gaps = 23/252 (9%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGK-NLDTFFFRINPSAKLPV--FQN  410
            ++L+HHP S+ S+KVRLALEEKG+ +    ++ I  +  LD ++ ++NP+  +P   F N
Sbjct  4    IKLHHHPLSVCSMKVRLALEEKGLVWAGREIDIIRAQEQLDPWYLKLNPNGVVPTLEFDN  63

Query  411  GSHiiydtieiiqyieRIAEKVSSGGFDL------NVSNQQVVEWMHKIQEWDPKYFTLY  572
            G+    + I     I R    +  G   L       +  +Q+V+    I   D +  +  
Sbjct  64   GNE---EVITDSARIIRFIATLPDGNPLLPQDAQDQIQMEQLVDLADTI---DLQILSYA  117

Query  573  HVPVKYRLYVSKFLRRVIIARM---AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEE  743
              P   +    + L R I   +    E P+L  +Y      + ++++   +A  V + E 
Sbjct  118  RHPSMEK--SGRILDRRIQKSLRLSEEHPELKDNYLTCAERSEKSKQFRVDAFHVARMER  175

Query  744  HLVKLLDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTR--PNLFDYW  917
               + LD  E +L +  YL GE +SLADV+   +L+RL +L    ++I+    P + DY+
Sbjct  176  EAQEALDIAEERLHQGEYLLGECYSLADVIWTVVLSRLDLLGY-TDWIDGSEYPAIGDYY  234

Query  918  ALVKQRPSYKKV  953
              +++R SY + 
Sbjct  235  QRMQKRRSYTQA  246



>ref|WP_039474341.1| hypothetical protein [Vibrio sinaloensis]
 gb|KHT51881.1| hypothetical protein RJ46_03955 [Vibrio sinaloensis]
Length=256

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 115/249 (46%), Gaps = 28/249 (11%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            + LYH  +S  +++VR+ALEEKG+ + SH V+ + G+NL T +  INP+A +P   +   
Sbjct  17   LHLYHTGFSNCAMRVRIALEEKGLTWESHLVDILKGENLTTEYMGINPNAVVPTLVDDG-  75

Query  420  iiydtieiiqyieRIAEKVSSGGFD--LNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYR  593
                 I+    I+ + +K S G          +Q+  WM+  ++         H+ +K  
Sbjct  76   --VVIIDSADIIDYLDKKYSPGTLRPVSEADEKQMYYWMYLARD--------NHLSIKTY  125

Query  594  LYVSKFLRRVIIARMAECPDLASSYHRKL---REAYETEEKLGNAQVVRQSE-EHLVKLL  761
            +Y +       I  M + P+    Y  K        E  E+  +     + E +   K++
Sbjct  126  MYANVGF----IKSMKKTPEEMEEYREKQTFDSALLEFHERFSSLDGFSKEELDKATKVV  181

Query  762  DE----VEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVK  929
            D+    ++ +L    +L G+ FSLAD+  IP L  L+  N   E     P+L  +   + 
Sbjct  182  DDCFYQIDERLKNHDWLVGDSFSLADIAWIPQLVILKAANYPFE---NYPHLVKWKNAIM  238

Query  930  QRPSYKKVI  956
             RPS+K+ +
Sbjct  239  ARPSFKQGV  247



>ref|WP_035898147.1| hypothetical protein, partial [Labrenzia sp. DG1229]
Length=244

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 116/248 (47%), Gaps = 37/248 (15%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            M L+H P S  S +VR+ L E G DYTSH ++    ++    +  I+P   +P F +   
Sbjct  17   MHLWHAPMSSCSQRVRIVLAETGKDYTSHLIDLAGDEHASPEYQAIHPKGLVPAFVDDGR  76

Query  420  iiydtieiiqyieRIAEKVSSGGFDL-NVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRL  596
            +  ++++       I ++++  G DL N ++Q +++   K Q             V  +L
Sbjct  77   LFIESVD-------IIQRIAQPGSDLANSTSQDLLQLADKAQ-------------VDLKL  116

Query  597  YVSKFLRRVIIARMAECPDLASSYH-----RKLREAYET--EEKLGNAQVVRQSEEHLVK  755
               +FL + +     E  D     H     ++ R  Y+   E    +A V R  E    +
Sbjct  117  LTFEFLFKGVERSSKESFDAFQENHQNEWLKQFRRDYKAGFETSRIDAAVTRTDE--AFR  174

Query  756  LLDEVEGKLSEA-SYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQ  932
            +LD+   +LS+   +L G+ FSLADV  +P + R  +++   E +   PNL  ++  V  
Sbjct  175  ILDD---RLSDGRPFLAGDTFSLADVAWMPNVHRFSLMDWPFEQV---PNLQSWFRRVAG  228

Query  933  RPSYKKVI  956
            RPSYKK +
Sbjct  229  RPSYKKAL  236



>ref|XP_007215956.1| hypothetical protein PRUPE_ppa011337mg [Prunus persica]
 gb|EMJ17155.1| hypothetical protein PRUPE_ppa011337mg [Prunus persica]
Length=215

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 120/239 (50%), Gaps = 34/239 (14%)
 Frame = +3

Query  252  HHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiyd  431
            + P+     +V + L EK I++ +  ++   G++ D  F ++ P  ++PV Q+G + +Y+
Sbjct  6    YGPFYASPKRVLVCLVEKEIEFETSPIDLFKGEHKDPEFLKLQPFGQVPVIQDGDYTLYE  65

Query  432  tieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKF  611
            +  II+Y    AEK  S G DL     + +E    +++W     + YH P+         
Sbjct  66   SRAIIRYY---AEKYKSQGTDL---LGKTIEERGLVEQWLEVEASNYHPPLDN-------  112

Query  612  LRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEA  791
                ++ ++   P+L                   + +++++SEE L K+LD  E +LS++
Sbjct  113  ----LVIQILFAPELGLP---------------SDPKIIQESEEKLGKVLDVYEERLSKS  153

Query  792  SYLTGEEFSLADVMLIPILARLQVLNLELEF-INTRPNLFDYWALVKQRPSYKKVIGRY  965
             YL G+ FSLAD+  +P    L   ++E E+ I  R ++  +W  +  RPS+KKV+ ++
Sbjct  154  KYLAGDFFSLADLSHLPFTYYL-ANSMEKEYMIKDRKHVSAWWDDISNRPSWKKVLQQF  211



>ref|XP_008229579.1| PREDICTED: glutathione S-transferase F9-like isoform X2 [Prunus 
mume]
Length=215

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 117/238 (49%), Gaps = 32/238 (13%)
 Frame = +3

Query  252  HHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiyd  431
            + P+     +V + L EK I++ +  ++   G++ D  F ++ P  ++PV Q+G + +Y+
Sbjct  6    YGPFYASPKRVLVCLVEKEIEFETSPIDLFKGEHKDPEFLKLQPFGQVPVIQDGDYTLYE  65

Query  432  tieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKF  611
            +  II+Y    AEK  S G DL     + +E    +++W     + YH P+ Y L +   
Sbjct  66   SRAIIRYY---AEKYKSQGTDLL---GKTIEERGLVEQWLEVEASNYHPPL-YNLVI---  115

Query  612  LRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEA  791
              +++ A     P                     + +++++SEE L K+LD  E +LS++
Sbjct  116  --QILFAPELGLP--------------------SDPKIIQESEEKLGKVLDVYEERLSKS  153

Query  792  SYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
             YL G+ FSLAD+  +P    L     +   I  R ++  +W  +  RPS+KKV+ ++
Sbjct  154  KYLAGDFFSLADLSHLPFTYYLANSMGKEYMIKDRKHVAAWWDDISNRPSWKKVLQQF  211



>ref|XP_005096784.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1-like [Aplysia californica]
Length=317

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 76/285 (27%), Positives = 127/285 (45%), Gaps = 54/285 (19%)
 Frame = +3

Query  228  ADDIMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQ  407
             D+ + LY  P S  S K+R+ALEEK + Y    ++    +  + +F RINP  ++PV +
Sbjct  2    TDETLHLYLFPASFFSQKIRIALEEKQLKYKETFISLFAKEQNEVWFLRINPQGQVPVLK  61

Query  408  NGSHiiydtieiiqyieRIAEKV----SSGGFDL--NVSNQQ---VVEWMHKIQEWDPKY  560
             G         I+   ERI E V    S  G  L  +VS ++   V EW  +    D + 
Sbjct  62   IGD-------AIVTDSERILEAVDKLESGKGKRLVPDVSTEEGKLVSEWRKRFNSVDVEN  114

Query  561  FTLYHVPVKYRLYVSKFLRRVIIARMA--------------------ECPDLASSYHRKL  680
             + Y V +   L   K   + + + M                     + PDL  +   K+
Sbjct  115  LS-YGVMLNTELVPDKAKVKALTSGMTLKGYHEGMQKAIADLEAKKEKNPDLIDALDAKI  173

Query  681  REAYETEEKLGNAQVVRQSEEHLV----KLLDEVEGKLSEAS-------YLTGEEFSLAD  827
                 ++ +L N Q +++  E ++    K+LD+VE +L ++        +L G  ++ AD
Sbjct  174  ---ATSQGRLQN-QFLKEDIEKVLNDVEKVLDDVEIQLRKSRTENILEHWLCGPNYTAAD  229

Query  828  VMLIPILARLQVLNLELEFIN--TRPNLFDYWALVKQRPSYKKVI  956
            + L  +L RL  + L   + +   RP L +YW   +QRPS KK +
Sbjct  230  IFLCVLLGRLDWIGLLDRYADPEKRPALVEYWMQAQQRPSVKKCV  274



>ref|XP_006437116.1| hypothetical protein CICLE_v10032743mg [Citrus clementina]
 gb|ESR50356.1| hypothetical protein CICLE_v10032743mg [Citrus clementina]
Length=211

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 71/230 (31%), Positives = 112/230 (49%), Gaps = 34/230 (15%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK I++ +  V+ I G+N +  + ++ P   LPV Q+G   +Y++  II+Y  
Sbjct  15   RVIVCLIEKQIEFETAPVDLIKGENRNPEYLKLQPFGALPVIQDGDFTLYESRAIIRYY-  73

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK  S G +L     + +E    +++W       YH P+ Y + V            
Sbjct  74   --AEKYRSQGTEL---LGKTIEERGLVEQWLEVEAHNYHPPI-YEMTVQLLF--------  119

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
                 L  S   KL               V++SEE L K+LD  EG+LS++ YL G+ FS
Sbjct  120  --ASKLGLSVDEKL---------------VKKSEEKLGKVLDVYEGRLSKSKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELEF-INTRPNLFDYWALVKQRPSYKKVIGRY  965
            LAD+  +P    L V  +E E+ I  R ++  +W  +  RPS+KKV+  Y
Sbjct  163  LADLSHLPFTQYL-VGPMEKEYMIRDRKHVSAWWDDISNRPSWKKVLELY  211



>ref|NP_001106075.1| glutathione S-transferase 3 [Zea mays]
 sp|P04907.4|GSTF3_MAIZE RecName: Full=Glutathione S-transferase 3; AltName: Full=GST 
class-phi member 3; AltName: Full=GST-III [Zea mays]
 emb|CAA29929.1| unnamed protein product [Zea mays]
Length=222

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 108/245 (44%), Gaps = 43/245 (18%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            ++LY  P S + ++V   L EKG+D+    V+  TG +    F  +NP  ++P   +G  
Sbjct  4    LKLYGMPLSPNVVRVATVLNEKGLDFEIVPVDLTTGAHKQPDFLALNPFGQIPALVDGDE  63

Query  420  iiydtieiiqyieRIAEKVSSGGFDL---NVSNQQVVEWMHKIQEWDPKYFTLYHVPVKY  590
            +++++  I +Y   IA K +S G DL     S  ++  W+    E +  +F     P+ +
Sbjct  64   VLFESRAINRY---IASKYASEGTDLLPATASAAKLEVWL----EVESHHFHPNASPLVF  116

Query  591  RLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEV  770
            +L V   L           PD                     A VV +  E L K+LD  
Sbjct  117  QLLVRPLL--------GGAPD---------------------AAVVEKHAEQLAKVLDVY  147

Query  771  EGKLSEASYLTGEEFSLADV--MLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSY  944
            E  L+   YL G+EF+LAD    L+P L   +        +  RP++  +W  +  RP++
Sbjct  148  EAHLARNKYLAGDEFTLADANHALLPALTSAR--PPRPGCVAARPHVKAWWEAIAARPAF  205

Query  945  KKVIG  959
            +K + 
Sbjct  206  QKTVA  210



>ref|NP_001267983.1| glutathione S-transferase 3 [Vitis vinifera]
 gb|ABO64930.1| glutathione S-transferase [Vitis vinifera]
 gb|ABW34389.1| glutathione S-transferase 3 [Vitis vinifera]
 emb|CBI22081.3| unnamed protein product [Vitis vinifera]
Length=215

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 108/225 (48%), Gaps = 33/225 (15%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK +++ +  ++ I G+N D  F ++ P   +PV Q+G + ++++  I++Y  
Sbjct  15   RVLVCLIEKEVEFETLPIDIIKGQNKDPEFLKLQPFGVVPVIQDGDYTLFESRAIMRYY-  73

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK  S G DL     + +E    +++W       YH        +   +  ++  R 
Sbjct  74   --AEKYKSQGTDL---LGKTIEERGVVEQWLEVEAQSYHPA------IDNLVIEILFGRK  122

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               P                     +A+V+ +SE+ L K+LD  E +LS++ YL G+ FS
Sbjct  123  RGIPP--------------------DAKVIEESEKKLAKVLDIYEERLSKSKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKV  953
            LAD+  +P    L  +  ++  I  R ++  +W  +  RPS+KKV
Sbjct  163  LADLSHLPFTKYLADMG-KMYLIEERKHVKAWWDDISNRPSWKKV  206



>ref|WP_017030963.1| hypothetical protein, partial [Vibrio breoganii]
Length=252

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 114/249 (46%), Gaps = 28/249 (11%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            + LYH  +S  +++VRLALEEKG+ + SH +N   G+ L   +  INP+A +P   +   
Sbjct  17   LHLYHTGFSNCAMRVRLALEEKGLTWESHPINLQKGEQLTKEYIGINPNAVVPTLVDEG-  75

Query  420  iiydtieiiqyieRIAEKVSSGGF--DLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYR  593
                 I+    I+ I +  +SG           Q+ EWM+  ++         H+ +K  
Sbjct  76   --VVIIDSADIIDYIDQHYASGSLRPQSKQDESQMYEWMYLARD--------NHLSIKTY  125

Query  594  LYVSKFLRRVIIARMAECPD---LASSYHRKLREAYE---TEEKLGNAQVVRQSE--EHL  749
            +Y S F     + R  E  D      ++ + L E +E   + E      VV  ++  +  
Sbjct  126  MY-SNFGSGDKMKRSQEVMDDYRKNQTFDKALLEFHERFNSNEGFSEQDVVNATQVIDDC  184

Query  750  VKLLDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVK  929
             K +DE   +L +  +L GEE+SLAD+  +P L  L+      E      +L  +   + 
Sbjct  185  FKKMDE---RLKDHKWLAGEEYSLADIAWVPQLIILKAAKFPFE---NYQHLEQWKEAIM  238

Query  930  QRPSYKKVI  956
             RPS+K+ I
Sbjct  239  DRPSFKRAI  247



>ref|WP_028865904.1| hypothetical protein [Psychromonas aquimarina]
Length=256

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 120/250 (48%), Gaps = 30/250 (12%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVF-QNGS  416
            + LYH  +S  +++VR+ALEEKG+++ SH V+ + G+ L   +  INP+A +P    NG 
Sbjct  17   LHLYHFGFSNCAMRVRIALEEKGLEWQSHLVDIMKGEQLTKEYIGINPNAVVPTLVDNG-  75

Query  417  HiiydtieiiqyieRIAEKVSSGGF--DLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKY  590
                  I+    I+ + ++ S+G        + QQ+ +W++  ++         H+ +K 
Sbjct  76   ---VVIIDSADIIDYLDKEYSAGSLRPGSQENEQQMYDWVYLARD--------NHLSIKT  124

Query  591  RLYVSKFLRRVIIARMAECPDLASSYHRKL---REAYETEEKLGNAQVVRQSEEH-LVKL  758
             +Y +  L    + +M   P+    Y +         E  E+  + +   + + H    +
Sbjct  125  YMYANVGL----LEKMKRTPEAMEEYRKNQTFDSALLEFHERFNSNEGFSKEDLHKATTV  180

Query  759  LDEVEGKLSEA----SYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALV  926
            +D+   +++E      +L G+ FSLAD+  IP L  L+V     E     P+L  +   V
Sbjct  181  IDDCFAQMNERLKDHDWLAGDNFSLADIAWIPQLVILKVAKYPFE---NYPHLVKWKNAV  237

Query  927  KQRPSYKKVI  956
             +RPS+K+ +
Sbjct  238  IERPSFKQGV  247



>gb|AIO36271.1| tetrachloro-P-hydroquinone reductive dehalogenase [Burkholderia 
cenocepacia]
Length=248

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 65/244 (27%), Positives = 113/244 (46%), Gaps = 19/244 (8%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVN-PITGKNLDTFFFRINPSAKLPVFQNGS  416
            ++LYH P S+ S+KVRL L E  + Y    V+  +  +NL+ ++ R+NP   +P   +G 
Sbjct  4    IKLYHFPMSICSMKVRLCLSELAVPYEERIVDIGLALENLEPWYVRLNPRGVVPTLCDGD  63

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYH---VPVK  587
                   +  + +  +A++  +G         +V  W+ K+ +  P +   Y    +P  
Sbjct  64   ---LVVTDSAKIMHYLADRFETGLPQDPQQRAEVERWV-KVADTFPLHAISYSRGGIPRG  119

Query  588  YRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDE  767
              L  S+  R  I+   A  PDLA +Y       Y+    L +A V  +     +  L+ 
Sbjct  120  DELLASRLAR--IVENKARHPDLADTYS----ALYDRVSALRDASVDGEGTNAALAELNT  173

Query  768  VEGKLSEA----SYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQR  935
            V  KL+       ++  E +S+ADV+    LARL +L L   F++  P L  Y+  +  R
Sbjct  174  VFSKLNAVLALKPFIGSETYSIADVIWTVTLARLDMLKLSDLFLSF-PLLSTYYTRMIAR  232

Query  936  PSYK  947
            PS++
Sbjct  233  PSFE  236



>gb|ABW34390.1| glutathione S-transferase 5 [Vitis vinifera]
Length=216

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 113/229 (49%), Gaps = 33/229 (14%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK I++ +  V+ I G++ D  + ++ P   +PV Q+G + +Y++  II+Y  
Sbjct  15   RVLICLVEKEIEFETVPVDIIKGEHKDPEYLKLQPFGVVPVIQDGDYTLYESRAIIRYY-  73

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK  + G DL     + +E    +++W       YH P  Y L +      V+ +  
Sbjct  74   --AEKYKAQGTDL---LGKTIEERGTVEQWLEVEAQNYH-PSIYNLVL-----HVLFSDK  122

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               P                     +A+V+ +SE++L K+LD  E +LS++ YL G+ FS
Sbjct  123  MGFP--------------------ADAKVIEESEKNLGKVLDIYEERLSKSKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
            LAD+  IP    L  +  ++  I  R ++  +W  +  RPS+KKV+  Y
Sbjct  163  LADLSHIPFTNYLGAMG-KMYLIKEREHVSAWWDDISSRPSWKKVLELY  210



>gb|KDP20539.1| hypothetical protein JCGZ_04912 [Jatropha curcas]
Length=210

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 67/241 (28%), Positives = 121/241 (50%), Gaps = 35/241 (15%)
 Frame = +3

Query  237  IMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS  416
            ++++Y   Y+    +V + L EKGI++ +  ++ I G++    + ++ P   +PV Q+G 
Sbjct  2    VVKVYGTAYA-SPKRVLVCLIEKGIEFETVPIDLIKGEHKSPEYLQLQPFGAVPVIQDGD  60

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRL  596
            + +Y++  II+Y    AEK  S G +L     + +E    +++W       YH P+ Y L
Sbjct  61   YALYESRAIIRYY---AEKYKSQGTEL---LGKTIEERGLVEQWLEVEAQNYHPPI-YNL  113

Query  597  YVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEG  776
                 L  +  + +   PD                      +++++SEE L K+LD  E 
Sbjct  114  ----TLHILFASALGFPPD---------------------EKIIKESEEKLAKVLDIYED  148

Query  777  KLSEASYLTGEEFSLADVMLIPILARLQVLNLELEF-INTRPNLFDYWALVKQRPSYKKV  953
            +LS++ YL GE FSLAD+  +P    L V  +  E+ I +R ++  +W  +  RPS+KKV
Sbjct  149  RLSKSKYLAGEFFSLADLSHLPFTQYL-VGPMNKEYMIKSRKHVSAWWDNISNRPSWKKV  207

Query  954  I  956
            +
Sbjct  208  L  208



>ref|WP_017243900.1| hypothetical protein [Vibrio breoganii]
Length=256

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 114/249 (46%), Gaps = 28/249 (11%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            + LYH  +S  +++VRLALEEKG+ + SH +N   G+ L   +  INP+A +P   +   
Sbjct  17   LHLYHTGFSNCAMRVRLALEEKGLTWESHPINLQKGEQLTKEYIGINPNAVVPTLVDEG-  75

Query  420  iiydtieiiqyieRIAEKVSSGGF--DLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYR  593
                 I+    I+ I +  +SG           Q+ EWM+  ++         H+ +K  
Sbjct  76   --VVIIDSADIIDYIDQHYASGSLRPQSKQDESQMYEWMYLARD--------NHLSIKTY  125

Query  594  LYVSKFLRRVIIARMAECPD---LASSYHRKLREAYE---TEEKLGNAQVVRQSE--EHL  749
            +Y S F     + R  E  D      ++ + L E +E   + E      VV  ++  +  
Sbjct  126  MY-SNFGSGDKMKRSQEVMDDYRKNQTFDKALLEFHERFNSNEGFSEQDVVNATQVIDDC  184

Query  750  VKLLDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVK  929
             K +DE   +L +  +L GEE+SLAD+  +P L  L+      E      +L  +   + 
Sbjct  185  FKKMDE---RLKDHKWLAGEEYSLADIAWVPQLIILKAAKFPFE---NYQHLEQWKEAIM  238

Query  930  QRPSYKKVI  956
             RPS+K+ I
Sbjct  239  DRPSFKRAI  247



>ref|XP_008305824.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1 [Cynoglossus semilaevis]
Length=361

 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 128/280 (46%), Gaps = 52/280 (19%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            + LYH   S +S KVRLA+ EKG+    + V+    ++ + +F R+NP+ ++PV  +G +
Sbjct  40   LTLYHWTQSFNSQKVRLAIAEKGLPCQEYDVSLPLSEHNEPWFMRLNPAGEVPVLVHGDN  99

Query  420  iiydtieiiqyieRIAEKVSSGGFDLN--VSNQQVVEWMHKIQEW---------------  548
            +I D         +I + + +   D    +   +   + H++Q +               
Sbjct  100  VICDPT-------QIMDYLENNFNDCTPKLVPDEGSTYYHRVQHYRELLDSLQMDAYTHG  152

Query  549  ---DPKYFTLYHVPVKYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEK-LGN  716
                P+     H+P     Y +  +R  I+    E   LA   + +L++AY  +++ L  
Sbjct  153  CILHPEITVDSHIPA----YAATCIRTQIVNTHTELKKLAEQ-NPELKDAYVAKQRRLKT  207

Query  717  AQVVRQSEEHLVKLLDEVEGKLSEA-----------------SYLTGEEFSLADVMLIPI  845
              +   + ++L KLLDE+E  + +                  S+L GE FS+AD+ L   
Sbjct  208  KLLDHDNMKYLKKLLDEMESVMDQVETELQRRVEETPEEGSPSWLCGEFFSMADISLAVT  267

Query  846  LARLQVLNLELEF--INTRPNLFDYWALVKQRPSYKKVIG  959
            L RL+ L L   +     R NL  Y+  V +RP++++V+G
Sbjct  268  LHRLKFLGLSRRYWGNGNRVNLETYYERVVERPAFRRVLG  307



>gb|KFK31251.1| hypothetical protein AALP_AA6G088300 [Arabis alpina]
Length=215

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 110/238 (46%), Gaps = 32/238 (13%)
 Frame = +3

Query  252  HHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiyd  431
            + P    S +  + L EKG+ + + HV+ + G+     +  I P  K+PV  +G + I++
Sbjct  6    YAPLFASSKRGVVTLVEKGVPFETVHVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFE  65

Query  432  tieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKF  611
            +  I++Y   IAEK  S G DL     + +E   ++++W     T YH P      +   
Sbjct  66   SRAIMRY---IAEKYRSQGPDL---LGKTIEERGQVEQWLDVEATSYHPP------LLAL  113

Query  612  LRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEA  791
               V+ A +   P                     + +V+++SEE L ++LD  E +LS+ 
Sbjct  114  TLNVVFAPLMGFP--------------------ADEKVIKESEEKLAEVLDVYEAQLSKN  153

Query  792  SYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
             YL G+  SLAD+  +P    L     +   I  R ++  +W  +  RP++K+V  +Y
Sbjct  154  EYLAGDFVSLADLAHLPFTEYLVGPIGKAHLIKDRKHVSAWWDKISSRPAWKEVSEKY  211



>gb|KDP22743.1| hypothetical protein JCGZ_02402 [Jatropha curcas]
Length=210

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 119/241 (49%), Gaps = 35/241 (15%)
 Frame = +3

Query  237  IMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS  416
            ++++Y   Y+    +V + L EKGI++ +  ++ I G++    + ++ P   +PV Q+G 
Sbjct  2    VVKVYGTAYA-SPKRVLVCLIEKGIEFETVPIDLIKGEHKSPEYLQLQPFGAVPVIQDGD  60

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRL  596
            + +Y++  II+Y    AEK  S G +L     + +E    +++W       YH P+ Y L
Sbjct  61   YTLYESRAIIRYY---AEKYKSQGTEL---LGKTIEERGLVEQWLEVEAQNYHPPI-YNL  113

Query  597  YVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEG  776
                 L  +    +   PD                      +V+++SEE L K+LD  E 
Sbjct  114  ----TLHILFAPALGFPPD---------------------EKVIKESEEKLAKVLDIYED  148

Query  777  KLSEASYLTGEEFSLADVMLIPILARL-QVLNLELEFINTRPNLFDYWALVKQRPSYKKV  953
            +LS++ YL GE FSLAD+  +P    L   +N E   I +R ++  +W  +  RPS+KKV
Sbjct  149  RLSKSKYLAGEFFSLADLSHLPFTQYLVGPMNKEY-LIKSRKHVSAWWDNISNRPSWKKV  207

Query  954  I  956
            +
Sbjct  208  L  208



>ref|WP_017029633.1| hypothetical protein [Vibrio breoganii]
Length=256

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 114/249 (46%), Gaps = 28/249 (11%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            + LYH  +S  +++VRLALEEKG+ + SH +N   G+ L   +  INP+A +P   +   
Sbjct  17   LHLYHTGFSNCAMRVRLALEEKGLAWESHPINLQKGEQLTKEYIGINPNAVVPTLVDEG-  75

Query  420  iiydtieiiqyieRIAEKVSSGGF--DLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYR  593
                 I+    I+ I +  +SG           Q+ EWM+  ++         H+ +K  
Sbjct  76   --VVIIDSADIIDYIDQHYASGSLRPQSKQDESQMYEWMYLARD--------NHLSIKTY  125

Query  594  LYVSKFLRRVIIARMAECPD---LASSYHRKLREAYE---TEEKLGNAQVVRQSE--EHL  749
            +Y S F     + R  E  D      ++ + L E +E   + E      VV  ++  +  
Sbjct  126  MY-SNFGSGDKMKRSQEVMDDYRKNQTFDKALLEFHERFNSNEGFSEQDVVNATQVIDDC  184

Query  750  VKLLDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVK  929
             K +DE   +L +  +L GEE+SLAD+  +P L  L+      E      +L  +   + 
Sbjct  185  FKKMDE---RLKDHKWLAGEEYSLADIAWVPQLIILKAAKFPFE---NYQHLEQWKEAIM  238

Query  930  QRPSYKKVI  956
             RPS+K+ I
Sbjct  239  DRPSFKRAI  247



>ref|XP_010469787.1| PREDICTED: glutathione S-transferase F10 [Camelina sativa]
Length=220

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 111/238 (47%), Gaps = 32/238 (13%)
 Frame = +3

Query  252  HHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiyd  431
            + P    S +  + L EKG+ + + HV+ + G++    +  I P  K+PV  +G + I++
Sbjct  6    YAPLFASSKRAVVTLVEKGVPFETVHVDLMKGEHRKPEYIAIQPFGKIPVLTDGDYKIFE  65

Query  432  tieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKF  611
            +  I++Y   +AEK  S G DL     + +E   ++++W     T YH P      +   
Sbjct  66   SRAIMRY---VAEKYRSQGPDL---LGKTIEERGQVEQWLDVEATSYHPP------LLAL  113

Query  612  LRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEA  791
               ++ A +   P                     + +V+++SEE L ++LD  E +LS+ 
Sbjct  114  TLNIVFAPLMGFP--------------------ADEKVIKESEEKLGEVLDVYEAQLSKN  153

Query  792  SYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
             YL G+  SLAD+  +P    L     +   I  R ++  +W  +  RP++K+V  +Y
Sbjct  154  EYLAGDFVSLADLAHLPFTEYLVNEIGKAHLIKDRKHVSAWWDKISSRPAWKEVCEKY  211



>ref|XP_009377060.1| PREDICTED: glutathione S-transferase F9-like [Pyrus x bretschneideri]
Length=214

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 112/233 (48%), Gaps = 32/233 (14%)
 Frame = +3

Query  258  PYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydti  437
            P+     +V + L EK I++ +  ++   G++    F ++ P  +LPV Q+G + +Y++ 
Sbjct  8    PFYAAPKRVLVCLVEKEIEFETSPIDLFKGEHKSPEFLKLQPFGQLPVIQDGDYTLYESR  67

Query  438  eiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLR  617
             II+Y    AEK  S G DL     + +E    +++W     + YH P+ Y L     + 
Sbjct  68   AIIRYY---AEKYKSQGTDLL---GKTIEERGLVEQWLEVEASNYHPPL-YNL-----VM  115

Query  618  RVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASY  797
             V+ A     P                     + +++++SEE L K+LD  E +LS++ Y
Sbjct  116  HVLFASAMGFP--------------------SDPKIIQESEEKLGKVLDIYEERLSKSKY  155

Query  798  LTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
            L G+ FSLAD+  +P    L     +   I  R ++  +W  +  RPS+KKV+
Sbjct  156  LAGDFFSLADLSHLPFTHYLANSMGKEYMIRDRKHVSAWWDDISSRPSWKKVL  208



>ref|XP_007260150.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1 [Astyanax mexicanus]
Length=359

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 69/272 (25%), Positives = 126/272 (46%), Gaps = 38/272 (14%)
 Frame = +3

Query  246  LYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHii  425
            LYH   S  S KVRLA+ EKG+    + V+    +N + +F R+NP+ ++PV  +   +I
Sbjct  39   LYHWTQSFSSQKVRLAIAEKGLKCEEYDVSLPLSENNEPWFMRLNPTGEVPVLVHDDQVI  98

Query  426  ydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDP----------KYFTLYH  575
             D  +I+ Y+E+  +   +      V +     + H++Q +             +  + H
Sbjct  99   SDPTQILDYLEQTFQDEKTPRLIPEVGSM----YYHRVQHYRELLDSLPMDAYTHGCILH  154

Query  576  VPVKYRLYVSKFLRRVIIARMA-----------ECPDLASSYHRKLREAYETEEKLGNAQ  722
              +    ++  +    I A++            + P+L  +Y  K R          N +
Sbjct  155  PEITVDSHIPAYATNRICAQIGSMESELKKLAEDNPELKDAYIAKQRRLKTKLFDHDNVK  214

Query  723  VVRQSEEHLVKLLDEVEGKL-----------SEASYLTGEEFSLADVMLIPILARLQVLN  869
             +++  + L K++D+VE +L           S+ ++L GE FS+ADV L   L RL+ L 
Sbjct  215  YLKKILDELEKVMDQVETELQRRAEETPEEGSQQAWLCGEFFSMADVSLAVTLHRLKFLG  274

Query  870  LELEF--INTRPNLFDYWALVKQRPSYKKVIG  959
            L   +    TR NL  Y+  V +RP++++V+G
Sbjct  275  LSRRYWGSGTRVNLETYYERVLERPTFRRVLG  306



>emb|CAN75964.1| hypothetical protein VITISV_036241 [Vitis vinifera]
Length=216

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 112/229 (49%), Gaps = 33/229 (14%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK I++ +  V+ I G++ D  + ++ P   +PV Q+G + +Y++  II+Y  
Sbjct  15   RVLICLVEKEIEFETVPVDIIKGEHKDPEYLKLQPFGVVPVIQDGDYTLYESRAIIRYY-  73

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK    G DL     + +E    +++W       YH P  Y L     +  V+ +  
Sbjct  74   --AEKYKXQGTDL---LGKTIEERGTVEQWLEVEAQNYH-PXIYNL-----VLHVLFSDK  122

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               P                     +A+V+ +SE++L K+LD  E +LS++ YL G+ FS
Sbjct  123  MGFP--------------------ADAKVIEESEKNLGKVLDIYEERLSKSKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
            LAD+  IP    L  +  ++  I  R ++  +W  +  RPS+KKV+  Y
Sbjct  163  LADLSHIPFTNYLGAMG-KMYLIKEREHVSAWWDDISSRPSWKKVLELY  210



>ref|WP_011042729.1| glutathione S-transferase [Colwellia psychrerythraea]
 ref|YP_268635.1| glutathione S-transferase [Colwellia psychrerythraea 34H]
 gb|AAZ25344.1| glutathione S-transferase family protein [Colwellia psychrerythraea 
34H]
Length=255

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 123/243 (51%), Gaps = 15/243 (6%)
 Frame = +3

Query  246  LYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKN-LDTFFFRINPSAKLPV--FQNGS  416
            LYHHP S+ S+KVRL LEEKG+ ++   ++ +  ++ LD ++ ++NP   +P   F+NG+
Sbjct  6    LYHHPLSVCSMKVRLVLEEKGLAWSGRVIDIVQKQDQLDPWYLKLNPKGVIPTLEFRNGT  65

Query  417  HiiydtieiiqyieRIAEKVSSGGFDL--NVSNQQVVEWMHKI-QEWDPKYFTLYHVPV-  584
                  +    +I R    VS G   L  + ++ Q++E +  +  + D +  +    P  
Sbjct  66   ---TKVLTDSAHIIRFVASVSEGNVLLPQDENDLQLMERLIDLADDIDLQILSYARHPSM  122

Query  585  --KYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKL  758
                ++  ++  + +++++  + P+L+ +Y      + +++    +   +   E+  ++ 
Sbjct  123  EKSEKILNARVTKSLLMSK--QLPELSDNYLVCAERSQKSKTFRVDNTHIENIEQSALEA  180

Query  759  LDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTR-PNLFDYWALVKQR  935
            +  VE  L +  +L G  ++LADV+   IL+RL +L       N   P +  Y+  ++QR
Sbjct  181  ITFVEKLLQDNEFLIGNTYTLADVIWTVILSRLDLLGYSKWLNNNSFPQIASYYLRMQQR  240

Query  936  PSY  944
             SY
Sbjct  241  KSY  243



>ref|XP_002530205.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
 gb|EEF32179.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
Length=214

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 67/234 (29%), Positives = 111/234 (47%), Gaps = 42/234 (18%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EKGI++ +  V+ I G++ +  F ++ P   LPV Q+G + +Y++  II+Y  
Sbjct  15   RVLVCLIEKGIEFETVPVDLIKGEHRNPDFLKLQPFGALPVIQDGDYTLYESRAIIRYY-  73

Query  459  RIAEKVSSGGFDL---NVSNQQVVE-WMH-KIQEWDPKYFTLYHVPVKYRLYVSKFLRRV  623
              AEK  S G DL    +  + +VE W+  + Q + P  + +              L  +
Sbjct  74   --AEKYKSQGTDLLGKTIEERGLVEQWLEVEAQNYHPHVYNMT-------------LHVL  118

Query  624  IIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLT  803
              + +   PD                EKL     +++SEE + K+LD  E +LS++ YL 
Sbjct  119  FASALGFTPD----------------EKL-----IKESEEKIAKVLDIYEERLSKSKYLA  157

Query  804  GEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
            G+ FSLAD+  +P    L         I  R  +  +W  +  RPS+KKV+  Y
Sbjct  158  GDFFSLADLSHLPFTQYLVGPMKRECMIKDRKYVSAWWDDISSRPSWKKVLELY  211



>ref|XP_004081067.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1-like [Oryzias latipes]
Length=361

 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 69/277 (25%), Positives = 125/277 (45%), Gaps = 46/277 (17%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            + LYH   S +S KVRLA+ EKG+    + V+    ++ + +F R+NP+ ++PVF    H
Sbjct  40   LTLYHWTQSFNSQKVRLAIAEKGLRCEEYDVSLPLSEHNEPWFMRLNPAGEVPVF---VH  96

Query  420  iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEW-----------------  548
                  +  Q ++ + +  +  G  L +  ++   +  ++Q +                 
Sbjct  97   NDNIICDPTQIMDYLEQNFTDEGV-LKLVPEEDSRYYLRVQHYRELLDSLQMDAYTHGCI  155

Query  549  -DPKYFTLYHVPVKYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQV  725
              P+     H+P     Y +  +R  I     E   LA   + +L++AY  +++   +++
Sbjct  156  LHPEITVDSHIPT----YAATSIRTQIGNTQTELKKLAEQ-NPELKDAYIAKQRRLKSKL  210

Query  726  VRQSEEHLVKLLDEVEGKLSE-----------------ASYLTGEEFSLADVMLIPILAR  854
                  +L KLL E+E  + +                 AS+L G+ FSLADV L   L R
Sbjct  211  FDHDNMNLKKLLGELESVMDQVETELQRRAEETPEEGSASWLCGDFFSLADVSLAVTLHR  270

Query  855  LQVLNLELEF--INTRPNLFDYWALVKQRPSYKKVIG  959
            L+ L L   +     R N+  Y+  V +RP+++KV+G
Sbjct  271  LKFLGLSRRYWGNGNRTNVETYYERVVERPAFRKVLG  307



>ref|WP_007105984.1| glutathione S-transferase 2 [Glaciecola polaris]
 dbj|GAC34218.1| glutathione S-transferase 2 [Glaciecola polaris LMG 21857]
Length=270

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 66/248 (27%), Positives = 121/248 (49%), Gaps = 22/248 (9%)
 Frame = +3

Query  237  IMQLYHHPYSLDSLKVRLALEEKGIDY-TSHHVNPITGKNLDTFFFRINPSAKLPVFQNG  413
            ++ LYHH  S+ + KVR AL EK +    +H+++ + G+     + +INP A +P   + 
Sbjct  1    MLDLYHHGSSVCAAKVRFALAEKQVQVDNAHYIDILKGEQFTEDYRKINPKAVVPSLVHD  60

Query  414  SHiiydtieiiqyieRIAEKVS---SGGFD---LNVSNQQVVEWMHKIQEWDPKYFTLYH  575
              II ++  I +Y++ +    S    G ++   + +  + V E +H      P    L  
Sbjct  61   GLIINESTVICEYLDEVFPGPSLKPEGAYEKTLMRIWTKAVDEQLH------PACGELTF  114

Query  576  VPVKYRLYVSKFLRRVIIARMAECPDLASSY---HRKLREAYETEEKLGNAQVVRQSEEH  746
            V   +R  V +  +  +   ++  PD + +     RK +      +  G    +R  + +
Sbjct  115  V-CCHRFIVQRLGKEKMQEFLSSTPDQSVTSKWKERKKQIVLMGFDAPGIEDTIRLYDGY  173

Query  747  LVKLLDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTR-PNLFDYWAL  923
            L K+    E  L   ++L GE FSLAD+ L P + RL +LN+   + N R P++ D+++ 
Sbjct  174  LSKM----EETLKNHTWLAGETFSLADIGLTPYVNRLDMLNMSGMWENGRLPHVADWFSR  229

Query  924  VKQRPSYK  947
            +KQRP +K
Sbjct  230  IKQRPDFK  237



>ref|XP_008805761.1| PREDICTED: probable glutathione S-transferase GSTF1 [Phoenix 
dactylifera]
Length=216

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 66/240 (28%), Positives = 109/240 (45%), Gaps = 32/240 (13%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            +++Y    S  + +V L LEE G +Y    ++  TG++        NP  ++P F++G+ 
Sbjct  3    VKVYGATMSTCTARVLLCLEEMGAEYELVPIDFSTGEHKQPAHLARNPFGQVPAFEDGAL  62

Query  420  iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
            I+Y++  I +YI R  +  SSGG  L   + Q    +    E + + F     P+ Y+++
Sbjct  63   ILYESRAIARYILR--KYKSSGGDLLKEGSLQESAMVDLWLEVESQQFNPAIGPIFYQIF  120

Query  600  VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
                    I  R    PD A                     V+  + E L K+LD  E +
Sbjct  121  --------IFPRFGNVPDQA---------------------VIDTNLEKLCKVLDVYEAR  151

Query  780  LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
            LS+  YL G+ FSLAD+  +P+L            +N+RP++  +W  V  RP+ KKV  
Sbjct  152  LSKTKYLAGDFFSLADLSHVPLLHYFMA-TPHASVVNSRPHVKAWWEGVSSRPACKKVTA  210



>ref|XP_009336611.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103929182 
[Pyrus x bretschneideri]
Length=430

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 62/243 (26%), Positives = 114/243 (47%), Gaps = 36/243 (15%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            +++Y  P S    +V   L EKG+DY    VN   G++    + +I P  ++P F++  H
Sbjct  5    VKVYGPPLSTAVSRVLACLLEKGVDYQLISVNMAKGEHKKPDYLKIQPFGQVPAFED-EH  63

Query  420  ii--ydtieiiqyieRIAEKVSSGGFDLN-VSNQQVVEWMH-KIQEWDPKYFTLYHVPVK  587
            I             ++ A++ + G + +N ++   + +W+  + Q + P   TL      
Sbjct  64   ISLFESRAICRYICDKYADQGNKGLYGMNPLAKASIDQWLEAEGQSFSPPSSTL------  117

Query  588  YRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDE  767
                         + ++A  P + ++   KL+          +  V+RQ+EE L K+LD 
Sbjct  118  -------------VFQLAFAPRMKAN---KLKH---------DEGVIRQNEEKLAKVLDV  152

Query  768  VEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYK  947
             E +L E+  L G+EFSLAD+  +P    L       E I +R N+  +W+ + +R S++
Sbjct  153  YEKRLGESRLLAGDEFSLADLSHLPNTQYLINATDRGELITSRENVGRWWSEISRRESWQ  212

Query  948  KVI  956
            KV+
Sbjct  213  KVV  215



>gb|ACF85374.1| unknown [Zea mays]
 gb|ACG32991.1| glutathione S-transferase III [Zea mays]
Length=221

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 63/243 (26%), Positives = 106/243 (44%), Gaps = 40/243 (16%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            ++LY  P S + ++V   L EKG+D+    V+  TG +    F  +NP  ++P   +G  
Sbjct  4    LKLYGMPLSPNVVRVATVLNEKGLDFEIVPVDLTTGAHKQPDFLTLNPFGQIPALVDGDE  63

Query  420  iiydtieiiqyieRIAEKVSSGGFDL---NVSNQQVVEWMHKIQEWDPKYFTLYHVPVKY  590
            +++++  I +Y   IA K +S G DL     S  ++  W+    E +  +F     P+ +
Sbjct  64   VLFESRAINRY---IASKYASEGTDLLPATASAAKLEVWL----EVESHHFHPNASPLVF  116

Query  591  RLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEV  770
            +L V   L           PD                     A VV +  E L K+LD  
Sbjct  117  QLLVRPLL--------GGAPD---------------------AAVVEKHAEQLAKVLDVY  147

Query  771  EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKK  950
            E  L+   YL G+EF+LAD      L  L     +   +  RP++  +W  +  RP+++K
Sbjct  148  EAHLARNKYLAGDEFTLADANHASYLLYLSK-TPKAGLVAARPHVKAWWEAIAARPAFQK  206

Query  951  VIG  959
             + 
Sbjct  207  TVA  209



>ref|XP_006001128.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1 isoform X2 [Latimeria chalumnae]
Length=362

 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 77/289 (27%), Positives = 127/289 (44%), Gaps = 53/289 (18%)
 Frame = +3

Query  216  LVVHADDIMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKL  395
            L+    D + LYH   S  S KVRL + EKG+    ++VN    ++ + +F R+NPS ++
Sbjct  32   LIERKPDKLILYHWTQSFSSQKVRLVITEKGLKCEEYNVNLPLSEHNEPWFMRLNPSGEV  91

Query  396  PVFQNGSHiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVE---WMHKIQEW------  548
            PV  +   II +         RI + +     D N+    V E   +  ++Q +      
Sbjct  92   PVLVHEDKIICEAT-------RIIDYLEQTFVDENIPKLMVEEGSMYYPRVQHYRELLDS  144

Query  549  ------------DPKYFTLYHVPVKYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAY  692
                         P+      +P     Y S  +R  I    +E   LA   + +L+EAY
Sbjct  145  LPIDAYTHGCILHPELTVDSMIPA----YASSRIRSQIGNTESELKKLAQE-NPELQEAY  199

Query  693  ETEEKLGNAQVVRQSE-EHLVKLLDEVEGKLSEAS-----------------YLTGEEFS  818
              ++K   ++++     ++L K+LDE+E  L +                   +L G+ FS
Sbjct  200  LAKQKRLKSKLLDHDNIKYLKKILDEMEKVLDQVETELQRRIEETPGKRNDPWLCGQFFS  259

Query  819  LADVMLIPILARLQVLNLELEF--INTRPNLFDYWALVKQRPSYKKVIG  959
            LADV L   L RL+ L L   +     RPNL  Y+  V +R +++KV+G
Sbjct  260  LADVTLAITLHRLKFLGLSRRYWGAGRRPNLETYYERVLKRKAFRKVLG  308



>ref|NP_001105111.1| Glutathione transferase III(b) [Zea mays]
 emb|CAB38119.1| Glutathione transferase III(b) [Zea mays]
Length=221

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 63/243 (26%), Positives = 106/243 (44%), Gaps = 40/243 (16%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            ++LY  P S + ++V   L EKG+D+    V+  TG +    F  +NP  ++P   +G  
Sbjct  4    LKLYGMPLSPNVVRVATVLNEKGLDFEIVPVDLTTGAHKQPDFLALNPFGQIPALVDGDE  63

Query  420  iiydtieiiqyieRIAEKVSSGGFDL---NVSNQQVVEWMHKIQEWDPKYFTLYHVPVKY  590
            +++++  I +Y   IA K +S G DL     S  ++  W+    E +  +F     P+ +
Sbjct  64   VLFESRAINRY---IASKYASEGTDLLPATASAAKLEVWL----EVESHHFYPNASPLVF  116

Query  591  RLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEV  770
            +L V   L           PD                     A VV +  E L K+LD  
Sbjct  117  QLLVRPLL--------GGAPD---------------------AAVVEKHAEQLAKVLDVY  147

Query  771  EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKK  950
            E  L+   YL G+EF+LAD      L  L     +   +  RP++  +W  +  RP+++K
Sbjct  148  EAHLARNKYLAGDEFTLADANHASYLLYLSK-TPKAGLVAARPHVKAWWEAIAARPAFQK  206

Query  951  VIG  959
             + 
Sbjct  207  TVA  209



>ref|XP_006001127.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1 isoform X1 [Latimeria chalumnae]
Length=362

 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 77/289 (27%), Positives = 127/289 (44%), Gaps = 53/289 (18%)
 Frame = +3

Query  216  LVVHADDIMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKL  395
            L+    D + LYH   S  S KVRL + EKG+    ++VN    ++ + +F R+NPS ++
Sbjct  32   LIERKPDKLILYHWTQSFSSQKVRLVITEKGLKCEEYNVNLPLSEHNEPWFMRLNPSGEV  91

Query  396  PVFQNGSHiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVE---WMHKIQEW------  548
            PV  +   II +         RI + +     D N+    V E   +  ++Q +      
Sbjct  92   PVLVHEDKIICEAT-------RIIDYLEQTFVDENIPKLMVEEGSMYYPRVQHYRELLDS  144

Query  549  ------------DPKYFTLYHVPVKYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAY  692
                         P+      +P     Y S  +R  I    +E   LA   + +L+EAY
Sbjct  145  LPIDAYTHGCILHPELTVDSMIPA----YASSRIRSQIGNTESELKKLAQE-NPELQEAY  199

Query  693  ETEEKLGNAQVVRQSE-EHLVKLLDEVEGKLSEAS-----------------YLTGEEFS  818
              ++K   ++++     ++L K+LDE+E  L +                   +L G+ FS
Sbjct  200  LAKQKRLKSKLLDHDNIKYLKKILDEMEKVLDQVETELQRRIEETPEEGNDPWLCGQFFS  259

Query  819  LADVMLIPILARLQVLNLELEF--INTRPNLFDYWALVKQRPSYKKVIG  959
            LADV L   L RL+ L L   +     RPNL  Y+  V +R +++KV+G
Sbjct  260  LADVTLAITLHRLKFLGLSRRYWGAGRRPNLETYYERVLKRKAFRKVLG  308



>ref|XP_007223949.1| hypothetical protein PRUPE_ppa011153mg [Prunus persica]
 gb|EMJ25148.1| hypothetical protein PRUPE_ppa011153mg [Prunus persica]
Length=221

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/242 (25%), Positives = 109/242 (45%), Gaps = 37/242 (15%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS-  416
            +++Y  P S    +V   L EKG+DY    VN   G++    + +I P  ++P FQ+   
Sbjct  6    VKVYGPPISTAVSRVLACLLEKGVDYQLISVNMSKGEHKKPDYLKIQPFGQVPAFQDEDI  65

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLN-VSNQQVVEWMH-KIQEWDPKYFTLYHVPVKY  590
             +           ++ A++ + G +  N ++   + +W+  + Q + P   TL       
Sbjct  66   SLFESRAICRYICDKYADRGNKGLYGTNPLAKASIDQWLEAEGQSFSPPSSTL-------  118

Query  591  RLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEV  770
                        + ++A  P +      KL++         +  V+RQ+EE L K+LD  
Sbjct  119  ------------VFQLAFAPRM------KLKQ---------DQGVIRQNEEKLKKVLDVY  151

Query  771  EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKK  950
            E +L E+ +L G+EFSLAD+  +P    L       E   +R N+  +W  +  R S++K
Sbjct  152  EKRLGESRFLAGDEFSLADLSHLPNGHYLVNATDRGELFTSRNNVGRWWTEISTRDSWEK  211

Query  951  VI  956
            V+
Sbjct  212  VV  213



>ref|XP_009377051.1| PREDICTED: glutathione S-transferase F9-like [Pyrus x bretschneideri]
Length=214

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/233 (26%), Positives = 110/233 (47%), Gaps = 32/233 (14%)
 Frame = +3

Query  258  PYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydti  437
            P+     +V + L EK I++ +  ++   G++    F ++ P  ++PV Q+G + +Y++ 
Sbjct  8    PFYASPKRVLVCLVEKEIEFETSPIDLFKGEHKSPEFLKLQPFGQVPVIQDGDYTLYESR  67

Query  438  eiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLR  617
             II+Y    AEK  S G DL     + +E    +++W     + YH P+         + 
Sbjct  68   AIIRYY---AEKYKSQGTDLL---GKTIEERGLVEQWLEVEASNYHPPL------DNLVM  115

Query  618  RVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASY  797
             ++ A     P                     + +++++SEE L K+LD  E +LS++ Y
Sbjct  116  HILFASALGFP--------------------SDPKIIQESEEKLGKVLDIYEERLSKSKY  155

Query  798  LTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
            L G+ FSLAD+  +P    L     +   I  R ++  +W  +  RPS+KKV+
Sbjct  156  LAGDFFSLADLSHLPFTHYLANSMGKEYMIRDRKHVSAWWDDISSRPSWKKVL  208



>ref|NP_001018511.1| ganglioside-induced differentiation-associated protein 1 [Danio 
rerio]
 gb|AAH95731.1| Ganglioside-induced differentiation-associated protein 1 [Danio 
rerio]
Length=362

 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 124/279 (44%), Gaps = 52/279 (19%)
 Frame = +3

Query  246  LYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHii  425
            LYH   S  S KVRLA+ EKG+    + V+    ++ + +F R+NP+ ++PV  + +H+I
Sbjct  42   LYHWTQSFSSQKVRLAIAEKGLQCEDYDVSLPLSEHNEPWFMRLNPTGEVPVLVHDNHVI  101

Query  426  ydtieiiqyieRIAEKVSSGGFDLNVSN---QQVVEWMHKIQEW----------------  548
             D         +I + +     D        ++   + H++Q +                
Sbjct  102  CDPT-------QIMDYLEQNFCDEQTPKLIPEEGSTYYHRVQHYRELLDSLQMDAYTHGC  154

Query  549  --DPKYFTLYHVPVKYRLYVSKFLRRVI------IARMA-ECPDLASSYHRKLREAYETE  701
               P+     H+P     Y +  +R  I      + ++A E PDL  +Y  K R      
Sbjct  155  ILHPEITVDSHIPA----YATTHIRTQIGNTESELKKLAVENPDLKDAYIAKQRRLKSKL  210

Query  702  EKLGNAQVVRQSEEHLVKLLDEVEGKL-----------SEASYLTGEEFSLADVMLIPIL  848
                N + +++  + L  +LD+VE +L           S+ ++L G+ FS+ADV L   L
Sbjct  211  FDHDNMKYLKKLLDELENVLDQVETELQRRSEETPEEGSQQAWLCGDFFSIADVSLAVTL  270

Query  849  ARLQVLNLELEFINT--RPNLFDYWALVKQRPSYKKVIG  959
             RL+ L L   +     R NL  Y+  V  RP++++V+G
Sbjct  271  HRLKFLGLSRRYWGNGMRVNLETYYERVLDRPTFRRVLG  309



>ref|XP_010510278.1| PREDICTED: glutathione S-transferase F10-like [Camelina sativa]
Length=220

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 110/238 (46%), Gaps = 32/238 (13%)
 Frame = +3

Query  252  HHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiyd  431
            + P    S +  + L EKG+ + + HV+ + G++    +  I P  K+PV  +G + I++
Sbjct  6    YAPLFASSKRAVVTLVEKGVPFETVHVDLMKGEHRKPEYIAIQPFGKIPVLTDGDYKIFE  65

Query  432  tieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKF  611
            +  I++Y   +AEK  S G DL     + +E   ++++W     T YH P      +   
Sbjct  66   SRAIMRY---VAEKYRSQGPDL---LGKTIEERGQVEQWLDVEATSYHPP------LLAL  113

Query  612  LRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEA  791
               ++ A +   P                     +  V+++SEE L ++LD  E +LS+ 
Sbjct  114  TLNIVFAPLMGFP--------------------ADENVIKESEEKLGEVLDVYEAQLSKN  153

Query  792  SYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
             YL G+  SLAD+  +P    L     +   I  R ++  +W  +  RP++K+V  +Y
Sbjct  154  EYLAGDFVSLADLAHLPFTEYLVNEIGKAYLIKDRKHVSAWWDKISSRPAWKEVCEKY  211



>ref|XP_006410185.1| hypothetical protein EUTSA_v10017227mg [Eutrema salsugineum]
 dbj|BAJ34506.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51638.1| hypothetical protein EUTSA_v10017227mg [Eutrema salsugineum]
Length=215

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 59/238 (25%), Positives = 111/238 (47%), Gaps = 32/238 (13%)
 Frame = +3

Query  252  HHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiyd  431
            + P    + +  + L EKG+D+ + +V+ + G+     +  I P  K+PV  +G + I++
Sbjct  6    YAPLYASTKRALVTLVEKGVDFETVNVDLLKGEQRQPEYVAIQPFGKIPVLVDGDYKIFE  65

Query  432  tieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKF  611
            +  I++Y   +AEK  S G DL     + +E   ++++W     T YH P      +   
Sbjct  66   SRAIMRY---VAEKYRSQGPDL---LGKTIEERGQVEQWLDVEATSYHPP------LLAL  113

Query  612  LRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEA  791
               +I A +   P                     + +V+++SEE L ++ D  E +LS+ 
Sbjct  114  TLNIIFAPLMGFP--------------------ADEKVIKESEEKLGEVFDVYEAQLSKT  153

Query  792  SYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
             YL G+  SLAD+  +P  + L     +   I  R ++  +W  +  RP++K+V  +Y
Sbjct  154  EYLAGDFVSLADLAHLPFTSYLVGPIGKAYMIKDRKHVSAWWDKISSRPAWKEVSEKY  211



>ref|XP_009033291.1| hypothetical protein AURANDRAFT_19775 [Aureococcus anophagefferens]
 gb|EGB12219.1| hypothetical protein AURANDRAFT_19775 [Aureococcus anophagefferens]
Length=221

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 98/231 (42%), Gaps = 40/231 (17%)
 Frame = +3

Query  252  HHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiyd  431
            HH  +  S +V +AL E G D+   HV+   G++    F +I P  K+PV Q+G      
Sbjct  14   HH--TTCSRRVIMALLESGQDFEYVHVDMAKGEHKSPAFLKIQPFGKVPVLQDGDF----  67

Query  432  tieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKF  611
                  +  R   K    G  L   + + +  +      +  YFT   +PV    YV + 
Sbjct  68   ----TLFESRAIMKYVLTGTPLCPGDAKEMAAVESAISVEYSYFTPAFMPV----YVERM  119

Query  612  LRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEA  791
            L++                 +K  EA ET+        V  + E L  +LD VE  L   
Sbjct  120  LKK-----------------KKGLEADETK--------VAAAIEALGPVLDVVEALLEGK  154

Query  792  SYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSY  944
            +Y+ G +F++AD+  +P   +   L +  E  + RPNL  +WA V   P++
Sbjct  155  TYMAGPKFTMADISYMPYFHQFDALGIA-ELRDDRPNLKAWWATVSTMPNW  204



>gb|AAG34812.1|AF243377_1 glutathione S-transferase GST 22, partial [Glycine max]
Length=210

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 111/229 (48%), Gaps = 32/229 (14%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK I++ + HV+   G+N +  F ++ P   LPV Q+G + +Y++  II+Y  
Sbjct  10   RVLVCLIEKEIEFETVHVDLFKGENKEPEFLKLQPFGSLPVIQDGDYTLYESRAIIRY--  67

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
             +AEK    G DL     + +E    +++W       +H P+ Y L ++     V+ A +
Sbjct  68   -LAEKYKDQGTDL---LGKTIEEKGLVEQWLEVEAHNFHPPL-YNLVIN-----VLFAPL  117

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               P                     + +V+ +S++ + K+LD  E +LS++ YL G+ FS
Sbjct  118  TGAP--------------------SDQKVIEESDKKIEKVLDVYEERLSKSKYLAGDFFS  157

Query  819  LADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
            LAD+  +P    L         +  R ++  +W  +  RP+++KV+  Y
Sbjct  158  LADLSHLPFGHYLVNQTGRGNLVRDRKHVSAWWDDISNRPAWQKVLQLY  206



>ref|NP_001239642.1| glutathione S-transferase GST 22 [Glycine max]
 gb|ACU13210.1| unknown [Glycine max]
 gb|KHM99650.1| Glutathione S-transferase F9 [Glycine soja]
Length=215

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 111/229 (48%), Gaps = 32/229 (14%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK I++ + HV+   G+N +  F ++ P   LPV Q+G + +Y++  II+Y  
Sbjct  15   RVLVCLIEKEIEFETVHVDLFKGENKEPEFLKLQPFGSLPVIQDGDYTLYESRAIIRY--  72

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
             +AEK    G DL     + +E    +++W       +H P+ Y L ++     V+ A +
Sbjct  73   -LAEKYKDQGTDL---LGKTIEEKGLVEQWLEVEAHNFHPPL-YNLVIN-----VLFAPL  122

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               P                     + +V+ +S++ + K+LD  E +LS++ YL G+ FS
Sbjct  123  TGAP--------------------SDQKVIEESDKKIEKVLDVYEERLSKSKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
            LAD+  +P    L         +  R ++  +W  +  RP+++KV+  Y
Sbjct  163  LADLSHLPFGHYLVNQTGRGNLVRDRKHVSAWWDDISNRPAWQKVLQLY  211



>ref|XP_007215954.1| hypothetical protein PRUPE_ppa011337mg [Prunus persica]
 gb|EMJ17153.1| hypothetical protein PRUPE_ppa011337mg [Prunus persica]
Length=214

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 60/235 (26%), Positives = 112/235 (48%), Gaps = 32/235 (14%)
 Frame = +3

Query  252  HHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiyd  431
            + P+     +V + L EK I++ +  ++   G++ D  F ++ P  ++PV Q+G + +Y+
Sbjct  6    YGPFYASPKRVLVCLVEKEIEFETSPIDLFKGEHKDPEFLKLQPFGQVPVIQDGDYTLYE  65

Query  432  tieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKF  611
            +  II+Y    AEK  S G  L     + +E    +++W       +H P      ++  
Sbjct  66   SRAIIRYY---AEKYKSQGTAL---LGKTIEERGLVEQWLEVEAHNFHPP------LNNL  113

Query  612  LRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEA  791
            +  ++ A     P                     + +V+++SEE L K+LD  E +LS++
Sbjct  114  VLHILFASALGFP--------------------SDPKVIQESEEKLGKVLDIYEERLSKS  153

Query  792  SYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
             YL G+ FSLAD+  +P    +  L  +   I  R ++  +W  +  RPS+KKV+
Sbjct  154  KYLAGDFFSLADLSHLPFTQYMVTLLGKEYLIKDRKHVSAWWNDISNRPSWKKVL  208



>ref|WP_019620049.1| hypothetical protein [Amphritea japonica]
Length=255

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 125/245 (51%), Gaps = 15/245 (6%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPI-TGKNLDTFFFRINPSAKLPVFQNGS  416
            + L+HHP S+ S+KVRLALEEKG++++S+ ++ +   + L+ ++ ++NP+  +P  +   
Sbjct  4    LTLHHHPLSVCSMKVRLALEEKGLNWSSNVIDIVREQEQLEPWYVKLNPNGVIPTLECHD  63

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKI----QEWDPKYFTLYHVPV  584
                      + I  IA      G  L  +N+  ++ M K+     E D +  +    P 
Sbjct  64   AETKVVTNSARIIRFIA--ALPDGKSLLPTNKNDIQLMDKLIDLADEVDLQILSYARHPS  121

Query  585  ---KYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVK  755
                 ++  ++  + +++A   + P+L S Y      + +++    +A+ ++  E+   +
Sbjct  122  MEKSEKILDARINKSLLLAE--QHPELRSRYLACADRSDKSKTFRVDAKRIKDIEQSAFE  179

Query  756  LLDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTR--PNLFDYWALVK  929
             L   E +++  ++L G+ +SLADV+   +L+RL +L   +++IN    P L  Y+   +
Sbjct  180  SLSFAEKQMNGNTFLLGDIYSLADVIWTVVLSRLDLLGY-IDWINGNDFPLLASYYQRAQ  238

Query  930  QRPSY  944
             R S+
Sbjct  239  DRKSF  243



>ref|XP_010414208.1| PREDICTED: glutathione S-transferase F10-like [Camelina sativa]
Length=220

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 110/236 (47%), Gaps = 32/236 (14%)
 Frame = +3

Query  258  PYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydti  437
            P    S +  + L EKG+ + + HV+ + G++    +  I P  K+PV  +G + I+++ 
Sbjct  8    PLFASSKRAVVTLVEKGVPFETVHVDLMKGEHRKPEYIAIQPFGKIPVLTDGDYKIFESR  67

Query  438  eiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLR  617
             I++Y   +AEK  S G +L     + +E   ++++W     T YH P      +     
Sbjct  68   AIMRY---VAEKYRSQGPEL---LGKTIEERGQVEQWLDVEATSYHPP------LLALTL  115

Query  618  RVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASY  797
             ++ A +   P                     + +V+++SEE L ++LD  E +LS+  Y
Sbjct  116  NIVFAPLMGFP--------------------ADEKVIKESEEKLGEVLDVYEAQLSKNEY  155

Query  798  LTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
            L G+  SLAD+  +P    L     +   I  R ++  +W  +  RP++K+V  +Y
Sbjct  156  LAGDFVSLADLAHLPFTEYLVNEIGKAHLIKDRKHVSAWWDKISSRPAWKEVCEKY  211



>emb|CAB38118.1| Glutathione transferase III(a) [Zea mays]
Length=221

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 63/243 (26%), Positives = 106/243 (44%), Gaps = 40/243 (16%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            ++LY  P S + ++V   L EKG+D+    V+  TG +    F  +NP  ++P   +G  
Sbjct  4    LKLYGMPLSPNVVRVATVLNEKGLDFEIVPVDLTTGAHKQPDFLTLNPFGQIPALVDGDE  63

Query  420  iiydtieiiqyieRIAEKVSSGGFDL---NVSNQQVVEWMHKIQEWDPKYFTLYHVPVKY  590
            +++++  I +Y   IA K +S G DL     S  ++  W+    E +  +F     P+ +
Sbjct  64   VLFESRAINRY---IASKYASEGTDLLPATASAAKLEVWL----EVESHHFYPNASPLVF  116

Query  591  RLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEV  770
            +L V   L           PD                     A VV +  E L K+LD  
Sbjct  117  QLLVRPLL--------GGAPD---------------------AAVVDKHAEQLAKVLDVY  147

Query  771  EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKK  950
            E  L+   YL G+EF+LAD      L  L     +   +  RP++  +W  +  RP+++K
Sbjct  148  EAHLARNKYLAGDEFTLADANHASYLLYLSK-TPKAGLVAARPHVKAWWEAIVARPAFQK  206

Query  951  VIG  959
             + 
Sbjct  207  TVA  209



>gb|ACF82527.1| unknown [Zea mays]
 gb|ACF84267.1| unknown [Zea mays]
 gb|ACF84990.1| unknown [Zea mays]
 gb|ACF86463.1| unknown [Zea mays]
 gb|ACN27153.1| unknown [Zea mays]
 tpg|DAA55960.1| TPA: glutathione S-transferase4 [Zea mays]
Length=221

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 63/243 (26%), Positives = 106/243 (44%), Gaps = 40/243 (16%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            ++LY  P S + ++V   L EKG+D+    V+  TG +    F  +NP  ++P   +G  
Sbjct  4    LKLYGMPLSPNVVRVATVLNEKGLDFEIVPVDLTTGAHKQPDFLALNPFGQIPALVDGDE  63

Query  420  iiydtieiiqyieRIAEKVSSGGFDL---NVSNQQVVEWMHKIQEWDPKYFTLYHVPVKY  590
            +++++  I +Y   IA K +S G DL     S  ++  W+    E +  +F     P+ +
Sbjct  64   VLFESRAINRY---IASKYASEGTDLLPATASAAKLEVWL----EVESHHFYPNASPLVF  116

Query  591  RLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEV  770
            +L V   L           PD                     A VV +  E L K+LD  
Sbjct  117  QLLVRPLL--------GGAPD---------------------AAVVDKHAEQLAKVLDVY  147

Query  771  EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKK  950
            E  L+   YL G+EF+LAD      L  L     +   +  RP++  +W  +  RP+++K
Sbjct  148  EAHLARNKYLAGDEFTLADANHASYLLYLSK-TPKAGLVAARPHVKAWWEAIVARPAFQK  206

Query  951  VIG  959
             + 
Sbjct  207  TVA  209



>emb|CAA12269.1| ORF 3 [Sphingomonas sp. RW5]
Length=246

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 63/243 (26%), Positives = 119/243 (49%), Gaps = 9/243 (4%)
 Frame = +3

Query  237  IMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS  416
            +++LYH   S  S+KVRL L EK + + S  V+ +  ++    + R+NP+  +P   +  
Sbjct  1    MLELYHDWRSFCSIKVRLCLAEKQLPWESRFVDLMKLEHTRPEYTRLNPNGVVPTLVHNG  60

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRL  596
              I ++  I +Y+E +  ++S    D  V   ++  W+    +++         P  + L
Sbjct  61   VPIIESTIINEYLEEVFPEISLVPSD-PVERARMRAWV----KFEDDVLHPSIRPATFTL  115

Query  597  YVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLG-NAQVVRQSEEHLVKLLDEVE  773
             +S+ L ++    + E   LA   +++  E Y    +   +   V +++  + K LD +E
Sbjct  116  MMSQELAKLSDVELDE--QLAKHPNQQRAEEYRIAARSPVDHAAVEEAKVKMSKALDRLE  173

Query  774  GKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKV  953
             +L    YL G+ +SLADV   P + RL+ LN      + RP+L  + A +K RPS+ + 
Sbjct  174  KQLDTTPYLAGDSYSLADVAAAPFVDRLEELNFA-RLWDDRPSLSAWIARLKSRPSFSEA  232

Query  954  IGR  962
            + R
Sbjct  233  VPR  235



>gb|AIC33066.1| glutathione s-transferase [Elaeis guineensis]
Length=216

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 60/244 (25%), Positives = 104/244 (43%), Gaps = 44/244 (18%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            +++Y    S  + +V L LEE G +Y    +N  TG++        NP  ++P F++G+ 
Sbjct  3    VKVYGPTMSTCTARVLLCLEEVGAEYELVPINLSTGEHKQPAHLARNPIGQVPAFEDGA-  61

Query  420  iiydtieiiqyieRIAEKVSSGGFDL----NVSNQQVVE-WMH-KIQEWDPKYFTLYHVP  581
                  E       ++ K  S G DL     +    +V+ W+  +  ++DP    +    
Sbjct  62   --LMLHESRAIARYVSRKYKSSGADLLKEGGLEESAMVDVWLEVESHQFDPAIGPI----  115

Query  582  VKYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLL  761
                     F +  I+  +   PD                       V+  + E L K+L
Sbjct  116  ---------FFQSFIVPMIGGVPD---------------------QTVINTNLEKLCKVL  145

Query  762  DEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPS  941
            D  E +LS+  YL G+ FSLAD+  +P+L    + +     +N+RP++  +W  V  RP+
Sbjct  146  DIYEARLSKTKYLAGDFFSLADLSHVPLLYYF-MGSPHASVVNSRPHVKAWWEAVSSRPA  204

Query  942  YKKV  953
             KKV
Sbjct  205  CKKV  208



>ref|XP_004499970.1| PREDICTED: glutathione S-transferase F9-like [Cicer arietinum]
Length=215

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 110/229 (48%), Gaps = 32/229 (14%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK I++ +  ++   G++    F ++ P  ++PV Q+G + +Y++  II+Y  
Sbjct  15   RVLVCLFEKEIEFETLDIDLFKGEHKQPDFLKLQPFGEVPVVQDGDYTLYESRAIIRYY-  73

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK  + G DL     + +E    +++W       +H P  Y L ++     V+ A +
Sbjct  74   --AEKYKNQGTDLL---GKTIEERGLVEQWLEVEAHNFH-PAIYNLVIN-----VLFAPL  122

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               P                     N +V+ +S+E L K+LD  E KLS+  YL G+ FS
Sbjct  123  QGTP--------------------SNQKVIEESDEKLKKVLDIYEEKLSKTKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
            LAD+  +P    L         +  R ++ ++W  +  RPS+KKV+ +Y
Sbjct  163  LADLSHLPFGHYLVNQTGRGNLVRERKHVSEWWDDISNRPSWKKVLEQY  211



>ref|XP_010904819.1| PREDICTED: probable glutathione S-transferase GSTF1 [Elaeis guineensis]
 gb|AGE46021.1| glutathione S-transferase [Elaeis guineensis]
Length=216

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 60/244 (25%), Positives = 104/244 (43%), Gaps = 44/244 (18%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            +++Y    S  + +V L LEE G +Y    +N  TG++        NP  ++P F++G+ 
Sbjct  3    VKVYGPTMSTCTARVLLCLEEVGAEYELVPINLSTGEHKQPAHLARNPFGQVPAFEDGA-  61

Query  420  iiydtieiiqyieRIAEKVSSGGFDL----NVSNQQVVE-WMH-KIQEWDPKYFTLYHVP  581
                  E       ++ K  S G DL     +    +V+ W+  +  ++DP    +    
Sbjct  62   --LMLHESRAIARYVSRKYKSSGADLLKEGGLEESAMVDVWLEVESHQFDPAIGPI----  115

Query  582  VKYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLL  761
                     F +  I+  +   PD                       V+  + E L K+L
Sbjct  116  ---------FFQSFIVPMIGGVPD---------------------QTVINTNLEKLCKVL  145

Query  762  DEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPS  941
            D  E +LS+  YL G+ FSLAD+  +P+L    + +     +N+RP++  +W  V  RP+
Sbjct  146  DIYEARLSKTKYLAGDFFSLADLSHVPLLYYF-MGSPHASVVNSRPHVKAWWEAVSSRPA  204

Query  942  YKKV  953
             KKV
Sbjct  205  CKKV  208



>ref|XP_008342336.1| PREDICTED: glutathione S-transferase F9-like [Malus domestica]
Length=236

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 60/233 (26%), Positives = 109/233 (47%), Gaps = 32/233 (14%)
 Frame = +3

Query  258  PYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydti  437
            P+     +V + L EK I++ +  ++   G++    F ++ P  + PV Q+G + +Y++ 
Sbjct  30   PFYASPKRVLVCLVEKEIEFETSPIDLFKGEHKSPEFLKLQPFGQXPVIQDGDYTLYESR  89

Query  438  eiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLR  617
             II+Y    AEK  S G DL     + +E    +++W     + YH P+         + 
Sbjct  90   AIIRYY---AEKYKSQGTDLL---GKTIEERGLVEQWLEVEASNYHPPL------DNLVM  137

Query  618  RVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASY  797
             ++ A     P                     + +++++SEE L K+LD  E +LS++ Y
Sbjct  138  HILFASALGFP--------------------SDPKIIQESEEKLGKVLDIYEERLSKSKY  177

Query  798  LTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
            L G+ FSLAD+  +P    L     +   I  R ++  +W  +  RPS+KKV+
Sbjct  178  LAGDFFSLADLSHLPFTHYLANSMGKEYMIRDRKHVSAWWDDISSRPSWKKVL  230



>ref|NP_001237836.1| uncharacterized protein LOC100499911 [Glycine max]
 gb|ACU14147.1| unknown [Glycine max]
Length=215

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 110/229 (48%), Gaps = 32/229 (14%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK I++ + H++   G+N +  F ++ P   LPV Q+G + +Y++  II+Y  
Sbjct  15   RVLVCLIEKEIEFETVHIDLFKGENREPEFLKLQPFGSLPVIQDGDYTLYESRAIIRY--  72

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK    G DL     + +E    +++W       +H P+ Y L ++     V+ A +
Sbjct  73   -FAEKYKDQGTDL---LGKTIEEKGLVEQWLEVEAHNFHPPL-YNLVIN-----VLFAPL  122

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               P                     + +V+ +S++ + K+LD  E +LS++ YL G+ FS
Sbjct  123  TGAP--------------------SDQKVIEESDKKIEKVLDVYEERLSKSKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
            LAD+  +P    L         +  R ++  +W  +  RP+++KV+  Y
Sbjct  163  LADLSHLPFGHYLVNQTGRGNLVRERKHVSAWWDDISNRPAWQKVLQLY  211



>ref|XP_003977399.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1-like [Takifugu rubripes]
Length=361

 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 126/283 (45%), Gaps = 47/283 (17%)
 Frame = +3

Query  225  HADDIMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVF  404
             +D  + LYH   S +S KVRLA+ EKG     + V+    ++ + +F  +NP+ ++PV 
Sbjct  34   QSDAKLTLYHWTQSFNSQKVRLAVAEKGFHCEEYDVSLPLSEHNEPWFMHLNPTGEVPVL  93

Query  405  QNGSHiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEW------------  548
                H      +  Q ++ + +  +  G    +  ++   + H++Q +            
Sbjct  94   ---VHKDNIICDPTQIMDYLEQNFNDEG-SPKLIPEEGSTYYHRVQHYRELLDSLQMDAY  149

Query  549  ------DPKYFTLYHVPVKYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAY-ETEEK  707
                   P+     HVP     Y +  +R  I+    E  +LA   + +L++AY   + +
Sbjct  150  THGCILHPEITVDSHVPA----YAATCIRTQIVNTQTELTNLAEQ-NPELKDAYLAKQRR  204

Query  708  LGNAQVVRQSEEHLVKLLDEVEGKLSEA-----------------SYLTGEEFSLADVML  836
            L +      + ++L KLLDE+E  + +                  S+L GE FS+ADV L
Sbjct  205  LKSKLFDHDNMKYLKKLLDELENVMDQVETELQRRVEETPEEGSQSWLCGEFFSMADVSL  264

Query  837  IPILARLQVLNLELEF--INTRPNLFDYWALVKQRPSYKKVIG  959
               L RL+ L L   +     R N+  Y+  V +RP++++V+G
Sbjct  265  AVTLHRLKFLGLSRRYWGNGNRVNVETYYERVVERPAFRRVLG  307



>pdb|1AW9|A Chain A, Structure Of Glutathione S-Transferase Iii In Apo Form
Length=216

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/243 (26%), Positives = 106/243 (44%), Gaps = 40/243 (16%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            ++LY  P S + ++V   L EKG+D+    V+  TG +    F  +NP  ++P   +G  
Sbjct  3    LKLYGMPLSPNVVRVATVLNEKGLDFEIVPVDLTTGAHKQPDFLALNPFGQIPALVDGDE  62

Query  420  iiydtieiiqyieRIAEKVSSGGFDL---NVSNQQVVEWMHKIQEWDPKYFTLYHVPVKY  590
            +++++  I +Y   IA K +S G DL     S  ++  W+    E +  +F     P+ +
Sbjct  63   VLFESRAINRY---IASKYASEGTDLLPATASAAKLEVWL----EVESHHFYPNASPLVF  115

Query  591  RLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEV  770
            +L V   L           PD                     A VV +  E L K+LD  
Sbjct  116  QLLVRPLL--------GGAPD---------------------AAVVDKHAEQLAKVLDVY  146

Query  771  EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKK  950
            E  L+   YL G+EF+LAD      L  L     +   +  RP++  +W  +  RP+++K
Sbjct  147  EAHLARNKYLAGDEFTLADANHASYLLYLSK-TPKAGLVAARPHVKAWWEAIVARPAFQK  205

Query  951  VIG  959
             + 
Sbjct  206  TVA  208



>gb|KHN13182.1| Glutathione S-transferase F9 [Glycine soja]
Length=215

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 110/229 (48%), Gaps = 32/229 (14%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK I++ + H++   G+N +  F ++ P   LPV Q+G + +Y++  II+Y  
Sbjct  15   RVLVCLIEKEIEFETVHIDLFKGENKEPEFLKLQPFGSLPVIQDGDYTLYESRAIIRY--  72

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK    G DL     + +E    +++W       +H P+ Y L ++     V+ A +
Sbjct  73   -FAEKYKDQGTDL---LGKTIEEKGLVEQWLEVEAHNFHPPL-YNLVIN-----VLFAPL  122

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               P                     + +V+ +S++ + K+LD  E +LS++ YL G+ FS
Sbjct  123  TGAP--------------------SDQKVIEESDKKIEKVLDVYEERLSKSKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
            LAD+  +P    L         +  R ++  +W  +  RP+++KV+  Y
Sbjct  163  LADLSHLPFGHYLVNQTGRGNLVRERKHVSAWWDDISNRPAWQKVLQLY  211



>ref|XP_002611064.1| hypothetical protein BRAFLDRAFT_205905 [Branchiostoma floridae]
 gb|EEN67074.1| hypothetical protein BRAFLDRAFT_205905 [Branchiostoma floridae]
Length=325

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 117/270 (43%), Gaps = 34/270 (13%)
 Frame = +3

Query  228  ADDIMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVF-  404
            +DD++ LYH   S  S+KVRLAL  KG+ +    V     +N + ++ R++P+  +P+  
Sbjct  11   SDDLL-LYHCDGSFFSMKVRLALAVKGLSFKKRTVFFPIQENFEPWYMRLDPAGLVPLLV  69

Query  405  QNGSHiiydtieiiqyie-------RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYF  563
             NG  I   T  +            R+A  V +   DL    +   + +  +      Y 
Sbjct  70   HNGKVISESTRIVDYVDTVFHDRGPRLAPPVDT---DLGRRVRHFRDLLDGLPVELYSYG  126

Query  564  TLYH--------VPVKYRLYVSKFLRRVIIARM----AECPDLASSYHRKLREAYETEEK  707
            T+YH        +P   R    KFL      R+    A  PDLA +Y RK  +  E    
Sbjct  127  TIYHPDLAKDSSLPEILRRKARKFLSPSTAQRLHDLAAMHPDLAEAYTRKANKVAERTRD  186

Query  708  LGNAQVVRQSEEHLVKLLDEVEGKLSE----------ASYLTGEEFSLADVMLIPILARL  857
              +  ++ +  + L   LDEVE +L E            +L GE F+ ADVML  ++ RL
Sbjct  187  REDRGLIEKLLDELEVALDEVEKELGERKREKDASGQQQWLCGESFTAADVMLSCLVHRL  246

Query  858  QVLNLELEFINTRPNLFDYWALVKQRPSYK  947
            + + L       RP L  Y+   ++ P +K
Sbjct  247  KWVGLSHRSTLKRPLLDAYYLQAQKFPPFK  276



>ref|XP_002531867.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
 gb|EEF30504.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
Length=217

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 66/228 (29%), Positives = 101/228 (44%), Gaps = 40/228 (18%)
 Frame = +3

Query  282  VRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyieR  461
            V   L EKG+D+    ++   G++    F   NP  ++PV ++G        E       
Sbjct  17   VITCLHEKGVDFELVPIDLFAGEHKQPPFIAKNPFGQVPVLEDGD---LTLFESRAIAAY  73

Query  462  IAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYH---VPVKYRLYVSKFLRRVIIA  632
            IAEK    G+DL + +Q + E    ++ W       YH    P+ Y+LYV+  L+ V   
Sbjct  74   IAEKFKESGYDL-IRHQNLKE-AATVRVWTEVESQQYHPAIAPIVYQLYVNP-LKGV---  127

Query  633  RMAECPDLASSYHRKLREAYETE-EKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGE  809
                 PD         +E  ET  EKLG             K+LD  E +LS + YL G+
Sbjct  128  ----SPD---------QEIIETNLEKLG-------------KVLDIYEARLSTSKYLAGD  161

Query  810  EFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKV  953
             +SLAD+  +P    L   +     IN RP++  +W  +  RP++KK 
Sbjct  162  FYSLADLHHLPYTYYLMKTH-AASVINERPHVKAWWEDISSRPAFKKA  208



>dbj|BAJ85232.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  723  VVRQSEEHLVKLLDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPN  902
            VV Q+EE L K+LD  EG+L+E+ Y  G+EF+LAD++ +P    L     +   I  R N
Sbjct  138  VVEQNEEKLAKVLDVYEGRLAESQYFAGDEFTLADLVHMPNTDLLVSKTGKAGLITERKN  197

Query  903  LFDYWALVKQRPSYKKVI  956
            L  +W  V  RPS+KKV+
Sbjct  198  LSRWWDEVSARPSWKKVV  215



>ref|XP_007215944.1| hypothetical protein PRUPE_ppa011246mg [Prunus persica]
 gb|EMJ17143.1| hypothetical protein PRUPE_ppa011246mg [Prunus persica]
Length=217

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 112/227 (49%), Gaps = 34/227 (15%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V   L EK ID+    ++   G++ D  F ++ P  ++PV Q+G + +Y++  I++Y  
Sbjct  15   RVLACLVEKEIDFEIIPIDLFKGEHKDPEFLKLQPFGQVPVIQDGDYTLYESRAIMRYY-  73

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK  S G +L     + +E    +++W       +H PV Y+L V      +++A  
Sbjct  74   --AEKFKSQGTELL---GKTIEERGLVEQWLEVEAQRFHPPV-YKLVV-----HILLASA  122

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               P                     + +++++SE  L K+LD  E +LS++ YL G+ FS
Sbjct  123  LGFP--------------------SDPKIIQESEAKLGKVLDIYEERLSKSKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELE-FINTRPNLFDYWALVKQRPSYKKVI  956
            LAD+  +P    L V +L  E  I  R ++  +W  +  RPS+KKV+
Sbjct  163  LADLSHLPFNQHL-VADLGKEHMIRDRKHVSAWWDDIGNRPSWKKVL  208



>ref|WP_029639183.1| hypothetical protein [alpha proteobacterium Mf 1.05b.01]
Length=271

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 63/247 (26%), Positives = 118/247 (48%), Gaps = 13/247 (5%)
 Frame = +3

Query  237  IMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS  416
            ++ L+H+  S  S KVR  L EK +D+TS  ++ + G+    ++ +I+P   +P   +  
Sbjct  1    MLTLFHNAVSTCSQKVRWILSEKNMDFTSREIDLLAGEQHADWYIKIHPDHMVPALVHDE  60

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRL  596
             II ++  I+ Y+++I +       D  +   Q+  W+H I           H       
Sbjct  61   TIIRESSLIMMYLDQIGDG-ERFIPDNPLEAHQMRSWLHLIDH-------TIHAEAAVVT  112

Query  597  YVSKFLRRVIIARMAECPDLASS--YHRKLREAYETEEKLG-NAQVVRQSEEHLVKLLDE  767
            + S   R +I A+ A+  + A S       R    +   LG  A   +++ E  +K+L E
Sbjct  113  F-SLGPRNLINAQPADVREAAISNIVDPIARAQRRSVLDLGVMAPEFKRAVERFIKMLTE  171

Query  768  VEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYK  947
            +E +L    +L G + S+AD  ++P + RL+ L L+   I   P +  + + +KQRPS+ 
Sbjct  172  IEAQLQRTPWLAGPKLSIADGAVLPYVLRLEHLGLD-TIITPYPAVAAWLSSMKQRPSFA  230

Query  948  KVIGRYF  968
              +G++ 
Sbjct  231  NAVGQWI  237



>ref|XP_008229578.1| PREDICTED: glutathione S-transferase F9-like isoform X1 [Prunus 
mume]
Length=219

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 108/219 (49%), Gaps = 32/219 (15%)
 Frame = +3

Query  309  IDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyieRIAEKVSSGG  488
            I++ +  ++   G++ D  F ++ P  ++PV Q+G + +Y++  II+Y    AEK  S G
Sbjct  29   IEFETSPIDLFKGEHKDPEFLKLQPFGQVPVIQDGDYTLYESRAIIRYY---AEKYKSQG  85

Query  489  FDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARMAECPDLASSY  668
             DL     + +E    +++W     + YH P+ Y L +     +++ A     P      
Sbjct  86   TDLL---GKTIEERGLVEQWLEVEASNYHPPL-YNLVI-----QILFAPELGLP------  130

Query  669  HRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFSLADVMLIPIL  848
                           + +++++SEE L K+LD  E +LS++ YL G+ FSLAD+  +P  
Sbjct  131  --------------SDPKIIQESEEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPFT  176

Query  849  ARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
              L     +   I  R ++  +W  +  RPS+KKV+ ++
Sbjct  177  YYLANSMGKEYMIKDRKHVAAWWDDISNRPSWKKVLQQF  215



>ref|NP_180644.1| glutathione S-transferase PHI 10 [Arabidopsis thaliana]
 sp|P42761.3|GSTFA_ARATH RecName: Full=Glutathione S-transferase F10; Short=AtGSTF10; 
AltName: Full=AtGSTF4; AltName: Full=GST class-phi member 10; 
AltName: Full=Protein EARLY RESPONSE TO DEHYDRATION 13 [Arabidopsis 
thaliana]
 dbj|BAA04554.1| glutathione S-transferase [Arabidopsis thaliana]
 gb|AAC20721.1| glutathione S-transferase [Arabidopsis thaliana]
 gb|AAM91601.1| glutathione S-transferase [Arabidopsis thaliana]
 gb|AAN15396.1| glutathione S-transferase [Arabidopsis thaliana]
 gb|AEC08450.1| glutathione S-transferase PHI 10 [Arabidopsis thaliana]
Length=215

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/238 (25%), Positives = 109/238 (46%), Gaps = 32/238 (13%)
 Frame = +3

Query  252  HHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiyd  431
            + P    S +  + L EKG+ + + +V+ + G+     +  I P  K+PV  +G + I++
Sbjct  6    YAPLFASSKRAVVTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFE  65

Query  432  tieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKF  611
            +  I++Y   IAEK  S G DL     + +E   ++++W     T YH P      +   
Sbjct  66   SRAIMRY---IAEKYRSQGPDL---LGKTIEERGQVEQWLDVEATSYHPP------LLAL  113

Query  612  LRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEA  791
               ++ A +   P                     + +V+++SEE L ++LD  E +LS+ 
Sbjct  114  TLNIVFAPLMGFP--------------------ADEKVIKESEEKLAEVLDVYEAQLSKN  153

Query  792  SYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
             YL G+  SLAD+  +P    L     +   I  R ++  +W  +  R ++K+V  +Y
Sbjct  154  EYLAGDFVSLADLAHLPFTEYLVGPIGKAHLIKDRKHVSAWWDKISSRAAWKEVSAKY  211



>ref|XP_009384404.1| PREDICTED: glutathione S-transferase 3-like [Musa acuminata subsp. 
malaccensis]
Length=215

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 103/240 (43%), Gaps = 37/240 (15%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            +++Y  P S ++++V  AL EKG+++    V+  TG +    F  +NP  ++P  ++G  
Sbjct  3    VKVYGMPMSTNTVRVLAALNEKGVEFELVIVDLRTGAHKKPDFLALNPFGQIPALEDGD-  61

Query  420  iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
                  E       IA K +  G DL +S+    E                      R  
Sbjct  62   --VVLFESRAINRYIATKYAEAGPDLLLSSGTPAE----------------------RAV  97

Query  600  VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQ---VVRQSEEHLVKLLDEV  770
            V  +L    +      P +A+  +  L      +  LG A    VV      L K+LD  
Sbjct  98   VDLWLE---VESQQFGPPIAALVYEAL-----IKPMLGGATDVTVVEAQATKLEKVLDVY  149

Query  771  EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKK  950
            E +L+++ YL G EF+L D+  IP    L +   +   + +RP+L  +W  V  RP+++K
Sbjct  150  EARLAQSKYLAGAEFTLVDLNHIPYTNYL-MKTPKASLVTSRPHLLAWWQDVSSRPAWQK  208



>ref|XP_006294907.1| hypothetical protein CARUB_v10023958mg, partial [Capsella rubella]
 gb|EOA27805.1| hypothetical protein CARUB_v10023958mg, partial [Capsella rubella]
Length=239

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 114/243 (47%), Gaps = 33/243 (14%)
 Frame = +3

Query  237  IMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS  416
            ++++Y  P    S +  + L EKG+ + + HV+ + G+  +  +  I P  K+PV  +G 
Sbjct  26   VLKIYA-PLFASSKRAVVTLIEKGVSFETVHVDLMKGEQRNPEYLAIQPFGKIPVLVDGD  84

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRL  596
            + I+++  I++Y   IAEK  S G DL     + +E   ++++W     T YH P     
Sbjct  85   YKIFESRAIMRY---IAEKYRSQGPDL---LGKTIEERGQVEQWLDVEATSYHPP-----  133

Query  597  YVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEG  776
             +      ++ A +   P                     + +V+++SEE L ++LD  E 
Sbjct  134  -LLALTLNIVFAPLMGFP--------------------ADEKVIKESEEKLGEVLDVYEA  172

Query  777  KLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
            +LS+  YL G+  SLAD+  +P    L     +   I  R ++  +W  +  R ++K+V 
Sbjct  173  QLSKNEYLAGDFVSLADLAHLPFTEYLVNQIGKAYMIKDRKHVSAWWDKISSRAAWKEVS  232

Query  957  GRY  965
             +Y
Sbjct  233  EKY  235



>ref|XP_007215955.1| hypothetical protein PRUPE_ppa011337mg [Prunus persica]
 gb|EMJ17154.1| hypothetical protein PRUPE_ppa011337mg [Prunus persica]
Length=214

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 111/235 (47%), Gaps = 32/235 (14%)
 Frame = +3

Query  252  HHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiyd  431
            + P+     +V + L EK I++ +  ++   G++ D  F ++ P   +P+ Q+G + +Y+
Sbjct  6    YGPFYASPKRVLVCLVEKEIEFETSPIDLFKGEHKDPEFLKLQPFGTVPLIQDGDYTLYE  65

Query  432  tieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKF  611
            +  II+Y    AEK  S G  L     + +E    +++W       +H P+      +  
Sbjct  66   SRAIIRYY---AEKYKSQGTALL---GKTIEERGLVEQWLEVEAHNFHPPL------NNL  113

Query  612  LRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEA  791
            +  ++ A     P                     + +V+++SEE L K+LD  E +LS++
Sbjct  114  VLHILFASALGFP--------------------SDPKVIQESEEKLGKVLDIYEERLSKS  153

Query  792  SYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
             YL G+ FSLAD+  +P    +  L  +   I  R ++  +W  +  RPS+KKV+
Sbjct  154  KYLAGDFFSLADLSHLPFTQYMVTLLGKEYLIKDRKHVSAWWNDISNRPSWKKVL  208



>ref|XP_002510614.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
 gb|EEF52801.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
Length=218

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 58/242 (24%), Positives = 108/242 (45%), Gaps = 37/242 (15%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS-  416
            +++Y  P S    +V   L EK +D+    VN   G++    F +I P  ++P FQ+ S 
Sbjct  5    VKVYGPPLSTAVSRVLACLLEKDVDFQLIPVNMSKGEHKKPDFLKIQPFGQVPAFQDESI  64

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLN-VSNQQVVEWMH-KIQEWDPKYFTLYHVPVKY  590
             +           E+ A+K + G +  N ++   + +W+  + Q ++P        P   
Sbjct  65   SLFESRAICRYICEKHADKGNKGLYGTNPLAKASIDQWLEAEGQSFNP--------PSGA  116

Query  591  RLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEV  770
             ++   F  R+ I +                          +  +++Q+EE L KLL+  
Sbjct  117  LVFQLAFAPRMKIPQ--------------------------DEGLIKQNEEKLGKLLNIY  150

Query  771  EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKK  950
            E +L E+ +L G+EFSLAD+  +P    +     + E   +R N+  +W+ +  R S+KK
Sbjct  151  EKRLGESRFLAGDEFSLADLSHLPNTQYVVAATDKGELFTSRKNVGRWWSEISSRESWKK  210

Query  951  VI  956
            V+
Sbjct  211  VV  212



>ref|XP_006484982.1| PREDICTED: glutathione S-transferase F9-like [Citrus sinensis]
 gb|KDO40901.1| hypothetical protein CISIN_1g027956mg [Citrus sinensis]
Length=216

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 68/245 (28%), Positives = 119/245 (49%), Gaps = 43/245 (18%)
 Frame = +3

Query  237  IMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS  416
            ++++Y   Y+    +V L L EK I++ +  V+ I G+     + ++ P  +LPV Q+G 
Sbjct  2    VVKVYGPAYA-SPKRVILCLVEKEIEFETVPVDLIKGEQRSPEYLKLQPFGELPVIQDGD  60

Query  417  HiiydtieiiqyieRIAEKVSSGGFDL---NVSNQQVVE-WMH-KIQEWDPKYFTLYHVP  581
             I+Y++  I++Y    AEK  S G +L    +  + +VE W+  +   ++P    +Y + 
Sbjct  61   FILYESRAIMRYY---AEKYRSQGTELLGKTIEERGLVEQWLEVEAHNYNP---AIYELT  114

Query  582  VKYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLL  761
            ++  L+ SKF R V                              + ++V++S+E L K L
Sbjct  115  IQL-LFSSKFGRPV------------------------------DEKLVKESDEKLGKTL  143

Query  762  DEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPS  941
            D  E +LS++ YL G+ FSLAD+  IP    L         I  R ++  +W  +  RPS
Sbjct  144  DVYEERLSKSKYLAGDFFSLADLSHIPFTHYLVGPMGRQHMIRDRKHVSAWWDDISNRPS  203

Query  942  YKKVI  956
            +KKV+
Sbjct  204  WKKVL  208



>ref|XP_007048950.1| Glutathione S-transferase PHI 9 [Theobroma cacao]
 gb|EOX93107.1| Glutathione S-transferase PHI 9 [Theobroma cacao]
Length=217

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 63/235 (27%), Positives = 117/235 (50%), Gaps = 44/235 (19%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK +++ +  V+ + G++ D  + ++ P   +PV Q+G + +Y++  I++Y  
Sbjct  15   RVLVCLIEKEVEFETVPVDLLKGEHKDPEYLKLQPFGTVPVTQDGDYTLYESRAIMRYY-  73

Query  459  RIAEKVSSGGFDL---NVSNQQVVE-WMH-KIQEWDPKYFTLYHVPVKYRLYVSKFLRRV  623
              AEK  S G DL    V  + +VE W+  + Q ++P  FTL                ++
Sbjct  74   --AEKYKSQGTDLLGKTVEERGLVENWLEVEAQSYNPPMFTL--------------TVQI  117

Query  624  IIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLT  803
            +++     P                     +  ++++SEE L K+LD  E +LS++ YL 
Sbjct  118  MLSSKLGLPR--------------------DENLIKESEEKLGKVLDIYEERLSKSKYLA  157

Query  804  GEEFSLADVMLIPILARLQVLNLELEF-INTRPNLFDYWALVKQRPSYKKVIGRY  965
            G  FSLAD+  +P    L V ++  E+ I +R ++  +W  +  RPS++KV+  Y
Sbjct  158  GNFFSLADLSHLPFTQYL-VDHMGKEYMIKSRKHVSAWWDDISSRPSWQKVLQLY  211



>ref|XP_010873506.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1-like 1 isoform X1 [Esox lucius]
Length=367

 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 122/273 (45%), Gaps = 29/273 (11%)
 Frame = +3

Query  228  ADDIMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQ  407
            + D + LYH   S  S KVRL + EKG+      V+    ++ + +F R+N   ++PVF 
Sbjct  44   SKDKLVLYHWTQSFTSQKVRLVINEKGLLCEERDVSLPIAEHKEPWFMRLNLGEEVPVFI  103

Query  408  NGS------HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTL  569
            +G       + I   +E     E +A+ +   G  L+   QQ  E +  +      +  +
Sbjct  104  HGDTIVSDYNQIIQYLEANFVGETVAQLIPDAGSPLHDRVQQYRELLDGLPMDAYTHGCI  163

Query  570  YHVPVKYRLYVSKF----LRRVIIARMAEC-------PDLASSYHRKLREAYETEEKLGN  716
             H  +     + K+    +RR +    +E        P L   Y  K ++         N
Sbjct  164  LHPELTTDSMIPKYATAEIRRHLANAASELMKLDHDEPTLTEPYLSKQKKLMAKILDHDN  223

Query  717  AQVVRQSEEHLVKLLDEVEGKLSEAS----------YLTGEEFSLADVMLIPILARLQVL  866
               +++    L  +LD+VE +L +            +L G EF+LADV L  +L RL+ L
Sbjct  224  VTFLKKILGELAMVLDQVEAELEKRKIEYEGQKYELWLCGPEFTLADVCLGALLHRLKFL  283

Query  867  NLELEFI--NTRPNLFDYWALVKQRPSYKKVIG  959
             L  ++    +RPNL  ++  V++R +++KV+G
Sbjct  284  GLSKKYWEDGSRPNLQSFFERVQKRYAFRKVLG  316



>ref|XP_010035935.1| PREDICTED: glutathione S-transferase F9-like [Eucalyptus grandis]
 gb|KCW47444.1| hypothetical protein EUGRSUZ_K01229 [Eucalyptus grandis]
Length=215

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 109/226 (48%), Gaps = 32/226 (14%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EKG+++ +  V+   G+     F ++ P   +PV Q+G + ++++  II+Y  
Sbjct  15   RVLVCLIEKGVEFETVPVDLFKGEQKAPEFLKLQPFGSVPVIQDGDYTLFESRAIIRYY-  73

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK    G DL     + +E    +++W       Y  P++        + ++++A +
Sbjct  74   --AEKYKHQGTDL---LGKTIEERGLVEQWLEAEAHSYQPPLR------DLVHKIVLAPI  122

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
                       R L           + +++++SE+ L K+LD  E +LS++ YL G+ FS
Sbjct  123  -----------RGLT---------SDPKLIKESEDKLCKVLDIYEERLSKSKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
            LAD+  +P    L     +   I  R ++  +W  +  RPS+KKV+
Sbjct  163  LADLSHLPFTQYLMGKMGKEYLIRDRKSVSAWWDDISSRPSWKKVV  208



>ref|XP_004303893.1| PREDICTED: glutathione S-transferase F9-like isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004303894.1| PREDICTED: glutathione S-transferase F9-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=214

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 108/226 (48%), Gaps = 32/226 (14%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK I++ +  ++   G++ D  F ++ P   +PV Q+G + +Y++  II+Y  
Sbjct  15   RVLVCLVEKEIEFETIPIDLFKGEHKDPEFLKLQPFGAVPVIQDGDYTLYESRAIIRYY-  73

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK  S G DL     + +E    +++W      L      Y   +   +  ++ A +
Sbjct  74   --AEKYKSQGTDL---LGKTIEERGLVEQW------LEVEAQNYHPSIDNLVIHILFAPV  122

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               P                     + +++++SEE L K+LD  E +LS++ YL G+ FS
Sbjct  123  QGFP--------------------SDPKIIQESEEKLGKVLDVYEERLSKSKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
            LAD+  +P    L     +   I +R ++  +W  +  RPS+KKV+
Sbjct  163  LADLSHLPFTQYLVGAVGKDYMIKSRKHVSAWWDDISNRPSWKKVL  208



>ref|WP_026006160.1| glutathione S-transferase [Moritella dasanensis]
Length=254

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 63/247 (26%), Positives = 118/247 (48%), Gaps = 19/247 (8%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGK-NLDTFFFRINPSAKLPVFQNGS  416
            + LYHHP S+ S+KVRLALEEKGI ++   ++ +  +  L+ ++ ++NP   +P  +   
Sbjct  4    ITLYHHPLSVCSMKVRLALEEKGIAWSGRIIDIVRKQEQLEPWYVKLNPKGVIPTLE-YR  62

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLNVS---NQQVVEWMHKIQEWDPKYFTLYHVPV-  584
            H   + +     I R    +  G   L  S   NQ + + +    + D +  +    P  
Sbjct  63   HDTTEIVTDSASIIRSVASLPEGNSLLPNSKRDNQLMEKLIDLADDVDLQILSYARHPSM  122

Query  585  -KYRLYVSKFLRRVIIARMAEC-PDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKL  758
             K    +   +++ ++  MAE  P+L S+Y      + +++    + + ++  E   +  
Sbjct  123  DKSEKILDDRIKKSLL--MAEQHPELRSNYIVCAERSEKSKTFRVDEKFIKDVESKALAS  180

Query  759  LDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNL-----ELEFINTRPNLFDYWAL  923
            +   E  L   +YL G  ++LADV+   +L+RL +L       E EF    P LF+Y+  
Sbjct  181  ITFAEKALQGNTYLLGNSYTLADVIWTVVLSRLDLLGYSNWLDENEF----PQLFNYYQR  236

Query  924  VKQRPSY  944
            ++ R S+
Sbjct  237  MQNRSSF  243



>ref|XP_003567436.2| PREDICTED: glutathione S-transferase 3 [Brachypodium distachyon]
Length=224

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 107/246 (43%), Gaps = 41/246 (17%)
 Frame = +3

Query  228  ADDIMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQ  407
            A   M+L+    S + L+V   L EKGID+    V+ +TG +    F  +NP  ++P  Q
Sbjct  3    APPAMKLHGMALSQNVLRVATVLNEKGIDFEIVQVSLLTGAHKHPDFLALNPFGQIPALQ  62

Query  408  NGSHiiydtieiiqyieRIAEKVSSGGFDL--NVSNQQVVEWMHKIQEWDPKYFTLYHVP  581
            +G  ++Y++  I +Y   IAEK  + G DL     + ++  W+    E + K+F     P
Sbjct  63   DGDEVLYESRAINRY---IAEKYRTSGTDLLPAAPSAKMEVWL----EVESKHFYPAAQP  115

Query  582  VKYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLL  761
            V Y L +   L           PD A                     VV +    L K+L
Sbjct  116  VVYELLIKPML--------GLAPDQA---------------------VVDKHSADLAKVL  146

Query  762  DEVEGKLSEAS--YLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQR  935
            D  E  L +    YL GE+F+LAD   +  L  L     +   +++RP +  +W  +  R
Sbjct  147  DVYEAHLGKDGNKYLAGEQFTLADANHMCYLFSL-CKTAQAGLVDSRPRVKAWWDEISAR  205

Query  936  PSYKKV  953
            P++ K 
Sbjct  206  PAWVKT  211



>ref|XP_007146992.1| hypothetical protein PHAVU_006G087500g [Phaseolus vulgaris]
 gb|ESW18986.1| hypothetical protein PHAVU_006G087500g [Phaseolus vulgaris]
Length=214

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 113/243 (47%), Gaps = 40/243 (16%)
 Frame = +3

Query  237  IMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS  416
            ++++Y    +    +V + L EKG+++   H++   G+     F  + P  ++PV ++G 
Sbjct  3    VVKVYGEARAACPQRVMVCLLEKGVEFQLVHIDLQQGQQKTPQFLLLQPFGQVPVVEDGD  62

Query  417  HiiydtieiiqyieRIAEKVSSGGFDL---NVSNQQVVE-WMHKIQEWDPKYFTLYHVPV  584
              ++++  II+Y    A K +  G +L    +  + +VE W+    E +   F       
Sbjct  63   FRLFESRAIIRYY---ATKYADRGTELLGKTLEERALVEQWL----EVEAHNFN------  109

Query  585  KYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLD  764
               L  S  L+ VI+ +M +  DLA                     + ++ EE + K+LD
Sbjct  110  --NLCFSIMLQLVILPKMGKVGDLA---------------------LAKKGEEDIGKVLD  146

Query  765  EVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSY  944
              E +LSE++YL G+ FSLAD+  +P L  L         +  R N+  +W  +  RP++
Sbjct  147  VYESRLSESTYLAGDHFSLADLSHLPGLGHLIEEAKLGHLVTQRKNVNAWWEKISSRPAW  206

Query  945  KKV  953
            KK+
Sbjct  207  KKL  209



>ref|XP_007048951.1| Glutathione S-transferase PHI 9 isoform 1 [Theobroma cacao]
 ref|XP_007048952.1| Glutathione S-transferase PHI 9 isoform 1 [Theobroma cacao]
 gb|EOX93108.1| Glutathione S-transferase PHI 9 isoform 1 [Theobroma cacao]
 gb|EOX93109.1| Glutathione S-transferase PHI 9 isoform 1 [Theobroma cacao]
Length=217

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 68/247 (28%), Positives = 120/247 (49%), Gaps = 41/247 (17%)
 Frame = +3

Query  237  IMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS  416
            ++++Y   Y+    +V + L EK +++ +  V+ + G++ D  + ++ P   +PV Q+G 
Sbjct  2    VVKVYGPAYATPK-RVLVCLIEKEVEFETVPVDLLKGEHKDPEYLKLQPFGTVPVTQDGD  60

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRL  596
            +I+Y++  I++Y    AEK  S G DL     + VE    ++ W       YH P+ Y L
Sbjct  61   YILYESRAILRYY---AEKYKSQGTDL---LGKTVEERGLVENWLEVEAQSYHPPI-YTL  113

Query  597  YVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLG---NAQVVRQSEEHLVKLLDE  767
             V                                  KLG   +  ++++SEE L K+LD 
Sbjct  114  TVQILF----------------------------SSKLGFPRDENLIKESEEKLAKVLDI  145

Query  768  VEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEF-INTRPNLFDYWALVKQRPSY  944
             E +LS++ YL G+ FSLAD+  +P    L V  +  E+ I +R ++  +W  +  RPS+
Sbjct  146  YEERLSKSKYLGGDFFSLADLSHLPFTQYL-VDQMGKEYMIRSRKHVSAWWDDISSRPSW  204

Query  945  KKVIGRY  965
            +KV+  Y
Sbjct  205  QKVLQLY  211



>ref|XP_006484981.1| PREDICTED: glutathione S-transferase F9-like [Citrus sinensis]
Length=211

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 110/230 (48%), Gaps = 34/230 (15%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK I++ +  V+ I G++ +  + ++ P   LPV Q+G   +Y++  II+Y  
Sbjct  15   RVIVCLIEKQIEFETAPVDLIKGEHRNPEYLKLQPFGALPVIQDGDFTLYESRAIIRYY-  73

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK  S G +L     +  E    +++W       YH P+ Y + V            
Sbjct  74   --AEKYRSQGTEL---LGKTTEERGLVEQWLEVEAHNYHPPI-YEMTVQLLF--------  119

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
                 L  S   KL               V++SEE L K+LD  E +LS++ YL G+ FS
Sbjct  120  --ASKLGLSVDEKL---------------VKKSEEKLGKVLDVYEERLSKSKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELEF-INTRPNLFDYWALVKQRPSYKKVIGRY  965
            LAD+  +P    L V  +E E+ I  R ++  +W  +  RPS+KKV+  Y
Sbjct  163  LADLSHLPFTQYL-VGPMEKEYMIRDRKHVSAWWDDISNRPSWKKVLELY  211



>gb|KEH33687.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=215

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 118/248 (48%), Gaps = 43/248 (17%)
 Frame = +3

Query  237  IMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS  416
            ++++Y   Y+    +V + L EK I++ + HV+   G++ +  + ++ P   LPV Q+G 
Sbjct  2    VVKVYGPDYACPK-RVIVCLIEKDIEFETVHVDGFKGEHKEAEYLKLQPFGLLPVIQDGD  60

Query  417  HiiydtieiiqyieRIAEKVSSGGFDL---NVSNQQVVE-WMH-KIQEWDPKYFTLYHVP  581
            + +Y++  I++Y    AEK  + G DL    +  + +VE W+  +   ++P  + L    
Sbjct  61   YTLYESRAILRYY---AEKYKNQGTDLLGKTIEERGLVEQWLEVEAHNFNPPIYNL----  113

Query  582  VKYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLL  761
                      +  +++  +   P                     + +VV++SEE L K+L
Sbjct  114  ----------VMNLLVYPLVGLP--------------------SDQKVVQESEEKLGKVL  143

Query  762  DEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPS  941
            D  E +LS+  YL G+ FSLAD+  +P    L     +   +  R ++  +W  +  RPS
Sbjct  144  DIYEERLSKTKYLAGDFFSLADLSHLPFGHYLMNSMGKENMVKERKHVNAWWDDISNRPS  203

Query  942  YKKVIGRY  965
            +KKV+  Y
Sbjct  204  WKKVLQLY  211



>gb|AFK37527.1| unknown [Lotus japonicus]
Length=215

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 61/228 (27%), Positives = 107/228 (47%), Gaps = 32/228 (14%)
 Frame = +3

Query  282  VRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyieR  461
            V + L EK I++ S  V+   G+N    F +I P  K+PV Q+G + +Y++  I +Y   
Sbjct  16   VVMCLIEKEIEFESVPVDLSKGENKTPEFLKIQPFGKIPVIQDGDYTLYESRAINRY---  72

Query  462  IAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARMA  641
            +AEK  + G +L     + +E    +++W       +H P      + K +  V+ A + 
Sbjct  73   LAEKYKNQGTEL---LGKTIEERGLVEQWLEVEAQNFHPP------LHKLVLHVLFAPIR  123

Query  642  ECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFSL  821
              P                     + +V+ +SE  L+K+LD  E +LS++ YL G+ FSL
Sbjct  124  GFP--------------------SDPKVIEESEVKLLKVLDIYEERLSKSKYLAGDFFSL  163

Query  822  ADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
            AD+  +P    L         +  R ++  +W  +  RPS++KV+  Y
Sbjct  164  ADLSHLPFGYYLVNQTGRENLVRERKHVSAWWDDISTRPSWQKVLQLY  211



>ref|XP_010269470.1| PREDICTED: glutathione S-transferase F13-like [Nelumbo nucifera]
Length=217

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 100/244 (41%), Gaps = 44/244 (18%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            ++LY  P S  + +V   L EK +D+    VN  T ++ +  F   NP   +PV ++G  
Sbjct  3    LKLYGLPMSSYTTRVMTCLHEKAVDFEFVPVNLFTCEHKEPPFLAKNPFGLIPVLEDGD-  61

Query  420  iiydtieiiqyieRIAEKVSSGGFDL----NVSNQQVVE-WMH-KIQEWDPKYFTLYHVP  581
                  E       +A K    G DL    ++     V  WM  + Q+++P        P
Sbjct  62   --LTLFESRAINSYVAHKYKDSGTDLLRLSDIKEAAAVGVWMEVESQQFNPAI-----TP  114

Query  582  VKYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLL  761
            + Y  +V+            + PD A                     ++  S E L K+L
Sbjct  115  IIYEFFVAPI--------SGKTPDQA---------------------IIDASAEKLGKVL  145

Query  762  DEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPS  941
            D  E +LS   YL G+ ++LAD+  +P    L         I +RP++  +W  +  RP+
Sbjct  146  DIYEARLSSTKYLAGDSYTLADLHHLPYTFYLMKTPWA-SLIESRPHVKAWWEDISSRPA  204

Query  942  YKKV  953
            +KKV
Sbjct  205  FKKV  208



>gb|ADE76351.1| unknown [Picea sitchensis]
Length=214

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 106/244 (43%), Gaps = 38/244 (16%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            +++Y HP S  +  V   L EK ++Y    V    G +    +  +NP   LP  Q+G  
Sbjct  4    IKVYGHPISTATRLVLCCLHEKKVEYDFVLVELSAGAHKQPQYLALNPFGVLPTIQDGD-  62

Query  420  iiydtieiiqyieRIAEKVSSGGFDL---NVSNQQVVEWMHKIQEWDPKYFTLYHVPVKY  590
                  E     + +A+K    G +L   ++S Q +VE      +W       ++ P   
Sbjct  63   --LTLFESRAIAKYLAKKYEGQGTELLGNSLSEQALVE------QWSQVEGQSFNSPA--  112

Query  591  RLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEV  770
                S  L +++I  M+                  T+E       V  + E L K+LD  
Sbjct  113  ----SAILFQILIVPMS---------------GGSTDEA-----AVEMNVEKLKKVLDIY  148

Query  771  EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKK  950
            E +LS++ YL G+ FSLAD+  +P L  L     + + I++R ++  +W  +  RP++KK
Sbjct  149  EERLSKSKYLAGDFFSLADLQHLPYLDYLVTDCGKGDLISSRKHVKAWWEDISSRPAWKK  208

Query  951  VIGR  962
              G+
Sbjct  209  ATGK  212



>gb|EYU46696.1| hypothetical protein MIMGU_mgv1a013633mg [Erythranthe guttata]
Length=214

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 108/243 (44%), Gaps = 39/243 (16%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            ++++   +S  +++V   L EKG+D+    V+  +G +    F  +NP  ++P F++G  
Sbjct  3    IKVHGSTFSTAAMRVFACLNEKGLDFEFVPVDMRSGAHKKESFLSLNPFGQVPAFEDG--  60

Query  420  iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
                                    DLN+   + +         D     LY  P K  + 
Sbjct  61   ------------------------DLNLFESRAINQYIAHTYADNGTPLLYLDPKKMAIA  96

Query  600  VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQ---VVRQSEEHLVKLLDEV  770
                +   + A+  + P    ++   L+        LG A    VV Q E  L K+LD  
Sbjct  97   T---VWAEVEAQKFDGPASKLTWELGLKPL------LGMATDDAVVEQQEALLCKVLDVY  147

Query  771  EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKK  950
            E +L+E+ YL G+ F+LAD+  +P ++ L    ++  F ++RP++  + A +  RP+++K
Sbjct  148  EARLAESKYLGGDRFTLADLHHLPTMSYLMATRVKACF-DSRPHVSAWCADISARPAWEK  206

Query  951  VIG  959
            V+ 
Sbjct  207  VVA  209



>ref|XP_002879283.1| early dehydration-induced 13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55542.1| early dehydration-induced 13 [Arabidopsis lyrata subsp. lyrata]
Length=215

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 59/238 (25%), Positives = 109/238 (46%), Gaps = 32/238 (13%)
 Frame = +3

Query  252  HHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiyd  431
            + P    S +  + L EKG+ + + +V+ + G+     +  I P  K+PV  +G + I++
Sbjct  6    YAPLFASSKRAVVTLVEKGVSFETVNVDLMKGEQRKPEYLAIQPFGKIPVLVDGDYKIFE  65

Query  432  tieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKF  611
            +  I++Y   IAEK  S G DL     + +E   ++++W     T YH P      +   
Sbjct  66   SRAIMRY---IAEKYRSQGPDL---LGKTIEERGQVEQWLDVEATSYHPP------LLAL  113

Query  612  LRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEA  791
               ++ A +   P                     + +V+++SEE L ++LD  E +LS+ 
Sbjct  114  TLNIVFAPLMGFP--------------------ADEKVIKESEEKLGEVLDVYEAQLSKN  153

Query  792  SYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
             YL G+  SLAD+  +P    L     +   I  R ++  +W  +  R ++K+V  +Y
Sbjct  154  EYLAGDFVSLADLAHLPFTEYLVGPIGKAHLIKDRKHVSAWWDKISSRAAWKEVSAKY  211



>ref|XP_008348377.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase F9-like, 
partial [Malus domestica]
Length=202

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 59/227 (26%), Positives = 114/227 (50%), Gaps = 34/227 (15%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK +D+ +  ++ + G++    F ++ P   +P+ Q+G + +Y++  II+Y  
Sbjct  3    RVLVCLVEKEVDFETVPIDLLKGEHKHPDFLKLQPFGSVPLIQDGDYTLYESRAIIRY--  60

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK  S G +L + N   +E    +++W       +H P+      +  +  ++ A +
Sbjct  61   -CAEKYKSQGTNL-LGN--TIEERGLVEQWLEVEAQNFHPPI------NNLVLHILFASV  110

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               P                     + +++++SEE L K+LD  E +LS++ YL G+ FS
Sbjct  111  LGFP--------------------SDRKIIQESEEKLGKVLDIYEERLSKSKYLAGDFFS  150

Query  819  LADVMLIPILARLQVLNLELEF-INTRPNLFDYWALVKQRPSYKKVI  956
            LAD+  +P    L V N+  E+ I  R ++  +W  +  RPS+K+V+
Sbjct  151  LADLSHLPFTHYL-VANMGKEYMIRDRKHVSAWWDDISNRPSWKRVL  196



>gb|KDP36862.1| hypothetical protein JCGZ_08153 [Jatropha curcas]
Length=217

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 98/239 (41%), Gaps = 31/239 (13%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            +++Y    S    +V   L EK +++    +N   G++    F +I P  ++P FQ+ S 
Sbjct  5    VKVYGPTLSPAVCRVLACLIEKDVNFQLIPINMSKGEHKKPEFLKIQPFGQVPAFQDES-  63

Query  420  iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
                  E       I EK    G+        + +    I +W       Y+ P    L+
Sbjct  64   --ISLFESRAICRYICEKYPDKGYKGLYGTNPLAK--ASIDQWVEAEGQSYNAPSGALLF  119

Query  600  VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
                  R+ I +                          +  +++Q+EE L K+LD  E +
Sbjct  120  QLALAPRMNIPQ--------------------------DQGIIKQNEEKLGKVLDVYEKR  153

Query  780  LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
            L E+ +L G+EFSLAD+  +P    L       E I ++ N+  +W+ +  R S+KKV+
Sbjct  154  LGESRFLAGDEFSLADLSHLPNTQYLVAATDRAELITSKQNVGRWWSEISNRQSWKKVV  212



>ref|XP_009132757.1| PREDICTED: glutathione S-transferase F10 [Brassica rapa]
Length=215

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 59/238 (25%), Positives = 110/238 (46%), Gaps = 32/238 (13%)
 Frame = +3

Query  252  HHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiyd  431
            + P    S +  + L EKG+++ + +V+ + G+     +  I P  K+PV  +G + I++
Sbjct  6    YAPLFASSKRAVVTLVEKGVEFETVNVDLMKGEQRQPEYMAIQPFGKIPVLVDGDYKIFE  65

Query  432  tieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKF  611
            +  I++Y   IAEK  S G DL     + +E   ++++W     T YH P      +   
Sbjct  66   SRAIMRY---IAEKYRSQGPDL---LGKTIEERGQVEQWLDVEATSYHPP------LLAL  113

Query  612  LRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEA  791
               ++ A +   P                     + +V+++SEE L ++LD  E +LS+ 
Sbjct  114  TLNIVFAPLMGFP--------------------ADEKVIKESEEKLGEVLDVYEAQLSKN  153

Query  792  SYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
             YL G+  SLAD+  +P    L     +   I  R ++  +W  +  R ++K+V  +Y
Sbjct  154  EYLAGDFVSLADLAHLPFTEYLVGAIGKAYMIKDRKHVSAWWDKISNRAAWKEVSEKY  211



>ref|XP_009365718.1| PREDICTED: glutathione S-transferase F13 [Pyrus x bretschneideri]
Length=217

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 56/228 (25%), Positives = 94/228 (41%), Gaps = 38/228 (17%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V   L EKG+D+    VN + G++    F   NP  ++PV ++G        E      
Sbjct  16   RVLTILHEKGLDFELLPVNLLAGEHKQPHFLAKNPFGQIPVLEDGD---LTLFESRAITA  72

Query  459  RIAEKVSSGGFDL---NVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVII  629
             +AEK    G DL   N  N+  +     ++ W       +H  +   ++     + +I+
Sbjct  73   YVAEKFKENGVDLIRHNNLNEAAL-----VKVWTEVESQSFHPAISPIVF-----QHIIV  122

Query  630  ARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGE  809
                + PD A                     V+  + E L K+LD  E +LS   YL G+
Sbjct  123  PMRGQTPDQA---------------------VIDANLEKLAKVLDVYEARLSSTKYLAGD  161

Query  810  EFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKV  953
             +SLAD+  +P              +N RP++  +W  +  RP++KKV
Sbjct  162  FYSLADLHHLPYTYYFMKTPWA-SLVNERPHVKAWWEDISSRPAFKKV  208



>ref|XP_002593983.1| hypothetical protein BRAFLDRAFT_57407 [Branchiostoma floridae]
 gb|EEN49994.1| hypothetical protein BRAFLDRAFT_57407 [Branchiostoma floridae]
Length=334

 Score = 63.9 bits (154),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 75/273 (27%), Positives = 123/273 (45%), Gaps = 41/273 (15%)
 Frame = +3

Query  246  LYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHii  425
            LYH   S  S K RLAL EK + Y  H V+    +N + +F RINPS ++PV  +G  I+
Sbjct  19   LYHFVTSFYSQKARLALIEKRLKYEEHDVSLPLNENTEPWFMRINPSGEVPVLVHGEQIL  78

Query  426  ydtieiiqyieRI-----------AEKVSSGG----FDLNVSNQQVVEWMHKI-------  539
             D   II YIE              E   +G     F   + N  V  + H         
Sbjct  79   ADANSIIDYIEETFTDDSVPRLVPPEDTRAGRRVRYFREILDNLPVAAYTHGCILHPQLT  138

Query  540  -QEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGN  716
                 P Y T      K +  +++   + +  R +E PDL+ +Y +K ++  +  ++  +
Sbjct  139  ADSMIPSYAT-----AKLKGMIAQ-TEQTLTKRASEHPDLSEAYMKKQKQLQQQLQQHDD  192

Query  717  AQVVRQSEEHLVKLLDEVEGKL----------SEASYLTGEEFSLADVMLIPILARLQVL  866
               +++    L + LD VE +L           +  +L  E F+ AD+ L  +L RL  L
Sbjct  193  INYMKRLLHDLEETLDFVEKELVQRFKETQESGQQMWLCCESFTAADIALSTLLHRLTFL  252

Query  867  NLELEFINT--RPNLFDYWALVKQRPSYKKVIG  959
             L   +     RP++ +Y+  V++ PS+K+V+G
Sbjct  253  GLSRRYWGNGIRPHIQNYYTRVQEHPSFKQVLG  285



>ref|XP_008380180.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase F9-like 
[Malus domestica]
Length=214

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 59/227 (26%), Positives = 114/227 (50%), Gaps = 34/227 (15%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK +D+ +  ++ + G++    F ++ P   +P+ Q+G + +Y++  II+Y  
Sbjct  15   RVLVCLVEKEVDFETVPIDLLKGEHKHPDFLKLQPFGSVPLIQDGDYTLYESRAIIRY--  72

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK  S G +L + N   +E    +++W       +H P+      +  +  ++ A +
Sbjct  73   -CAEKYKSQGTNL-LGN--TIEERGLVEQWLEVEAQNFHPPI------NNLVLHILFASV  122

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               P                     + +++++SEE L K+LD  E +LS++ YL G+ FS
Sbjct  123  LGFP--------------------SDRKIIQESEEKLGKVLDIYEERLSKSKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELEF-INTRPNLFDYWALVKQRPSYKKVI  956
            LAD+  +P    L V N+  E+ I  R ++  +W  +  RPS+K+V+
Sbjct  163  LADLSHLPFTHYL-VANMGKEYMIRDRKHVSAWWDDISNRPSWKRVL  208



>ref|XP_008229577.1| PREDICTED: glutathione S-transferase F9-like [Prunus mume]
Length=219

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 110/227 (48%), Gaps = 34/227 (15%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V   L EK ID+    ++   G++ D  F ++ P  ++PV Q+G + +Y++  I++Y  
Sbjct  15   RVLACLVEKEIDFEIIRIDLFKGEHKDPEFLKLEPFGQVPVIQDGDYTLYESRAIMRYY-  73

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK  S G +L     + VE    +++W       +H PV Y+L V      +++A  
Sbjct  74   --AEKFKSQGTELL---GKTVEERGLVEQWLEVEALRFHPPV-YKLVV-----HILLASA  122

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               P                     + +++++SE  L K+LD  E +LS++ YL G+ FS
Sbjct  123  LGFP--------------------SDPKIIQESEAKLGKVLDIYEERLSKSKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELE-FINTRPNLFDYWALVKQRPSYKKVI  956
            LAD   +P    L V +L  E  I  R ++  +W  +   PS+KKV+
Sbjct  163  LADRSHLPFSQHL-VADLGKEHMIRDRKHVSAWWDDISNGPSWKKVL  208



>ref|XP_009377092.1| PREDICTED: glutathione S-transferase F9-like [Pyrus x bretschneideri]
Length=214

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 112/227 (49%), Gaps = 34/227 (15%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK +D+ +  ++ + G+N    F ++ P   +P+ Q+G + +Y++  I++Y  
Sbjct  15   RVLVCLVEKEVDFETIPIDLLKGENKHPDFLKLQPFGTVPLIQDGDYTLYESRAIMRYY-  73

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK  S G DL     + +E    +++W       +  P+ Y L V      ++ A +
Sbjct  74   --AEKYKSQGTDL---LGKTIEERGLVEQWLEVEAHNFQPPI-YNLVV-----HILFAPV  122

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               P                     + +++++SEE L K+LD  E +LS++ YL G+ FS
Sbjct  123  LGFP--------------------SDPKILQESEEKLGKVLDIYEEQLSKSKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELEF-INTRPNLFDYWALVKQRPSYKKVI  956
            LAD+  +P      V N+  E+ I  R ++  +W  +  RPS+K+V+
Sbjct  163  LADLSHLP-FTHFLVANMGKEYMIRDRKHVSAWWDDISNRPSWKRVL  208



>gb|KDO84982.1| hypothetical protein CISIN_1g027634mg [Citrus sinensis]
Length=221

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 56/243 (23%), Positives = 104/243 (43%), Gaps = 39/243 (16%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS-  416
            +++Y  P S    +V   L EK +++    +N   G +    F +I P  ++P FQ+   
Sbjct  5    VKVYGPPLSTAVCRVVACLLEKDVEFQLISLNMAKGDHKKPDFLKIQPFGQVPAFQDEKI  64

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLN-VSNQQVVEWMH-KIQEWDPKYFTL-YHVPVK  587
             ++          E   EK + G F  N ++   + +W+  + Q ++P    L + + + 
Sbjct  65   SLLESRAICRYVCENYPEKGNKGLFGTNPLAKASIDQWLEAEGQSFNPPSSALVFQLALA  124

Query  588  YRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDE  767
             R+ + +                                   +  V++Q+EE L K+LD 
Sbjct  125  PRMNIKQ-----------------------------------DEGVIKQNEEKLAKVLDV  149

Query  768  VEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYK  947
             E +L E+ +L G+EFSLAD+  +P    L       E + +R N+  +W  +  R S+K
Sbjct  150  YEKRLGESRFLAGDEFSLADLSHLPNAHYLVNATDRGEILTSRDNVGRWWGEISNRDSWK  209

Query  948  KVI  956
            KV+
Sbjct  210  KVV  212



>gb|AHA46522.1| phi class glutathione S-transferase [Larix kaempferi]
Length=215

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 60/242 (25%), Positives = 104/242 (43%), Gaps = 38/242 (16%)
 Frame = +3

Query  237  IMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS  416
            +++L+ H +S  +  V   L EK +DY    ++ +TG      +  +NP   +P  Q+G 
Sbjct  3    LIKLHGHYFSTATTVVLCCLNEKQVDYELVVIDLLTGAQKQPQYLALNPFGVVPTIQDGD  62

Query  417  HiiydtieiiqyieRIAEKVSSGGFDL---NVSNQQVVEWMHKIQEWDPKYFTLYHVPVK  587
                   E    +  +A K    G DL    +S Q VV+      +W       ++ P  
Sbjct  63   ---LTLYESRAILRYLARKFKGQGTDLLGSTLSEQAVVD------QWCEVEGHSFNTPAS  113

Query  588  YRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDE  767
              +Y     + +I+  +    D A+                     V  + E L K+LD 
Sbjct  114  VTVY-----QLLIVPMIGGSTDQAA---------------------VEMNVEKLKKVLDI  147

Query  768  VEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYK  947
             E +LS+  YL G+ FSLAD+  +P    L  L  + + I++R ++  +W  +  RP++K
Sbjct  148  YEERLSKNKYLAGDFFSLADLQHLPRTHYLVNLCGKGDLISSRKHVKAWWDDISSRPAWK  207

Query  948  KV  953
            KV
Sbjct  208  KV  209



>ref|XP_006473732.1| PREDICTED: glutathione S-transferase-like [Citrus sinensis]
Length=221

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/243 (23%), Positives = 103/243 (42%), Gaps = 39/243 (16%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS-  416
            +++Y  P S    +V   L EK +++    +N   G +    F +I P  ++P FQ+   
Sbjct  5    VKVYGPPLSTAVCRVVACLLEKDVEFQLISLNMAKGDHKKPDFLKIQPFGQVPAFQDEKI  64

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLN-VSNQQVVEWMH-KIQEWDPKYFTL-YHVPVK  587
             +           E   EK + G F  N ++   + +W+  + Q ++P    L + + + 
Sbjct  65   SLFESRAICRYVCENYPEKGNKGLFGTNPLAKASIDQWLEAEGQSFNPPSSALVFQLALA  124

Query  588  YRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDE  767
             R+ + +                                   +  V++Q+EE L K+LD 
Sbjct  125  PRMNIKQ-----------------------------------DEGVIKQNEEKLAKVLDV  149

Query  768  VEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYK  947
             E +L E+ +L G+EFSLAD+  +P    L       E + +R N+  +W  +  R S+K
Sbjct  150  YEKRLGESRFLAGDEFSLADLSHLPNAHYLVNATDRGEILTSRDNVGRWWGEISNRDSWK  209

Query  948  KVI  956
            KV+
Sbjct  210  KVV  212



>ref|XP_007885195.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1 isoform X2 [Callorhinchus milii]
Length=361

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 120/286 (42%), Gaps = 45/286 (16%)
 Frame = +3

Query  213  ALVVHADDIMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAK  392
            A +    + M LYH   S  S KVRL + EKG+    + VN    ++ + +F  +NP+ +
Sbjct  33   AKIPQTHNKMVLYHWSQSFCSQKVRLVIAEKGLKCEEYDVNLPLSEHNEPWFMHLNPTGE  92

Query  393  LPVFQNGSHiiydtieiiqyieRIAEKVSSGGFDLNVSN-------------QQVVEWMH  533
            +PV    SH      E      +I + +     D N+               Q   E + 
Sbjct  93   VPVL---SHTDKIICEST----QIIDYLEKTFVDANIPKLIPDEGSLYYPRVQHYRELLD  145

Query  534  KIQEWDPKYFTLYHVPVKYR----LYVSKFLRRVIIARMAECPDLASSYHRKLREAYETE  701
             +      +  + H  +        Y +  +R  I    +E   LA   H +LREAY T+
Sbjct  146  SLPMDAYTHGCILHPELTMGSLIPAYATTRIRSQIENTESELKKLAEE-HPELREAYLTK  204

Query  702  EKL--------GNAQVVRQSEEHLVKLLDEVEGKL----------SEASYLTGEEFSLAD  827
            +K          N + +++    L  +LD+VE +L              +L GE FSLAD
Sbjct  205  QKQIKSKIRDHDNVKYLKKILTELENVLDQVETELQRRIEETPEEGHQPWLCGEFFSLAD  264

Query  828  VMLIPILARLQVLNLELEFINT--RPNLFDYWALVKQRPSYKKVIG  959
            V L   + RL+ L L   +     RPNL  Y+  V QR ++++V+G
Sbjct  265  VSLAVTVHRLKFLGLARRYWGNGRRPNLESYYERVLQRKTFRRVLG  310



>ref|XP_007885194.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1 isoform X1 [Callorhinchus milii]
Length=362

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 120/287 (42%), Gaps = 46/287 (16%)
 Frame = +3

Query  213  ALVVHADDIMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAK  392
            A +    + M LYH   S  S KVRL + EKG+    + VN    ++ + +F  +NP+ +
Sbjct  33   AKIPQTHNKMVLYHWSQSFCSQKVRLVIAEKGLKCEEYDVNLPLSEHNEPWFMHLNPTGE  92

Query  393  LPVFQNGSHiiydtieiiqyieRIAEKVSSGGFDLNVSN-------------QQVVEWMH  533
            +PV    SH      E      +I + +     D N+               Q   E + 
Sbjct  93   VPVL---SHTDKIICEST----QIIDYLEKTFVDANIPKLIPDEGSLYYPRVQHYRELLD  145

Query  534  KIQEWDPKYFTLYHVPVKYR----LYVSKFLRRVIIARMAECPDLASSYHRKLREAYETE  701
             +      +  + H  +        Y +  +R  I    +E   LA   H +LREAY T+
Sbjct  146  SLPMDAYTHGCILHPELTMGSLIPAYATTRIRSQIENTESELKKLAEE-HPELREAYLTK  204

Query  702  EKL--------GNAQVVRQSEEHLVKLLDEVEGKL-----------SEASYLTGEEFSLA  824
            +K          N + +++    L  +LD+VE +L               +L GE FSLA
Sbjct  205  QKQIKSKIRDHDNVKYLKKILTELENVLDQVETELQRRIEETPAEEGHQPWLCGEFFSLA  264

Query  825  DVMLIPILARLQVLNLELEFINT--RPNLFDYWALVKQRPSYKKVIG  959
            DV L   + RL+ L L   +     RPNL  Y+  V QR ++++V+G
Sbjct  265  DVSLAVTVHRLKFLGLARRYWGNGRRPNLESYYERVLQRKTFRRVLG  311



>ref|XP_011098390.1| PREDICTED: glutathione S-transferase F9-like [Sesamum indicum]
Length=215

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 105/230 (46%), Gaps = 34/230 (15%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V   L EK I+Y   HVN   G+N    + ++ P   LPV Q+G + +Y++  II+Y  
Sbjct  15   RVITCLVEKEIEYEVVHVNLFKGENTTPQYLQLQPFGVLPVIQDGDYTLYESRAIIRYY-  73

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK  + G +L     + VE    +++W       +H P+         +  +   + 
Sbjct  74   --AEKYKTQGTEL---LGRTVEERGLVEQWLEVEAHNFHPPLD-----DLVIHVLFDGKK  123

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               PD                      + +++ EE L ++LD  E +LS + YL G+ FS
Sbjct  124  GVTPD---------------------EKRIKEDEEKLARVLDVYEQRLSTSKYLAGDSFS  162

Query  819  LADVMLIPILARLQVLNLELEF-INTRPNLFDYWALVKQRPSYKKVIGRY  965
            LAD+  +P      V +L  E+ I  R ++  +W  +  RPS+KKV+  Y
Sbjct  163  LADLSHLP-FGHYLVTSLGKEYMIRERKHVSRWWDDISNRPSWKKVLHLY  211



>emb|CDX84815.1| BnaA03g14150D [Brassica napus]
Length=215

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/238 (25%), Positives = 111/238 (47%), Gaps = 32/238 (13%)
 Frame = +3

Query  252  HHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiyd  431
            + P    S +  + L EKG+++ + +V+ + G+     +  I+P  K+PV  +G + I++
Sbjct  6    YAPLFASSKRAVVTLVEKGVEFETVNVDLMKGEQRQPEYMAIHPFGKIPVLVDGDYKIFE  65

Query  432  tieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKF  611
            +  I++Y   IAEK  S G DL     + +E   ++++W     T YH P      +   
Sbjct  66   SRAIMRY---IAEKYRSQGPDL---LGKTIEERGQVEQWLDVEATSYHPP------LLAL  113

Query  612  LRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEA  791
               ++ A +   P                     + +V+++SEE L ++LD  E +LS+ 
Sbjct  114  TLNIVFAPLMGFP--------------------ADEKVIKESEEKLGEVLDVYEAQLSKN  153

Query  792  SYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
             YL G+  SLAD+  +P    L     +   I  R ++  +W  +  R ++K+V  +Y
Sbjct  154  EYLAGDFVSLADLAHLPFTEYLVGAIGKGYMIKDRKHVSAWWDKISNRAAWKEVSEKY  211



>ref|XP_002937122.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1 [Xenopus (Silurana) tropicalis]
Length=350

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 77/267 (29%), Positives = 123/267 (46%), Gaps = 29/267 (11%)
 Frame = +3

Query  246  LYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHii  425
            LYH  +S  S KVRL + EK +    H V+    ++ + +F R+NPS ++PV  +G +II
Sbjct  21   LYHWTHSFSSQKVRLVIAEKSLKCEEHDVSLPLSEHNEPWFMRLNPSGEVPVLVHGENII  80

Query  426  ydtieiiqyieR--IAEK----VSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYH----  575
             +  +II Y+E+  I EK    +   G       Q   E +  +      +  + H    
Sbjct  81   CEATQIIDYLEQTFIDEKTPRLIPEEGSMYYPRVQHYRELLDSLPMDAYTHGCILHPELT  140

Query  576  VPVKYRLYVSKFLRRVI------IARMA-ECPDLASSYHRKLREAYETEEKLGNAQVVRQ  734
            V      Y +  +R  I      + ++A E PDL  +Y  K +      +   N + +++
Sbjct  141  VDSMIPAYATSRIRTQIGSTESELKKLAQENPDLEDAYIAKQKRLKTKLQDHDNIKFLKK  200

Query  735  SEEHLVKLLDEVEGKL----------SEASYLTGEEFSLADVMLIPILARLQVLNLELEF  884
              E L K+LD+VE +L             S+L G+ FSLADV L   L RL+ L      
Sbjct  201  ILEELEKVLDQVETELQRRNEETPEEGSESWLCGQFFSLADVSLAVTLHRLRFLGFARRN  260

Query  885  INT--RPNLFDYWALVKQRPSYKKVIG  959
                 RPNL  Y+  + QR ++ +V+G
Sbjct  261  WGNGKRPNLEAYYERILQRKTFNRVLG  287



>gb|KHG21992.1| Glutathione S-transferase F9 -like protein [Gossypium arboreum]
Length=215

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 66/230 (29%), Positives = 114/230 (50%), Gaps = 34/230 (15%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V   L EK I++ +  V+ + G++ D  F ++ P   +PV Q+G +++Y++  II+Y  
Sbjct  15   RVIACLIEKEIEFETVPVDLLKGEHKDPEFLKLQPFGTVPVTQDGDYVLYESRAIIRYY-  73

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK  S G DL     + VE   +++ W       ++ P+ Y L     L  +  ++M
Sbjct  74   --AEKYKSQGTDL---LGKTVEERGQVENWLEVEAHNFNPPI-YALT----LHVMFASKM  123

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               PD                       ++++SEE L K+LD  E +LS+  YL G+ FS
Sbjct  124  GFPPD---------------------ENLIKESEEKLGKVLDIYEERLSKNKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELEF-INTRPNLFDYWALVKQRPSYKKVIGRY  965
            LAD+  +P    L V  +  E+ I +R ++  +W  +  RPS++KV+  Y
Sbjct  163  LADLSHLPFTQYL-VGQMGKEYMITSRKHVSAWWDDISSRPSWQKVLQLY  211



>ref|XP_009628525.1| PREDICTED: glutathione S-transferase-like [Nicotiana tomentosiformis]
Length=234

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 61/230 (27%), Positives = 103/230 (45%), Gaps = 38/230 (17%)
 Frame = +3

Query  276  LKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyi  455
            LKV   L+EK +D+   HVN   G +       +NP  ++P F++G        E     
Sbjct  15   LKVIACLKEKELDFELVHVNLPAGDHKKEPLISLNPFGQVPAFEDGD---LKLFESRAIT  71

Query  456  eRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIAR  635
            + IA   +  G              +K+   DPK   + +V ++     +KF        
Sbjct  72   QYIAHTYADKG--------------NKLLPNDPKEMAIMYVWMEVE--STKF--------  107

Query  636  MAECPDLASSYHRKLREAY---ETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTG  806
              + P    S+   L+  +    T+E       V ++EE L K+LD  E +L E+ YL G
Sbjct  108  --DTPGFNLSFEIALKPLFFGVATDE-----AAVTENEEKLGKVLDVYESRLKESKYLGG  160

Query  807  EEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
            E F+LAD+  IP++  L    ++  F + RP++ D+ A +  RP++ K +
Sbjct  161  ESFTLADLHHIPVVNYLMGTKVKSLF-DCRPHVSDWCADILARPAWSKAL  209



>ref|XP_004971178.1| PREDICTED: glutathione S-transferase 3-like [Setaria italica]
Length=219

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 62/242 (26%), Positives = 106/242 (44%), Gaps = 39/242 (16%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            ++LY  P S + ++V   L EKG+++    V+  TG +    F  +NP  ++P  ++G  
Sbjct  4    LKLYGLPLSPNVVRVATVLNEKGLEFEVVPVDLTTGAHKQPEFLALNPFGQIPALEDGDE  63

Query  420  iiydtieiiqyieRIAEKVSSGGFDL--NVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYR  593
            ++Y++  I +Y   IA K  S G DL   + + ++  W+    E +  +F     P+ Y 
Sbjct  64   VLYESRAINRY---IATKYKSDGADLLPTIPSAKLEVWL----EVESHHFYPNASPLVYH  116

Query  594  LYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVE  773
            L V           M   PD                       VV +    L K+LD  E
Sbjct  117  LLVKPM--------MGGAPD---------------------PLVVDKHAHQLAKVLDIYE  147

Query  774  GKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKV  953
              L++  YL G+EF+LAD   +  L  L     +   +  RP++  +W  +  RP++KK 
Sbjct  148  DHLAKNKYLAGDEFTLADANHMSYLFYLSK-TPKAGLVAERPHVKAWWEDIAARPAFKKT  206

Query  954  IG  959
            + 
Sbjct  207  VA  208



>gb|ADE76600.1| unknown [Picea sitchensis]
Length=214

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 105/244 (43%), Gaps = 38/244 (16%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            +++Y HP S  +  V   L EK ++Y    V    G +    +  +NP   LP  Q+G  
Sbjct  4    IKVYGHPISTATRLVLCCLHEKKVEYDFVLVELSAGAHKQPQYLALNPFGVLPTIQDGD-  62

Query  420  iiydtieiiqyieRIAEKVSSGGFDL---NVSNQQVVEWMHKIQEWDPKYFTLYHVPVKY  590
                  E     + +A+K    G +L   ++S Q +VE      +W       ++ P   
Sbjct  63   --LTLFESRAIAKYLAKKYEGQGTELLGNSLSEQALVE------QWSQVEGQSFNSPA--  112

Query  591  RLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEV  770
                S  L +++   M+                  T+E       V  + E L K+LD  
Sbjct  113  ----STILFQILFVPMS---------------GGSTDEA-----AVEMNVEKLKKVLDIY  148

Query  771  EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKK  950
            E +LS++ YL G+ FSLAD+  +P L  L     + + I++R ++  +W  +  RP++KK
Sbjct  149  EERLSKSKYLAGDFFSLADLQHLPYLDYLVTDCGKGDLISSRKHVKAWWEDISSRPAWKK  208

Query  951  VIGR  962
              G+
Sbjct  209  ATGK  212



>ref|XP_004585882.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1-like 1 isoform X4 [Ochotona princeps]
Length=309

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 76/241 (32%), Positives = 122/241 (51%), Gaps = 34/241 (14%)
 Frame = +3

Query  246  LYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHii  425
            LYH   S  S KVRL + EKG+      V+    ++ + +F R+N   ++PV  +G +II
Sbjct  49   LYHWTQSFSSQKVRLVIAEKGLACEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHGDNII  108

Query  426  ydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVS  605
             D  +II Y     E+  +GG   N +     + M    E +P        P+    Y+S
Sbjct  109  SDYDQIIDY----VERTFTGGHLANAT----TDLMKLDHEEEP--------PLS-EPYLS  151

Query  606  KFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGN-AQVVRQSEEHLVKLLDEVEGKL  782
            K  ++ ++A++ E  D+  SY +K+         LG  A V+ Q E  L K   E EG+ 
Sbjct  152  K--QKKLMAKILEHDDV--SYLKKI---------LGELAMVLDQIEAELEKRKLENEGQK  198

Query  783  SEASYLTGEEFSLADVMLIPILARLQVLNLELEFI--NTRPNLFDYWALVKQRPSYKKVI  956
             E  +L G  F+LADV+L   L RL+ L L  ++    +RPNL  ++  V++R +++KV+
Sbjct  199  CEL-WLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQSFFERVQRRFAFRKVL  257

Query  957  G  959
            G
Sbjct  258  G  258



>ref|XP_010272271.1| PREDICTED: glutathione S-transferase F10-like [Nelumbo nucifera]
Length=211

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 64/240 (27%), Positives = 112/240 (47%), Gaps = 32/240 (13%)
 Frame = +3

Query  237  IMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS  416
            +++++   Y+  S +V   L EK I++    V+ + G+     F  + P   +PV Q+G 
Sbjct  2    VVKVHGPAYASCSRRVLACLVEKEIEFDIVPVDLLKGEQKSPEFLELQPFGVVPVIQDGD  61

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRL  596
            + +Y++  II++    AEK  + G DL     + VE    +++W       YH P+ Y L
Sbjct  62   YTLYESRAIIRFY---AEKYRTQGTDL---LGKTVEERGVVEQWLEVEGQNYHPPI-YTL  114

Query  597  YVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEG  776
             V                     +H KL           + ++V++ EE L K+LD  E 
Sbjct  115  VVQLL------------------FHPKLGLPV-------DQKIVQECEEKLGKVLDVYEE  149

Query  777  KLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
            +LS++ YL G+ FSLAD+  +P    L     +   +  R ++  +W  +  RPS+KKV+
Sbjct  150  RLSKSKYLAGDFFSLADLTHLPFTHYLVNDIGKEHLVRDRKHVSAWWDDISSRPSWKKVL  209



>ref|WP_033335810.1| glutathione S-transferase, partial [Scytonema hofmanni]
Length=95

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVF  404
            ++LYH P SL S KVRLAL EKGI++ SH VN +T +NL   + RINP A +P  
Sbjct  4    LELYHFPDSLCSQKVRLALAEKGIEWKSHIVNLLTFENLKPDYVRINPKAVVPTL  58



>gb|KDR11132.1| Ganglioside-induced differentiation-associated protein 1 [Zootermopsis 
nevadensis]
Length=328

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 67/271 (25%), Positives = 120/271 (44%), Gaps = 40/271 (15%)
 Frame = +3

Query  246  LYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHii  425
            LYHH YS  S KV +AL EK + +  H +N   G+    +F RINP  ++PV ++G   +
Sbjct  25   LYHHHYSFYSQKVIMALHEKKLPFKEHIINLTKGEQYQPWFLRINPRGEVPVLKDG---V  81

Query  426  ydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVS  605
                +  + ++ + +  S+G     +   Q  E   K+ ++      + H+P       S
Sbjct  82   KVIPDSGRILDYLEDNFSNGDTPRLMPLDQGPEIRQKVLQF---RTVIDHIPAGTVTMGS  138

Query  606  KF---------------LRRVIIARMAECPDLASSYHRK---LREAYETEEKLGNAQVVR  731
             F               +R+ ++A      ++   +  +   ++E    + K    + V 
Sbjct  139  FFHPEFCQNPKQPFIQPVRKSLMAAENNSANILRMHAERNPDIQEILLQKAKFQETKHVS  198

Query  732  QSE-EHLVKLLDEVEGKLSEAS-------------YLTGEEFSLADVMLIPILARLQVLN  869
             ++ E   K+L++V+  LSE               +L  + F++AD+ L  +L RL  L 
Sbjct  199  VTDKEEFKKILNQVDLVLSEVEKELESHKEDQKNWWLCSDRFTVADIGLAILLDRLNRLG  258

Query  870  LELEF--INTRPNLFDYWALVKQRPSYKKVI  956
            LE  F     +P++  Y+  V+QR SYKK I
Sbjct  259  LERYFWEDGKKPHISQYYHRVQQRDSYKKTI  289



>gb|AFK48087.1| unknown [Lotus japonicus]
Length=215

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 109/229 (48%), Gaps = 32/229 (14%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK + + +  ++   G+N +  + ++ P  KLPV Q+G + +Y++  II+Y  
Sbjct  15   RVLVCLIEKAVQFETVPLDLFKGENKEPEYLKLQPFGKLPVIQDGDYTLYESRAIIRYY-  73

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK  + G +L     + VE    +++W       +H P      V   + +V+ A +
Sbjct  74   --AEKYRNQGTEL---LGKTVEERGLVEQWLEVEAHNFHPP------VLDLVLQVLFAPL  122

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               P                     + +++ +S+E + K+LD  E +LS++ YL G+ FS
Sbjct  123  RGLP--------------------SDQKLIEESDEKVQKVLDIYEDRLSKSKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
            LAD+  +P    L        F+  R ++  +W  +  RPS++KV+  Y
Sbjct  163  LADLSHLPFGHYLVNQTGRGNFVRERKHVSAWWDDISSRPSWQKVLQLY  211



>ref|XP_006435273.1| hypothetical protein CICLE_v10002119mg [Citrus clementina]
 gb|ESR48513.1| hypothetical protein CICLE_v10002119mg [Citrus clementina]
Length=278

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 56/243 (23%), Positives = 103/243 (42%), Gaps = 39/243 (16%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS-  416
            +++Y  P S    +V   L EK +++    +N   G +    F +I P  ++P FQ+   
Sbjct  62   VKVYGPPLSTAVCRVVACLLEKDVEFQLISLNMAKGDHKKPDFLKIQPFGQVPAFQDEKI  121

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLN-VSNQQVVEWMH-KIQEWDPKYFTL-YHVPVK  587
             +           E   EK + G F  N ++   + +W+  + Q ++P    L + + + 
Sbjct  122  SLFESRAICRYVCENYPEKGNKGLFGTNPLAKASIDQWLEAEGQSFNPPSSALVFQLALA  181

Query  588  YRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDE  767
             R+ + +                                   +  V++Q+EE L K+LD 
Sbjct  182  PRMNIKQ-----------------------------------DEGVIKQNEEKLAKVLDV  206

Query  768  VEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYK  947
             E +L E+ +L G+EFSLAD+  +P    L       E + +R N+  +W  +  R S+K
Sbjct  207  YEKRLGESRFLAGDEFSLADLSHLPNAHYLVNATDRGEILTSRDNVGRWWGEISNRDSWK  266

Query  948  KVI  956
            KV+
Sbjct  267  KVV  269



>emb|CAN69111.1| hypothetical protein VITISV_031837 [Vitis vinifera]
 emb|CBI18904.3| unnamed protein product [Vitis vinifera]
Length=223

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 59/246 (24%), Positives = 103/246 (42%), Gaps = 45/246 (18%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            +++Y  P S    +V   L EK +++    V+   G++    + +I P  ++P FQ+ S 
Sbjct  5    VKVYGPPMSTAVSRVLACLLEKDVNFQLIPVDMSKGEHKKPDYLKIQPFGQVPSFQDES-  63

Query  420  iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
                  E       ++EK ++ G                                  RLY
Sbjct  64   --ISLFESRAICRYVSEKYANQG--------------------------------NKRLY  89

Query  600  VSKFLRRVIIARMAEC-------PDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKL  758
             +  L +  I +  E        P  A  +        + ++ LG   V++QSEE L K+
Sbjct  90   GTNPLEKASIEQWLEAEGQSFNPPSSALVFQLAFAPRMKLKQDLG---VIKQSEEKLAKV  146

Query  759  LDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRP  938
            LD  E +L E+ +L G+EF+LAD+  +P    L  +  + E    R N+  +W+ +  R 
Sbjct  147  LDVYEQRLGESRFLAGDEFTLADLSHLPNTQYLVSVTEKGEMFTKRKNVGRWWSEISGRD  206

Query  939  SYKKVI  956
            S+KKV+
Sbjct  207  SWKKVV  212



>ref|XP_008451606.1| PREDICTED: glutathione S-transferase-like [Cucumis melo]
Length=215

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 66/245 (27%), Positives = 109/245 (44%), Gaps = 44/245 (18%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            ++++  P S  + +V  AL EKG+ +   +V    G++    F  +NP  ++P FQ+G  
Sbjct  5    IKVHGIPTSTATGRVLAALYEKGLQFELVNVKLHEGEHKREPFLSLNPFGQVPAFQDGD-  63

Query  420  iiydtieiiqyieRIAEKVSSGGFDLNVSNQQ----VVEWMHKIQEWDPKYFTLYHVPVK  587
               +  E     + I+   +S G  L   + +    V+ W+    E +  +F     PV 
Sbjct  64   --LNLFESRAITQYISGNYASNGTQLIPQDPKKAAVVLTWI----EVESHHFD----PVA  113

Query  588  YRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQ--VVRQSEEHLVKLL  761
             +L     L+ V                             G+A   VV QSE  L K+L
Sbjct  114  MKLVFELCLKPVF--------------------------GWGDADPAVVAQSETELGKVL  147

Query  762  DEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPS  941
            D  E +LSE+ YL GE FSLAD+  +P+L  L     + +   +RP++  + A +  RPS
Sbjct  148  DIYEKRLSESKYLGGESFSLADLHHLPVLGYLLATQSK-KLFESRPHVNAWVADIIARPS  206

Query  942  YKKVI  956
            + KV+
Sbjct  207  WAKVL  211



>ref|XP_002734706.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1-like [Saccoglossus kowalevskii]
Length=290

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 117/272 (43%), Gaps = 38/272 (14%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            + LY    S  S++V +AL EKGI+Y    +N    +NL+ ++ ++NP+ K+P   +G  
Sbjct  7    LTLYVAGASYYSVRVEVALAEKGINYDRCTINGFICENLEPWYMKMNPTGKVPTLMHGDK  66

Query  420  -iiydtieiiqyieRIAEKVSSGGFDLNVSNQQ-VVEWMHKIQEWDPKYF--TLYHVPVK  587
             +      +    +   E VS     L    Q  + + + + +E    YF  TL     K
Sbjct  67   PVCGSAAILKYLDDEFPETVS-----LYPDKQSPLYDQIKQFEELVDSYFLGTLVGGCYK  121

Query  588  YRLYVSKF--------------LRRVIIARMAEC----PDLASSYHRKLREAYETEEKLG  713
            Y  YV KF                ++I +R AE     P+L   Y RK     E +    
Sbjct  122  YPKYVPKFGLWDHNCCKNIWMVGHKIIPSRAAENARKHPELTELYERKKDNIVEYDP---  178

Query  714  NAQVVRQSEEHLVKLLDEVEGKLSEAS-------YLTGEEFSLADVMLIPILARLQVLNL  872
              +V +   E +  ++D  E K  + +       Y   + FS AD+ L+  L ++  +  
Sbjct  179  TEEVFKDVLEKVKNIVDTAEEKFQDRADKGEKVEYFMTDNFSSADIYLVVFLKKVGAIGF  238

Query  873  ELEFINTR-PNLFDYWALVKQRPSYKKVIGRY  965
               + + + P + +Y+  +KQRPS K+V   Y
Sbjct  239  SSYWEDGKHPFVTEYFKRLKQRPSVKEVFKVY  270



>emb|CDY23979.1| BnaC03g17120D [Brassica napus]
Length=215

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 110/238 (46%), Gaps = 32/238 (13%)
 Frame = +3

Query  252  HHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiyd  431
            + P    S +  + L EKG+++ + +V+ + G+     +  I P  K+PV  +G + I++
Sbjct  6    YAPLFASSKRAVVTLVEKGVEFETVNVDLMKGEQRQPEYMAIQPFGKIPVLVDGDYKIFE  65

Query  432  tieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKF  611
            +  I++Y   IAEK  S G DL     + +E   ++++W     T YH P      +   
Sbjct  66   SRAIMRY---IAEKYRSQGPDL---LGKTIEERGQVEQWLDVEATSYHPP------LLAL  113

Query  612  LRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEA  791
               ++ A +   P                     + +V+++SEE L ++LD  + +LS+ 
Sbjct  114  TLNIVFAPLMGFP--------------------ADEKVIKESEEKLGEVLDVYDAQLSKN  153

Query  792  SYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
             YL G+  SLAD+  +P    L     +   I  R ++  +W  +  R ++K+V  +Y
Sbjct  154  EYLAGDFVSLADLAHLPFTEYLVGAIGKGYMIKDRKHVSAWWDKISNRAAWKEVSEKY  211



>gb|EYU33954.1| hypothetical protein MIMGU_mgv1a013692mg [Erythranthe guttata]
Length=213

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 57/240 (24%), Positives = 112/240 (47%), Gaps = 32/240 (13%)
 Frame = +3

Query  237  IMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS  416
            +++++   Y     +V   L E G+++    ++ ++G++    F    P  ++P  ++G 
Sbjct  2    VVKVFGPAYGACPQRVLTCLVELGLEFELIPIDILSGQHKKPDFLLRQPFGQVPAIEDGD  61

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRL  596
              ++++  II+Y    A+    GG +L     + +E    + +W       Y+      L
Sbjct  62   FRLFESRAIIRYYA--AKCARDGGVNLY---GKTLEERALVDQWLEVEVNNYN-----SL  111

Query  597  YVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEG  776
              +  L+ +++ RM +  DL                     ++VR  +  L K+LD  E 
Sbjct  112  IYTMVLQLLVLPRMGQGTDL---------------------ELVRDCKGKLEKVLDVYEE  150

Query  777  KLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
            +LS++ YL GEEF++ADV  +P    L    +E + I  R N++ +W  +  RPS+KKV+
Sbjct  151  RLSKSKYLAGEEFTIADVSHLPNTRFLMEEGME-DLIKGRKNVYAWWIDISSRPSWKKVM  209



>gb|KDP28123.1| hypothetical protein JCGZ_13894 [Jatropha curcas]
Length=217

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 102/241 (42%), Gaps = 38/241 (16%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            ++LY    S  +  V   L EK +D+    V+   G++    F   NP  ++PV ++G  
Sbjct  3    LKLYGAAMSTSTSLVLTCLHEKEVDFEFIPVDLFAGEHKQPHFGAKNPFGQVPVLEDGD-  61

Query  420  iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEW---DPKYFTLYHVPVKY  590
                  E       I EK    G+DL  +  + +E    ++ W   + + +     P+ Y
Sbjct  62   --LTLFESRAITAYITEKYKEPGYDL--TRHKKLEEAAMVKVWIEVESQRYNPAIAPIVY  117

Query  591  RLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEV  770
            +LYV   L+ V        PD A                     ++  + E L K+LD  
Sbjct  118  QLYVGP-LKGV-------APDEA---------------------IIDTNIEKLRKVLDIY  148

Query  771  EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKK  950
            E +LS + YL G+ FSLAD+  +P    L   +     IN RP +  +W  +  RP++KK
Sbjct  149  EERLSCSKYLAGDFFSLADLHHLPYTYYLMKTSAA-SVINERPRVKAWWDDISSRPAFKK  207

Query  951  V  953
            V
Sbjct  208  V  208



>ref|XP_008229575.1| PREDICTED: glutathione S-transferase F9-like [Prunus mume]
Length=214

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 116/240 (48%), Gaps = 33/240 (14%)
 Frame = +3

Query  237  IMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS  416
            ++++Y   Y+    +V + L EK +D+ +  ++ + G++    F ++ P   +P+ Q+G 
Sbjct  2    VVKVYGAAYA-SPKRVLVCLVEKEVDFETIPIDLLKGEHKHPEFLKLQPFGTVPLIQDGD  60

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRL  596
            + +Y++  II+Y    AEK  S G  L     + +E    +++W       +H P+ Y L
Sbjct  61   YTLYESRAIIRYY---AEKYKSQGTAL---LGKTIEERGLVEQWLEVEAHNFHPPL-YNL  113

Query  597  YVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEG  776
             +      ++ A     P                     + +V+++SEE L K+LD  E 
Sbjct  114  VL-----HILFASALGFPS--------------------DPKVIQESEEKLGKVLDIYEE  148

Query  777  KLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
            +LS++ YL G+ FSLAD+  +P    L  +  +   I  R ++  +W  +  RPS+KKV+
Sbjct  149  RLSKSKYLAGDFFSLADLSHLPFTQYLVTILGKEYLIKDRKHVSAWWNDISNRPSWKKVL  208



>ref|XP_007146198.1| hypothetical protein PHAVU_006G020800g [Phaseolus vulgaris]
 gb|ESW18192.1| hypothetical protein PHAVU_006G020800g [Phaseolus vulgaris]
Length=240

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 110/229 (48%), Gaps = 32/229 (14%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK I++ +  V+   G++ +  F ++ P   +PV Q+G + +Y++  II+Y  
Sbjct  40   RVLVCLIEKEIEFETVDVDLFKGEHKEPEFLKLQPFGSVPVIQDGDYTLYESRAIIRY--  97

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
             +AEK    G +L     + +E    +++W       +H P+ Y L ++     ++ A +
Sbjct  98   -LAEKYKEQGTEL---LGKTIEEKGLVEQWLEVEAHNFHPPL-YNLVIN-----ILFAPL  147

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               P                     + +V+ +S++ L K+LD  E +LS + YL G+ FS
Sbjct  148  MGAP--------------------SDQKVIEESDKKLEKVLDVYEERLSNSKYLAGDFFS  187

Query  819  LADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
            LAD+  +P    L         +  R ++  +W  +  RPS+KKV+ +Y
Sbjct  188  LADLSHLPFGHYLVNQTGRGNLVRERKHVNAWWDDISNRPSWKKVLQQY  236



>ref|XP_011079699.1| PREDICTED: glutathione S-transferase-like [Sesamum indicum]
Length=214

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 105/240 (44%), Gaps = 33/240 (14%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            ++++ +  S   ++V   L EKG++Y    V+   G++    F  +NP  ++P F++G  
Sbjct  3    IKVHGNAISTAVMRVFACLNEKGLEYEFVPVDMRAGEHKKEPFLSLNPFGQVPAFEDGD-  61

Query  420  iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
                  E     + IA   +  G  L   + +    M  +  W       Y VP      
Sbjct  62   --LKLFESRAVNQYIAHAYADKGNPLICQDPKK---MAIVSLWMEVEAQKYDVPA-----  111

Query  600  VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
             +K +R  II      P L  S                +  +V + E  L K+LD  E +
Sbjct  112  -AKLVREFIIK-----PLLGMST---------------DDAIVEEQEVQLAKVLDVYEAR  150

Query  780  LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIG  959
            L+++ YL G+ FSLAD+  +P +  L    ++  F + RP++  + A +  RP+++KV+ 
Sbjct  151  LAQSKYLGGDSFSLADLHHLPTMNYLMGTRIKAVF-DARPHVSSWCADIMGRPAWQKVVA  209



>ref|XP_011098399.1| PREDICTED: glutathione S-transferase F9-like [Sesamum indicum]
Length=215

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 102/228 (45%), Gaps = 50/228 (22%)
 Frame = +3

Query  300  EKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyieRIAEKVS  479
            EK I+Y   H++   G+N    +  + P   LPV Q+G + +Y++  II+Y    AEK  
Sbjct  22   EKEIEYDVVHIDLFKGENTTPHYLNLQPFGALPVIQDGDYTLYESRAIIRYY---AEKYK  78

Query  480  SGGFDL---NVSNQQVVE-WM----HKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIAR  635
            S G +L    V  + +VE W+    H  Q   P Y  + HV              +   +
Sbjct  79   SQGTELLGRTVEERGLVEQWLEVEAHNFQP--PLYDLVIHV--------------LFDGK  122

Query  636  MAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEF  815
                PD                      + +++ EE L ++LD  E +LS + YL G+ F
Sbjct  123  EGVIPD---------------------EKRIKEDEEKLARVLDVYEQRLSTSKYLAGDSF  161

Query  816  SLADVMLIPILARLQVLNLELEF-INTRPNLFDYWALVKQRPSYKKVI  956
            SLAD+  +P      V +L  E+ I  R ++  +W  +  RPS+KKV+
Sbjct  162  SLADLSHLP-FGHYLVTSLGREYMIRDRKHVSRWWDDISSRPSWKKVL  208



>gb|ABI79308.1| glutathione S-transferase [Pyrus communis]
Length=204

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 106/229 (46%), Gaps = 32/229 (14%)
 Frame = +3

Query  258  PYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydti  437
            P+     +V + L EK I++ +  ++   G++    F ++ P  ++PV Q+G + +Y++ 
Sbjct  8    PFYASPKRVLVCLVEKEIEFETSPIDLFKGEHKSPEFLKLQPFGQVPVIQDGDYTLYESR  67

Query  438  eiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLR  617
             II+Y    AEK  S G DL     + +E    +++W     + YH P+         + 
Sbjct  68   AIIRYY---AEKYKSQGTDLL---GKTIEERGLVEQWLEVEASNYHPPL------DNLVM  115

Query  618  RVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASY  797
             ++ A     P                     + +++++SEE L K+LD  E +LS++ Y
Sbjct  116  HILFASALGFP--------------------SDPKIIQESEEKLGKVLDIYEERLSKSKY  155

Query  798  LTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSY  944
            L G+ FSLAD+  +P    L     +   I  R ++  +W  +  RP++
Sbjct  156  LAGDFFSLADLSHLPFTHYLANSMGKEYMIRDRKHVSAWWDDISSRPAW  204



>emb|CDQ72002.1| unnamed protein product [Oncorhynchus mykiss]
Length=367

 Score = 61.6 bits (148),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 67/273 (25%), Positives = 122/273 (45%), Gaps = 29/273 (11%)
 Frame = +3

Query  228  ADDIMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQ  407
            + D + LYH   S  S KVRL + EKG+      V+    ++ + +F R+N   ++PVF 
Sbjct  44   SKDKLVLYHWTQSFISQKVRLVINEKGLLCDERDVSLPIAEHNEPWFMRLNLGEEVPVFI  103

Query  408  NGS------HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTL  569
            +G       + I   +E     E +A+ +   G  ++   QQ  + +  +      +  +
Sbjct  104  HGDTIVSDYNQIIQYLEANFGGETVAQLIPDAGSPVHECVQQYRKLLDGLPMDAYTHGCI  163

Query  570  YHVPVKYRLYVSKF----LRRVIIARMAEC-------PDLASSYHRKLREAYETEEKLGN  716
             H  +     + K+    +RR +    +E        P L   Y  K ++         N
Sbjct  164  LHPELTTDSMIPKYATAEIRRHLANAASELMKLDHEEPTLTEPYLSKQKKLMAKILDHDN  223

Query  717  AQVVRQSEEHLVKLLDEVEGKLSEAS----------YLTGEEFSLADVMLIPILARLQVL  866
               +++    L  +LD+VE +L +            +L G EF+LADV L  +L RL+ L
Sbjct  224  VTYLKKILGELAMVLDQVEAELEKRKIEYEGQKCELWLCGPEFTLADVCLGALLHRLKFL  283

Query  867  NLELEFI--NTRPNLFDYWALVKQRPSYKKVIG  959
             L  ++    +RPNL  ++  V++R +++KV+G
Sbjct  284  GLSKKYWEDGSRPNLQSFFERVQKRYAFRKVLG  316



>dbj|BAM14585.1| putative glutathione S-transferase [Cyclamen persicum x Cyclamen 
purpurascens]
Length=221

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 59/239 (25%), Positives = 100/239 (42%), Gaps = 31/239 (13%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            +++Y  P S    +V   L EK + +   +V+    ++    F +I P  ++P FQ+ S 
Sbjct  5    VKVYGTPLSTAVSRVLACLLEKDVPFQLINVDMAKAEHKKPDFLKIQPFGQVPAFQDES-  63

Query  420  iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
                  E       I EK  + G + N+     +E    I +W       ++ P    ++
Sbjct  64   --ISLFESRAICRYIVEKYQNQG-NKNLYGTNPLE-KASIDQWLEAEGQSFNPPSSALVF  119

Query  600  VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
               F  R+ I +                          +  ++RQSE  L+K+LD  E +
Sbjct  120  QLAFAPRMKIKQ--------------------------DEALIRQSEAKLLKVLDVYEKR  153

Query  780  LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
            L E  YL G+EFSLAD+  +P    L     + E   +R N+  +W  +  R S+KKV+
Sbjct  154  LGETRYLAGDEFSLADLSHLPNGDYLVNGTTKEEMFTSRENVGRWWGEISGRESWKKVV  212



>ref|XP_007464827.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1-like 1 isoform X5 [Lipotes vexillifer]
Length=309

 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 122/241 (51%), Gaps = 34/241 (14%)
 Frame = +3

Query  246  LYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHii  425
            LYH   S  S KVRL + EKG+      V+    ++ + +F R+N   ++PV  +  +II
Sbjct  49   LYHWTQSFSSQKVRLVIAEKGLACEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNII  108

Query  426  ydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVS  605
             D  +II Y     E+  +GG   N +    +++M    E +P+             Y+S
Sbjct  109  SDYDQIIDY----VERTFTGGHLANAT----MDFMKLDHEEEPQL---------SEPYLS  151

Query  606  KFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGN-AQVVRQSEEHLVKLLDEVEGKL  782
            K  ++ ++A++ E  D+  SY +K+         LG  A V+ Q E  L K   E EG+ 
Sbjct  152  K--QKKLMAKILEHDDV--SYLKKM---------LGELAMVLDQIEAELEKRKLENEGQK  198

Query  783  SEASYLTGEEFSLADVMLIPILARLQVLNLELEFI--NTRPNLFDYWALVKQRPSYKKVI  956
             E  +L G  F+LADV+L   L RL+ L L  ++    +RPNL  ++  V++R +++KV+
Sbjct  199  CEL-WLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQSFFERVQKRFAFRKVL  257

Query  957  G  959
            G
Sbjct  258  G  258



>ref|XP_004858252.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1-like 1 isoform X3 [Heterocephalus glaber]
Length=309

 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 120/241 (50%), Gaps = 34/241 (14%)
 Frame = +3

Query  246  LYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHii  425
            LYH   S  S KVRL + EKG+      V+    ++ + +F R+N   ++PV  +  +II
Sbjct  49   LYHWTQSFSSQKVRLVIAEKGLACEEQDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNII  108

Query  426  ydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVS  605
             D  +II Y     E+  +GG   N +     + M    E +P+             Y+S
Sbjct  109  SDYAQIIDY----VERTFTGGHLANAT----TDLMKLDHEEEPQL---------SEPYLS  151

Query  606  KFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGN-AQVVRQSEEHLVKLLDEVEGKL  782
            K  ++ ++A++ E  D+  SY +K+         LG  A V+ Q E  L K   E EGK 
Sbjct  152  K--QKKLMAKILEHDDV--SYLKKI---------LGELAMVLDQIEAELEKRKLENEGKK  198

Query  783  SEASYLTGEEFSLADVMLIPILARLQVLNLELEFI--NTRPNLFDYWALVKQRPSYKKVI  956
             E  +L G  F+LADV+L   L RL+ L L  ++    +RPNL  ++  V++R +++KV+
Sbjct  199  CEL-WLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQSFFERVQRRFAFRKVL  257

Query  957  G  959
            G
Sbjct  258  G  258



>ref|XP_010069962.1| PREDICTED: glutathione S-transferase-like [Eucalyptus grandis]
 gb|KCW58491.1| hypothetical protein EUGRSUZ_H01166 [Eucalyptus grandis]
Length=213

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 57/245 (23%), Positives = 106/245 (43%), Gaps = 42/245 (17%)
 Frame = +3

Query  237  IMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS  416
            +M++Y    S  ++++  AL EK +++    ++   G++    F  +NP  ++P F++G 
Sbjct  2    VMKVYGTVLSTATMRIFAALYEKDLEFEFVPIDMPAGEHKKEHFLALNPFGQVPAFEDGD  61

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVE---WMH-KIQEWDPKYFTLYHVPV  584
                   E     + IA   +  G  L    + +     WM  + Q+++P          
Sbjct  62   ---LKLFESRAVTQHIAHVFADEGTPLICEGKSMATVGVWMEVEAQQFEP----------  108

Query  585  KYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLD  764
                 ++  LRR               +  K R    T     +A VV +SE  L K+LD
Sbjct  109  -----LALKLRR--------------EFLYKPRSGVAT-----DAAVVEESEAKLAKVLD  144

Query  765  EVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSY  944
              E +LS++ YL  + F+LAD+  +P +  L    +  +  + RP L  + A +  RP++
Sbjct  145  VYEARLSQSKYLGCDCFTLADLHPLPTMTTLMGTPVR-KLFDARPKLSAWLADISARPAW  203

Query  945  KKVIG  959
             KV+ 
Sbjct  204  AKVLA  208



>ref|XP_007035561.1| Phi class glutathione transferase GSTF7 [Theobroma cacao]
 gb|EOY06487.1| Phi class glutathione transferase GSTF7 [Theobroma cacao]
Length=214

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 103/241 (43%), Gaps = 36/241 (15%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVR--LALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNG  413
            M +  H Y++ +   R  L L EKG++Y    V+   G +    +  +NP  ++P F++G
Sbjct  1    MSIKVHGYAMSTCTARVLLCLSEKGLEYEVVPVDVANGAHKQQPYLSLNPFGQIPAFEDG  60

Query  414  SHiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYR  593
                    E     + +A K    G DL  S+   V  +  +  W       ++ P+   
Sbjct  61   D---VKIFESRAISKYLARKYKDTGIDLLGSSSLTVSTI--VDTWMEVESHQFNSPM---  112

Query  594  LYVSKFLRRVIIARMAECPDLASSYHRKLREAYETE-EKLGNAQVVRQSEEHLVKLLDEV  770
                    + II +M   P    +   K+    ETE EKLG             K+LD  
Sbjct  113  --------QAIIRQMIVNPIFGIATDEKI---IETELEKLG-------------KVLDVY  148

Query  771  EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKK  950
            E +LS+  YL G+ +SLAD+  IP L    +   +   I +RP++  +W  +  RP+  K
Sbjct  149  EERLSKCKYLGGDFYSLADLHHIPYLVYF-MRTPKSSVITSRPHVSAWWNDISSRPATVK  207

Query  951  V  953
            V
Sbjct  208  V  208



>gb|KDO84983.1| hypothetical protein CISIN_1g027634mg [Citrus sinensis]
Length=170

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +3

Query  723  VVRQSEEHLVKLLDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPN  902
            V++Q+EE L K+LD  E +L E+ +L G+EFSLAD+  +P    L       E + +R N
Sbjct  84   VIKQNEEKLAKVLDVYEKRLGESRFLAGDEFSLADLSHLPNAHYLVNATDRGEILTSRDN  143

Query  903  LFDYWALVKQRPSYKKVI  956
            +  +W  +  R S+KKV+
Sbjct  144  VGRWWGEISNRDSWKKVV  161



>ref|XP_004612542.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1-like 1 isoform X4 [Sorex araneus]
Length=333

 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 121/241 (50%), Gaps = 34/241 (14%)
 Frame = +3

Query  246  LYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHii  425
            LYH   S  S KVRL + EKG+      V+    ++ + +F R+N   ++PV  +  +II
Sbjct  73   LYHWTQSFSSQKVRLVIAEKGLACEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNII  132

Query  426  ydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVS  605
             D  +II Y     E+  +GG   N +     + M    E +P++            Y+S
Sbjct  133  SDYDQIIDY----VERTFTGGHLANAT----TDLMKLDHEEEPQF---------SEPYLS  175

Query  606  KFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGN-AQVVRQSEEHLVKLLDEVEGKL  782
            K  ++ ++A++ E  D+  SY +K+         LG  A V+ Q E  L K   E EG+ 
Sbjct  176  K--QKKLMAKILEHDDV--SYLKKI---------LGELAMVLDQIEAELEKRKLENEGQK  222

Query  783  SEASYLTGEEFSLADVMLIPILARLQVLNLELEFI--NTRPNLFDYWALVKQRPSYKKVI  956
             E  +L G  F+LADV+L   L RL+ L L  ++    +RPNL  ++  V++R +++KV+
Sbjct  223  CEL-WLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQSFFERVQKRFAFRKVL  281

Query  957  G  959
            G
Sbjct  282  G  282



>ref|XP_005002835.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1-like 1 isoform X3 [Cavia porcellus]
Length=309

 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 120/241 (50%), Gaps = 34/241 (14%)
 Frame = +3

Query  246  LYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHii  425
            LYH   S  S KVRL + EKG+      V+    ++ + +F R+N   ++PV  +  +II
Sbjct  49   LYHWTQSFSSQKVRLVIAEKGLACEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNII  108

Query  426  ydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVS  605
             D  +II Y     E+  +GG   N +     + M    E +P+             Y+S
Sbjct  109  SDYDQIIDY----VERTFTGGHLANAT----TDLMKLDHEEEPQL---------SEPYLS  151

Query  606  KFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGN-AQVVRQSEEHLVKLLDEVEGKL  782
            K  ++ ++A++ E  D+  SY +K+         LG  A V+ Q E  L K   E EGK 
Sbjct  152  K--QKKLMAKILEHDDV--SYLKKI---------LGELAMVLDQIEAELEKRKLENEGKK  198

Query  783  SEASYLTGEEFSLADVMLIPILARLQVLNLELEFI--NTRPNLFDYWALVKQRPSYKKVI  956
             E  +L G  F+LADV+L   L RL+ L L  ++    +RPNL  ++  V++R +++KV+
Sbjct  199  CEL-WLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQSFFERVQRRFAFRKVL  257

Query  957  G  959
            G
Sbjct  258  G  258



>ref|XP_007017931.1| Ubiquitin-like superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY15156.1| Ubiquitin-like superfamily protein isoform 3 [Theobroma cacao]
Length=237

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 57/242 (24%), Positives = 114/242 (47%), Gaps = 37/242 (15%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            +++Y  P S    +V   L EK + +    VN   G++    F +I P  ++P FQ+ S 
Sbjct  23   VKVYGPPMSTAVSRVLACLLEKDVQFQLIPVNMFKGEHKSPDFLKIQPFGQVPAFQDEST  82

Query  420  iiydtieiiq-yieRIAEKVSSGGFDLN-VSNQQVVEWMH-KIQEWDPKYFTLYHVPVKY  590
             ++++  I +   E+ AEK ++G +  N ++   + +W+  + Q ++P            
Sbjct  83   SLFESRSICRYLCEKYAEKGNTGLYGTNPLAKASIDQWLEAEGQSFNPP-----------  131

Query  591  RLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEV  770
                      V++ ++A  P +      K+++         +  V+ ++E+ L K+L+  
Sbjct  132  --------SSVLVFQLAFAPRM------KIKQ---------DQAVINENEQKLAKVLEVY  168

Query  771  EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKK  950
            E +L E+ +L G+EFSLAD+  +P    L   +   E    + N+  +W  +  R S+KK
Sbjct  169  EKRLGESRFLAGDEFSLADLSHLPNTHYLVNASDRGELFTFKKNVGRWWGEISSRDSWKK  228

Query  951  VI  956
            V+
Sbjct  229  VV  230



>ref|XP_004630982.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1-like 1 isoform X3 [Octodon degus]
Length=309

 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 120/241 (50%), Gaps = 34/241 (14%)
 Frame = +3

Query  246  LYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHii  425
            LYH   S  S KVRL + EKG+      V+    ++ + +F R+N   ++PV  +  +II
Sbjct  49   LYHWTQSFSSQKVRLVIAEKGLACEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNII  108

Query  426  ydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVS  605
             D  +II Y     E+  +GG   N +     + M    E +P+             Y+S
Sbjct  109  SDYDQIIDY----VERTFTGGHLANAT----TDLMKLDHEEEPQL---------SEPYLS  151

Query  606  KFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGN-AQVVRQSEEHLVKLLDEVEGKL  782
            K  ++ ++A++ E  D+  SY +K+         LG  A V+ Q E  L K   E EGK 
Sbjct  152  K--QKKLMAKILEHDDV--SYLKKI---------LGELAMVLDQIEAELEKRKLENEGKK  198

Query  783  SEASYLTGEEFSLADVMLIPILARLQVLNLELEFI--NTRPNLFDYWALVKQRPSYKKVI  956
             E  +L G  F+LADV+L   L RL+ L L  ++    +RPNL  ++  V++R +++KV+
Sbjct  199  CEL-WLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQSFFERVQRRFAFRKVL  257

Query  957  G  959
            G
Sbjct  258  G  258



>ref|WP_011042500.1| glutathione S-transferase [Colwellia psychrerythraea]
 ref|YP_268406.1| glutathione S-transferase [Colwellia psychrerythraea 34H]
 gb|AAZ24590.1| glutathione S-transferase family protein [Colwellia psychrerythraea 
34H]
Length=255

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 60/243 (25%), Positives = 124/243 (51%), Gaps = 15/243 (6%)
 Frame = +3

Query  246  LYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGK-NLDTFFFRINPSAKLPV--FQNGS  416
            LYHHP S+ S+KVRLALEEKG+ ++   ++ +  +  L+ ++ ++NP   +P   F+NG+
Sbjct  6    LYHHPLSVCSMKVRLALEEKGLAWSGRVIDIVQKQEQLEPWYLKLNPKGVIPTVEFRNGT  65

Query  417  HiiydtieiiqyieRIAEKVSSGGFDL--NVSNQQVVEWMHKI-QEWDPKYFTLYHVPV-  584
                  +    +I R    +S G   L  + S++ +++ +  +  + D    +    P  
Sbjct  66   ---TKVLTDSAHIIRAIASLSEGNALLPKDESDRPLMDQLIDLADDIDLHILSYARHPSM  122

Query  585  -KYRLYVSKFLRRVIIARMAEC-PDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKL  758
             K    +++ +++ ++  M+E  P L+++Y      + +T++   + Q +   E + ++ 
Sbjct  123  EKSEEILNERIQKTLL--MSEKHPKLSANYVVCANRSEKTKKFRVDKQYIETVENNALEA  180

Query  759  LDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFI-NTRPNLFDYWALVKQR  935
            +  VE +L +  +L G  +++ADV+    L+R  +L        N  P L  Y+  ++QR
Sbjct  181  IIFVEKQLQDNDFLLGNTYTVADVIWTVALSRFDLLGYSSWLDKNIFPRLASYYLRMQQR  240

Query  936  PSY  944
             SY
Sbjct  241  KSY  243



>ref|XP_007123082.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1-like 1 isoform X5 [Physeter catodon]
Length=309

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 122/241 (51%), Gaps = 34/241 (14%)
 Frame = +3

Query  246  LYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHii  425
            LYH   S  S KVRL + EKG+      V+    ++ + +F R+N   ++PV  +  +II
Sbjct  49   LYHWTQSFSSQKVRLVIAEKGLACEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNII  108

Query  426  ydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVS  605
             D  +II Y     E+  +GG   N +    +++M    E +P+             Y+S
Sbjct  109  SDYDQIIDY----VERTFTGGHLANAT----MDFMKLDHEEEPQL---------SEPYLS  151

Query  606  KFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGN-AQVVRQSEEHLVKLLDEVEGKL  782
            K  ++ ++A++ E  D+  SY +K+         LG  A V+ Q E  L K   E EG+ 
Sbjct  152  K--QKKLMAKILEHDDV--SYLKKI---------LGELAMVLDQIEAELEKRKLENEGQK  198

Query  783  SEASYLTGEEFSLADVMLIPILARLQVLNLELEFI--NTRPNLFDYWALVKQRPSYKKVI  956
             E  +L G  F+LADV+L   L RL+ L L  ++    +RPNL  ++  V++R +++KV+
Sbjct  199  CEL-WLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQSFFERVQKRFAFRKVL  257

Query  957  G  959
            G
Sbjct  258  G  258



>ref|WP_017057666.1| glutathione S-transferase [Vibrio kanaloae]
Length=255

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 65/254 (26%), Positives = 121/254 (48%), Gaps = 33/254 (13%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGK-NLDTFFFRINPSAKLPVFQNGS  416
            + LYHHP S+ S+KVRLALEEKG+ ++   ++ I  +  LD ++ ++NP   +P  +  +
Sbjct  4    LMLYHHPLSVCSMKVRLALEEKGLAWSGRVIDIIRKQEQLDPWYLKLNPQGVIPTVEIRN  63

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRL  596
                   +    I  IA    S G +L  S +   + M K          L ++     L
Sbjct  64   GTTKVLTDSAYIIRSIASL--SEGNNLIPSGESNCQLMDK----------LINLADGIDL  111

Query  597  YVSKFLR--------RVIIARMAECPDLASSYHRKLREAYE-TEEKLGNAQVVRQSEEHL  749
             +  + R        +++ +R+ +   +A  Y  +L++ Y    ++  N++V R   +H+
Sbjct  112  QILSYSRHPSMEKSEKILNSRITKALLMADKYP-ELKDNYIFCADRSENSKVFRVDSKHI  170

Query  750  VKL----LDEV---EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLE--LEFINTRPN  902
             K+    L+ +   E +L    +L G  ++LADV+   +L+RL +L     L+  N  P 
Sbjct  171  EKVEQYALEAISFSEKQLEGNQFLLGNVYTLADVIWTVVLSRLDLLGYSKWLDKDNF-PE  229

Query  903  LFDYWALVKQRPSY  944
            +  Y+  ++ R SY
Sbjct  230  ISSYYLRMQHRKSY  243



>ref|XP_004253135.1| PREDICTED: glutathione S-transferase [Solanum lycopersicum]
Length=221

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  723  VVRQSEEHLVKLLDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPN  902
            ++RQ+EE L K+LD  E +L ++ YL G+EF+LAD+  +P +  L       E I +R N
Sbjct  135  LIRQNEEKLKKVLDVYEKRLGDSQYLAGDEFTLADLSHLPNIQYLVNGTDRAELITSREN  194

Query  903  LFDYWALVKQRPSYKKVI  956
            +  +W  +  R S+KKV+
Sbjct  195  VGRWWGEISNRESWKKVV  212



>ref|XP_007146224.1| hypothetical protein PHAVU_006G022600g [Phaseolus vulgaris]
 gb|ESW18218.1| hypothetical protein PHAVU_006G022600g [Phaseolus vulgaris]
Length=215

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 109/229 (48%), Gaps = 32/229 (14%)
 Frame = +3

Query  279  KVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSHiiydtieiiqyie  458
            +V + L EK I++ +  V+   G++ +  F ++ P   +PV Q+G + +Y++  II+Y  
Sbjct  15   RVLVCLIEKEIEFETVDVDLFKGEHKEPEFLKLQPFGSVPVIQDGDYTLYESRAIIRY--  72

Query  459  RIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLYVSKFLRRVIIARM  638
              AEK    G +L     + +E    +++W       +H P+ Y L ++     ++ A +
Sbjct  73   -FAEKYKEQGTEL---LGKTIEEKGLVEQWLEVEAHNFHPPL-YNLVIN-----ILFAPL  122

Query  639  AECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGKLSEASYLTGEEFS  818
               P                     + +V+ +S++ L K+LD  E +LS + YL G+ FS
Sbjct  123  KGVP--------------------SDQKVIEESDKKLEKVLDVYEERLSNSKYLAGDFFS  162

Query  819  LADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVIGRY  965
            LAD+  +P    L         +  R ++  +W  +  RPS+KKV+ +Y
Sbjct  163  LADLSHLPFGHYLVNQTGRGNLVRERKHVNAWWDDISNRPSWKKVLQQY  211



>gb|EYU34184.1| hypothetical protein MIMGU_mgv1a013345mg [Erythranthe guttata]
Length=223

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 101/239 (42%), Gaps = 31/239 (13%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            +++Y  P+S    +V   L EK + +    VN   G++    + +I P  ++P FQ+ S 
Sbjct  7    VRVYGPPFSSAVSRVLACLLEKDVPFQLQPVNMAKGEHKKPDYLKIQPFGQVPAFQDES-  65

Query  420  iiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYHVPVKYRLY  599
                  E       + EK S+ G +  +     +E    I +W       ++ P    ++
Sbjct  66   --ITLFESRAISRYVCEKYSTKG-NKGLYGTNPLE-KASIDQWLEGEGQNFNPPSSVLVF  121

Query  600  VSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEVEGK  779
               F  R+ I +                          +  +++Q++  L K+LD  E +
Sbjct  122  QLAFAPRMKIKQ--------------------------DESLIKQNKAKLAKVLDVYEKR  155

Query  780  LSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKKVI  956
            L E+ YL GEEF+LAD+  IP    L  +    E   +R N+  +W  +  R S++KV+
Sbjct  156  LGESRYLAGEEFTLADLSHIPNTHYLVNVCERDELFASRENVERWWGEISSRESWRKVV  214



>ref|XP_004161070.1| PREDICTED: glutathione S-transferase F8, chloroplastic-like [Cucumis 
sativus]
Length=220

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 58/242 (24%), Positives = 107/242 (44%), Gaps = 37/242 (15%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS-  416
            +++Y  P S    +V   L EK + +    VN   G++    + +I P  ++P FQ+ S 
Sbjct  5    VKVYGPPLSTAVSRVLACLLEKDVQFQLLPVNMAKGEHKSQEYLKIQPFGQVPAFQDESI  64

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLN-VSNQQVVEWMH-KIQEWDPKYFTLYHVPVKY  590
             +           ++ AEK + G + L+ +    + +W+  + Q ++P            
Sbjct  65   SLFESRAICRYICDKHAEKGNKGLYGLDQLGKASIDQWIEAEGQSFNPA-----------  113

Query  591  RLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEV  770
                      +++ ++A  P          R     +EK      ++Q+EE L K+LD  
Sbjct  114  --------SSILVFQLAFAP----------RMRLPQDEK-----AIKQNEEKLSKVLDVY  150

Query  771  EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKK  950
            E +L E+ YL G+EFSLAD+  +P    L  +    E   +R N+  +W  +  R S+K+
Sbjct  151  EQRLGESRYLAGDEFSLADLSHLPNGHYLVNVADRAELFTSRKNVDRWWNEISGRESWKE  210

Query  951  VI  956
            V+
Sbjct  211  VV  212



>gb|KGN62277.1| hypothetical protein Csa_2G348150 [Cucumis sativus]
Length=220

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 58/242 (24%), Positives = 107/242 (44%), Gaps = 37/242 (15%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGS-  416
            +++Y  P S    +V   L EK + +    VN   G++    + +I P  ++P FQ+ S 
Sbjct  5    VKVYGPPLSTAVSRVLACLLEKDVQFQLLPVNMAKGEHKSQEYLKIQPFGQVPAFQDESI  64

Query  417  HiiydtieiiqyieRIAEKVSSGGFDLN-VSNQQVVEWMH-KIQEWDPKYFTLYHVPVKY  590
             +           ++ AEK + G + L+ +    + +W+  + Q ++P            
Sbjct  65   SLFESRAICRYICDKHAEKGNKGLYGLDQLGKASIDQWIEAEGQSFNPA-----------  113

Query  591  RLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLLDEV  770
                      +++ ++A  P          R     +EK      ++Q+EE L K+LD  
Sbjct  114  --------SSILVFQLAFAP----------RMRLPQDEK-----AIKQNEEKLSKVLDVY  150

Query  771  EGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPSYKK  950
            E +L E+ YL G+EFSLAD+  +P    L  +    E   +R N+  +W  +  R S+K+
Sbjct  151  EQRLGESRYLAGDEFSLADLSHLPNGHYLVNVADRAELFTSRKNVDRWWNEISGRESWKE  210

Query  951  VI  956
            V+
Sbjct  211  VV  212



>ref|XP_006132293.1| PREDICTED: ganglioside-induced differentiation-associated protein 
1-like 1 isoform X5 [Pelodiscus sinensis]
Length=309

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 125/251 (50%), Gaps = 34/251 (14%)
 Frame = +3

Query  216  LVVHADDIMQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKL  395
            L + + D + LYH   S  S KVRL + EKG+      V+    ++ + +F R+N   ++
Sbjct  39   LALRSKDRLVLYHWTQSFSSQKVRLVIAEKGLPCEERDVSMPLTEHKEPWFMRLNLGEEV  98

Query  396  PVFQNGSHiiydtieiiqyieRIAEKVSSGGFDLNVSNQQVVEWMHKIQEWDPKYFTLYH  575
            PV  +G +II D  +II YI    EK  +GG   N S     E M    E +P+      
Sbjct  99   PVIIHGDNIISDYNQIIDYI----EKNFTGGHLANAS----TELMKLDYEGEPQL-----  145

Query  576  VPVKYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGN-AQVVRQSEEHLV  752
                   Y+SK  ++ ++A++ E  ++  SY +K+         LG    V+ Q E  L 
Sbjct  146  ----TEPYLSK--QKKLMAKILEHDNV--SYLKKI---------LGELGMVLDQIEAELE  188

Query  753  KLLDEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFI--NTRPNLFDYWALV  926
            K   E  G+  E  +L G  F+LAD++L   L RL+ L L  ++    +RPNL  ++  +
Sbjct  189  KRKLEYRGQKCEL-WLCGCVFTLADILLGATLHRLKFLGLSKKYWEDGSRPNLQSFFDRI  247

Query  927  KQRPSYKKVIG  959
            ++R +++KV+G
Sbjct  248  QKRFAFRKVLG  258



>ref|XP_010259661.1| PREDICTED: glutathione S-transferase F13 [Nelumbo nucifera]
Length=214

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 105/244 (43%), Gaps = 44/244 (18%)
 Frame = +3

Query  240  MQLYHHPYSLDSLKVRLALEEKGIDYTSHHVNPITGKNLDTFFFRINPSAKLPVFQNGSH  419
            ++LY    S  + +V   L EKG+D+    +N   G++    F   NP  ++P  ++G  
Sbjct  3    VKLYGIAMSTCTTRVMTCLHEKGVDFEIVPINLSAGEHKQPSFISKNPFGQIPALEDGD-  61

Query  420  iiydtieiiqyieRIAEKVSSGGFDL----NVSNQQVVE-WMH-KIQEWDPKYFTLYHVP  581
                  E     + +A K    G DL    N+    +V  W+  + Q+++P        P
Sbjct  62   --LTLFESRAITKYLATKHKDKGTDLLRLDNLKEAALVNVWLEVEAQQFNP--------P  111

Query  582  VKYRLYVSKFLRRVIIARMAECPDLASSYHRKLREAYETEEKLGNAQVVRQSEEHLVKLL  761
            +   +Y     +R+        PD                      +V+  + E L K+L
Sbjct  112  ISALVY-----QRMFSPLFGGTPD---------------------EKVIEANAEKLGKVL  145

Query  762  DEVEGKLSEASYLTGEEFSLADVMLIPILARLQVLNLELEFINTRPNLFDYWALVKQRPS  941
            D  E +LS++ YL G+ +SLAD+  +     L + N E   IN+RP++  +W  +  RP+
Sbjct  146  DVYEERLSKSKYLAGDFYSLADLHHLSYTYYL-MKNPEANLINSRPHVKAWWEDISSRPA  204

Query  942  YKKV  953
            ++K 
Sbjct  205  FRKA  208



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3380901351172