BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24941_g1_i4 len=414 path=[3845:0-48 4213:49-132 1406:133-134
1408:135-180 1454:181-207 1481:208-243 1517:244-413]

Length=414
                                                                      Score     E

ref|XP_009789562.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV1      162   4e-47   
ref|XP_006340331.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    161   8e-47   
ref|XP_004251228.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV1      161   9e-47   
ref|XP_009608558.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV1      159   5e-46   
ref|XP_010687499.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV1      157   3e-45   
ref|XP_010556521.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV1      155   1e-44   
ref|XP_002263818.2|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    154   6e-44   Vitis vinifera
ref|XP_011088057.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV1      152   2e-43   
gb|KCW63632.1|  hypothetical protein EUGRSUZ_G01264                     152   3e-43   
ref|XP_006486938.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    150   3e-43   
ref|XP_006422848.1|  hypothetical protein CICLE_v10029310mg             152   3e-43   
ref|XP_003628199.1|  FAD-linked sulfhydryl oxidase ALR                  152   3e-43   
gb|AET02675.2|  FAD-linked sulfhydryl oxidase Erv1-like protein         152   3e-43   
gb|KDO57867.1|  hypothetical protein CISIN_1g039511mg                   152   4e-43   
emb|CDO97264.1|  unnamed protein product                                153   5e-43   
ref|XP_010500542.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    150   8e-43   
gb|KHG13062.1|  FAD-linked sulfhydryl oxidase ERV1 -like protein        150   1e-42   
ref|XP_010479425.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    150   1e-42   
ref|XP_006486935.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    150   1e-42   
gb|AAG51780.1|AC079674_13  hypothetical protein; 32417-34250            149   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002527495.1|  alr/erv, putative                                  150   2e-42   Ricinus communis
ref|XP_010252830.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    150   2e-42   
ref|XP_010065922.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    148   3e-42   
ref|XP_008236433.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV1      149   3e-42   
ref|XP_010065921.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    149   5e-42   
gb|KEH41407.1|  FAD-linked sulfhydryl oxidase Erv1-like protein         149   6e-42   
ref|XP_007200613.1|  hypothetical protein PRUPE_ppa012227mg             148   6e-42   
ref|XP_011001766.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV1      148   1e-41   
ref|XP_002891539.1|  hypothetical protein ARALYDRAFT_891909             148   1e-41   
ref|XP_010500541.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    148   1e-41   
ref|XP_006305627.1|  hypothetical protein CARUB_v10010320mg             148   1e-41   
ref|XP_007042610.1|  Erv1/Alr family protein isoform 2                  147   1e-41   
ref|XP_009347742.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    148   1e-41   
gb|KDP44476.1|  hypothetical protein JCGZ_16309                         148   1e-41   
pdb|2HJ3|A  Chain A, Structure Of The Arabidopsis Thaliana Erv1 T...    145   1e-41   
ref|XP_007042609.1|  Erv1/Alr family protein isoform 1                  149   1e-41   
ref|XP_004985273.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    147   2e-41   
gb|EYU37584.1|  hypothetical protein MIMGU_mgv1a014174mg                147   2e-41   
ref|XP_010479424.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    147   2e-41   
ref|XP_010461839.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    147   2e-41   
ref|XP_009407666.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV1      147   2e-41   
gb|EMS62108.1|  FAD-linked sulfhydryl oxidase ERV1                      145   2e-41   
gb|AAM63908.1|  unknown                                                 147   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564557.1|  FAD-linked sulfhydryl oxidase ERV1                    147   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010909086.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    146   3e-41   
ref|XP_008787162.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    146   4e-41   
ref|NP_001148317.1|  augmenter of liver regeneration                    146   5e-41   Zea mays [maize]
tpg|DAA43898.1|  TPA: augmenter of liver regeneration                   146   5e-41   
ref|XP_006393205.1|  hypothetical protein EUTSA_v10011740mg             147   5e-41   
ref|XP_008347043.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    146   8e-41   
ref|XP_010905288.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    145   8e-41   
ref|XP_004289791.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    145   1e-40   
ref|XP_004498850.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    145   1e-40   
ref|XP_007156316.1|  hypothetical protein PHAVU_003G276100g             145   1e-40   
ref|XP_004511174.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    145   1e-40   
ref|XP_003558546.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV1      145   1e-40   
ref|XP_008373045.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV1      145   1e-40   
gb|EMT33766.1|  FAD-linked sulfhydryl oxidase ALR                       144   2e-40   
emb|CDY03576.1|  BnaC03g68350D                                          144   2e-40   
ref|XP_004156855.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    145   2e-40   
ref|XP_009107254.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV1      144   2e-40   
ref|XP_008792627.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV1      145   2e-40   
ref|XP_004152374.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    144   2e-40   
emb|CDY16533.1|  BnaA08g02340D                                          144   3e-40   
gb|EYU37205.1|  hypothetical protein MIMGU_mgv1a020352mg                144   3e-40   
ref|XP_010909084.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    144   4e-40   
ref|XP_003546726.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    144   4e-40   
ref|XP_008454384.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV1      144   6e-40   
ref|XP_006598115.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    143   2e-39   
gb|EYU37204.1|  hypothetical protein MIMGU_mgv1a022490mg                139   2e-39   
gb|EYU37586.1|  hypothetical protein MIMGU_mgv1a025602mg                143   4e-39   
ref|XP_003542836.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    140   8e-39   
ref|XP_008366502.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    129   3e-34   
gb|EPS60171.1|  hypothetical protein M569_14634                         127   5e-34   
gb|ADE75626.1|  unknown                                                 129   5e-34   
ref|XP_002313169.2|  Erv1/Alr family protein                            126   2e-33   Populus trichocarpa [western balsam poplar]
gb|KDO38067.1|  hypothetical protein CISIN_1g034937mg                   122   7e-33   
gb|EEC74725.1|  hypothetical protein OsI_10452                          126   2e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_001751213.1|  predicted protein                                  121   4e-32   
ref|XP_002976837.1|  hypothetical protein SELMODRAFT_105740             117   1e-30   
gb|KEH15539.1|  FAD-linked sulfhydryl oxidase ERV1-like protein         113   9e-30   
ref|XP_010665046.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...    106   1e-26   
ref|XP_006422846.1|  hypothetical protein CICLE_v10029975mg             105   2e-26   
ref|XP_001774132.1|  predicted protein                                98.6    2e-23   
ref|XP_006486937.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...  97.8    2e-22   
ref|XP_002465673.1|  hypothetical protein SORBIDRAFT_01g043500        97.1    3e-22   Sorghum bicolor [broomcorn]
gb|KEH15538.1|  FAD-linked sulfhydryl oxidase ERV1-like protein       94.0    3e-22   
gb|KHG00105.1|  FAD-linked sulfhydryl oxidase ERV1 -like protein      99.4    4e-22   
ref|XP_006486936.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...  95.5    1e-21   
ref|XP_008675741.1|  PREDICTED: augmenter of liver regeneration i...  94.4    3e-21   
emb|CEF99903.1|  Erv1/Alr                                             90.1    2e-19   
ref|XP_003082338.1|  Mitochondrial sulfhydryl oxidase involved in...  90.1    2e-19   
ref|XP_005847374.1|  hypothetical protein CHLNCDRAFT_35514            88.6    1e-18   
ref|XP_001703298.1|  sulfhydryl oxidase                               88.6    2e-18   Chlamydomonas reinhardtii
ref|XP_006598117.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...  87.0    3e-18   
ref|XP_001420816.1|  predicted protein                                82.8    2e-17   Ostreococcus lucimarinus CCE9901
ref|XP_005184939.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  83.6    4e-17   
gb|KFM23758.1|  FAD-linked sulfhydryl oxidase ERV1                    80.9    1e-16   
ref|XP_005649822.1|  hypothetical protein COCSUDRAFT_9381             80.1    3e-16   
ref|XP_007512315.1|  predicted protein                                80.9    6e-16   
gb|EQB61710.1|  protein of the erv1 alr family                        80.1    6e-16   
ref|XP_002946841.1|  hypothetical protein VOLCADRAFT_46761            78.6    7e-16   
ref|XP_004992076.1|  sulfhydryl oxidase                               80.9    8e-16   
ref|XP_001744987.1|  hypothetical protein                             78.2    1e-15   Monosiga brevicollis MX1
gb|EFA83584.1|  hypothetical protein PPL_02650                        79.7    1e-15   Heterostelium album PN500
ref|XP_009221301.1|  FAD-linked sulfhydryl oxidase ALR                79.3    2e-15   
ref|XP_006965065.1|  predicted protein                                76.3    7e-15   
gb|EJW04303.1|  hypothetical protein EDEG_01427                       77.0    9e-15   
ref|XP_004529672.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  77.0    1e-14   
ref|XP_010139072.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     75.1    1e-14   
ref|XP_009502266.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     74.7    1e-14   
ref|XP_004360441.1|  hypothetical protein DFA_04720                   77.4    1e-14   
ref|XP_010905289.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...  76.6    1e-14   
ref|XP_010019315.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     75.5    2e-14   
ref|XP_002024412.1|  GL15019                                          76.6    2e-14   Drosophila persimilis
gb|KFQ55516.1|  FAD-linked sulfhydryl oxidase ALR                     75.5    2e-14   
gb|KFO77108.1|  FAD-linked sulfhydryl oxidase ALR                     74.7    2e-14   
ref|XP_008631813.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     75.5    2e-14   
gb|KFO58942.1|  FAD-linked sulfhydryl oxidase ALR                     75.1    2e-14   
ref|XP_009560489.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     74.3    2e-14   
gb|EGI63891.1|  FAD-linked sulfhydryl oxidase ALR                     75.9    2e-14   
ref|XP_009975068.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     75.1    2e-14   
gb|ETS02653.1|  augmenter of liver regeneration                       76.3    2e-14   
ref|XP_011057094.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     75.9    3e-14   
ref|XP_003887455.1|  mitochondrial sulfhydryl oxidase                 75.5    4e-14   
ref|XP_002996554.1|  hypothetical protein NCER_100332                 75.5    4e-14   
gb|KFP17365.1|  FAD-linked sulfhydryl oxidase ALR                     73.6    4e-14   
ref|XP_001963570.1|  GF20218                                          76.3    5e-14   Drosophila ananassae
ref|XP_005716875.1|  Growth factor                                    74.7    5e-14   
pdb|3O55|A  Chain A, Crystal Structure Of Human Fad-Linked Augmen...  74.3    5e-14   
gb|KFZ68027.1|  FAD-linked sulfhydryl oxidase ALR                     73.9    5e-14   
gb|EHH31317.1|  FAD-linked sulfhydryl oxidase ALR                     74.3    5e-14   
ref|XP_002071161.1|  GK25283                                          75.5    5e-14   Drosophila willistoni
ref|XP_009090296.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     73.9    6e-14   
ref|XP_002011249.1|  GI16104                                          75.1    6e-14   Drosophila mojavensis
gb|KFR08085.1|  FAD-linked sulfhydryl oxidase ALR                     73.6    6e-14   
ref|XP_009704486.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     73.9    6e-14   
ref|XP_001990841.1|  GH18034                                          75.1    7e-14   Drosophila grimshawi
ref|XP_002039476.1|  GM22993                                          75.5    7e-14   Drosophila sechellia
ref|XP_002107437.1|  GD17467                                          75.1    7e-14   Drosophila simulans
gb|KFP32714.1|  FAD-linked sulfhydryl oxidase ALR                     73.6    7e-14   
ref|XP_010202652.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     73.9    7e-14   
ref|XP_002100970.1|  GE15875                                          75.5    7e-14   Drosophila yakuba
gb|KFP68003.1|  FAD-linked sulfhydryl oxidase ALR                     73.6    7e-14   
ref|XP_003484466.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  74.3    8e-14   
ref|NP_001259731.1|  augmenter of liver regeneration, isoform B       75.5    8e-14   
ref|XP_001120016.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  74.3    8e-14   Apis mellifera [bee]
gb|ELQ38257.1|  hypothetical protein OOU_Y34scaffold00548g73          77.8    8e-14   
gb|KFV16568.1|  FAD-linked sulfhydryl oxidase ALR                     73.6    8e-14   
gb|AAM11207.1|  RE13652p                                              74.7    8e-14   Drosophila melanogaster
ref|XP_010083255.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     73.6    8e-14   
pdb|3MBG|A  Chain A, Crystal Structure Of Human Augmenter Of Live...  73.9    8e-14   
ref|XP_010390593.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     74.7    8e-14   
ref|NP_608353.2|  augmenter of liver regeneration, isoform A          75.5    8e-14   Drosophila melanogaster
ref|XP_009877286.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.8    9e-14   
ref|XP_004652040.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     74.7    9e-14   
ref|XP_003712172.1|  FAD-linked sulfhydryl oxidase ALR                74.7    9e-14   
ref|XP_974453.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR        74.3    9e-14   Tribolium castaneum [rust-red flour beetle]
ref|XP_001977829.1|  GG19256                                          75.1    9e-14   Drosophila erecta
gb|EHB14214.1|  FAD-linked sulfhydryl oxidase ALR                     74.7    9e-14   
ref|XP_002110094.1|  hypothetical protein TRIADDRAFT_21000            74.3    1e-13   Trichoplax adhaerens
ref|XP_009264693.1|  mitochondrial sulfhydryl oxidase                 74.3    1e-13   
ref|XP_010178643.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     74.7    1e-13   
ref|XP_004071807.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  74.3    1e-13   
ref|XP_003398016.1|  PREDICTED: LOW QUALITY PROTEIN: FAD-linked s...  73.9    1e-13   
gb|KFQ17480.1|  FAD-linked sulfhydryl oxidase ALR                     73.2    1e-13   
gb|KFQ31723.1|  FAD-linked sulfhydryl oxidase ALR                     74.3    1e-13   
ref|XP_008948643.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     73.2    1e-13   
ref|XP_006679365.1|  hypothetical protein BATDEDRAFT_12046            73.2    1e-13   
gb|KFW84517.1|  FAD-linked sulfhydryl oxidase ALR                     73.2    1e-13   
gb|KFP80668.1|  FAD-linked sulfhydryl oxidase ALR                     72.4    1e-13   
gb|EOA98493.1|  FAD-linked sulfhydryl oxidase ALR                     73.2    1e-13   
ref|XP_010618748.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     73.2    1e-13   
ref|XP_001082639.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  74.3    1e-13   Macaca mulatta [rhesus macaque]
gb|EFX73902.1|  hypothetical protein DAPPUDRAFT_307542                73.9    1e-13   
gb|AAD10339.1|  ALR                                                   73.2    1e-13   Mus musculus [mouse]
ref|XP_008926462.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     73.2    1e-13   
ref|XP_002200264.2|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  72.8    1e-13   Taeniopygia guttata
ref|XP_005145105.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     73.2    1e-13   
gb|KFU83859.1|  FAD-linked sulfhydryl oxidase ALR                     72.8    2e-13   
gb|KFM12471.1|  FAD-linked sulfhydryl oxidase ALR                     72.8    2e-13   
gb|EPR79276.1|  Mitochondrial-type FAD-linked sulfhydryl oxidase ...  73.6    2e-13   
gb|KFV53802.1|  FAD-linked sulfhydryl oxidase ALR                     72.8    2e-13   
ref|XP_009481869.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.8    2e-13   
gb|EZA58330.1|  FAD-linked sulfhydryl oxidase ALR                     73.6    2e-13   
ref|XP_010291926.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.8    2e-13   
ref|XP_003389418.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  73.6    2e-13   
gb|KGL85997.1|  FAD-linked sulfhydryl oxidase ALR                     72.8    2e-13   
gb|KFQ99939.1|  FAD-linked sulfhydryl oxidase ALR                     72.8    2e-13   
ref|XP_009810707.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.8    2e-13   
gb|KFZ47941.1|  FAD-linked sulfhydryl oxidase ALR                     72.8    2e-13   
ref|XP_010150672.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.8    2e-13   
ref|XP_009638726.1|  PREDICTED: LOW QUALITY PROTEIN: FAD-linked s...  72.8    2e-13   
ref|XP_010170633.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.8    2e-13   
ref|XP_005007449.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  73.6    2e-13   
gb|KFV97755.1|  FAD-linked sulfhydryl oxidase ALR                     72.8    2e-13   
ref|XP_009284882.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.8    2e-13   
ref|XP_009946599.1|  PREDICTED: LOW QUALITY PROTEIN: FAD-linked s...  72.4    2e-13   
ref|XP_005023415.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.8    2e-13   
ref|XP_009893264.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.8    2e-13   
gb|KFQ77264.1|  FAD-linked sulfhydryl oxidase ALR                     72.4    2e-13   
ref|XP_003501592.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  72.8    2e-13   
ref|XP_004627937.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     73.9    2e-13   
ref|XP_009583172.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.8    2e-13   
ref|XP_008854455.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     73.9    2e-13   
ref|XP_005054062.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.8    2e-13   
ref|XP_002057971.1|  GJ15753                                          73.6    2e-13   Drosophila virilis
ref|XP_010116326.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.4    2e-13   
ref|XP_003478518.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  73.9    2e-13   
ref|XP_005444166.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.4    2e-13   
ref|XP_005007448.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  73.9    2e-13   
ref|XP_005229191.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.4    2e-13   
ref|XP_003351186.1|  hypothetical protein SMAC_03489                  73.6    2e-13   
ref|XP_005523146.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     73.6    2e-13   
gb|EPQ07991.1|  FAD-linked sulfhydryl oxidase ALR                     71.2    2e-13   
ref|XP_009494342.1|  hypothetical protein H696_02170                  73.2    3e-13   
ref|XP_008347042.1|  PREDICTED: FAD-linked sulfhydryl oxidase ERV...  53.5    3e-13   
ref|XP_006607929.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  72.8    3e-13   
gb|ELT89413.1|  hypothetical protein CAPTEDRAFT_226289                72.8    3e-13   
ref|XP_001632107.1|  predicted protein                                72.8    3e-13   Nematostella vectensis
ref|XP_009466242.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.8    4e-13   
ref|XP_007606755.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  72.4    4e-13   
ref|XP_004367724.1|  Erv1 / Alr family protein                        73.2    4e-13   
gb|AAD56538.1|AF183892_1  hepatopoietin                               72.8    4e-13   Homo sapiens [man]
ref|XP_005349211.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     73.2    4e-13   
gb|EMC80188.1|  FAD-linked sulfhydryl oxidase ALR                     71.6    4e-13   
gb|EDL22353.1|  mCG12842, isoform CRA_a                               72.8    4e-13   
ref|XP_005426017.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.8    4e-13   
ref|XP_005495859.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.8    4e-13   
ref|XP_009930669.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.4    4e-13   
gb|AAD17328.1|  hepatopoietin HPO2                                    71.6    4e-13   Homo sapiens [man]
gb|EHK23249.1|  hypothetical protein TRIVIDRAFT_111157                72.8    4e-13   
gb|AAH23941.1|  Gfer protein                                          72.8    5e-13   Mus musculus [mouse]
ref|NP_001156283.1|  augmenter of liver regeneration-like             72.8    5e-13   Acyrthosiphon pisum
ref|NP_075527.2|  FAD-linked sulfhydryl oxidase ALR                   72.8    5e-13   Mus musculus [mouse]
ref|XP_005081660.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.8    5e-13   
ref|NP_001082855.1|  FAD-linked sulfhydryl oxidase ALR                72.8    5e-13   Danio rerio [leopard danio]
ref|XP_002431288.1|  Augmenter of liver regeneration, putative        72.4    5e-13   Pediculus humanus corporis [human body lice]
ref|XP_004902572.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  73.6    5e-13   
gb|EOB13550.1|  Mitochondrial FAD-linked sulfhydryl oxidase ERV1      72.4    5e-13   
ref|XP_003916407.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.8    5e-13   
ref|XP_004902571.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  73.6    5e-13   
ref|XP_002187437.2|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.4    5e-13   Taeniopygia guttata
ref|XP_010297786.1|  PREDICTED: LOW QUALITY PROTEIN: FAD-linked s...  71.2    5e-13   
ref|XP_009993053.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.4    5e-13   
pdb|1OQC|A  Chain A, The Crystal Structure Of Augmenter Of Liver ...  71.2    5e-13   
ref|XP_009327678.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.4    5e-13   
gb|KFV76351.1|  FAD-linked sulfhydryl oxidase ALR                     71.2    6e-13   
pdb|3TK0|A  Chain A, Mutation Of Sfalr                                71.2    6e-13   
ref|XP_003665449.1|  hypothetical protein MYCTH_2309177               72.4    6e-13   
gb|AAD17327.1|  hepatopoietin HPO1                                    71.2    6e-13   Homo sapiens [man]
gb|EAW85578.1|  growth factor, augmenter of liver regeneration (E...  71.2    6e-13   
ref|NP_585865.1|  PROTEIN OF THE ERV1/ALR FAMILY                      72.0    7e-13   Encephalitozoon cuniculi GB-M1
ref|XP_003654078.1|  hypothetical protein THITE_2145027               72.0    7e-13   
ref|XP_004342977.1|  FAD dependent sulfhydryl oxidase Erv2            72.4    7e-13   
gb|AGE95756.1|  protein of the ERV1/ALR family                        72.0    7e-13   
pdb|3U2L|A  Chain A, Crystal Structure Of Human Alr Mutant C142s      70.9    7e-13   
gb|EPZ36898.1|  Erv1/Alr domain-containing protein                    71.6    7e-13   
gb|KGK36453.1|  hypothetical protein JL09_g4389                       75.5    7e-13   
ref|XP_006741981.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.0    8e-13   
ref|XP_003700010.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  71.6    8e-13   
ref|XP_005512154.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     71.2    8e-13   
pdb|3R7C|A  Chain A, The Structure Of A Hexahestidine-Tagged Form...  71.2    8e-13   
ref|XP_001862367.1|  augmenter of liver regeneration                  71.6    9e-13   Culex quinquefasciatus
ref|XP_010386151.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.0    9e-13   
gb|EPZ34491.1|  Erv1/Alr domain-containing protein                    71.6    9e-13   
dbj|GAM24323.1|  hypothetical protein SAMD00019534_074980             72.0    9e-13   
ref|XP_003423948.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     71.6    9e-13   
ref|XP_003928473.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     72.0    9e-13   
ref|XP_005391542.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  72.0    1e-12   
gb|KGG50535.1|  hypothetical protein DI09_67p230                      71.6    1e-12   
ref|XP_005391541.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  72.0    1e-12   
ref|XP_005289009.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     71.6    1e-12   
ref|XP_004057029.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     71.6    1e-12   
ref|XP_006101004.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     71.2    1e-12   
ref|XP_008722836.1|  hypothetical protein G647_01213                  72.0    1e-12   
ref|XP_006893908.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     71.6    1e-12   
ref|XP_007753383.1|  hypothetical protein A1O7_01154                  72.0    1e-12   
gb|KFA61348.1|  hypothetical protein S40285_05855                     71.6    1e-12   
ref|XP_007980253.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  71.6    1e-12   
gb|EHY66529.1|  FAD-linked sulfhydryl oxidase ERV2                    71.2    1e-12   
gb|AAM94000.1|  growth factor                                         70.9    1e-12   
gb|KFG26764.1|  hypothetical protein NESG_00920                       71.2    1e-12   
ref|XP_414848.2|  PREDICTED: FAD-linked sulfhydryl oxidase ALR is...  71.6    1e-12   
ref|XP_005866643.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     70.9    1e-12   
gb|EFZ13810.1|  hypothetical protein SINV_04448                       70.5    1e-12   
gb|AAG38105.1|  hepatopoietin protein                                 71.2    2e-12   
ref|NP_005253.3|  FAD-linked sulfhydryl oxidase ALR                   71.2    2e-12   
gb|EFX00923.1|  FAD dependent sulfhydryl oxidase                      71.2    2e-12   
emb|CEG63610.1|  Putative ERV2 protein-like protein                   70.9    2e-12   
ref|XP_009913935.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     69.3    2e-12   
gb|EFN76890.1|  FAD-linked sulfhydryl oxidase ALR                     70.5    2e-12   
ref|XP_003269203.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     71.2    2e-12   
ref|XP_008184693.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  69.7    2e-12   
ref|NP_037354.2|  FAD-linked sulfhydryl oxidase ALR                   71.2    2e-12   
gb|KGL77668.1|  FAD-linked sulfhydryl oxidase ALR                     70.1    2e-12   
ref|XP_006523575.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  72.4    2e-12   
emb|CAB87993.1|  augmenter of liver regeneration                      70.9    2e-12   
ref|XP_007797544.1|  putative augmenter of liver regeneration pro...  70.9    2e-12   
ref|XP_006270557.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     70.9    2e-12   
ref|XP_001915422.2|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     70.9    2e-12   
gb|EIJ89648.1|  FAD-linked sulfhydryl oxidase ERV2                    70.5    2e-12   
gb|KFO95541.1|  FAD-linked sulfhydryl oxidase ALR                     69.7    2e-12   
ref|XP_004604467.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     70.5    2e-12   
ref|XP_006978972.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     70.9    2e-12   
ref|XP_003073069.1|  mitochondrial sulfhydryl oxidase                 70.5    2e-12   
ref|XP_008561195.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     70.5    2e-12   
ref|XP_009664326.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     70.9    3e-12   
ref|XP_001692749.1|  sulfhydryl oxidase                               69.7    3e-12   
gb|KDR13402.1|  FAD-linked sulfhydryl oxidase ALR                     70.5    3e-12   
emb|CDS03262.1|  hypothetical protein LRAMOSA00664                    70.5    3e-12   
ref|XP_757955.1|  hypothetical protein UM01808.1                      71.2    3e-12   
ref|XP_010568763.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     70.5    3e-12   
ref|XP_003286950.1|  hypothetical protein DICPUDRAFT_150985           70.5    3e-12   
gb|EHK43682.1|  hypothetical protein TRIATDRAFT_222224                70.5    3e-12   
gb|KFH67728.1|  hypothetical protein MVEG_06460                       70.1    3e-12   
gb|KEY64372.1|  hypothetical protein S7711_06401                      70.1    3e-12   
gb|EFN62310.1|  FAD-linked sulfhydryl oxidase ALR                     69.7    3e-12   
ref|XP_645302.1|  hypothetical protein DDB_G0272230                   70.5    3e-12   
gb|KFA72365.1|  hypothetical protein S40288_05592                     70.1    4e-12   
ref|XP_001172822.2|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     69.3    4e-12   
ref|XP_004403209.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     70.1    4e-12   
ref|XP_007002262.1|  hypothetical protein TREMEDRAFT_23431            68.9    4e-12   
ref|XP_008504940.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     70.9    4e-12   
ref|XP_008074224.1|  hypothetical protein VCUG_01206                  73.2    4e-12   
ref|XP_557147.3|  AGAP006470-PA                                       70.1    4e-12   
ref|XP_009069252.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     68.9    4e-12   
gb|ETS63024.1|  hypothetical protein PaG_02798                        70.9    4e-12   
gb|KFP76638.1|  FAD-linked sulfhydryl oxidase ALR                     68.9    4e-12   
dbj|GAK63659.1|  conserved hypothetical protein                       70.5    4e-12   
dbj|GAC76770.1|  mitochondrial sulfhydryl oxidase                     70.5    4e-12   
ref|XP_008144621.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     70.1    5e-12   
gb|ETN62338.1|  augmenter of liver regeneration                       69.7    5e-12   
ref|XP_004750793.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     70.1    5e-12   
gb|EPE03653.1|  augmenter of liver regeneration                       69.7    5e-12   
ref|XP_010213563.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  69.3    5e-12   
emb|CBK24728.2|  Erv1                                                 70.1    5e-12   
gb|EPT02481.1|  hypothetical protein FOMPIDRAFT_1160311               69.7    5e-12   
gb|KEY68516.1|  hypothetical protein S7711_08367                      69.7    6e-12   
ref|XP_008488784.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     68.9    6e-12   
ref|XP_003124774.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     69.7    6e-12   
gb|EKC40956.1|  FAD-linked sulfhydryl oxidase ALR                     69.3    6e-12   
ref|XP_004373447.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     70.1    6e-12   
ref|XP_007904271.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     67.8    6e-12   
ref|XP_006024100.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     69.3    6e-12   
gb|KFA63988.1|  hypothetical protein S40285_05487                     69.7    6e-12   
gb|EKC97418.1|  hypothetical protein A1Q2_08341                       70.1    7e-12   
ref|XP_010595722.1|  PREDICTED: LOW QUALITY PROTEIN: FAD-linked s...  69.3    7e-12   
ref|XP_004691886.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     68.9    7e-12   
gb|EJT48642.1|  thiol oxidase                                         70.1    7e-12   
gb|KHE79018.1|  augmenter of liver regeneration                       69.3    8e-12   
ref|XP_009853377.1|  augmenter of liver regeneration                  69.3    8e-12   
ref|XP_001929745.1|  hypothetical protein                             68.9    8e-12   
ref|XP_959716.1|  augmenter of liver regeneration                     69.3    8e-12   
ref|XP_009012845.1|  hypothetical protein HELRODRAFT_74545            68.2    8e-12   
pdb|3U2M|A  Chain A, Crystal Structure Of Human Alr Mutant C142145S   68.2    8e-12   
ref|XP_006683265.1|  hypothetical protein BATDEDRAFT_15048            68.2    8e-12   
ref|XP_003228508.2|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     69.3    9e-12   
ref|XP_006873929.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     69.3    9e-12   
gb|EHH60061.1|  FAD-linked sulfhydryl oxidase ALR                     68.2    9e-12   
pdb|4LDK|A  Chain A, Fad-linked Sulfhydryl Oxidase Alr Mutation       68.2    9e-12   
ref|XP_786637.2|  PREDICTED: FAD-linked sulfhydryl oxidase ALR-like   68.6    1e-11   
ref|XP_003790836.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     68.9    1e-11   
ref|XP_008184890.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  67.8    1e-11   
emb|CCF53243.1|  related to ERV2-Flavin dependent sulfhydryl oxidase  69.7    1e-11   
ref|XP_010990913.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     68.9    1e-11   
ref|XP_003807737.2|  PREDICTED: LOW QUALITY PROTEIN: FAD-linked s...  68.9    1e-11   
ref|XP_002595430.1|  hypothetical protein BRAFLDRAFT_69262            71.2    1e-11   
ref|XP_008484371.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  67.8    1e-11   
ref|XP_006673953.1|  FAD dependent sulfhydryl oxidase Erv2            69.7    1e-11   
ref|XP_001587894.1|  hypothetical protein SS1G_11135                  68.6    1e-11   
ref|XP_007386135.1|  hypothetical protein PUNSTDRAFT_54065            68.9    1e-11   
gb|EPY88942.1|  FAD-linked sulfhydryl oxidase ALR-like protein        67.8    1e-11   
ref|XP_006637339.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  68.6    1e-11   
ref|XP_004821215.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     70.1    1e-11   
gb|EHL03430.1|  putative FAD-linked sulfhydryl oxidase ERV2           67.8    1e-11   
gb|ERZ98942.1|  hypothetical protein GLOINDRAFT_334385                68.6    1e-11   
gb|EGU78665.1|  hypothetical protein FOXB_10851                       68.2    2e-11   
ref|XP_004438236.1|  PREDICTED: LOW QUALITY PROTEIN: FAD-linked s...  68.6    2e-11   
gb|EWG43708.1|  hypothetical protein FVEG_05068                       68.2    2e-11   
gb|KFH63810.1|  hypothetical protein MVEG_10503                       68.6    2e-11   
gb|EPB81374.1|  hypothetical protein HMPREF1544_11923                 67.8    2e-11   
ref|XP_008031174.1|  hypothetical protein SETTUDRAFT_24360            68.2    2e-11   
ref|XP_009261741.1|  hypothetical protein FPSE_10349                  68.2    2e-11   
emb|CCT67418.1|  related to erv1 protein, mitochondrial precursor     68.2    2e-11   
ref|XP_006204458.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     68.2    2e-11   
ref|XP_008083217.1|  FAD-dependent thiol oxidase                      68.2    2e-11   
emb|CBQ72028.1|  related to ERV2-Flavin dependent sulfhydryl oxidase  68.9    2e-11   
gb|ESU16465.1|  hypothetical protein FGSG_09833                       68.2    2e-11   
gb|KFB34819.1|  AGAP006470-PA-like protein                            68.2    2e-11   
ref|XP_007098772.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     67.4    2e-11   
ref|XP_005337867.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  68.2    2e-11   
gb|ERT02774.1|  hypothetical protein HMPREF1624_01076                 68.2    2e-11   
emb|CCA72168.1|  related to ERV2-Flavin dependent sulfhydryl oxidase  68.2    2e-11   
emb|CDJ90293.1|  Erv1 Alr domain containing protein                   67.4    2e-11   
ref|XP_005337866.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  68.2    2e-11   
ref|XP_008328369.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     68.2    2e-11   
emb|CDW55277.1|  Evr1 Alr domain containing protein                   67.8    2e-11   
gb|ENN75156.1|  hypothetical protein YQE_08269                        67.4    2e-11   
gb|KIH89106.1|  augmenter of liver regeneration                       67.8    2e-11   
emb|CDH57505.1|  fad-linked sulfhydryl oxidase erv2                   67.8    2e-11   
dbj|GAA55264.1|  FAD-linked sulfhydryl oxidase ALR                    67.8    2e-11   
ref|XP_010948191.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     67.8    2e-11   
gb|ACO09175.1|  Augmenter of liver regeneration                       67.8    2e-11   
ref|XP_006779627.1|  PREDICTED: LOW QUALITY PROTEIN: growth facto...  67.4    2e-11   
gb|ETE65342.1|  FAD-linked sulfhydryl oxidase ALR                     67.8    2e-11   
ref|XP_007875770.1|  hypothetical protein PFL1_00082                  69.3    3e-11   
gb|KDQ12999.1|  hypothetical protein BOTBODRAFT_175876                67.4    3e-11   
gb|KGB78048.1|  thiol oxidase                                         67.8    3e-11   
ref|XP_007398333.1|  hypothetical protein PHACADRAFT_260119           67.8    3e-11   
gb|EST07757.1|  hypothetical protein PSEUBRA_SCAF2g02884              68.6    3e-11   
ref|XP_008600899.1|  FAD-linked sulfhydryl oxidase ERV2               67.8    3e-11   
gb|KGQ06410.1|  FAD-linked sulfhydryl oxidase ERV2                    67.8    3e-11   
ref|XP_006006753.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     67.4    3e-11   
gb|ACO10459.1|  FAD-linked sulfhydryl oxidase ALR                     67.0    3e-11   
gb|EYB96334.1|  hypothetical protein Y032_0151g2813                   67.0    3e-11   
ref|XP_003998994.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     67.4    4e-11   
gb|EHK47640.1|  hypothetical protein TRIATDRAFT_8726                  67.4    4e-11   
ref|XP_008579883.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     67.4    4e-11   
gb|EYB96333.1|  hypothetical protein Y032_0151g2813                   67.0    4e-11   
emb|CCD34476.1|  similar to mitochondrial FAD-linked sulfhydryl o...  67.0    4e-11   
gb|ACO11466.1|  FAD-linked sulfhydryl oxidase ALR                     67.0    4e-11   
emb|CCE29909.1|  related to erv1 protein, mitochondrial precursor     67.0    4e-11   
ref|XP_006174115.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     67.0    4e-11   
gb|ACO10207.1|  FAD-linked sulfhydryl oxidase ALR                     67.0    4e-11   
ref|XP_008046903.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     67.0    4e-11   
ref|XP_007247902.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     67.0    5e-11   
ref|XP_005886869.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     66.2    5e-11   
gb|ACO10938.1|  FAD-linked sulfhydryl oxidase ALR                     66.6    5e-11   
ref|XP_010727421.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     67.0    5e-11   
gb|KIH54240.1|  Erv1 / Alr family protein                             66.6    5e-11   
ref|XP_007347089.1|  hypothetical protein AURDEDRAFT_114255           67.0    5e-11   
emb|CDY50964.1|  BnaA06g37600D                                        64.7    5e-11   
ref|XP_005945497.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  67.0    5e-11   
gb|EHJ78861.1|  hypothetical protein KGM_10330                        66.2    5e-11   
ref|XP_006129366.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     67.4    5e-11   
ref|XP_005967385.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     65.9    6e-11   
ref|XP_005750224.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  66.6    6e-11   
ref|XP_006798085.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  66.6    6e-11   
ref|XP_004575880.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  66.6    6e-11   
gb|AAH97922.1|  LOC733269 protein                                     66.6    6e-11   
ref|XP_002163122.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  66.6    6e-11   
gb|ELR62855.1|  FAD-linked sulfhydryl oxidase ALR                     66.2    6e-11   
gb|ACO13796.1|  FAD-linked sulfhydryl oxidase ALR                     66.2    6e-11   
ref|XP_006798084.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  66.6    7e-11   
ref|XP_503294.1|  YALI0D25894p                                        66.6    7e-11   
ref|XP_007438821.1|  PREDICTED: uncharacterized protein LOC103053400  68.2    7e-11   
ref|XP_006146516.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     66.6    7e-11   
ref|XP_008286938.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     66.6    7e-11   
emb|CCU74510.1|  FAD dependent sulfhydryl oxidase                     66.2    7e-11   
ref|XP_008413927.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     66.6    7e-11   
gb|EPQ67930.1|  hypothetical protein BGT96224_A20624                  66.2    7e-11   
ref|XP_007681454.1|  hypothetical protein BAUCODRAFT_52163            65.5    8e-11   
gb|KDB13063.1|  ERV2 protein-like protein                             66.6    8e-11   
emb|CAF89716.1|  unnamed protein product                              66.2    8e-11   
ref|XP_010782690.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     66.2    8e-11   
ref|XP_001995556.1|  GH17696                                          67.0    9e-11   
ref|XP_007305834.1|  hypothetical protein STEHIDRAFT_81986            67.4    9e-11   
ref|XP_002935903.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     66.2    9e-11   
gb|EJT96937.1|  hypothetical protein DACRYDRAFT_25371                 66.2    9e-11   
ref|XP_775403.1|  hypothetical protein CNBE1190                       67.4    9e-11   
gb|KFH43039.1|  FAD-linked sulfhydryl oxidase-like protein            66.2    9e-11   
ref|XP_007565792.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  66.2    1e-10   
gb|ESZ90162.1|  hypothetical protein SBOR_9450                        66.2    1e-10   
ref|XP_009519041.1|  hypothetical protein PHYSODRAFT_284799           65.9    1e-10   
ref|XP_006369737.1|  hypothetical protein POPTR_0001s30320g           65.9    1e-10   
gb|EJK62006.1|  hypothetical protein THAOC_17407                      65.9    1e-10   
ref|XP_001649468.1|  regulatory protein, putative                     65.9    1e-10   
ref|XP_007499436.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  67.4    1e-10   
ref|XP_003194164.1|  thiol oxidase                                    67.4    1e-10   
gb|EMP36905.1|  FAD-linked sulfhydryl oxidase ALR                     67.0    1e-10   
ref|XP_570710.1|  thiol oxidase                                       67.4    1e-10   
ref|XP_007058633.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     65.9    1e-10   
ref|XP_003051942.1|  hypothetical protein NECHADRAFT_92415            65.9    1e-10   
ref|XP_010864514.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  66.2    1e-10   
gb|KHN69444.1|  mitochondrial sulfhydryl oxidase                      65.9    1e-10   
ref|XP_010864513.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  65.9    1e-10   
ref|XP_007499435.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  67.4    1e-10   
ref|XP_005806123.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  65.9    1e-10   
ref|XP_001447386.1|  hypothetical protein                             65.9    1e-10   
emb|CCE26593.1|  related to Erv1p and rat ALR protein                 65.9    1e-10   
gb|EUB59991.1|  FAD-linked sulfhydryl oxidase ALR                     65.5    1e-10   
gb|KFD54603.1|  hypothetical protein M513_04548                       65.5    1e-10   
ref|XP_007181740.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR...  65.9    1e-10   
ref|XP_007316396.1|  hypothetical protein SERLADRAFT_384601           64.7    1e-10   
ref|NP_001180117.1|  FAD-linked sulfhydryl oxidase ALR                65.9    1e-10   
emb|CCG80838.1|  Putative uncharacterized protein                     65.5    1e-10   
ref|XP_007453616.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     65.5    1e-10   
gb|AFR95401.1|  thiol oxidase                                         67.0    1e-10   
gb|ELQ76912.1|  Mitochondrial sulfhydryl oxidase involved in the ...  68.2    1e-10   
ref|XP_008695302.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     64.7    2e-10   
ref|XP_004270362.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     65.5    2e-10   
ref|XP_004020763.1|  PREDICTED: FAD-linked sulfhydryl oxidase ALR     65.5    2e-10   
ref|XP_007866495.1|  hypothetical protein GLOTRDRAFT_138931           65.5    2e-10   
ref|XP_002507269.1|  predicted protein                                63.9    2e-10   
emb|CDJ06217.1|  FAD linked sulfhydryl oxidase ALR                    65.1    2e-10   
ref|XP_002185840.1|  predicted protein                                64.3    2e-10   
ref|XP_003833694.1|  similar to FAD-linked sulfhydryl oxidase ERV2    65.1    2e-10   
ref|XP_007708837.1|  hypothetical protein COCCADRAFT_33816            65.1    2e-10   
ref|XP_002958944.1|  hypothetical protein VOLCADRAFT_108387           68.6    2e-10   



>ref|XP_009789562.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 [Nicotiana sylvestris]
Length=196

 Score =   162 bits (409),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHFKEVLRANPVQAGSQAEFSQWLC++HNVVNRSL KPIFPC+RVD
Sbjct  114  MAILSRMYPCKECADHFKEVLRANPVQAGSQAEFSQWLCYMHNVVNRSLNKPIFPCDRVD  173

Query  231  ARWGKLDCEQHNCDLQGSDKLW  296
            ARWGKLDCEQ  CDLQG+DK W
Sbjct  174  ARWGKLDCEQRACDLQGTDKFW  195



>ref|XP_006340331.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like [Solanum tuberosum]
Length=199

 Score =   161 bits (408),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC +CADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSL KP FPC+RVD
Sbjct  117  MAILSRMYPCNECADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLSKPKFPCDRVD  176

Query  231  ARWGKLDCEQHNCDLQGSDKLW  296
            ARWGKLDCEQ  CDLQG+DK W
Sbjct  177  ARWGKLDCEQRACDLQGTDKFW  198



>ref|XP_004251228.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 [Solanum lycopersicum]
Length=200

 Score =   161 bits (407),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC +CADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSL KP FPC+RVD
Sbjct  118  MAILSRMYPCSECADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLSKPKFPCDRVD  177

Query  231  ARWGKLDCEQHNCDLQGSDKLW  296
            ARWGKLDCEQ  CDLQG+DK W
Sbjct  178  ARWGKLDCEQRACDLQGTDKFW  199



>ref|XP_009608558.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 [Nicotiana tomentosiformis]
Length=196

 Score =   159 bits (402),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHFKEVLRANPVQAGSQAE SQWLC++HNVVNRSL KPIFPC+RVD
Sbjct  114  MAILSRMYPCKECADHFKEVLRANPVQAGSQAELSQWLCYMHNVVNRSLNKPIFPCDRVD  173

Query  231  ARWGKLDCEQHNCDLQGSDKLW  296
            ARWGKLDCEQ  CDLQG+DK W
Sbjct  174  ARWGKLDCEQRACDLQGNDKFW  195



>ref|XP_010687499.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 [Beta vulgaris 
subsp. vulgaris]
Length=185

 Score =   157 bits (396),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHFKEVLRANPVQAGSQ EFSQWLCHVHNVVNRSLGK IFPCERVD
Sbjct  100  MAILSRMYPCKECADHFKEVLRANPVQAGSQVEFSQWLCHVHNVVNRSLGKTIFPCERVD  159

Query  231  ARWGKLDCEQHNCDLQGSDKL  293
            ARWGKLDCE+  CDLQG++  
Sbjct  160  ARWGKLDCEKRMCDLQGTNTF  180



>ref|XP_010556521.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 [Tarenaya hassleriana]
Length=190

 Score =   155 bits (393),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC++CADHFKE+LRANPVQAGSQ EFSQWLCHVHN VNRSLGK +FPCERVD
Sbjct  109  MAILSRMYPCRECADHFKEILRANPVQAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVD  168

Query  231  ARWGKLDCEQHNCDLQGSD  287
            ARWGKLDCEQ +CDLQGS 
Sbjct  169  ARWGKLDCEQRSCDLQGSS  187



>ref|XP_002263818.2| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 isoform X1 [Vitis 
vinifera]
 emb|CBI22473.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   154 bits (389),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSL KPIFPC+RVD
Sbjct  113  MAILSRMYPCKECADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLNKPIFPCKRVD  172

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKLDCE   CDLQG+
Sbjct  173  ARWGKLDCELRACDLQGT  190



>ref|XP_011088057.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 [Sesamum indicum]
Length=193

 Score =   152 bits (384),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHFKEV+RANPVQAGS  EFSQWLCHVHNVVNRSLGKP+FPCERVD
Sbjct  107  MAILSRMYPCKECADHFKEVIRANPVQAGSHHEFSQWLCHVHNVVNRSLGKPVFPCERVD  166

Query  231  ARWGKLDCEQHNCDLQG  281
            ARWGKL+CE+  CDLQG
Sbjct  167  ARWGKLECERRECDLQG  183



>gb|KCW63632.1| hypothetical protein EUGRSUZ_G01264 [Eucalyptus grandis]
Length=179

 Score =   152 bits (383),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            +  QM ILSRMYPC++CADHFKE+LRANPVQA S  EFSQWLCHVHNVVNRSLGK +FPC
Sbjct  92   LAAQMAILSRMYPCQECADHFKEILRANPVQAASHTEFSQWLCHVHNVVNRSLGKSVFPC  151

Query  219  ERVDARWGKLDCEQHNCDLQG-SDKLW  296
            ERVDARWGKL+CE   CDLQG S K W
Sbjct  152  ERVDARWGKLECELRACDLQGTSTKFW  178



>ref|XP_006486938.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like isoform X4 
[Citrus sinensis]
Length=154

 Score =   150 bits (380),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHF+EVLRANPVQAGS  EFSQWLCHVHNVVNRSLGK +FPCERVD
Sbjct  72   MAILSRMYPCKECADHFREVLRANPVQAGSHDEFSQWLCHVHNVVNRSLGKLVFPCERVD  131

Query  231  ARWGKLDCEQHNCDLQGSDKL  293
            ARWGKL+CEQ  CDLQG+  L
Sbjct  132  ARWGKLECEQRACDLQGTPDL  152



>ref|XP_006422848.1| hypothetical protein CICLE_v10029310mg [Citrus clementina]
 gb|ESR36088.1| hypothetical protein CICLE_v10029310mg [Citrus clementina]
Length=198

 Score =   152 bits (384),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHFKEVLRANPVQAGS  EFSQWLCHVHNVVNRSLGK +FPCERVD
Sbjct  116  MAILSRMYPCKECADHFKEVLRANPVQAGSHDEFSQWLCHVHNVVNRSLGKLVFPCERVD  175

Query  231  ARWGKLDCEQHNCDLQGSDKL  293
            ARWGKL+CEQ  CDLQG+  L
Sbjct  176  ARWGKLECEQRACDLQGTPDL  196



>ref|XP_003628199.1| FAD-linked sulfhydryl oxidase ALR [Medicago truncatula]
Length=188

 Score =   152 bits (383),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            ILSRMYPCK+CADHFKEVLR+NPVQAGS AEFSQWLCHVHNVVNRS+GKPIFPCERVDAR
Sbjct  105  ILSRMYPCKECADHFKEVLRSNPVQAGSHAEFSQWLCHVHNVVNRSIGKPIFPCERVDAR  164

Query  237  WGKLDCEQHNCDLQGSDKLW  296
            WGKLDCEQ+ C++ GS  ++
Sbjct  165  WGKLDCEQNACEIIGSTSIF  184



>gb|AET02675.2| FAD-linked sulfhydryl oxidase Erv1-like protein [Medicago truncatula]
Length=188

 Score =   152 bits (383),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            ILSRMYPCK+CADHFKEVLR+NPVQAGS AEFSQWLCHVHNVVNRS+GKPIFPCERVDAR
Sbjct  105  ILSRMYPCKECADHFKEVLRSNPVQAGSHAEFSQWLCHVHNVVNRSIGKPIFPCERVDAR  164

Query  237  WGKLDCEQHNCDLQGSDKLW  296
            WGKLDCEQ+ C++ GS  ++
Sbjct  165  WGKLDCEQNACEIIGSTSIF  184



>gb|KDO57867.1| hypothetical protein CISIN_1g039511mg [Citrus sinensis]
Length=198

 Score =   152 bits (383),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHFKEVLRANPVQAGS  EFSQWLCHVHNVVNRSLGK +FPCERVD
Sbjct  116  MAILSRMYPCKECADHFKEVLRANPVQAGSHDEFSQWLCHVHNVVNRSLGKLVFPCERVD  175

Query  231  ARWGKLDCEQHNCDLQGSDKL  293
            ARWGKL+CEQ  CDLQG+  L
Sbjct  176  ARWGKLECEQRACDLQGTPDL  196



>emb|CDO97264.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   153 bits (387),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHFKEVLR NPVQAG+Q EFSQWLCHVHNVVNRSLGK +FPCERVD
Sbjct  178  MAILSRMYPCKECADHFKEVLRVNPVQAGNQHEFSQWLCHVHNVVNRSLGKLVFPCERVD  237

Query  231  ARWGKLDCEQHNCDLQGSDKLW  296
            ARWGKLDCEQ  CDLQG +  W
Sbjct  238  ARWGKLDCEQRACDLQGDENPW  259



>ref|XP_010500542.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like isoform X2 
[Camelina sativa]
Length=178

 Score =   150 bits (379),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            +  QM ILSRMYPC++CADHFKE+LR+NP QAGSQ EFSQWLCHVHN VNRSLGK +FPC
Sbjct  93   LAAQMSILSRMYPCRECADHFKEILRSNPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPC  152

Query  219  ERVDARWGKLDCEQHNCDLQGSD  287
            ERVDARWGKL+CEQ +CDL G+ 
Sbjct  153  ERVDARWGKLECEQKSCDLHGTS  175



>gb|KHG13062.1| FAD-linked sulfhydryl oxidase ERV1 -like protein [Gossypium arboreum]
Length=192

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC++CADHFKEVLRANPV AGS  EFSQWLCHVHNVVNRSLGK IFPCERVD
Sbjct  108  MSILSRMYPCQECADHFKEVLRANPVMAGSHDEFSQWLCHVHNVVNRSLGKLIFPCERVD  167

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKLDCEQ  CDLQG+
Sbjct  168  ARWGKLDCEQRGCDLQGT  185



>ref|XP_010479425.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 isoform X2 [Camelina 
sativa]
Length=177

 Score =   150 bits (378),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            +  QM ILSRMYPC++CADHFKE+LR+NP QAGSQ EFSQWLCHVHN VNRSLGK +FPC
Sbjct  92   LAAQMSILSRMYPCRECADHFKEILRSNPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPC  151

Query  219  ERVDARWGKLDCEQHNCDLQGSD  287
            ERVDARWGKL+CEQ +CDL G+ 
Sbjct  152  ERVDARWGKLECEQKSCDLHGTS  174



>ref|XP_006486935.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like isoform X1 
[Citrus sinensis]
Length=198

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHF+EVLRANPVQAGS  EFSQWLCHVHNVVNRSLGK +FPCERVD
Sbjct  116  MAILSRMYPCKECADHFREVLRANPVQAGSHDEFSQWLCHVHNVVNRSLGKLVFPCERVD  175

Query  231  ARWGKLDCEQHNCDLQGSDKL  293
            ARWGKL+CEQ  CDLQG+  L
Sbjct  176  ARWGKLECEQRACDLQGTPDL  196



>gb|AAG51780.1|AC079674_13 hypothetical protein; 32417-34250 [Arabidopsis thaliana]
Length=175

 Score =   149 bits (377),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            +  QM ILSRMYPC++CADHFKE+LR+NP QAGSQ EFSQWLCHVHN VNRSLGK +FPC
Sbjct  90   LAAQMTILSRMYPCRECADHFKEILRSNPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPC  149

Query  219  ERVDARWGKLDCEQHNCDLQGSD  287
            ERVDARWGKL+CEQ +CDL G+ 
Sbjct  150  ERVDARWGKLECEQKSCDLHGTS  172



>ref|XP_002527495.1| alr/erv, putative [Ricinus communis]
 gb|EEF34893.1| alr/erv, putative [Ricinus communis]
Length=196

 Score =   150 bits (378),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHF+EVLR NPVQAGS  EFSQWLCHVHNVVNRSLGK +FPCERVD
Sbjct  113  MAILSRMYPCKECADHFREVLRVNPVQAGSHTEFSQWLCHVHNVVNRSLGKLVFPCERVD  172

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKL+CEQ  CDLQG+
Sbjct  173  ARWGKLECEQRACDLQGT  190



>ref|XP_010252830.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 isoform X2 [Nelumbo 
nucifera]
Length=196

 Score =   150 bits (378),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSR+YPC+DCADHFKEVLRA+PVQA SQAEFSQWLCHVHNVVNRSLGKPIFPC RVD
Sbjct  114  MAILSRIYPCRDCADHFKEVLRASPVQAESQAEFSQWLCHVHNVVNRSLGKPIFPCRRVD  173

Query  231  ARWGKLDCEQHNCDLQG  281
            ARWGKLDC++  CD+QG
Sbjct  174  ARWGKLDCKERTCDVQG  190



>ref|XP_010065922.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 isoform X2 [Eucalyptus 
grandis]
Length=160

 Score =   148 bits (374),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 72/83 (87%), Gaps = 1/83 (1%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC++CADHFKE+LRANPVQA S  EFSQWLCHVHNVVNRSLGK +FPCERVD
Sbjct  77   MAILSRMYPCQECADHFKEILRANPVQAASHTEFSQWLCHVHNVVNRSLGKSVFPCERVD  136

Query  231  ARWGKLDCEQHNCDLQG-SDKLW  296
            ARWGKL+CE   CDLQG S K W
Sbjct  137  ARWGKLECELRACDLQGTSTKFW  159



>ref|XP_008236433.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 [Prunus mume]
Length=200

 Score =   149 bits (377),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 5/87 (6%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHF+E+LR+NPVQAGS AEFSQWLCHVHN VNRSL KP+FPCERVD
Sbjct  114  MSILSRMYPCKECADHFQEILRSNPVQAGSHAEFSQWLCHVHNTVNRSLSKPVFPCERVD  173

Query  231  ARWGKLDCEQHNCDLQG-----SDKLW  296
            ARWGKL+CEQ  CDL G      DKL+
Sbjct  174  ARWGKLECEQRACDLLGLTSGFEDKLY  200



>ref|XP_010065921.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW63633.1| hypothetical protein EUGRSUZ_G01264 [Eucalyptus grandis]
Length=195

 Score =   149 bits (376),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 72/83 (87%), Gaps = 1/83 (1%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC++CADHFKE+LRANPVQA S  EFSQWLCHVHNVVNRSLGK +FPCERVD
Sbjct  112  MAILSRMYPCQECADHFKEILRANPVQAASHTEFSQWLCHVHNVVNRSLGKSVFPCERVD  171

Query  231  ARWGKLDCEQHNCDLQG-SDKLW  296
            ARWGKL+CE   CDLQG S K W
Sbjct  172  ARWGKLECELRACDLQGTSTKFW  194



>gb|KEH41407.1| FAD-linked sulfhydryl oxidase Erv1-like protein [Medicago truncatula]
Length=188

 Score =   149 bits (375),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            ILSRMYPCK+CADHFKEVLR+NPVQAGS AEFSQWLCHVHNVVNRS+ KPIFPCERVDAR
Sbjct  105  ILSRMYPCKECADHFKEVLRSNPVQAGSHAEFSQWLCHVHNVVNRSISKPIFPCERVDAR  164

Query  237  WGKLDCEQHNCDLQGSDKLW  296
            WGKLDCEQ+ C++ GS  ++
Sbjct  165  WGKLDCEQNACEIIGSISIF  184



>ref|XP_007200613.1| hypothetical protein PRUPE_ppa012227mg [Prunus persica]
 gb|EMJ01812.1| hypothetical protein PRUPE_ppa012227mg [Prunus persica]
Length=179

 Score =   148 bits (374),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHF+E+LR+NPVQAGS AEFSQWLCHVHN VNRSL KP+FPCERVD
Sbjct  93   MSILSRMYPCKECADHFQEILRSNPVQAGSHAEFSQWLCHVHNTVNRSLSKPVFPCERVD  152

Query  231  ARWGKLDCEQHNCDLQG  281
            ARWGKL+CEQ  CDL G
Sbjct  153  ARWGKLECEQRACDLLG  169



>ref|XP_011001766.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 [Populus euphratica]
Length=198

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC+ CADHFKEVLR NPVQ GS AEFSQWLCHVHN+VNRSLGK +FPCERVD
Sbjct  115  MAILSRMYPCQGCADHFKEVLRVNPVQVGSHAEFSQWLCHVHNIVNRSLGKLVFPCERVD  174

Query  231  ARWGKLDCEQHNCDLQGSDKL  293
            ARWGKL+CEQ  CD+QG+  L
Sbjct  175  ARWGKLECEQRACDVQGTTNL  195



>ref|XP_002891539.1| hypothetical protein ARALYDRAFT_891909 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67798.1| hypothetical protein ARALYDRAFT_891909 [Arabidopsis lyrata subsp. 
lyrata]
Length=187

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC++CADHFKE+LR+NP QAGSQ EFSQWLCHVHN VNRSLGK +FPCERVD
Sbjct  106  MAILSRMYPCRECADHFKEILRSNPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVD  165

Query  231  ARWGKLDCEQHNCDLQGSD  287
            ARWGKL+CEQ +CDL GS 
Sbjct  166  ARWGKLECEQKSCDLHGSS  184



>ref|XP_010500541.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like isoform X1 
[Camelina sativa]
Length=194

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC++CADHFKE+LR+NP QAGSQ EFSQWLCHVHN VNRSLGK +FPCERVD
Sbjct  113  MSILSRMYPCRECADHFKEILRSNPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVD  172

Query  231  ARWGKLDCEQHNCDLQGSD  287
            ARWGKL+CEQ +CDL G+ 
Sbjct  173  ARWGKLECEQKSCDLHGTS  191



>ref|XP_006305627.1| hypothetical protein CARUB_v10010320mg, partial [Capsella rubella]
 gb|EOA38525.1| hypothetical protein CARUB_v10010320mg, partial [Capsella rubella]
Length=203

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC++CADHFKE+LR+NP QAGSQ EFSQWLCHVHN VNRSLGK +FPCERVD
Sbjct  122  MSILSRMYPCRECADHFKEILRSNPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVD  181

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKL+CEQ +CDL G+
Sbjct  182  ARWGKLECEQRSCDLHGT  199



>ref|XP_007042610.1| Erv1/Alr family protein isoform 2, partial [Theobroma cacao]
 gb|EOX98441.1| Erv1/Alr family protein isoform 2, partial [Theobroma cacao]
Length=167

 Score =   147 bits (371),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHFKEVLRANPVQAGS  EFSQWLCHVHNVVNRSLGK  FPCERVD
Sbjct  83   MSILSRMYPCKECADHFKEVLRANPVQAGSHDEFSQWLCHVHNVVNRSLGKLRFPCERVD  142

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKL+CEQ  CDL+G+
Sbjct  143  ARWGKLECEQRACDLEGT  160



>ref|XP_009347742.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like [Pyrus x bretschneideri]
 ref|XP_009347759.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like [Pyrus x bretschneideri]
Length=203

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHF+E+LR+NPVQAGS AEFSQWLCHVHN VNRSL KP+FPCERVD
Sbjct  117  MSILSRMYPCKECADHFQEILRSNPVQAGSHAEFSQWLCHVHNTVNRSLNKPVFPCERVD  176

Query  231  ARWGKLDCEQHNCDLQG  281
            ARWGKL+CEQ  CDL G
Sbjct  177  ARWGKLECEQRACDLLG  193



>gb|KDP44476.1| hypothetical protein JCGZ_16309 [Jatropha curcas]
Length=197

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC++CADHFKEVLR NPVQAGS  EFS WLCHVHN+VNRSLGK IFPCERVD
Sbjct  113  MAILSRMYPCRECADHFKEVLRVNPVQAGSHTEFSLWLCHVHNIVNRSLGKLIFPCERVD  172

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKL+CEQ  CDLQG+
Sbjct  173  ARWGKLECEQRACDLQGT  190



>pdb|2HJ3|A Chain A, Structure Of The Arabidopsis Thaliana Erv1 Thiol Oxidase
 pdb|2HJ3|B Chain B, Structure Of The Arabidopsis Thaliana Erv1 Thiol Oxidase
Length=125

 Score =   145 bits (367),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC++CADHFKE+LR+NP QAGSQ EFSQWLCHVHN VNRSLGK +FPCERVD
Sbjct  44   MTILSRMYPCRECADHFKEILRSNPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVD  103

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKL+CEQ +CDL G+
Sbjct  104  ARWGKLECEQKSCDLHGT  121



>ref|XP_007042609.1| Erv1/Alr family protein isoform 1 [Theobroma cacao]
 gb|EOX98440.1| Erv1/Alr family protein isoform 1 [Theobroma cacao]
Length=229

 Score =   149 bits (375),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHFKEVLRANPVQAGS  EFSQWLCHVHNVVNRSLGK  FPCERVD
Sbjct  145  MSILSRMYPCKECADHFKEVLRANPVQAGSHDEFSQWLCHVHNVVNRSLGKLRFPCERVD  204

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKL+CEQ  CDL+G+
Sbjct  205  ARWGKLECEQRACDLEGT  222



>ref|XP_004985273.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like [Setaria italica]
Length=186

 Score =   147 bits (372),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M I+SR+YPCK+CADHFKEVL+ANPVQAGSQAEFSQWLC+VHNVVNRSLGKPIFPC+RV 
Sbjct  102  MHIISRLYPCKECADHFKEVLKANPVQAGSQAEFSQWLCYVHNVVNRSLGKPIFPCQRVT  161

Query  231  ARWGKLDCEQHNCDLQGSDKL  293
            ARWGKLDC + +CDL+G++ +
Sbjct  162  ARWGKLDCPERSCDLEGANDI  182



>gb|EYU37584.1| hypothetical protein MIMGU_mgv1a014174mg [Erythranthe guttata]
Length=198

 Score =   147 bits (372),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHFKEV+R+NPV+AGS  EFSQW+CHVHNVVNRSLGK +FPCERVD
Sbjct  112  MAILSRMYPCKECADHFKEVIRSNPVEAGSHHEFSQWVCHVHNVVNRSLGKLVFPCERVD  171

Query  231  ARWGKLDCEQHNCDLQGSD  287
            ARWGKL+CEQ  CDLQG+ 
Sbjct  172  ARWGKLECEQRACDLQGTS  190



>ref|XP_010479424.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 isoform X1 [Camelina 
sativa]
Length=193

 Score =   147 bits (372),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC++CADHFKE+LR+NP QAGSQ EFSQWLCHVHN VNRSLGK +FPCERVD
Sbjct  112  MSILSRMYPCRECADHFKEILRSNPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVD  171

Query  231  ARWGKLDCEQHNCDLQGSD  287
            ARWGKL+CEQ +CDL G+ 
Sbjct  172  ARWGKLECEQKSCDLHGTS  190



>ref|XP_010461839.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like [Camelina 
sativa]
Length=193

 Score =   147 bits (372),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC++CADHFKE+LR+NP QAGSQ EFSQWLCHVHN VNRSLGK +FPCERVD
Sbjct  112  MSILSRMYPCRECADHFKEILRSNPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVD  171

Query  231  ARWGKLDCEQHNCDLQGSD  287
            ARWGKL+CEQ +CDL G+ 
Sbjct  172  ARWGKLECEQKSCDLHGTS  190



>ref|XP_009407666.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 [Musa acuminata 
subsp. malaccensis]
Length=200

 Score =   147 bits (372),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSR+YPCK+CADH KEVL+ANP+QAGSQ EFSQWLCH+HNVVNRSLGK IFPC RV+
Sbjct  115  MAILSRLYPCKECADHIKEVLKANPIQAGSQDEFSQWLCHIHNVVNRSLGKLIFPCNRVN  174

Query  231  ARWGKLDCEQHNCDLQGSDKL  293
            ARWGKLDC  HNCDLQGS  L
Sbjct  175  ARWGKLDCIDHNCDLQGSSDL  195



>gb|EMS62108.1| FAD-linked sulfhydryl oxidase ERV1 [Triticum urartu]
Length=133

 Score =   145 bits (366),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M +LSR+YPCK+CADHFKEVL+ANPVQAGSQAEFSQWLC+VHNVVNRSLGK IFPC+RV+
Sbjct  49   MALLSRIYPCKECADHFKEVLKANPVQAGSQAEFSQWLCYVHNVVNRSLGKTIFPCQRVN  108

Query  231  ARWGKLDCEQHNCDLQGSDKL  293
            ARWGKLDC    CDL+GS+ +
Sbjct  109  ARWGKLDCPDRACDLEGSNDI  129



>gb|AAM63908.1| unknown [Arabidopsis thaliana]
Length=190

 Score =   147 bits (371),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC++CADHFKE+LR+NP QAGSQ EFSQWLCHVHN VNRSLGK +FPCERVD
Sbjct  109  MTILSRMYPCRECADHFKEILRSNPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVD  168

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKL+CEQ +CDL G+
Sbjct  169  ARWGKLECEQKSCDLHGT  186



>ref|NP_564557.1| FAD-linked sulfhydryl oxidase ERV1 [Arabidopsis thaliana]
 sp|Q8GXX0.1|ERV1_ARATH RecName: Full=FAD-linked sulfhydryl oxidase ERV1; Short=AtErv1; 
AltName: Full=Mitochondrial sulfhydryl oxidase ERV1 [Arabidopsis 
thaliana]
 dbj|BAC42626.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39946.1| At1g49880 [Arabidopsis thaliana]
 emb|CAD83013.1| mitochondrial sulfhydryl oxidase Erv1p [Arabidopsis thaliana]
 gb|AEE32487.1| FAD-linked sulfhydryl oxidase ERV1 [Arabidopsis thaliana]
Length=191

 Score =   147 bits (370),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC++CADHFKE+LR+NP QAGSQ EFSQWLCHVHN VNRSLGK +FPCERVD
Sbjct  110  MTILSRMYPCRECADHFKEILRSNPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVD  169

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKL+CEQ +CDL G+
Sbjct  170  ARWGKLECEQKSCDLHGT  187



>ref|XP_010909086.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 isoform X2 [Elaeis 
guineensis]
Length=174

 Score =   146 bits (369),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            +  QM ILSR+YPCK+CADHFKE+L+ANPVQAGSQAEFSQWLCHVHN+VNRSLGK  FPC
Sbjct  86   IAAQMVILSRLYPCKECADHFKEILKANPVQAGSQAEFSQWLCHVHNIVNRSLGKLTFPC  145

Query  219  ERVDARWGKLDCEQHNCDLQGS  284
             RV+ARWGKLDC+   CDLQG+
Sbjct  146  NRVNARWGKLDCKDRACDLQGT  167



>ref|XP_008787162.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like [Phoenix dactylifera]
Length=194

 Score =   146 bits (369),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSR+YPCK+CADHFKEVL+ANPVQAGSQAEFSQWLCHVHNVVNRSLGK  FP ER++
Sbjct  117  MAILSRLYPCKECADHFKEVLKANPVQAGSQAEFSQWLCHVHNVVNRSLGKSTFPSERLN  176

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKLDCE   CD++GS
Sbjct  177  ARWGKLDCEDRGCDVEGS  194



>ref|NP_001148317.1| augmenter of liver regeneration [Zea mays]
 gb|ACG30576.1| augmenter of liver regeneration [Zea mays]
Length=188

 Score =   146 bits (369),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M I+SR+YPCK+CADHFKEVL+ANPVQAGSQA+FSQWLC+VHNVVNRSLGKPIFPC+RV 
Sbjct  104  MHIISRLYPCKECADHFKEVLKANPVQAGSQADFSQWLCYVHNVVNRSLGKPIFPCQRVT  163

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKLDC + +CDL+GS
Sbjct  164  ARWGKLDCPERSCDLEGS  181



>tpg|DAA43898.1| TPA: augmenter of liver regeneration [Zea mays]
Length=188

 Score =   146 bits (368),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M I+SR+YPCK+CADHFKEVL+ANPVQAGSQA+FSQWLC+VHNVVNRSLGKPIFPC+RV 
Sbjct  104  MHIISRLYPCKECADHFKEVLKANPVQAGSQADFSQWLCYVHNVVNRSLGKPIFPCQRVT  163

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKLDC + +CDL+GS
Sbjct  164  ARWGKLDCPERSCDLEGS  181



>ref|XP_006393205.1| hypothetical protein EUTSA_v10011740mg [Eutrema salsugineum]
 gb|ESQ30491.1| hypothetical protein EUTSA_v10011740mg [Eutrema salsugineum]
Length=245

 Score =   147 bits (372),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC++CADHFKE+LR+NP QAGSQ EFSQWLCHVHN VNRSLGK +FPCERVD
Sbjct  164  MAILSRMYPCRECADHFKEILRSNPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVD  223

Query  231  ARWGKLDCEQHNCDLQGSD  287
            ARWGKL+CEQ +CDL G+ 
Sbjct  224  ARWGKLECEQKSCDLHGTS  242



>ref|XP_008347043.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like isoform X2 
[Malus domestica]
Length=209

 Score =   146 bits (368),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHF+E+LR+NPVQAGS AEFSQWLCHVHN VNRS+ KPIFPCERVD
Sbjct  122  MSILSRMYPCKECADHFQEILRSNPVQAGSHAEFSQWLCHVHNTVNRSINKPIFPCERVD  181

Query  231  ARWGKLDCEQHNCDLQG  281
            ARWGKL+CE+  CDL G
Sbjct  182  ARWGKLECERRACDLLG  198



>ref|XP_010905288.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like isoform X1 
[Elaeis guineensis]
Length=188

 Score =   145 bits (367),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M I+SR+YPCK+CADHFKEVL+ANPVQAGSQAEFSQWLCHVHNVVNRSLGK  FP ERV+
Sbjct  111  MAIISRLYPCKECADHFKEVLKANPVQAGSQAEFSQWLCHVHNVVNRSLGKLTFPSERVN  170

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKLDCE   CD++GS
Sbjct  171  ARWGKLDCEDGGCDVEGS  188



>ref|XP_004289791.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like [Fragaria 
vesca subsp. vesca]
Length=191

 Score =   145 bits (366),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHF+E+LR+NPVQAGS AEFSQWLCHVHN VNRSL K IFPCERVD
Sbjct  108  MSILSRMYPCKECADHFQEILRSNPVQAGSHAEFSQWLCHVHNTVNRSLNKVIFPCERVD  167

Query  231  ARWGKLDCEQHNCDLQGSD  287
            ARWGKL+CEQ  CD+ GS 
Sbjct  168  ARWGKLECEQRACDVLGSS  186



>ref|XP_004498850.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like [Cicer arietinum]
Length=187

 Score =   145 bits (366),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            ILSRMYPCK+CADHFKEVLR+NPVQAGS AEFSQWLCHVHNVVNRS+GKP+F CERVDAR
Sbjct  105  ILSRMYPCKECADHFKEVLRSNPVQAGSHAEFSQWLCHVHNVVNRSIGKPVFHCERVDAR  164

Query  237  WGKLDCEQHNCDLQGSDKLW  296
            WGKL+CEQ  C++ G+  ++
Sbjct  165  WGKLECEQKACEIIGTTSIF  184



>ref|XP_007156316.1| hypothetical protein PHAVU_003G276100g [Phaseolus vulgaris]
 ref|XP_007156317.1| hypothetical protein PHAVU_003G276100g [Phaseolus vulgaris]
 gb|ESW28310.1| hypothetical protein PHAVU_003G276100g [Phaseolus vulgaris]
 gb|ESW28311.1| hypothetical protein PHAVU_003G276100g [Phaseolus vulgaris]
Length=196

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            ILSRMYPC++CADHFK++LRANPVQ GS AEFSQWLCHVHNVVNRSL KP+FPCERVDAR
Sbjct  114  ILSRMYPCRECADHFKDILRANPVQTGSHAEFSQWLCHVHNVVNRSLDKPVFPCERVDAR  173

Query  237  WGKLDCEQHNCDLQGSDKLW  296
            WGKL+CEQ  C++ GS  L+
Sbjct  174  WGKLECEQKACEIIGSTSLF  193



>ref|XP_004511174.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like [Cicer arietinum]
Length=192

 Score =   145 bits (366),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            ILSRMYPCK+CADHFKEVLR+NPVQAGS AEFSQWLCHVHNVVNRS+GKP+F CERVDAR
Sbjct  110  ILSRMYPCKECADHFKEVLRSNPVQAGSHAEFSQWLCHVHNVVNRSIGKPVFHCERVDAR  169

Query  237  WGKLDCEQHNCDLQGSDKLW  296
            WGKL+CEQ  C++ G+  ++
Sbjct  170  WGKLECEQKACEIIGTTSIF  189



>ref|XP_003558546.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 [Brachypodium distachyon]
Length=191

 Score =   145 bits (366),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ++SR+YPCK+CADHFKEVL+ANPVQAGSQAEFSQWLC+VHNVVNRSLGK IFPC+RV+
Sbjct  107  MALISRLYPCKECADHFKEVLKANPVQAGSQAEFSQWLCYVHNVVNRSLGKTIFPCQRVN  166

Query  231  ARWGKLDCEQHNCDLQGSDKL  293
            ARWGKLDC +  CDL+GS+ +
Sbjct  167  ARWGKLDCPERLCDLEGSNDI  187



>ref|XP_008373045.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 [Malus domestica]
Length=209

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHF+E+LR+NPVQAGS AEFSQWLCHVHN VNRS+ KPIFPCERVD
Sbjct  122  MSILSRMYPCKECADHFQEILRSNPVQAGSHAEFSQWLCHVHNTVNRSVNKPIFPCERVD  181

Query  231  ARWGKLDCEQHNCDLQG  281
            ARWGKL+CE+  CDL G
Sbjct  182  ARWGKLECERRACDLLG  198



>gb|EMT33766.1| FAD-linked sulfhydryl oxidase ALR [Aegilops tauschii]
Length=164

 Score =   144 bits (363),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M +LSR+YPCK+CA+HFKEVL+ANPVQAGSQAEFSQWLC+VHNVVNRSLGK IFPC+RV+
Sbjct  80   MALLSRIYPCKECAEHFKEVLKANPVQAGSQAEFSQWLCYVHNVVNRSLGKTIFPCQRVN  139

Query  231  ARWGKLDCEQHNCDLQGSDKL  293
            ARWGKLDC    CDL+GS+ +
Sbjct  140  ARWGKLDCPDRACDLEGSNDI  160



>emb|CDY03576.1| BnaC03g68350D [Brassica napus]
Length=190

 Score =   144 bits (364),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC++CADHFKE+LR+NP +AGSQ EFSQWLCHVHN VNRSLGK +FPCERVD
Sbjct  109  MAILSRMYPCRECADHFKEILRSNPPRAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVD  168

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKL+CEQ +CDL G+
Sbjct  169  ARWGKLECEQKSCDLHGT  186



>ref|XP_004156855.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like [Cucumis sativus]
 gb|KGN52776.1| hypothetical protein Csa_4G000950 [Cucumis sativus]
Length=197

 Score =   145 bits (365),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC +CADHFKEVLRANPV+ GS A+FS+WLC VHNVVNRSLGKPIFPCERVD
Sbjct  110  MAILSRMYPCGECADHFKEVLRANPVETGSHADFSRWLCRVHNVVNRSLGKPIFPCERVD  169

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKL+CEQ  CD+ GS
Sbjct  170  ARWGKLECEQRACDVLGS  187



>ref|XP_009107254.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 [Brassica rapa]
Length=189

 Score =   144 bits (364),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC++CADHFKE+LR+NP +AGSQ EFSQWLCHVHN VNRSLGK +FPCERVD
Sbjct  108  MAILSRMYPCRECADHFKEILRSNPPRAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVD  167

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKL+CEQ +CDL G+
Sbjct  168  ARWGKLECEQKSCDLHGT  185



>ref|XP_008792627.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 [Phoenix dactylifera]
Length=206

 Score =   145 bits (365),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSR+YPCK+CADHFKE+L+ANPVQAGSQAEFSQWLCHVHNVVNRSLGK  FPC RV+
Sbjct  122  MVILSRLYPCKECADHFKEILKANPVQAGSQAEFSQWLCHVHNVVNRSLGKLTFPCNRVN  181

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKLDC+   CDLQG+
Sbjct  182  ARWGKLDCKDRACDLQGT  199



>ref|XP_004152374.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like [Cucumis sativus]
Length=197

 Score =   144 bits (364),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC +CADHFKEVLRANPV+ GS A+FS+WLC VHNVVNRSLGKPIFPCERVD
Sbjct  110  MAILSRMYPCGECADHFKEVLRANPVETGSHADFSRWLCRVHNVVNRSLGKPIFPCERVD  169

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKL+CEQ  CD+ GS
Sbjct  170  ARWGKLECEQRACDVLGS  187



>emb|CDY16533.1| BnaA08g02340D [Brassica napus]
Length=189

 Score =   144 bits (363),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC++CADHFKE+LR+NP +AGSQ EFSQWLCHVHN VNRSLGK +FPCERVD
Sbjct  108  MAILSRMYPCRECADHFKEILRSNPPRAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVD  167

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKL+CEQ +CDL G+
Sbjct  168  ARWGKLECEQKSCDLHGT  185



>gb|EYU37205.1| hypothetical protein MIMGU_mgv1a020352mg [Erythranthe guttata]
Length=198

 Score =   144 bits (364),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHFKEV+R+NPV+AGS  EFSQW+C VHNVVNRSLGK +FPCERVD
Sbjct  112  MAILSRMYPCKECADHFKEVIRSNPVEAGSHHEFSQWVCRVHNVVNRSLGKLVFPCERVD  171

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKL+CEQ  CDLQG+
Sbjct  172  ARWGKLECEQRACDLQGT  189



>ref|XP_010909084.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 isoform X1 [Elaeis 
guineensis]
 ref|XP_010909085.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 isoform X1 [Elaeis 
guineensis]
Length=190

 Score =   144 bits (363),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSR+YPCK+CADHFKE+L+ANPVQAGSQAEFSQWLCHVHN+VNRSLGK  FPC RV+
Sbjct  106  MVILSRLYPCKECADHFKEILKANPVQAGSQAEFSQWLCHVHNIVNRSLGKLTFPCNRVN  165

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKLDC+   CDLQG+
Sbjct  166  ARWGKLDCKDRACDLQGT  183



>ref|XP_003546726.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like isoform X1 
[Glycine max]
 ref|XP_006598116.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like isoform X3 
[Glycine max]
 gb|KHN25116.1| FAD-linked sulfhydryl oxidase ERV1 [Glycine soja]
Length=200

 Score =   144 bits (363),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +L R+YPC +C DHFKEVLRANPVQ GS AEFSQWLCHVHNVVNRSLGKPIFPCERVDAR
Sbjct  113  MLPRIYPCGECRDHFKEVLRANPVQTGSHAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  172

Query  237  WGKLDCEQHNCDLQGSDKLW*RDIFK  314
            WGKLDCEQ+ C++ GS  ++ R I+K
Sbjct  173  WGKLDCEQNACEIIGSTSIF-RKIWK  197



>ref|XP_008454384.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 [Cucumis melo]
Length=197

 Score =   144 bits (362),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPC +CADHFKEVLRANPV+ GS AEFS+WLC VHNVVNRSLGKPIFPCERVD
Sbjct  110  MAILSRMYPCGECADHFKEVLRANPVETGSHAEFSRWLCRVHNVVNRSLGKPIFPCERVD  169

Query  231  ARWGKLDCEQHNCDLQGS  284
             RWGK++CEQ  CD+ GS
Sbjct  170  GRWGKVECEQRACDVLGS  187



>ref|XP_006598115.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like isoform X2 
[Glycine max]
Length=230

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +L R+YPC +C DHFKEVLRANPVQ GS AEFSQWLCHVHNVVNRSLGKPIFPCERVDAR
Sbjct  143  MLPRIYPCGECRDHFKEVLRANPVQTGSHAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  202

Query  237  WGKLDCEQHNCDLQGSDKLW*RDIFK  314
            WGKLDCEQ+ C++ GS  ++ R I+K
Sbjct  203  WGKLDCEQNACEIIGSTSIF-RKIWK  227



>gb|EYU37204.1| hypothetical protein MIMGU_mgv1a022490mg, partial [Erythranthe 
guttata]
Length=103

 Score =   139 bits (350),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSR+YPCK+CADHFKEV+R+NPV+AGS  EFSQW+C VHNVVNRSLGK +FPCERV+
Sbjct  17   MAILSRIYPCKECADHFKEVIRSNPVEAGSHHEFSQWVCRVHNVVNRSLGKLVFPCERVE  76

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKL+CEQ  CDLQG+
Sbjct  77   ARWGKLECEQRACDLQGT  94



>gb|EYU37586.1| hypothetical protein MIMGU_mgv1a025602mg [Erythranthe guttata]
Length=251

 Score =   143 bits (360),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHFKEV+R+NPV+AGS  EFSQW+C VHNVVNRSLGK +FPCERV+
Sbjct  165  MAILSRMYPCKECADHFKEVIRSNPVEAGSHHEFSQWVCRVHNVVNRSLGKLVFPCERVE  224

Query  231  ARWGKLDCEQHNCDLQGSD  287
            ARWGKL+CEQ  CDLQG+ 
Sbjct  225  ARWGKLECEQRACDLQGTS  243



>ref|XP_003542836.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1 isoform 2 [Glycine 
max]
 gb|KHN37648.1| FAD-linked sulfhydryl oxidase ERV1 [Glycine soja]
Length=197

 Score =   140 bits (354),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +L R+YPC++C DHFKEVLRANPV  GS AEFSQWLCHVHNVVNRSL KPIFPCERVDAR
Sbjct  110  MLPRIYPCRECRDHFKEVLRANPVLTGSHAEFSQWLCHVHNVVNRSLAKPIFPCERVDAR  169

Query  237  WGKLDCEQHNCDLQGSDKLW*R  302
            WGKLDCEQ+ C++ GS  ++ R
Sbjct  170  WGKLDCEQNACEIIGSTSIFGR  191



>ref|XP_008366502.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like [Malus domestica]
Length=184

 Score =   129 bits (323),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRMYPCK+CADHF+E+LR+NPVQAGS AEFSQWLCHVHN VNRSL KP+FPCERVD
Sbjct  117  MSILSRMYPCKECADHFQEILRSNPVQAGSHAEFSQWLCHVHNTVNRSLNKPVFPCERVD  176

Query  231  ARWGKL  248
            AR GK 
Sbjct  177  ARXGKF  182



>gb|EPS60171.1| hypothetical protein M569_14634, partial [Genlisea aurea]
Length=169

 Score =   127 bits (320),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            MGILSRMYPCK+CA HF+ +LR+NPVQAG+  E S+W+C VHNVVNRSLGK  FPCERVD
Sbjct  94   MGILSRMYPCKECAQHFQRILRSNPVQAGTHDELSRWMCDVHNVVNRSLGKVSFPCERVD  153

Query  231  ARWGKLDCEQHNCDLQ  278
             RWG+L+CE   CDL+
Sbjct  154  GRWGRLECENRGCDLE  169



>gb|ADE75626.1| unknown [Picea sitchensis]
Length=214

 Score =   129 bits (323),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSR+YPCKDC +HFKE+L+ANPVQ  S AE +QW+C VHN+VNRSL KP FPC+RVD
Sbjct  131  MAILSRVYPCKDCGEHFKEILKANPVQVDSGAELAQWMCQVHNIVNRSLDKPKFPCQRVD  190

Query  231  ARWGKLDCEQHNCDLQG  281
            ARWG L+C++  CDLQG
Sbjct  191  ARWGALECDEGACDLQG  207



>ref|XP_002313169.2| Erv1/Alr family protein [Populus trichocarpa]
 gb|EEE87124.2| Erv1/Alr family protein [Populus trichocarpa]
Length=197

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRM P + C + FK+ L  NPVQAGS AEFSQWLCHVHNVVNRSLGK +FPCERVD
Sbjct  115  MAILSRMSPSQKCPNPFKKFL-INPVQAGSHAEFSQWLCHVHNVVNRSLGKLVFPCERVD  173

Query  231  ARWGKLDCEQHNCDLQGSDKL  293
            ARWGKL+CEQ  CDLQG+   
Sbjct  174  ARWGKLECEQRACDLQGTTNF  194



>gb|KDO38067.1| hypothetical protein CISIN_1g034937mg [Citrus sinensis]
Length=78

 Score =   122 bits (305),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 63/78 (81%), Gaps = 8/78 (10%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M ILSRM        HFKEVLRANPVQA S  EFSQWLCHVHNVVNRSLGK +FPCERVD
Sbjct  1    MAILSRM--------HFKEVLRANPVQAESHDEFSQWLCHVHNVVNRSLGKLVFPCERVD  52

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKL+CEQ  CDLQG+
Sbjct  53   ARWGKLECEQRACDLQGT  70



>gb|EEC74725.1| hypothetical protein OsI_10452 [Oryza sativa Indica Group]
 gb|EEE58546.1| hypothetical protein OsJ_09843 [Oryza sativa Japonica Group]
Length=275

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M I+SR+YPCK+CA+HFKEVL+ANPVQAGSQAEFSQWLC+VHNVVNRSLGKPIFPC+RV+
Sbjct  110  MAIISRLYPCKECAEHFKEVLKANPVQAGSQAEFSQWLCYVHNVVNRSLGKPIFPCQRVN  169

Query  231  ARW  239
            ARW
Sbjct  170  ARW  172



>ref|XP_001751213.1| predicted protein [Physcomitrella patens]
 gb|EDQ83530.1| predicted protein [Physcomitrella patens]
Length=123

 Score =   121 bits (303),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 1/78 (1%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M I++R+YPCK CADHFKE+L+A PV+A S AE +QW+C VHNVVNRSLGKP FPCERVD
Sbjct  41   MSIMTRLYPCKTCADHFKEILKAYPVKADSGAELAQWMCQVHNVVNRSLGKPHFPCERVD  100

Query  231  ARWGKLDCEQHN-CDLQG  281
            ARWG L C++   CDL+G
Sbjct  101  ARWGALHCDEAGACDLEG  118



>ref|XP_002976837.1| hypothetical protein SELMODRAFT_105740, partial [Selaginella 
moellendorffii]
 ref|XP_002980565.1| hypothetical protein SELMODRAFT_113099, partial [Selaginella 
moellendorffii]
 gb|EFJ18216.1| hypothetical protein SELMODRAFT_113099, partial [Selaginella 
moellendorffii]
 gb|EFJ21947.1| hypothetical protein SELMODRAFT_105740, partial [Selaginella 
moellendorffii]
Length=120

 Score =   117 bits (294),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M I+SRMYPCK+CADHFKEVL++NPV+A S  + SQW+C VHN+VNRSLGKP F CERVD
Sbjct  38   MAIISRMYPCKECADHFKEVLKSNPVRANSGVDLSQWMCRVHNIVNRSLGKPQFSCERVD  97

Query  231  ARWGKLDCEQHNCDLQG  281
            ARWG L C+   CD+ G
Sbjct  98   ARWGALHCDG-ACDVHG  113



>gb|KEH15539.1| FAD-linked sulfhydryl oxidase ERV1-like protein, partial [Medicago 
truncatula]
Length=59

 Score =   113 bits (283),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFP  215
            M  Q+ ILSRMYPCK+CADHFKEVLR+NPVQAGS AEFSQWLCHVHNVVNRS+GKPIFP
Sbjct  1    METQVQILSRMYPCKECADHFKEVLRSNPVQAGSHAEFSQWLCHVHNVVNRSIGKPIFP  59



>ref|XP_010665046.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like [Vitis vinifera]
Length=106

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  105  EVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDARWGKLDCEQHNCDLQGS  284
            ++ +ANPVQAGSQAEFSQWLCHVHNVVNRSL KPIFPC+RVDARWGKL CE   C LQG+
Sbjct  41   QIEKANPVQAGSQAEFSQWLCHVHNVVNRSLNKPIFPCKRVDARWGKLKCELRACYLQGT  100



>ref|XP_006422846.1| hypothetical protein CICLE_v10029975mg [Citrus clementina]
 gb|ESR36086.1| hypothetical protein CICLE_v10029975mg [Citrus clementina]
Length=79

 Score =   105 bits (262),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 57/73 (78%), Gaps = 3/73 (4%)
 Frame = +3

Query  69   MYPCKDCADHFKEVL-RANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDARWGK  245
            MYP     D F  +  RANPVQA S  EFSQWLCHVHNVVNRSLGK +FPCERVDARWGK
Sbjct  1    MYPL--LMDVFLLMFDRANPVQAESHDEFSQWLCHVHNVVNRSLGKLVFPCERVDARWGK  58

Query  246  LDCEQHNCDLQGS  284
            L+CEQ  CDLQG+
Sbjct  59   LECEQRACDLQGT  71



>ref|XP_001774132.1| predicted protein [Physcomitrella patens]
 gb|EDQ61046.1| predicted protein [Physcomitrella patens]
Length=114

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M I+SR+YPCK CA+HFKE+L+ NP +A S  +  QW+C VHN+VN+SLGKP F CE+ +
Sbjct  37   MAIISRLYPCKTCAEHFKEILKTNPPKAKSGLDLVQWMCQVHNLVNKSLGKPQFRCEQAE  96

Query  231  ARWGKLDCEQHNCDL  275
             RWG  +C+   CDL
Sbjct  97   LRWGTFNCD-GACDL  110



>ref|XP_006486937.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like isoform X3 
[Citrus sinensis]
Length=167

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRS  194
            M ILSRMYPCK+CADHF+EVLRANPVQAGS  EFSQWLCHVHNVVNRS
Sbjct  116  MAILSRMYPCKECADHFREVLRANPVQAGSHDEFSQWLCHVHNVVNRS  163



>ref|XP_002465673.1| hypothetical protein SORBIDRAFT_01g043500 [Sorghum bicolor]
 gb|EER92671.1| hypothetical protein SORBIDRAFT_01g043500 [Sorghum bicolor]
Length=163

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCE  221
            M I+SR+YPCK+CADHFKEVL++NPVQAGSQAEFSQWLC+VHNVV  +LG   FP +
Sbjct  106  MHIISRLYPCKECADHFKEVLKSNPVQAGSQAEFSQWLCYVHNVVIEALGSQYFPAK  162



>gb|KEH15538.1| FAD-linked sulfhydryl oxidase ERV1-like protein, partial [Medicago 
truncatula]
Length=63

 Score = 94.0 bits (232),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNR  191
            + ILSRMYPCK+CADHFKEVLR+NPVQAGS AEFSQWLCHVHNVVNR
Sbjct  17   VQILSRMYPCKECADHFKEVLRSNPVQAGSHAEFSQWLCHVHNVVNR  63



>gb|KHG00105.1| FAD-linked sulfhydryl oxidase ERV1 -like protein [Gossypium arboreum]
Length=389

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGK  203
            M ILSRMYPC +CA HF+EVLRANPVQAGS  EFSQWLCHVHNV+NRSLGK
Sbjct  311  MSILSRMYPCNECAGHFEEVLRANPVQAGSHEEFSQWLCHVHNVINRSLGK  361



>ref|XP_006486936.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like isoform X2 
[Citrus sinensis]
Length=176

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNR  191
            M ILSRMYPCK+CADHF+EVLRANPVQAGS  EFSQWLCHVHNVVNR
Sbjct  116  MAILSRMYPCKECADHFREVLRANPVQAGSHDEFSQWLCHVHNVVNR  162



>ref|XP_008675741.1| PREDICTED: augmenter of liver regeneration isoform X1 [Zea mays]
Length=165

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSL  197
            M I+SR+YPCK+CADHFKEVL+ANPVQAGSQA+FSQWLC+VHNVVNR +
Sbjct  104  MHIISRLYPCKECADHFKEVLKANPVQAGSQADFSQWLCYVHNVVNRRI  152



>emb|CEF99903.1| Erv1/Alr [Ostreococcus tauri]
Length=180

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            +GI++R+YPC +CA HF+E++R NP    S  E  +W+C VHN VN SLGKP+F C +  
Sbjct  93   IGIMTRLYPCGECARHFEEIVRKNPPDCTSGLELQRWMCEVHNEVNTSLGKPMFDCAKTS  152

Query  231  ARWGKLDCE  257
             RW +LDC+
Sbjct  153  QRWSRLDCD  161



>ref|XP_003082338.1| Mitochondrial sulfhydryl oxidase involved in the biogenesis of 
cytosolic Fe/S proteins (ISS) [Ostreococcus tauri]
Length=180

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            +GI++R+YPC +CA HF+E++R NP    S  E  +W+C VHN VN SLGKP+F C +  
Sbjct  93   IGIMTRLYPCGECARHFEEIVRKNPPDCTSGLELQRWMCEVHNEVNTSLGKPMFDCAKTS  152

Query  231  ARWGKLDCE  257
             RW +LDC+
Sbjct  153  QRWSRLDCD  161



>ref|XP_005847374.1| hypothetical protein CHLNCDRAFT_35514 [Chlorella variabilis]
 gb|EFN55272.1| hypothetical protein CHLNCDRAFT_35514 [Chlorella variabilis]
Length=210

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M IL+RMYPC +CA HF+EV+RA+P    S+A FS W+C  HN VNR LGKP F C  V+
Sbjct  124  MDILTRMYPCGECARHFREVVRASPPAVDSRAAFSLWMCEAHNTVNRQLGKPAFNCALVE  183

Query  231  ARWG  242
            ARW 
Sbjct  184  ARWA  187



>ref|XP_001703298.1| sulfhydryl oxidase [Chlamydomonas reinhardtii]
 gb|EDP05980.1| sulfhydryl oxidase [Chlamydomonas reinhardtii]
Length=281

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   LSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDARW  239
            L+R+YPC DCA+HF E++R +P   GS  EF +WLC VHN VN  LGKP+F C+ V+ARW
Sbjct  187  LTRIYPCGDCAEHFAEIVRRDPPAVGSGREFRRWLCGVHNRVNSRLGKPVFNCDLVEARW  246

Query  240  GKLDCE  257
              L C 
Sbjct  247  APLGCS  252



>ref|XP_006598117.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like isoform X4 
[Glycine max]
Length=192

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRS  194
            +L R+YPC +C DHFKEVLRANPVQ GS AEFSQWLCHVHNVVNRS
Sbjct  143  MLPRIYPCGECRDHFKEVLRANPVQTGSHAEFSQWLCHVHNVVNRS  188



>ref|XP_001420816.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99109.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=110

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            IL+R YPC +CA HF E++R NP    S     +W+C VHN VN SLGK  F C +VD R
Sbjct  43   ILTRAYPCGECAAHFAEIVRVNPPDCSSGLALQRWMCAVHNEVNASLGKAWFDCAKVDGR  102

Query  237  WGKLDCEQ  260
            W KL+C++
Sbjct  103  WSKLECDE  110



>ref|XP_005184939.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR-like [Musca domestica]
Length=171

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LSR+YPC+ CA  F++ LR NPVQ  SQ +FSQWLC  HN VN  LGKP F C +V+ R
Sbjct  101  VLSRLYPCEYCAQDFRKDLRENPVQVNSQKDFSQWLCQFHNRVNVKLGKPEFDCSKVNER  160

Query  237  W  239
            W
Sbjct  161  W  161



>gb|KFM23758.1| FAD-linked sulfhydryl oxidase ERV1 [Auxenochlorella protothecoides]
Length=112

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + IL+RMYPC +CA HFKE++R NP +  S  E  Q++C +HN VN+ L KP F C    
Sbjct  21   IDILTRMYPCGECAAHFKELVRNNPPRVASGPELQQYMCELHNQVNQRLRKPAFNCALAG  80

Query  231  ARWGKLDCEQ  260
            ARW  LDC++
Sbjct  81   ARWRALDCDE  90



>ref|XP_005649822.1| hypothetical protein COCSUDRAFT_9381, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25278.1| hypothetical protein COCSUDRAFT_9381, partial [Coccomyxa subellipsoidea 
C-169]
Length=115

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
             L+R+YPC +CA+HF++++R+      S  E  QW C VHN+VN SLGK  F C+ V AR
Sbjct  39   TLTRIYPCGECANHFRDIVRSKAPATSSAEELQQWACEVHNLVNASLGKASFNCKLVQAR  98

Query  237  WGKLDC  254
            W  LDC
Sbjct  99   WNGLDC  104



>ref|XP_007512315.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66403.1| predicted protein [Bathycoccus prasinos]
Length=210

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            +  ++ +YPCK+C  HFK V+  NP +  S   F +W+C VHN VN  LGK +F C ++D
Sbjct  117  INAMATLYPCKECQTHFKTVIERNPPEVDSSVSFQEWMCKVHNAVNEKLGKELFDCAKID  176

Query  231  ARWGKLDC  254
             RWG ++C
Sbjct  177  ERWGGVEC  184



>gb|EQB61710.1| protein of the erv1 alr family [Nosema apis BRL 01]
Length=169

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LS ++PC +CA HF+++L+ NP Q  S  EF+QWLC  HN+VN+ L KPI  C+++D  
Sbjct  102  LLSSLFPCGECAGHFQKLLKENPPQVNSHDEFTQWLCKAHNIVNKRLNKPIIECKKIDEM  161

Query  237  WG  242
            W 
Sbjct  162  WS  163



>ref|XP_002946841.1| hypothetical protein VOLCADRAFT_46761 [Volvox carteri f. nagariensis]
 gb|EFJ52067.1| hypothetical protein VOLCADRAFT_46761 [Volvox carteri f. nagariensis]
Length=102

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  60   LSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDARW  239
            L+R+YPC DCA HF E++R +P    S   F +WLC +HN VN  LGKP+F C+ V++RW
Sbjct  38   LTRIYPCGDCARHFAELVRRDPPVVSSGPAFRRWLCQIHNRVNARLGKPLFNCDLVESRW  97

Query  240  GKLDC  254
              L C
Sbjct  98   APLGC  102



>ref|XP_004992076.1| sulfhydryl oxidase [Salpingoeca rosetta]
 gb|EGD75619.1| sulfhydryl oxidase [Salpingoeca rosetta]
Length=216

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   M +LSR YPC++CAD F E ++ +P    S++ F+QW+C  HN VN  LGKP F C
Sbjct  140  MKEMMRLLSRFYPCRECADDFGEYIQKDPPDTTSRSAFAQWMCKAHNAVNVRLGKPAFDC  199

Query  219  ERVDARW  239
             +VD RW
Sbjct  200  SKVDERW  206



>ref|XP_001744987.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90220.1| predicted protein [Monosiga brevicollis MX1]
Length=111

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   M ++ R YPC+DC +H    + A+PV A S   F++WLC  HN VN  LGKPIF C
Sbjct  35   MAEMMRLVGRFYPCRDCGEHLGHYIEAHPVDASSGPAFARWLCGAHNDVNERLGKPIFDC  94

Query  219  ERVDARW  239
            ++V+ RW
Sbjct  95   DQVEERW  101



>gb|EFA83584.1| hypothetical protein PPL_02650 [Polysphondylium pallidum PN500]
Length=201

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            +   S++YPCK CA  F+EVL A P +  SQ EF+QW+C  HN VN+ LGKP F C++VD
Sbjct  128  LQAFSKVYPCKVCAKDFQEVLTATPARLQSQHEFAQWMCEAHNHVNKILGKPEFDCDQVD  187

Query  231  ARWGK  245
             RW +
Sbjct  188  KRWKR  192



>ref|XP_009221301.1| FAD-linked sulfhydryl oxidase ALR [Gaeumannomyces graminis var. 
tritici R3-111a-1]
 gb|EJT75301.1| FAD-linked sulfhydryl oxidase ALR [Gaeumannomyces graminis var. 
tritici R3-111a-1]
Length=182

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            +V  MG+ S++YPC  CAD F+  +R  PVQA S+ +F QWLC  HN VN+ LGKP+F C
Sbjct  106  LVGFMGLFSKLYPCWVCADDFQAYMRREPVQARSRGDFGQWLCDAHNDVNKKLGKPVFDC  165

Query  219  ERVDARW  239
               + RW
Sbjct  166  RLWEQRW  172



>ref|XP_006965065.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR49071.1| predicted protein [Trichoderma reesei QM6a]
Length=112

 Score = 76.3 bits (186),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            +G+ S++YPC  CA+ F+  L     Q  S+ EFSQWLC  HN VNR LGKP F C RVD
Sbjct  40   VGLFSKLYPCWVCAEDFQGYLARQKPQVSSREEFSQWLCRAHNDVNRKLGKPEFDCSRVD  99

Query  231  ARW  239
             RW
Sbjct  100  ERW  102



>gb|EJW04303.1| hypothetical protein EDEG_01427 [Edhazardia aedis USNM 41457]
Length=167

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            +++ + +LS++YPC DCA+HF+E+L+  P +  +  EF+ WLC  HN VN+ LGK IF C
Sbjct  93   VLMFIHLLSKLYPCGDCAEHFQELLKNLPPKVDNHDEFALWLCTAHNTVNKRLGKAIFDC  152

Query  219  ERVDARW  239
             +VD  W
Sbjct  153  SKVDEVW  159



>ref|XP_004529672.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR-like [Ceratitis 
capitata]
Length=165

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + +LSR+YPC+ CA  F++ L+ +P Q  SQ EFSQWLC  HN VN  LGK  F C +V+
Sbjct  93   LDVLSRVYPCEHCAKDFRKDLKEHPAQVNSQYEFSQWLCKFHNRVNVKLGKAQFDCSKVN  152

Query  231  ARW  239
             RW
Sbjct  153  ERW  155



>ref|XP_010139072.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR, partial [Buceros 
rhinoceros silvestris]
Length=83

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  11   INLFSKFYPCEHCAEDLRERLRTNQPDTSTRTNFSQWLCLLHNEVNRKLGKSEFDCSRVD  70

Query  231  ARW  239
             RW
Sbjct  71   ERW  73



>ref|XP_009502266.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR, partial [Phalacrocorax 
carbo]
 gb|KFW96484.1| FAD-linked sulfhydryl oxidase ALR, partial [Phalacrocorax carbo]
Length=82

 Score = 74.7 bits (182),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     S+  FSQWLC +HN VNR LGK  F C RVD
Sbjct  10   INLFSKFYPCEHCAEDLRERLRTNQPDTSSRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  69

Query  231  ARW  239
             RW
Sbjct  70   ERW  72



>ref|XP_004360441.1| hypothetical protein DFA_04720 [Dictyostelium fasciculatum]
 gb|EGG22590.1| hypothetical protein DFA_04720 [Dictyostelium fasciculatum]
Length=205

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +3

Query  60   LSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDARW  239
             S++YPCKDCA  F+ +LR  P +  +Q EFS+W+C  HN VN  LGKP+F C  VD RW
Sbjct  139  FSKVYPCKDCAQDFQGILRDTPPKLDNQKEFSKWMCDSHNHVNNLLGKPLFDCNLVDKRW  198



>ref|XP_010905289.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like isoform X2 
[Elaeis guineensis]
Length=162

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 45/78 (58%), Gaps = 26/78 (33%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M I+SR+YPCK+CADHFKEVL                          +LGK  FP ERV+
Sbjct  111  MAIISRLYPCKECADHFKEVL--------------------------NLGKLTFPSERVN  144

Query  231  ARWGKLDCEQHNCDLQGS  284
            ARWGKLDCE   CD++GS
Sbjct  145  ARWGKLDCEDGGCDVEGS  162



>ref|XP_010019315.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR, partial [Nestor 
notabilis]
Length=124

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            + S+ YPC+ CA+  +E LR N     ++  FSQWLCH+HN VNR LGK  F C RVD R
Sbjct  54   LFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCHLHNEVNRKLGKAEFDCSRVDER  113

Query  237  W  239
            W
Sbjct  114  W  114



>ref|XP_002024412.1| GL15019 [Drosophila persimilis]
 ref|XP_001354903.2| GA11683 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW29828.1| GL15019 [Drosophila persimilis]
 gb|EAL31959.2| GA11683 [Drosophila pseudoobscura pseudoobscura]
Length=185

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LSR+YPC+ CA  F+  L  NP+   SQ E S WLC  HN VN  LGKP+F C +V+ R
Sbjct  115  VLSRLYPCEFCAKDFRTDLTVNPINVNSQKELSSWLCMFHNRVNDKLGKPLFDCSKVNER  174

Query  237  W  239
            W
Sbjct  175  W  175



>gb|KFQ55516.1| FAD-linked sulfhydryl oxidase ALR, partial [Nestor notabilis]
Length=123

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            + S+ YPC+ CA+  +E LR N     ++  FSQWLCH+HN VNR LGK  F C RVD R
Sbjct  53   LFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCHLHNEVNRKLGKAEFDCSRVDER  112

Query  237  W  239
            W
Sbjct  113  W  113



>gb|KFO77108.1| FAD-linked sulfhydryl oxidase ALR, partial [Cuculus canorus]
Length=88

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +3

Query  21   HILPFHMVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLG  200
            H     M   + + S+ YPC+ CA+  +E LRAN     ++  FSQWLC +HN VNR LG
Sbjct  6    HTQQKEMRDFISLFSKFYPCEHCAEDLRERLRANQPDTSNRNNFSQWLCLLHNEVNRKLG  65

Query  201  KPIFPCERVDARW  239
            K  F C RVD RW
Sbjct  66   KSEFDCSRVDERW  78



>ref|XP_008631813.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Corvus brachyrhynchos]
Length=129

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E L+ N     +++ FSQWLC +HN VNR LGKP F C RVD
Sbjct  57   INLFSKFYPCEHCAEDLRERLQTNQPDTSTRSNFSQWLCLLHNDVNRKLGKPEFDCSRVD  116

Query  231  ARW  239
             RW
Sbjct  117  ERW  119



>gb|KFO58942.1| FAD-linked sulfhydryl oxidase ALR, partial [Corvus brachyrhynchos]
Length=123

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E L+ N     +++ FSQWLC +HN VNR LGKP F C RVD
Sbjct  51   INLFSKFYPCEHCAEDLRERLQTNQPDTSTRSNFSQWLCLLHNDVNRKLGKPEFDCSRVD  110

Query  231  ARW  239
             RW
Sbjct  111  ERW  113



>ref|XP_009560489.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Cuculus canorus]
Length=93

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +3

Query  21   HILPFHMVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLG  200
            H     M   + + S+ YPC+ CA+  +E LRAN     ++  FSQWLC +HN VNR LG
Sbjct  11   HTQQKEMRDFISLFSKFYPCEHCAEDLRERLRANQPDTSNRNNFSQWLCLLHNEVNRKLG  70

Query  201  KPIFPCERVDARW  239
            K  F C RVD RW
Sbjct  71   KSEFDCSRVDERW  83



>gb|EGI63891.1| FAD-linked sulfhydryl oxidase ALR [Acromyrmex echinatior]
Length=159

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M       S++YPC  CA+  +E L+ +P Q GSQ + SQWLC +HN VN+ LGKP F C
Sbjct  83   MTSFFDTFSKLYPCNICAEDLQERLKYSPPQTGSQEKLSQWLCRIHNEVNKKLGKPEFDC  142

Query  219  ERVDARW  239
            + V+ RW
Sbjct  143  KLVNQRW  149



>ref|XP_009975068.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR, partial [Tyto alba]
Length=114

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LRAN     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  42   INLFSKFYPCEHCAEDLRERLRANQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  101

Query  231  ARW  239
             RW
Sbjct  102  ERW  104



>gb|ETS02653.1| augmenter of liver regeneration [Trichoderma reesei RUT C-30]
Length=199

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            +G+ S++YPC  CA+ F+  L     Q  S+ EFSQWLC  HN VNR LGKP F C RVD
Sbjct  127  VGLFSKLYPCWVCAEDFQGYLARQKPQVSSREEFSQWLCRAHNDVNRKLGKPEFDCSRVD  186

Query  231  ARW  239
             RW
Sbjct  187  ERW  189



>ref|XP_011057094.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Acromyrmex echinatior]
Length=192

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M       S++YPC  CA+  +E L+ +P Q GSQ + SQWLC +HN VN+ LGKP F C
Sbjct  116  MTSFFDTFSKLYPCNICAEDLQERLKYSPPQTGSQEKLSQWLCRIHNEVNKKLGKPEFDC  175

Query  219  ERVDARW  239
            + V+ RW
Sbjct  176  KLVNQRW  182



>ref|XP_003887455.1| mitochondrial sulfhydryl oxidase [Encephalitozoon hellem ATCC 
50504]
 gb|AFM98474.1| mitochondrial sulfhydryl oxidase [Encephalitozoon hellem ATCC 
50504]
Length=163

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LS ++PC DC  HF+++LR +P + GS  EF  WLC VHNVVN  LGK +  C+ VD  
Sbjct  97   LLSSLFPCGDCTKHFQKLLRDHPPRVGSNEEFKTWLCEVHNVVNERLGKAVVDCKTVDEI  156

Query  237  W  239
            W
Sbjct  157  W  157



>ref|XP_002996554.1| hypothetical protein NCER_100332 [Nosema ceranae BRL01]
 gb|EEQ82883.1| hypothetical protein NCER_100332 [Nosema ceranae BRL01]
Length=169

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LS ++PC +C  HF+ +L  NP Q  +  EF QWLC  HN+VN+ LGKPI  C++V+  
Sbjct  102  LLSSLFPCAECCGHFQRLLSLNPPQVATHDEFVQWLCKAHNIVNKRLGKPIMDCKKVEGV  161

Query  237  W  239
            W
Sbjct  162  W  162



>gb|KFP17365.1| FAD-linked sulfhydryl oxidase ALR, partial [Egretta garzetta]
Length=85

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  13   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  72

Query  231  ARW  239
             RW
Sbjct  73   ERW  75



>ref|XP_001963570.1| GF20218 [Drosophila ananassae]
 gb|EDV44646.1| GF20218 [Drosophila ananassae]
Length=275

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LSR+YPC+ CA  F+  L  NP+   SQ E + WLC  HN VN  LGKP+F C +V+ R
Sbjct  205  VLSRLYPCEFCAKDFRTDLDVNPINVNSQKELAMWLCKFHNRVNDKLGKPLFDCSKVNER  264

Query  237  W  239
            W
Sbjct  265  W  265



>ref|XP_005716875.1| Growth factor [Chondrus crispus]
 emb|CDF37056.1| Growth factor [Chondrus crispus]
Length=136

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M   S +YPC  CA+ F+++++ NPV+A S + FS+W+C  HN VNR LGK +F C +V 
Sbjct  43   MKDFSEVYPCAPCAESFRDIMKRNPVEAHSGSAFSRWMCVAHNEVNRELGKDVFDCAKVA  102

Query  231  ARWGKLD-CEQHNCDLQ  278
             +WG  + C  H  +L 
Sbjct  103  DKWGICESCAAHEEELS  119



>pdb|3O55|A Chain A, Crystal Structure Of Human Fad-Linked Augmenter Of Liver 
Regeneration (Alr)
Length=125

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + + S+ YPC++CA+  ++ L  N     ++A F+QWLCH+HN VNR LGKP F C
Sbjct  49   MAQFIHLFSKFYPCEECAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDC  108

Query  219  ERVDARW  239
             +VD RW
Sbjct  109  SKVDERW  115



>gb|KFZ68027.1| FAD-linked sulfhydryl oxidase ALR, partial [Podiceps cristatus]
Length=120

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LRAN     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  48   INLFSKFYPCEHCAEDLRERLRANQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  107

Query  231  ARW  239
             RW
Sbjct  108  ERW  110



>gb|EHH31317.1| FAD-linked sulfhydryl oxidase ALR, partial [Macaca mulatta]
Length=132

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + + S+ YPC++CA+  +E L  N     ++A F+QWLCH+HN VNR LGKP F C
Sbjct  56   MAHFIHLFSKFYPCEECAEDLRERLCRNQPDTRTRAGFTQWLCHLHNEVNRKLGKPDFDC  115

Query  219  ERVDARW  239
             +VD RW
Sbjct  116  SKVDERW  122



>ref|XP_002071161.1| GK25283 [Drosophila willistoni]
 gb|EDW82147.1| GK25283 [Drosophila willistoni]
Length=191

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LSR+YPC+ CA  F+  L  NP+   SQ + + WLC  HN VN  LGKPIF C +V+ R
Sbjct  121  VLSRLYPCEFCAKDFRTDLDVNPINVNSQKDLTLWLCKFHNRVNDKLGKPIFDCSKVNER  180

Query  237  W  239
            W
Sbjct  181  W  181



>ref|XP_009090296.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Serinus canaria]
Length=124

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPCK CA+  +E LR N     ++  FS+WLC +HN VNR LGK  F C RVD
Sbjct  52   INLFSKFYPCKHCAEDLRERLRTNQPDTSNRKNFSRWLCQLHNEVNRKLGKSEFDCSRVD  111

Query  231  ARW  239
             RW
Sbjct  112  ERW  114



>ref|XP_002011249.1| GI16104 [Drosophila mojavensis]
 gb|EDW06091.1| GI16104 [Drosophila mojavensis]
Length=191

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LSR+YPC+ CA  F+  +  NPV   SQ + + WLC+ HN VN  LGKP+F C +V+ R
Sbjct  121  VLSRLYPCEYCAKDFRSDIEVNPVNVNSQKDLAMWLCNFHNRVNDKLGKPLFDCSKVNER  180

Query  237  W  239
            W
Sbjct  181  W  181



>gb|KFR08085.1| FAD-linked sulfhydryl oxidase ALR, partial [Opisthocomus hoazin]
Length=108

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  36   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  95

Query  231  ARW  239
             RW
Sbjct  96   ERW  98



>ref|XP_009704486.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR, partial [Cariama 
cristata]
Length=124

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     +++ FSQWLC +HN VNR LGK  F C RVD
Sbjct  52   INLFSKFYPCEHCAEDLRERLRGNQPDTSNRSNFSQWLCLLHNEVNRKLGKSEFDCSRVD  111

Query  231  ARW  239
             RW
Sbjct  112  ERW  114



>ref|XP_001990841.1| GH18034 [Drosophila grimshawi]
 gb|EDV93903.1| GH18034 [Drosophila grimshawi]
Length=190

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LSR+YPC+ CA  F+  +  NPV   SQ + + WLC  HN VN  LGKP+F C +V+ R
Sbjct  120  VLSRLYPCEYCAKDFRSEIEVNPVNVNSQKDLAMWLCKFHNRVNDKLGKPLFNCSKVNER  179

Query  237  W  239
            W
Sbjct  180  W  180



>ref|XP_002039476.1| GM22993 [Drosophila sechellia]
 gb|EDW56218.1| GM22993 [Drosophila sechellia]
Length=265

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LSR+YPC+ CA  F+  L  NP+   SQ E + WLC  HN VN  LGKP+F C +V+ R
Sbjct  195  VLSRLYPCEFCAKDFRTDLDVNPINVNSQKELALWLCKFHNRVNDKLGKPLFDCTKVNER  254

Query  237  W  239
            W
Sbjct  255  W  255



>ref|XP_002107437.1| GD17467 [Drosophila simulans]
 gb|EDX18420.1| GD17467 [Drosophila simulans]
Length=192

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LSR+YPC+ CA  F+  L  NP+   SQ E + WLC  HN VN  LGKP+F C +V+ R
Sbjct  122  VLSRLYPCEFCAKDFRTDLDVNPINVNSQKELALWLCKFHNRVNDKLGKPLFDCTKVNER  181

Query  237  W  239
            W
Sbjct  182  W  182



>gb|KFP32714.1| FAD-linked sulfhydryl oxidase ALR, partial [Colius striatus]
Length=123

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  51   INLFSKFYPCEHCAEDLREKLRTNQPDTSTRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  110

Query  231  ARW  239
             RW
Sbjct  111  ERW  113



>ref|XP_010202652.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR, partial [Colius 
striatus]
Length=124

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  52   INLFSKFYPCEHCAEDLREKLRTNQPDTSTRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  111

Query  231  ARW  239
             RW
Sbjct  112  ERW  114



>ref|XP_002100970.1| GE15875 [Drosophila yakuba]
 gb|EDX02078.1| GE15875 [Drosophila yakuba]
Length=267

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LSR+YPC+ CA  F+  L  NP+   SQ E + WLC  HN VN  LGKP+F C +V+ R
Sbjct  197  VLSRLYPCEFCAKDFRTDLDVNPINVNSQKELALWLCKFHNRVNDKLGKPLFDCTKVNER  256

Query  237  W  239
            W
Sbjct  257  W  257



>gb|KFP68003.1| FAD-linked sulfhydryl oxidase ALR, partial [Cariama cristata]
Length=119

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     +++ FSQWLC +HN VNR LGK  F C RVD
Sbjct  47   INLFSKFYPCEHCAEDLRERLRGNQPDTSNRSNFSQWLCLLHNEVNRKLGKSEFDCSRVD  106

Query  231  ARW  239
             RW
Sbjct  107  ERW  109



>ref|XP_003484466.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR-like [Bombus impatiens]
Length=158

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
              S+ YPC  CA+  +E L+  P Q  SQ++ SQWLC +HN VN+ LGKP F C+ VD R
Sbjct  88   TFSKFYPCYVCAEDLQEQLKKTPPQTNSQSQLSQWLCMIHNEVNKKLGKPEFDCKLVDQR  147

Query  237  W  239
            W
Sbjct  148  W  148



>ref|NP_001259731.1| augmenter of liver regeneration, isoform B [Drosophila melanogaster]
 gb|ACN88650.1| MIP09632p [Drosophila melanogaster]
 gb|AGB95570.1| augmenter of liver regeneration, isoform B [Drosophila melanogaster]
Length=266

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LSR+YPC+ CA  F+  L  NP+   SQ E + WLC  HN VN  LGKP+F C +V+ R
Sbjct  196  VLSRLYPCEFCAKDFRTDLDVNPINVNSQKELALWLCKFHNRVNDKLGKPLFDCTKVNER  255

Query  237  W  239
            W
Sbjct  256  W  256



>ref|XP_001120016.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR isoformX1 [Apis 
mellifera]
 ref|XP_003249909.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR isoformX2 [Apis 
mellifera]
Length=158

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            I S+ YPC  CA+  +E L+ +P +  SQ + SQWLC +HN VNR LGKP F C+ VD +
Sbjct  88   IFSKFYPCNVCAEDLQEQLKHSPPETNSQEQLSQWLCKIHNEVNRKLGKPEFDCKLVDQK  147

Query  237  W--GKLD  251
            W  G LD
Sbjct  148  WKYGWLD  154



>gb|ELQ38257.1| hypothetical protein OOU_Y34scaffold00548g73 [Magnaporthe oryzae 
Y34]
 gb|ELQ69574.1| hypothetical protein OOW_P131scaffold00142g13 [Magnaporthe oryzae 
P131]
Length=523

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M + S++YPC  CAD F+E ++ +PV+  ++ EF  WLC+ HN VN+ LGKP+F C   D
Sbjct  117  MRLFSKLYPCWVCADDFREYIKRDPVRVRTRDEFGNWLCNAHNDVNKKLGKPVFDCNLWD  176

Query  231  ARW  239
             RW
Sbjct  177  QRW  179



>gb|KFV16568.1| FAD-linked sulfhydryl oxidase ALR, partial [Pterocles gutturalis]
Length=123

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N      +  FSQWLC +HN VNR LGK  F C RVD
Sbjct  51   INLFSKFYPCEHCAEDLRERLRTNQPDTSDRNNFSQWLCRLHNEVNRKLGKSEFDCSRVD  110

Query  231  ARW  239
             RW
Sbjct  111  ERW  113



>gb|AAM11207.1| RE13652p [Drosophila melanogaster]
 gb|ACL86524.1| CG12534-PA, partial [synthetic construct]
Length=193

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LSR+YPC+ CA  F+  L  NP+   SQ E + WLC  HN VN  LGKP+F C +V+ R
Sbjct  123  VLSRLYPCEFCAKDFRTDLDVNPINVNSQKELALWLCKFHNRVNDKLGKPLFDCTKVNER  182

Query  237  W  239
            W
Sbjct  183  W  183



>ref|XP_010083255.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR, partial [Pterocles 
gutturalis]
Length=124

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N      +  FSQWLC +HN VNR LGK  F C RVD
Sbjct  52   INLFSKFYPCEHCAEDLRERLRTNQPDTSDRNNFSQWLCRLHNEVNRKLGKSEFDCSRVD  111

Query  231  ARW  239
             RW
Sbjct  112  ERW  114



>pdb|3MBG|A Chain A, Crystal Structure Of Human Augmenter Of Liver Regeneration 
(Alr)
 pdb|3MBG|B Chain B, Crystal Structure Of Human Augmenter Of Liver Regeneration 
(Alr)
 pdb|3MBG|C Chain C, Crystal Structure Of Human Augmenter Of Liver Regeneration 
(Alr)
Length=139

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + + S+ YPC++CA+  ++ L  N     ++A F+QWLCH+HN VNR LGKP F C
Sbjct  63   MAQFIHLFSKFYPCEECAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDC  122

Query  219  ERVDARW  239
             +VD RW
Sbjct  123  SKVDERW  129



>ref|XP_010390593.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Corvus cornix cornix]
Length=189

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E L+ N     +++ FSQWLC +HN VNR LGKP F C RVD
Sbjct  117  INLFSKFYPCEHCAEDLRERLQTNQPDTSTRSNFSQWLCLLHNDVNRKLGKPEFDCSRVD  176

Query  231  ARW  239
             RW
Sbjct  177  ERW  179



>ref|NP_608353.2| augmenter of liver regeneration, isoform A [Drosophila melanogaster]
 gb|AAF49017.3| augmenter of liver regeneration, isoform A [Drosophila melanogaster]
Length=261

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LSR+YPC+ CA  F+  L  NP+   SQ E + WLC  HN VN  LGKP+F C +V+ R
Sbjct  191  VLSRLYPCEFCAKDFRTDLDVNPINVNSQKELALWLCKFHNRVNDKLGKPLFDCTKVNER  250

Query  237  W  239
            W
Sbjct  251  W  251



>ref|XP_009877286.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR, partial [Apaloderma 
vittatum]
Length=84

 Score = 72.8 bits (177),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FS+WLC +HN VNR LGK  F C RVD
Sbjct  12   INLFSKFYPCEHCAEDLRERLRTNQPDTSTRNNFSRWLCLLHNEVNRKLGKSEFDCSRVD  71

Query  231  ARW  239
             RW
Sbjct  72   ERW  74



>ref|XP_004652040.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Jaculus jaculus]
Length=200

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + I S+ YPC++CA+  ++ +  N     ++A F+QWLC +HN VNR LGKP+F C
Sbjct  124  MAQFIRIFSKFYPCEECAEDIRKRIGRNQPDTSTRASFTQWLCGLHNEVNRKLGKPVFDC  183

Query  219  ERVDARW  239
             RVD RW
Sbjct  184  SRVDERW  190



>ref|XP_003712172.1| FAD-linked sulfhydryl oxidase ALR [Magnaporthe oryzae 70-15]
 gb|EHA52365.1| FAD-linked sulfhydryl oxidase ALR [Magnaporthe oryzae 70-15]
Length=189

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M + S++YPC  CAD F+E ++ +PV+  ++ EF  WLC+ HN VN+ LGKP+F C   D
Sbjct  117  MRLFSKLYPCWVCADDFREYIKRDPVRVRTRDEFGNWLCNAHNDVNKKLGKPVFDCNLWD  176

Query  231  ARW  239
             RW
Sbjct  177  QRW  179



>ref|XP_974453.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Tribolium castaneum]
 gb|EFA00437.1| hypothetical protein TcasGA2_TC003291 [Tribolium castaneum]
Length=161

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M     + S+ YPC  CA+  ++ L+A+P Q  SQ + SQWLC +HN VN  LGKP F C
Sbjct  85   MTSFFTLFSKFYPCDFCAEDLRKELKADPPQIASQEDLSQWLCRLHNRVNNKLGKPEFDC  144

Query  219  ERVDARW  239
             +V+ RW
Sbjct  145  SKVNERW  151



>ref|XP_001977829.1| GG19256 [Drosophila erecta]
 gb|EDV46756.1| GG19256 [Drosophila erecta]
Length=265

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LSR+YPC+ CA  F+  L  NP+   SQ E + WLC  HN VN  LGKP+F C +V+ R
Sbjct  195  VLSRLYPCEFCAKDFRTDLDVNPINVNSQKELALWLCKFHNRVNDKLGKPLFDCAKVNER  254

Query  237  W  239
            W
Sbjct  255  W  255



>gb|EHB14214.1| FAD-linked sulfhydryl oxidase ALR [Heterocephalus glaber]
Length=206

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + + S+ YPC++CA+  +E +  N     ++A F+QWLCH+HN VNR LGKP F C
Sbjct  130  MAQFIHLFSKFYPCEECAEDIRERIGRNQPDTRTRASFTQWLCHLHNEVNRKLGKPDFNC  189

Query  219  ERVDARW  239
             +VD RW
Sbjct  190  SQVDERW  196



>ref|XP_002110094.1| hypothetical protein TRIADDRAFT_21000 [Trichoplax adhaerens]
 gb|EDV28260.1| hypothetical protein TRIADDRAFT_21000 [Trichoplax adhaerens]
Length=159

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M + S+ +PC DCA H +  ++ NP QA +Q  FS+W+C+ HN VN  LGK +F C +V+
Sbjct  87   MHLFSKFFPCDDCATHLRSWMKDNPPQAENQDRFSKWMCYAHNEVNGRLGKKLFDCSKVN  146

Query  231  ARW  239
             RW
Sbjct  147  ERW  149



>ref|XP_009264693.1| mitochondrial sulfhydryl oxidase [Encephalitozoon romaleae SJ-2008]
 gb|AFN83196.1| mitochondrial sulfhydryl oxidase [Encephalitozoon romaleae SJ-2008]
Length=164

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LS ++PC DC  HF+++LR +P + GS  EF  WLC VHNVVN  LGK +  C+ VD  
Sbjct  98   LLSSVFPCGDCTKHFQKLLRDHPPRVGSNEEFKAWLCEVHNVVNERLGKAVVDCKTVDNI  157

Query  237  W  239
            W
Sbjct  158  W  158



>ref|XP_010178643.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Mesitornis unicolor]
Length=191

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LRAN     S+  FSQWLC +HN VNR LGK  F C RVD
Sbjct  119  INLFSKFYPCEHCAEDLRERLRANQPDTSSRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  178

Query  231  ARW  239
             RW
Sbjct  179  ERW  181



>ref|XP_004071807.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR-like [Oryzias latipes]
Length=175

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S  YPC+DCA+  +  L+ N  +  +++  SQWLCH+HN VN  LGKP F C RVD
Sbjct  103  INLFSHFYPCEDCAEDLRNRLKTNQPETSNRSTLSQWLCHLHNDVNARLGKPEFDCSRVD  162

Query  231  ARW  239
             RW
Sbjct  163  ERW  165



>ref|XP_003398016.1| PREDICTED: LOW QUALITY PROTEIN: FAD-linked sulfhydryl oxidase 
ALR-like [Bombus terrestris]
Length=158

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
              S+ YPC  CA+  +E L+  P Q  SQ++ SQWLC +HN VN+ LGKP F C+ VD R
Sbjct  88   TFSKFYPCYVCAEDLQEQLKXTPPQTNSQSQLSQWLCMIHNEVNKKLGKPEFDCKLVDQR  147

Query  237  W  239
            W
Sbjct  148  W  148



>gb|KFQ17480.1| FAD-linked sulfhydryl oxidase ALR, partial [Merops nubicus]
Length=123

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  51   INLFSKFYPCEHCAEDLRERLRTNQPDTSTRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  110

Query  231  ARW  239
             RW
Sbjct  111  ERW  113



>gb|KFQ31723.1| FAD-linked sulfhydryl oxidase ALR, partial [Mesitornis unicolor]
Length=189

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LRAN     S+  FSQWLC +HN VNR LGK  F C RVD
Sbjct  117  INLFSKFYPCEHCAEDLRERLRANQPDTSSRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  176

Query  231  ARW  239
             RW
Sbjct  177  ERW  179



>ref|XP_008948643.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR, partial [Merops 
nubicus]
Length=124

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  52   INLFSKFYPCEHCAEDLRERLRTNQPDTSTRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  111

Query  231  ARW  239
             RW
Sbjct  112  ERW  114



>ref|XP_006679365.1| hypothetical protein BATDEDRAFT_12046, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF80040.1| hypothetical protein BATDEDRAFT_12046, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=125

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 4/81 (5%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            + +R+YPC DCA HFK +L+A+P     +   SQW C VHNVVN+ L KPIF C +V   
Sbjct  37   LFARLYPCGDCASHFKIILQAHPPIVTDREALSQWACTVHNVVNKRLHKPIFDCSKVGDM  96

Query  237  WGKLDCEQH---NCDLQGSDK  290
            W K  C++    N  +  +D+
Sbjct  97   W-KCGCDEDGAGNSTISATDR  116



>gb|KFW84517.1| FAD-linked sulfhydryl oxidase ALR, partial [Manacus vitellinus]
Length=123

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  51   INLFSKFYPCEHCAEDLRERLRTNQPDTSTRNNFSQWLCLLHNEVNRKLGKAEFDCSRVD  110

Query  231  ARW  239
             RW
Sbjct  111  ERW  113



>gb|KFP80668.1| FAD-linked sulfhydryl oxidase ALR, partial [Apaloderma vittatum]
Length=85

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FS+WLC +HN VNR LGK  F C RVD
Sbjct  13   INLFSKFYPCEHCAEDLRERLRTNQPDTSTRNNFSRWLCLLHNEVNRKLGKSEFDCSRVD  72

Query  231  ARW  239
             RW
Sbjct  73   ERW  75



>gb|EOA98493.1| FAD-linked sulfhydryl oxidase ALR, partial [Anas platyrhynchos]
 gb|KFQ61622.1| FAD-linked sulfhydryl oxidase ALR, partial [Pelecanus crispus]
Length=120

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  48   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  107

Query  231  ARW  239
             RW
Sbjct  108  ERW  110



>ref|XP_010618748.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Fukomys damarensis]
 ref|XP_010618749.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Fukomys damarensis]
 ref|XP_010618750.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Fukomys damarensis]
 gb|KFO34720.1| FAD-linked sulfhydryl oxidase ALR [Fukomys damarensis]
Length=125

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + + S+ YPC++CA+  +E +  N     ++  F+QWLCH+HN VNR LGKP F C
Sbjct  49   MAQFIHLFSKFYPCEECAEDIRERIGRNQPDTRTRVSFTQWLCHLHNEVNRKLGKPDFDC  108

Query  219  ERVDARW  239
             +VD RW
Sbjct  109  SQVDERW  115



>ref|XP_001082639.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR isoform 2 [Macaca 
mulatta]
 ref|XP_005590972.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR isoform X1 [Macaca 
fascicularis]
Length=205

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            + S+ YPC++CA+  +E L  N     ++A F+QWLCH+HN VNR LGKP F C +VD R
Sbjct  135  LFSKFYPCEECAEDLRERLCRNQPDTRTRAGFTQWLCHLHNEVNRKLGKPDFDCSKVDER  194

Query  237  W  239
            W
Sbjct  195  W  195



>gb|EFX73902.1| hypothetical protein DAPPUDRAFT_307542 [Daphnia pulex]
Length=184

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            MV  M + ++ YPC DC++ FKE L ANP    + +  SQWLC +HN VN  LGKP F C
Sbjct  108  MVQFMALFTKFYPCTDCSEDFKERLIANPPATQNNSILSQWLCAMHNEVNVKLGKPEFDC  167

Query  219  ERVDARW  239
              V+ RW
Sbjct  168  NLVNQRW  174



>gb|AAD10339.1| ALR [Mus musculus]
 gb|AAD36987.1| augmenter of liver regeneration [Mus musculus]
Length=125

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + I S+ YPC++CA+  ++ +  N     ++  FSQWLC +HN VNR LGKP F C
Sbjct  49   MAQFIHIFSKFYPCEECAEDIRKRIGRNQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDC  108

Query  219  ERVDARW  239
             RVD RW
Sbjct  109  SRVDERW  115



>ref|XP_008926462.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Manacus vitellinus]
Length=129

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  57   INLFSKFYPCEHCAEDLRERLRTNQPDTSTRNNFSQWLCLLHNEVNRKLGKAEFDCSRVD  116

Query  231  ARW  239
             RW
Sbjct  117  ERW  119



>ref|XP_002200264.2| PREDICTED: FAD-linked sulfhydryl oxidase ALR-like, partial [Taeniopygia 
guttata]
Length=120

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            + S+ YPC+ CA+  +E L+ N     S++ FSQWLC +HN VNR LGK  F C RVD R
Sbjct  50   LFSKFYPCEHCAEDLRERLQTNQPDTSSRSNFSQWLCQLHNEVNRKLGKLEFDCSRVDER  109

Query  237  W  239
            W
Sbjct  110  W  110



>ref|XP_005145105.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Melopsittacus undulatus]
Length=131

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  59   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKAEFDCSRVD  118

Query  231  ARW  239
             RW
Sbjct  119  ERW  121



>gb|KFU83859.1| FAD-linked sulfhydryl oxidase ALR, partial [Chaetura pelagica]
Length=122

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  51   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  110

Query  231  ARW  239
             RW
Sbjct  111  ERW  113



>gb|KFM12471.1| FAD-linked sulfhydryl oxidase ALR, partial [Aptenodytes forsteri]
 gb|KFQ68497.1| FAD-linked sulfhydryl oxidase ALR, partial [Phaethon lepturus]
 gb|KFW70862.1| FAD-linked sulfhydryl oxidase ALR, partial [Pygoscelis adeliae]
Length=123

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  51   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  110

Query  231  ARW  239
             RW
Sbjct  111  ERW  113



>gb|EPR79276.1| Mitochondrial-type FAD-linked sulfhydryl oxidase ERV1 [Spraguea 
lophii 42_110]
Length=160

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + + ++PCK+C+  FK++++ +P +  ++ EF  W+CH+HN VN  L KPIF C+ +D
Sbjct  91   LYLFTELFPCKNCSRDFKKIIKDSPPKVATRDEFVMWMCHIHNKVNHKLNKPIFNCKNID  150

Query  231  ARW  239
             RW
Sbjct  151  DRW  153



>gb|KFV53802.1| FAD-linked sulfhydryl oxidase ALR, partial [Gavia stellata]
Length=119

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  47   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  106

Query  231  ARW  239
             RW
Sbjct  107  ERW  109



>ref|XP_009481869.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR, partial [Pelecanus 
crispus]
Length=124

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  52   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  111

Query  231  ARW  239
             RW
Sbjct  112  ERW  114



>gb|EZA58330.1| FAD-linked sulfhydryl oxidase ALR [Cerapachys biroi]
Length=156

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            I S  YPC  CA+  +E L+ +P + GSQ   SQWLC +HN VN+ LGKP F C+ V+ R
Sbjct  86   IFSNFYPCTICAEDMQEQLKHSPPETGSQETLSQWLCRIHNKVNKKLGKPEFDCKLVNQR  145

Query  237  W  239
            W
Sbjct  146  W  146



>ref|XP_010291926.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR, partial [Phaethon 
lepturus]
Length=124

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  52   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  111

Query  231  ARW  239
             RW
Sbjct  112  ERW  114



>ref|XP_003389418.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR-like [Amphimedon 
queenslandica]
Length=152

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M + M   S+ YPC  C+ H +E + +NP     ++ FSQW+C +HN VN  L KPIF C
Sbjct  76   MAIMMRTFSKYYPCDYCSHHMREWMNSNPPLTKDRSSFSQWMCSMHNEVNVRLDKPIFDC  135

Query  219  ERVDARW  239
             +VD RW
Sbjct  136  SKVDERW  142



>gb|KGL85997.1| FAD-linked sulfhydryl oxidase ALR, partial [Charadrius vociferus]
Length=123

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  51   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  110

Query  231  ARW  239
             RW
Sbjct  111  ERW  113



>gb|KFQ99939.1| FAD-linked sulfhydryl oxidase ALR, partial [Nipponia nippon]
Length=120

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  48   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  107

Query  231  ARW  239
             RW
Sbjct  108  ERW  110



>ref|XP_009810707.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR, partial [Gavia 
stellata]
Length=124

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  52   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  111

Query  231  ARW  239
             RW
Sbjct  112  ERW  114



>gb|KFZ47941.1| FAD-linked sulfhydryl oxidase ALR, partial [Caprimulgus carolinensis]
Length=120

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  48   ISLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  107

Query  231  ARW  239
             RW
Sbjct  108  ERW  110



>ref|XP_010150672.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR, partial [Eurypyga 
helias]
Length=124

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  52   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  111

Query  231  ARW  239
             RW
Sbjct  112  ERW  114



>ref|XP_009638726.1| PREDICTED: LOW QUALITY PROTEIN: FAD-linked sulfhydryl oxidase 
ALR [Egretta garzetta]
Length=134

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  62   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  121

Query  231  ARW  239
             RW
Sbjct  122  ERW  124



>ref|XP_010170633.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR, partial [Caprimulgus 
carolinensis]
Length=124

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  52   ISLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  111

Query  231  ARW  239
             RW
Sbjct  112  ERW  114



>ref|XP_005007449.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR isoform X3 [Cavia 
porcellus]
Length=167

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + + S+ YPC++CA+  +E +  N     ++  F+QWLCH+HN VNR LGKP F C
Sbjct  91   MAQFIHLFSKFYPCEECAEDLRERIGRNQPDTRTRTSFTQWLCHLHNEVNRKLGKPDFDC  150

Query  219  ERVDARW  239
             +VD RW
Sbjct  151  SQVDERW  157



>gb|KFV97755.1| FAD-linked sulfhydryl oxidase ALR, partial [Fulmarus glacialis]
Length=123

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  51   VNLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  110

Query  231  ARW  239
             RW
Sbjct  111  ERW  113



>ref|XP_009284882.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Aptenodytes forsteri]
Length=126

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  54   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  113

Query  231  ARW  239
             RW
Sbjct  114  ERW  116



>ref|XP_009946599.1| PREDICTED: LOW QUALITY PROTEIN: FAD-linked sulfhydryl oxidase 
ALR, partial [Leptosomus discolor]
Length=121

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  49   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  108

Query  231  ARW  239
             RW
Sbjct  109  ERW  111



>ref|XP_005023415.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR, partial [Anas platyrhynchos]
Length=129

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  57   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  116

Query  231  ARW  239
             RW
Sbjct  117  ERW  119



>ref|XP_009893264.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Charadrius vociferus]
Length=126

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  54   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  113

Query  231  ARW  239
             RW
Sbjct  114  ERW  116



>gb|KFQ77264.1| FAD-linked sulfhydryl oxidase ALR, partial [Phoenicopterus ruber 
ruber]
Length=120

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  48   INLFSKFYPCEHCAEDLRERLRVNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  107

Query  231  ARW  239
             RW
Sbjct  108  ERW  110



>ref|XP_003501592.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR isoform X1, partial 
[Cricetulus griseus]
Length=137

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + I S+ YPCK+CA+  ++ +  N     ++  FSQWLC +HN VNR LGKP F C
Sbjct  61   MAQFIHIFSKFYPCKECAEDIRKRIGRNQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDC  120

Query  219  ERVDARW  239
             +VD RW
Sbjct  121  SKVDERW  127



>ref|XP_004627937.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Octodon degus]
Length=206

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + + S+ YPC++CA+  KE +  N     ++  F+QWLCH+HN VNR LGKP F C
Sbjct  130  MAQFIHLFSKFYPCEECAEDLKERICKNQPDTRTRTSFTQWLCHLHNEVNRKLGKPDFDC  189

Query  219  ERVDARW  239
             +VD RW
Sbjct  190  SQVDERW  196



>ref|XP_009583172.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR, partial [Fulmarus 
glacialis]
Length=124

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  52   VNLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  111

Query  231  ARW  239
             RW
Sbjct  112  ERW  114



>ref|XP_008854455.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Nannospalax galili]
Length=200

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + I S+ YPC++CA+  ++ +  NP    ++  FSQWLC +HN VN+ LGKP F C
Sbjct  124  MAQFIRIFSKFYPCEECAEDIRKRIGRNPPNTSTRVSFSQWLCRLHNEVNQKLGKPDFDC  183

Query  219  ERVDARW  239
             RVD RW
Sbjct  184  MRVDERW  190



>ref|XP_005054062.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Ficedula albicollis]
Length=132

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  ++ LR N     +++ FSQWLC +HN VNR LGK  F C RVD
Sbjct  60   INLFSKFYPCEHCAEDLRDRLRTNQPDTSTRSNFSQWLCLLHNEVNRKLGKAEFDCSRVD  119

Query  231  ARW  239
             RW
Sbjct  120  ERW  122



>ref|XP_002057971.1| GJ15753 [Drosophila virilis]
 gb|EDW66079.1| GJ15753 [Drosophila virilis]
Length=190

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LSR+YPC+ CA  F+  +  NP+   SQ + + WLC  HN VN  LGKP+F C +V+ R
Sbjct  120  VLSRLYPCEYCAKDFRTDIEVNPINVNSQKDLALWLCKFHNRVNDKLGKPLFDCSKVNER  179

Query  237  W  239
            W
Sbjct  180  W  180



>ref|XP_010116326.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR, partial [Chlamydotis 
macqueenii]
Length=124

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  52   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  111

Query  231  ARW  239
             RW
Sbjct  112  ERW  114



>ref|XP_003478518.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR isoform X1 [Cavia 
porcellus]
Length=206

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + + S+ YPC++CA+  +E +  N     ++  F+QWLCH+HN VNR LGKP F C
Sbjct  130  MAQFIHLFSKFYPCEECAEDLRERIGRNQPDTRTRTSFTQWLCHLHNEVNRKLGKPDFDC  189

Query  219  ERVDARW  239
             +VD RW
Sbjct  190  SQVDERW  196



>ref|XP_005444166.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Falco cherrug]
Length=125

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  53   ISLFSKFYPCQHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  112

Query  231  ARW  239
             RW
Sbjct  113  ERW  115



>ref|XP_005007448.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR isoform X2 [Cavia 
porcellus]
Length=205

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + + S+ YPC++CA+  +E +  N     ++  F+QWLCH+HN VNR LGKP F C
Sbjct  129  MAQFIHLFSKFYPCEECAEDLRERIGRNQPDTRTRTSFTQWLCHLHNEVNRKLGKPDFDC  188

Query  219  ERVDARW  239
             +VD RW
Sbjct  189  SQVDERW  195



>ref|XP_005229191.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Falco peregrinus]
Length=126

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  54   ISLFSKFYPCQHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  113

Query  231  ARW  239
             RW
Sbjct  114  ERW  116



>ref|XP_003351186.1| hypothetical protein SMAC_03489 [Sordaria macrospora k-hell]
 emb|CCC09459.1| unnamed protein product [Sordaria macrospora k-hell]
Length=204

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            + L MG+ +++YPC  CA+ F++ ++    + GS+ EF  WLC  HN VNR LGKP F C
Sbjct  128  LKLFMGLFAKLYPCWVCAEDFQQYIKKEEPKTGSRGEFGNWLCEAHNEVNRKLGKPTFDC  187

Query  219  ERVDARWGKLDCEQHNCD  272
             +   RW +   +  +CD
Sbjct  188  SKWQERW-RTGWKDGSCD  204



>ref|XP_005523146.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Pseudopodoces humilis]
Length=187

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     +++ FSQWLC +HN VNR LGK  F C RVD
Sbjct  115  INLFSKFYPCEHCAEDLRERLRTNQPDTSTRSNFSQWLCLLHNEVNRKLGKSEFDCSRVD  174

Query  231  ARW  239
             RW
Sbjct  175  ERW  177



>gb|EPQ07991.1| FAD-linked sulfhydryl oxidase ALR [Myotis brandtii]
Length=77

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + + S+ YPC++CA+  ++ +  N     ++A F+QWLC +HN VNR LGKP F C
Sbjct  1    MAQLIHLFSKFYPCEECAEDIRKRIYRNQPDTRTRASFTQWLCRLHNEVNRKLGKPDFDC  60

Query  219  ERVDARW  239
             +VD RW
Sbjct  61   SKVDERW  67



>ref|XP_009494342.1| hypothetical protein H696_02170 [Fonticula alba]
 gb|KCV71219.1| hypothetical protein H696_02170 [Fonticula alba]
Length=181

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + IL R++PC DCA H  E   A+P    S+   SQW C +HN VN  LGKP+F C
Sbjct  106  MTNLVSILGRLFPCGDCASHLTEYAAAHPPDTSSRTSISQWFCEMHNDVNVRLGKPVFDC  165

Query  219  ERVDARW  239
             RV  RW
Sbjct  166  ARVLERW  172



>ref|XP_008347042.1| PREDICTED: FAD-linked sulfhydryl oxidase ERV1-like isoform X1 
[Malus domestica]
Length=219

 Score = 53.5 bits (127),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  118  QILYKLDLKLSFPNGCVMCTMLLIEVWVNPFSLVNGLMHGG  240
            QILY+LD   S PNG VMC + L E   N FS VN LMHGG
Sbjct  177  QILYRLDHMPSSPNGYVMCIIRLTEALTNRFSPVNELMHGG  217


 Score = 47.8 bits (112),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLR  116
            M ILSRMYPCK+CADHF+E+LR
Sbjct  122  MSILSRMYPCKECADHFQEILR  143



>ref|XP_006607929.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR-like isoform X1 
[Apis dorsata]
 ref|XP_006607930.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR-like isoform X2 
[Apis dorsata]
Length=158

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            I S+ YPC  CA+  +E L+ +P +  SQ + SQWLC +HN VNR LGKP F C+ V+ +
Sbjct  88   IFSKFYPCNVCAEDLQEQLKHSPPETNSQEQLSQWLCKIHNEVNRKLGKPEFDCKLVNQK  147

Query  237  W--GKLD  251
            W  G LD
Sbjct  148  WKYGWLD  154



>gb|ELT89413.1| hypothetical protein CAPTEDRAFT_226289 [Capitella teleta]
Length=164

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = +3

Query  36   HMVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFP  215
             M   +G+ S+ +PC DCA   ++ L  N  Q  S+   SQW C +HN VNR +GKP F 
Sbjct  87   EMTQFIGLFSKFFPCDDCAKDLQKSLETNVPQTKSRHHLSQWFCQMHNQVNRKIGKPEFD  146

Query  216  CERVDARW  239
            C +VD RW
Sbjct  147  CSKVDERW  154



>ref|XP_001632107.1| predicted protein [Nematostella vectensis]
 gb|EDO40044.1| predicted protein [Nematostella vectensis]
Length=171

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            + S+ +PC +CA H +E +  +PV A S+   SQW+CH+HN VNR +GK  F C +VD R
Sbjct  101  LFSKFFPCNECATHLREKINEHPVDARSRHYLSQWMCHLHNDVNRYIGKEEFDCSKVDER  160

Query  237  W  239
            W
Sbjct  161  W  161



>ref|XP_009466242.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Nipponia nippon]
Length=160

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  88   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  147

Query  231  ARW  239
             RW
Sbjct  148  ERW  150



>ref|XP_007606755.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR isoform X2 [Cricetulus 
griseus]
Length=164

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + I S+ YPCK+CA+  ++ +  N     ++  FSQWLC +HN VNR LGKP F C
Sbjct  88   MAQFIHIFSKFYPCKECAEDIRKRIGRNQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDC  147

Query  219  ERVDARW  239
             +VD RW
Sbjct  148  SKVDERW  154



>ref|XP_004367724.1| Erv1 / Alr family protein [Acanthamoeba castellanii str. Neff]
 gb|ELR22631.1| Erv1 / Alr family protein [Acanthamoeba castellanii str. Neff]
Length=215

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + +   +YPCK CA  F+E +   P +  S    S W+C  HN VN+ LGKP+FPCERV 
Sbjct  139  LSLFPHLYPCKVCAKDFEETMDEIPPELESHDALSDWMCRAHNRVNQQLGKPLFPCERVR  198

Query  231  ARWG  242
             RWG
Sbjct  199  ERWG  202



>gb|AAD56538.1|AF183892_1 hepatopoietin [Homo sapiens]
Length=180

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + + SR YPC++CA+  ++ L  N     ++A F+QWLCH+HN VNR LGKP F C
Sbjct  104  MAQFIHLFSRFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDC  163

Query  219  ERVDARW  239
             +VD RW
Sbjct  164  SKVDERW  170



>ref|XP_005349211.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Microtus ochrogaster]
Length=205

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + I S+ YPC++CA+  ++ +  N     ++  FSQWLC +HN VNR LGKP F C
Sbjct  129  MAQFIHIFSKFYPCEECAEDIRKRISRNQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDC  188

Query  219  ERVDARW  239
             RVD RW
Sbjct  189  SRVDERW  195



>gb|EMC80188.1| FAD-linked sulfhydryl oxidase ALR, partial [Columba livia]
Length=117

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD R
Sbjct  47   LFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVDER  106

Query  237  W  239
            W
Sbjct  107  W  107



>gb|EDL22353.1| mCG12842, isoform CRA_a [Mus musculus]
Length=200

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + I S+ YPC++CA+  ++ +  N     ++  FSQWLC +HN VNR LGKP F C
Sbjct  124  MAQFIHIFSKFYPCEECAEDIRKRIGRNQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDC  183

Query  219  ERVDARW  239
             RVD RW
Sbjct  184  SRVDERW  190



>ref|XP_005426017.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Geospiza fortis]
Length=182

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPCK CA+  +E LR N     ++  FS+WLC +HN VNR LGK  F C RVD
Sbjct  110  INLFSKFYPCKHCAEDLRERLRTNQPDTSTRRNFSRWLCLLHNEVNRKLGKSEFDCSRVD  169

Query  231  ARW  239
             RW
Sbjct  170  ERW  172



>ref|XP_005495859.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Zonotrichia albicollis]
Length=182

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPCK CA+  +E LR N     ++  FS+WLC +HN VNR LGK  F C RVD
Sbjct  110  INLFSKFYPCKHCAEDLRERLRTNQPDTSTRRNFSRWLCLLHNEVNRKLGKSEFDCSRVD  169

Query  231  ARW  239
             RW
Sbjct  170  ERW  172



>ref|XP_009930669.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Opisthocomus hoazin]
Length=158

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  86   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  145

Query  231  ARW  239
             RW
Sbjct  146  ERW  148



>gb|AAD17328.1| hepatopoietin HPO2 [Homo sapiens]
 gb|AAD36986.1| augmenter of liver regeneration [Homo sapiens]
 gb|AAA96390.2| ERV1 [Homo sapiens]
 gb|AAH28348.2| GFER protein [Homo sapiens]
 gb|AAS55642.1| augmenter of liver regeneration [Homo sapiens]
 gb|AAH02429.1| GFER protein [Homo sapiens]
 gb|AIC58975.1| GFER, partial [synthetic construct]
Length=125

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + + S+ YPC++CA+  ++ L  N     ++A F+QWLCH+HN VNR LGKP F C
Sbjct  49   MAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDC  108

Query  219  ERVDARW  239
             +VD RW
Sbjct  109  SKVDERW  115



>gb|EHK23249.1| hypothetical protein TRIVIDRAFT_111157 [Trichoderma virens Gv29-8]
Length=199

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            +G+ S++YPC  CA+ F+  +     Q  S+ EFSQWLC  HN VNR LGKP F C R D
Sbjct  127  VGLFSKLYPCWVCAEDFQGYMARQKPQVSSRDEFSQWLCRAHNDVNRKLGKPEFDCSRWD  186

Query  231  ARW  239
             RW
Sbjct  187  ERW  189



>gb|AAH23941.1| Gfer protein [Mus musculus]
Length=198

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + I S+ YPC++CA+  ++ +  N     ++  FSQWLC +HN VNR LGKP F C
Sbjct  122  MAQFIHIFSKFYPCEECAEDIRKRIGRNQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDC  181

Query  219  ERVDARW  239
             RVD RW
Sbjct  182  SRVDERW  188



>ref|NP_001156283.1| augmenter of liver regeneration-like [Acyrthosiphon pisum]
 dbj|BAH72282.1| ACYPI008907 [Acyrthosiphon pisum]
Length=203

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            ++ ++YPC+ CA+ F E+L  +P    SQ  F++W+C VHN+VNR L KP+F C +V+ R
Sbjct  133  LIPKVYPCEVCANDFSEILTYHPPNISSQKSFAKWMCEVHNMVNRKLEKPLFDCSKVNER  192

Query  237  W  239
            W
Sbjct  193  W  193



>ref|NP_075527.2| FAD-linked sulfhydryl oxidase ALR [Mus musculus]
 sp|P56213.2|ALR_MOUSE RecName: Full=FAD-linked sulfhydryl oxidase ALR; AltName: Full=Augmenter 
of liver regeneration [Mus musculus]
 dbj|BAA95045.1| unnamed protein product [Mus musculus]
 dbj|BAE27275.1| unnamed protein product [Mus musculus]
 gb|EDL22354.1| mCG12842, isoform CRA_b [Mus musculus]
Length=198

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + I S+ YPC++CA+  ++ +  N     ++  FSQWLC +HN VNR LGKP F C
Sbjct  122  MAQFIHIFSKFYPCEECAEDIRKRIGRNQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDC  181

Query  219  ERVDARW  239
             RVD RW
Sbjct  182  SRVDERW  188



>ref|XP_005081660.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Mesocricetus auratus]
Length=198

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + I S+ YPC++CA+  ++ +  N     ++  FSQWLC +HN VNR LGKP F C
Sbjct  122  MAQFIHIFSKFYPCEECAEDIRKRIGRNQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDC  181

Query  219  ERVDARW  239
             RVD RW
Sbjct  182  SRVDERW  188



>ref|NP_001082855.1| FAD-linked sulfhydryl oxidase ALR [Danio rerio]
 gb|AAI39531.1| Gfer protein [Danio rerio]
Length=191

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  33   FHMVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIF  212
              M   + + S+++PC +CA+  +  L+ N   AGS+ + SQWLC +HN +N  LGKP F
Sbjct  113  LEMTQFINLFSKVFPCDECAEDLRTRLKTNRPDAGSRHKLSQWLCRLHNDINIRLGKPEF  172

Query  213  PCERVDARW  239
             C RVD RW
Sbjct  173  DCSRVDERW  181



>ref|XP_002431288.1| Augmenter of liver regeneration, putative [Pediculus humanus 
corporis]
 gb|EEB18550.1| Augmenter of liver regeneration, putative [Pediculus humanus 
corporis]
Length=162

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M + SR YPC  CA+  ++ +   P +  SQ EFSQWLC +HN +N  LGKP+F C  V+
Sbjct  90   MKLFSRFYPCSVCAEDLQQQIERFPPKTESQYEFSQWLCRIHNRINLRLGKPLFDCNTVN  149

Query  231  ARW  239
             RW
Sbjct  150  ERW  152



>ref|XP_004902572.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR isoform X2 [Heterocephalus 
glaber]
 ref|XP_004873730.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR isoform X2 [Heterocephalus 
glaber]
Length=310

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + + S+ YPC++CA+  +E +  N     ++A F+QWLCH+HN VNR LGKP F C
Sbjct  234  MAQFIHLFSKFYPCEECAEDIRERIGRNQPDTRTRASFTQWLCHLHNEVNRKLGKPDFNC  293

Query  219  ERVDARW  239
             +VD RW
Sbjct  294  SQVDERW  300



>gb|EOB13550.1| Mitochondrial FAD-linked sulfhydryl oxidase ERV1 [Nosema bombycis 
CQ1]
Length=174

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            +LS+++PC +CA HF+++L  NP Q  S  EF  WLC  HN+VN+ LGK I  C++ D  
Sbjct  106  LLSQLFPCGECAGHFQKLLSQNPPQVTSHDEFVGWLCKAHNIVNKRLGKEIVDCKKADDM  165

Query  237  W  239
            W
Sbjct  166  W  166



>ref|XP_003916407.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Papio anubis]
Length=205

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            + S+ YPC++CA+  ++ L  N     ++A F+QWLCH+HN VNR LGKP F C +VD R
Sbjct  135  LFSKFYPCEECAEDLRKRLCRNQPDTRTRAGFTQWLCHLHNEVNRKLGKPDFDCSKVDER  194

Query  237  W  239
            W
Sbjct  195  W  195



>ref|XP_004902571.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR isoform X1 [Heterocephalus 
glaber]
 ref|XP_004873729.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR isoform X1 [Heterocephalus 
glaber]
Length=321

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + + S+ YPC++CA+  +E +  N     ++A F+QWLCH+HN VNR LGKP F C
Sbjct  245  MAQFIHLFSKFYPCEECAEDIRERIGRNQPDTRTRASFTQWLCHLHNEVNRKLGKPDFNC  304

Query  219  ERVDARW  239
             +VD RW
Sbjct  305  SQVDERW  311



>ref|XP_002187437.2| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Taeniopygia guttata]
Length=187

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   ILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVDAR  236
            + S+ YPC+ CA+  +E L+ N     S++ FSQWLC +HN VNR LGK  F C RVD R
Sbjct  117  LFSKFYPCEHCAEDLRERLQTNQPDTSSRSNFSQWLCQLHNEVNRKLGKLEFDCSRVDER  176

Query  237  W  239
            W
Sbjct  177  W  177



>ref|XP_010297786.1| PREDICTED: LOW QUALITY PROTEIN: FAD-linked sulfhydryl oxidase 
ALR, partial [Balearica regulorum gibbericeps]
Length=121

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E L  N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  49   INLFSKFYPCEHCAEDLRERLHTNQPDTSNRNNFSQWLCRLHNEVNRKLGKSEFDCSRVD  108

Query  231  ARW  239
             RW
Sbjct  109  ERW  111



>ref|XP_009993053.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Chaetura pelagica]
Length=169

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  97   INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  156

Query  231  ARW  239
             RW
Sbjct  157  ERW  159



>pdb|1OQC|A Chain A, The Crystal Structure Of Augmenter Of Liver Regeneration: 
A Mammalian Fad Dependent Sulfhydryl Oxidase
 pdb|1OQC|B Chain B, The Crystal Structure Of Augmenter Of Liver Regeneration: 
A Mammalian Fad Dependent Sulfhydryl Oxidase
 pdb|1OQC|C Chain C, The Crystal Structure Of Augmenter Of Liver Regeneration: 
A Mammalian Fad Dependent Sulfhydryl Oxidase
 pdb|1OQC|D Chain D, The Crystal Structure Of Augmenter Of Liver Regeneration: 
A Mammalian Fad Dependent Sulfhydryl Oxidase
 gb|AAF12808.1|AF197192_1 augmenter of liver regeneration [Rattus norvegicus]
 dbj|BAA06399.1| augmenter of liver regeneration [Rattus norvegicus]
Length=125

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + I S+ YPC++CA+  ++ +  +     ++  FSQWLC +HN VNR LGKP F C
Sbjct  49   MAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDC  108

Query  219  ERVDARW  239
             RVD RW
Sbjct  109  SRVDERW  115



>ref|XP_009327678.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR [Pygoscelis adeliae]
Length=194

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  FSQWLC +HN VNR LGK  F C RVD
Sbjct  122  INLFSKFYPCEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLHNEVNRKLGKSEFDCSRVD  181

Query  231  ARW  239
             RW
Sbjct  182  ERW  184



>gb|KFV76351.1| FAD-linked sulfhydryl oxidase ALR, partial [Struthio camelus 
australis]
Length=119

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            + + S+ YPC+ CA+  +E LR N     ++  F QWLC +HN VNR LGK  F C RVD
Sbjct  47   INLFSKFYPCEQCAEDLRERLRTNQPDTSNRNNFCQWLCLLHNEVNRKLGKTEFDCSRVD  106

Query  231  ARW  239
             RW
Sbjct  107  ERW  109



>pdb|3TK0|A Chain A, Mutation Of Sfalr
Length=126

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +3

Query  39   MVLQMGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPC  218
            M   + + S+ YP ++CA+  ++ L  N     ++A F+QWLCH+HN VNR LGKP F C
Sbjct  50   MAQFIHLFSKFYPSEECAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDC  109

Query  219  ERVDARW  239
             +VD RW
Sbjct  110  SKVDERW  116



>ref|XP_003665449.1| hypothetical protein MYCTH_2309177 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO60204.1| hypothetical protein MYCTH_2309177 [Myceliophthora thermophila 
ATCC 42464]
Length=183

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  51   MGILSRMYPCKDCADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLGKPIFPCERVD  230
            M + S++YPC  CA+ F+  +    V+AGS+ EF  WLC  HN VNR LGKP F C + +
Sbjct  111  MRLFSKLYPCWVCAEDFQSYVEKKEVKAGSREEFGNWLCEAHNEVNRKLGKPTFDCSKWE  170

Query  231  ARW  239
             RW
Sbjct  171  ERW  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517347226690