BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24936_g9_i3 len=1333 path=[2627:0-484 9688:485-1133 21094:1134-1175
29699:1176-1332]

Length=1333
                                                                      Score     E

ref|XP_009762332.1|  PREDICTED: RNA-binding protein 24-like isofo...    268   7e-83   
ref|XP_009762333.1|  PREDICTED: RNA-binding protein 24-like isofo...    268   9e-83   
ref|XP_011008590.1|  PREDICTED: RNA-binding protein 24-like isofo...    264   1e-81   
ref|XP_011008591.1|  PREDICTED: RNA-binding protein 24-like isofo...    264   2e-81   
gb|KDP36698.1|  hypothetical protein JCGZ_07989                         263   4e-81   
ref|XP_009590241.1|  PREDICTED: RNA-binding protein 38-like isofo...    263   5e-81   
ref|XP_009590242.1|  PREDICTED: RNA-binding protein 38-like isofo...    263   8e-81   
ref|XP_011004898.1|  PREDICTED: RNA-binding protein 38-like isofo...    260   5e-80   
ref|XP_006371379.1|  hypothetical protein POPTR_0019s09640g             260   6e-80   
ref|XP_006352100.1|  PREDICTED: RNA-binding protein 24-A-like iso...    258   3e-79   
ref|XP_002510776.1|  RNA-binding region-containing protein, putative    256   1e-78   Ricinus communis
ref|XP_010063726.1|  PREDICTED: RNA-binding protein 38-like             253   2e-77   
ref|XP_007019702.1|  RNA-binding family protein isoform 2               253   3e-77   
ref|XP_010644001.1|  PREDICTED: RNA-binding protein 24 isoform X1       253   4e-77   
ref|XP_007131315.1|  hypothetical protein PHAVU_011G003400g             253   6e-77   
ref|XP_004250742.1|  PREDICTED: RNA-binding protein 24-like isofo...    251   2e-76   
ref|XP_009762334.1|  PREDICTED: RNA-binding protein 24-like isofo...    249   1e-75   
ref|XP_002319865.1|  hypothetical protein POPTR_0013s09120g             248   2e-75   Populus trichocarpa [western balsam poplar]
ref|XP_011008592.1|  PREDICTED: RNA-binding protein 24-like isofo...    248   3e-75   
ref|XP_008237806.1|  PREDICTED: RNA-binding protein 38-like isofo...    248   4e-75   
ref|XP_006441811.1|  hypothetical protein CICLE_v10021520mg             247   9e-75   
ref|XP_009590243.1|  PREDICTED: RNA-binding protein 38-like isofo...    246   2e-74   
ref|XP_006478306.1|  PREDICTED: RNA-binding protein 24-like isofo...    246   2e-74   
ref|XP_011095164.1|  PREDICTED: RNA-binding protein 24                  246   3e-74   
ref|XP_011004901.1|  PREDICTED: RNA-binding protein 38-like isofo...    245   4e-74   
ref|XP_004506366.1|  PREDICTED: RNA-binding protein Musashi homol...    245   5e-74   
ref|XP_011004902.1|  PREDICTED: RNA-binding protein 38-like isofo...    244   6e-74   
emb|CAN73746.1|  hypothetical protein VITISV_041364                     244   9e-74   Vitis vinifera
ref|XP_006352101.1|  PREDICTED: RNA-binding protein 24-A-like iso...    242   5e-73   
ref|XP_002266779.1|  PREDICTED: RNA-binding protein 24 isoform X2       242   6e-73   Vitis vinifera
ref|XP_006587725.1|  PREDICTED: RNA-binding protein 24-like isofo...    242   6e-73   
gb|KHG10370.1|  RNA-binding 38                                          241   1e-72   
ref|XP_003605646.1|  RNA-binding protein                                241   2e-72   
ref|XP_007019701.1|  RNA-binding family protein isoform 1               243   2e-72   
ref|XP_008459505.1|  PREDICTED: RNA-binding protein 24 isoform X3       241   2e-72   
ref|XP_008391857.1|  PREDICTED: RNA-binding protein 24-like isofo...    240   6e-72   
ref|XP_010252363.1|  PREDICTED: RNA-binding protein 24-B-like iso...    240   7e-72   
gb|KHN11639.1|  RNA-binding protein 38                                  237   6e-71   
ref|XP_008237808.1|  PREDICTED: RNA-binding protein 38-like isofo...    237   9e-71   
ref|XP_008237809.1|  PREDICTED: RNA-binding protein 38-like isofo...    236   1e-70   
ref|XP_007131316.1|  hypothetical protein PHAVU_011G003400g             235   3e-70   
ref|XP_008373311.1|  PREDICTED: RNA-binding protein 24-A-like iso...    235   5e-70   
ref|XP_004250743.1|  PREDICTED: RNA-binding protein 24-like isofo...    234   6e-70   
emb|CDP11532.1|  unnamed protein product                                235   6e-70   
ref|XP_009366887.1|  PREDICTED: RNA-binding protein 24-A isoform X1     234   8e-70   
ref|XP_006441812.1|  hypothetical protein CICLE_v10021520mg             233   2e-69   
ref|XP_006591951.1|  PREDICTED: RNA-binding protein 24-like isofo...    233   2e-69   
ref|XP_004141612.1|  PREDICTED: uncharacterized protein LOC101221767    233   2e-69   
ref|XP_008459503.1|  PREDICTED: RNA-binding protein 24 isoform X1       233   2e-69   
ref|XP_004173374.1|  PREDICTED: RNA-binding protein 38-like             233   2e-69   
ref|XP_007200548.1|  hypothetical protein PRUPE_ppa009564mg             233   3e-69   
ref|XP_009370661.1|  PREDICTED: RNA-binding protein 24-A-like iso...    233   3e-69   
ref|XP_006478309.1|  PREDICTED: RNA-binding protein 24-like isofo...    232   5e-69   
ref|XP_004506367.1|  PREDICTED: RNA-binding protein Musashi homol...    232   5e-69   
gb|KCW70980.1|  hypothetical protein EUGRSUZ_F04089                     231   1e-68   
gb|EYU22694.1|  hypothetical protein MIMGU_mgv1a011474mg                229   6e-68   
ref|XP_008391858.1|  PREDICTED: RNA-binding protein 24-like isofo...    229   6e-68   
ref|XP_010252364.1|  PREDICTED: RNA-binding protein 24-B-like iso...    228   1e-67   
ref|XP_008459504.1|  PREDICTED: RNA-binding protein 24 isoform X2       226   1e-66   
ref|XP_003605647.1|  RNA-binding protein                                224   3e-66   
ref|XP_010930548.1|  PREDICTED: RNA-binding protein 24-like isofo...    225   3e-66   
ref|XP_010112069.1|  RNA-binding protein 38                             225   3e-66   
ref|XP_008373312.1|  PREDICTED: RNA-binding protein 24-A-like iso...    224   4e-66   
ref|XP_009366888.1|  PREDICTED: RNA-binding protein 24-A isoform X2     224   7e-66   
ref|XP_009370662.1|  PREDICTED: RNA-binding protein 24-A-like iso...    223   3e-65   
ref|XP_003534424.1|  PREDICTED: RNA-binding protein 24-like isofo...    221   4e-65   
ref|XP_010912663.1|  PREDICTED: RNA-binding protein 24-like isofo...    221   2e-64   
ref|XP_010930549.1|  PREDICTED: RNA-binding protein 24-like isofo...    219   3e-64   
ref|XP_008786462.1|  PREDICTED: RNA-binding protein 24-like isofo...    219   4e-64   
ref|XP_003540599.1|  PREDICTED: RNA-binding protein 24-like isofo...    217   3e-63   
ref|XP_010910324.1|  PREDICTED: RNA-binding protein 24-like             218   3e-63   
gb|KHN32458.1|  RNA-binding protein 38                                  216   5e-63   
ref|XP_008795273.1|  PREDICTED: RNA-binding protein 24-like isofo...    213   1e-61   
gb|KHG08243.1|  RNA-binding 38                                          211   2e-61   
ref|XP_010912666.1|  PREDICTED: RNA-binding protein 24-like isofo...    211   3e-61   
ref|XP_008786463.1|  PREDICTED: RNA-binding protein 24-like isofo...    210   7e-61   
ref|XP_009405903.1|  PREDICTED: RNA-binding protein 24-B-like           209   7e-60   
ref|XP_008802943.1|  PREDICTED: RNA-binding protein 24                  208   1e-59   
ref|XP_004970766.1|  PREDICTED: RNA-binding protein 24-B-like iso...    207   2e-59   
ref|XP_008795272.1|  PREDICTED: RNA-binding protein 24-like isofo...    206   6e-59   
emb|CDM85227.1|  unnamed protein product                                206   8e-59   
gb|EMS52416.1|  RNA-binding protein 24-B                                206   1e-58   
ref|XP_006645107.1|  PREDICTED: RNA-binding protein 24-B-like iso...    206   1e-58   
ref|XP_008674753.1|  PREDICTED: RNA-binding protein 24-B-like iso...    205   2e-58   
dbj|BAD81881.1|  putative RRM-containing protein SEB-4                  204   3e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009421155.1|  PREDICTED: RNA-binding protein 24-like isofo...    204   6e-58   
gb|KDO51382.1|  hypothetical protein CISIN_1g0231862mg                  197   4e-57   
gb|KDO51379.1|  hypothetical protein CISIN_1g0231862mg                  196   8e-57   
ref|XP_010677208.1|  PREDICTED: RNA-binding protein 24-B                200   9e-57   
ref|XP_008657003.1|  PREDICTED: RNA-binding protein 24-B-like iso...    199   2e-56   
ref|XP_003564757.1|  PREDICTED: RNA-binding protein 24-B-like iso...    199   4e-56   
ref|XP_004970767.1|  PREDICTED: RNA-binding protein 24-B-like iso...    197   5e-56   
ref|XP_009421154.1|  PREDICTED: RNA-binding protein 24-like isofo...    199   5e-56   
ref|XP_009404840.1|  PREDICTED: RNA-binding protein 24-like isofo...    199   5e-56   
ref|XP_002456729.1|  hypothetical protein SORBIDRAFT_03g041530          197   7e-56   Sorghum bicolor [broomcorn]
dbj|BAK00568.1|  predicted protein                                      197   1e-55   
ref|XP_006645108.1|  PREDICTED: RNA-binding protein 24-B-like iso...    196   3e-55   
ref|XP_004290274.1|  PREDICTED: uncharacterized protein LOC101314616    197   3e-55   
ref|XP_009393485.1|  PREDICTED: RNA-binding protein 24-A-like           196   5e-55   
ref|XP_008674754.1|  PREDICTED: RNA-binding protein 24-B-like iso...    194   7e-55   
gb|EMT32381.1|  RNA-binding protein 24-B                                190   2e-54   
ref|XP_009421157.1|  PREDICTED: RNA-binding protein 24-like isofo...    194   2e-54   
ref|XP_009404842.1|  PREDICTED: RNA-binding protein 24-like isofo...    193   3e-54   
gb|EPS71852.1|  hypothetical protein M569_02910                         192   4e-54   
ref|XP_009404841.1|  PREDICTED: RNA-binding protein 24-like isofo...    192   7e-54   
ref|XP_009404843.1|  PREDICTED: RNA-binding protein 24-like isofo...    192   7e-54   
ref|XP_009404839.1|  PREDICTED: RNA-binding protein 24-like isofo...    193   7e-54   
ref|XP_008657004.1|  PREDICTED: RNA-binding protein 24-B-like iso...    192   8e-54   
ref|XP_009421156.1|  PREDICTED: RNA-binding protein 24-like isofo...    192   1e-53   
gb|KHN39756.1|  RNA-binding protein 24                                  187   1e-53   
gb|KDP24217.1|  hypothetical protein JCGZ_25874                         190   2e-53   
ref|XP_003564756.1|  PREDICTED: RNA-binding protein 24-B-like iso...    190   3e-53   
ref|XP_002518014.1|  RNA binding protein, putative                      190   4e-53   Ricinus communis
gb|KDO51384.1|  hypothetical protein CISIN_1g0231862mg                  185   8e-53   
gb|KHN24676.1|  RNA-binding protein 24                                  185   1e-52   
ref|XP_006598066.1|  PREDICTED: RNA-binding protein 24-like             182   3e-52   
gb|AFW84411.1|  hypothetical protein ZEAMMB73_895673                    182   4e-52   
ref|XP_006836891.1|  hypothetical protein AMTR_s00099p00115860          186   1e-51   
gb|KFK44379.1|  hypothetical protein AALP_AA1G249800                    180   2e-49   
ref|NP_973888.1|  RNA recognition motif-containing protein              179   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890544.1|  hypothetical protein ARALYDRAFT_889804             179   5e-49   
ref|NP_564184.1|  RNA recognition motif-containing protein              179   5e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305319.1|  hypothetical protein CARUB_v10009698mg             181   6e-49   
ref|XP_006305320.1|  hypothetical protein CARUB_v10009698mg             181   9e-49   
ref|XP_009103214.1|  PREDICTED: RNA-binding protein 38-like isofo...    178   9e-49   
ref|XP_009103211.1|  PREDICTED: RNA-binding protein 38-like isofo...    178   1e-48   
ref|XP_010460060.1|  PREDICTED: RNA-binding protein 38-like isofo...    177   1e-48   
ref|XP_010460059.1|  PREDICTED: RNA-binding protein 38-like isofo...    177   2e-48   
ref|XP_006303296.1|  hypothetical protein CARUB_v10010106mg             177   2e-48   
ref|XP_009103212.1|  PREDICTED: RNA-binding protein 38-like isofo...    176   4e-48   
emb|CDY25759.1|  BnaA07g10230D                                          176   4e-48   
ref|XP_010478773.1|  PREDICTED: RNA-binding protein 24-like isofo...    176   4e-48   
ref|XP_006303297.1|  hypothetical protein CARUB_v10010106mg             176   4e-48   
ref|XP_006416143.1|  hypothetical protein EUTSA_v10008564mg             176   4e-48   
ref|NP_973889.1|  RNA recognition motif-containing protein              179   4e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478772.1|  PREDICTED: RNA-binding protein 24-like isofo...    176   4e-48   
ref|XP_006416144.1|  hypothetical protein EUTSA_v10008564mg             176   5e-48   
gb|ABK24496.1|  unknown                                                 177   5e-48   Picea sitchensis
gb|AAB72160.1|  unknown                                                 179   5e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CDY67263.1|  BnaCnng54160D                                          177   9e-48   
ref|XP_010542626.1|  PREDICTED: RNA-binding protein 38 isoform X2       174   1e-47   
ref|XP_006305318.1|  hypothetical protein CARUB_v10009698mg             176   1e-47   
ref|XP_010542619.1|  PREDICTED: RNA-binding protein 38 isoform X1       174   2e-47   
ref|XP_010498781.1|  PREDICTED: RNA-binding protein 38-like isofo...    174   2e-47   
emb|CDY69197.1|  BnaAnng29640D                                          173   3e-47   
ref|XP_010498780.1|  PREDICTED: RNA-binding protein 38-like isofo...    174   3e-47   
ref|XP_006603346.1|  PREDICTED: RNA-binding protein 24-A-like           174   3e-47   
emb|CDY04769.1|  BnaC05g18200D                                          173   4e-47   
ref|XP_009115581.1|  PREDICTED: RNA-binding protein 24                  173   5e-47   
ref|XP_010499898.1|  PREDICTED: RNA-binding protein 24-like isofo...    172   9e-47   
ref|XP_010499895.1|  PREDICTED: RNA-binding protein 24-like isofo...    172   1e-46   
ref|XP_010499894.1|  PREDICTED: RNA-binding protein 24-like isofo...    172   1e-46   
ref|XP_010461180.1|  PREDICTED: RNA-binding protein 24-like isofo...    171   4e-46   
ref|XP_010252040.1|  PREDICTED: RNA-binding protein 24-B-like iso...    172   4e-46   
gb|AAG51218.1|AC051630_15  RNA-binding protein; 68390-68829             166   4e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010252048.1|  PREDICTED: RNA-binding protein 38-like isofo...    171   5e-46   
ref|XP_010461178.1|  PREDICTED: RNA-binding protein 24-like isofo...    171   5e-46   
ref|XP_010461179.1|  PREDICTED: RNA-binding protein 24-like isofo...    171   5e-46   
ref|XP_006415084.1|  hypothetical protein EUTSA_v10008315mg             172   6e-46   
ref|XP_010252031.1|  PREDICTED: RNA-binding protein 24-like isofo...    171   6e-46   
ref|XP_010252022.1|  PREDICTED: RNA-binding protein 24-like isofo...    171   6e-46   
ref|XP_010689715.1|  PREDICTED: RNA-binding protein 24                  171   9e-46   
ref|XP_006833255.1|  hypothetical protein AMTR_s00113p00116350          171   1e-45   
ref|XP_007051436.1|  RNA-binding family protein isoform 1               171   2e-45   
ref|XP_007051437.1|  RNA-binding family protein isoform 2               171   2e-45   
ref|XP_002301439.2|  hypothetical protein POPTR_0002s17990g             170   2e-45   Populus trichocarpa [western balsam poplar]
ref|XP_002974002.1|  hypothetical protein SELMODRAFT_100311             165   2e-45   
ref|XP_011025379.1|  PREDICTED: RNA-binding protein 24-B isoform X2     169   3e-45   
ref|XP_008233052.1|  PREDICTED: RNA-binding protein 24-B                169   4e-45   
ref|XP_002267504.2|  PREDICTED: RNA-binding protein 38 isoform X2       169   4e-45   Vitis vinifera
ref|XP_007220153.1|  hypothetical protein PRUPE_ppa018603mg             164   4e-45   
ref|NP_973958.1|  RNA recognition motif-containing protein              168   4e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010661490.1|  PREDICTED: RNA-binding protein 38 isoform X1       169   5e-45   
ref|NP_174613.2|  RNA recognition motif-containing protein              168   5e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007221059.1|  hypothetical protein PRUPE_ppa016222mg             169   6e-45   
ref|XP_011025377.1|  PREDICTED: RNA-binding protein 24-B isoform X1     169   6e-45   
ref|XP_010267393.1|  PREDICTED: RNA-binding protein 38-like isofo...    168   7e-45   
ref|XP_010267392.1|  PREDICTED: RNA-binding protein 38-like isofo...    168   7e-45   
ref|XP_010267391.1|  PREDICTED: RNA-binding protein 38-like isofo...    168   7e-45   
ref|XP_002891043.1|  RNA recognition motif-containing protein           167   8e-45   
ref|XP_010107154.1|  RNA-binding protein 38                             167   9e-45   
ref|XP_010267394.1|  PREDICTED: RNA-binding protein 38-like isofo...    168   9e-45   
ref|XP_008353173.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...    169   9e-45   
ref|XP_002320228.2|  hypothetical protein POPTR_0014s10090g             169   1e-44   Populus trichocarpa [western balsam poplar]
gb|EAZ14898.1|  hypothetical protein OsJ_04828                          164   1e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007135311.1|  hypothetical protein PHAVU_010G118600g             168   2e-44   
ref|XP_007135310.1|  hypothetical protein PHAVU_010G118600g             168   2e-44   
ref|XP_006444735.1|  hypothetical protein CICLE_v10021586mg             167   2e-44   
ref|XP_010662927.1|  PREDICTED: RNA-binding protein 24                  167   2e-44   
gb|KDP28419.1|  hypothetical protein JCGZ_14190                         167   2e-44   
ref|XP_004306619.1|  PREDICTED: uncharacterized protein LOC101297372    167   4e-44   
gb|ABK93394.1|  unknown                                                 167   5e-44   Populus trichocarpa [western balsam poplar]
gb|KHG03974.1|  RNA-binding 38                                          167   9e-44   
ref|XP_011039250.1|  PREDICTED: RNA-binding protein 24-B-like iso...    166   1e-43   
ref|XP_011039241.1|  PREDICTED: RNA-binding protein 24-B-like iso...    166   1e-43   
ref|XP_006849958.1|  hypothetical protein AMTR_s00022p00143970          166   1e-43   
ref|XP_002515069.1|  RNA-binding region-containing protein, putative    165   2e-43   Ricinus communis
ref|XP_010094513.1|  RNA-binding protein 24                             165   2e-43   
ref|XP_006645362.1|  PREDICTED: RNA-binding protein 24-like             165   2e-43   
ref|NP_001045454.1|  Os01g0958500                                       165   2e-43   Oryza sativa Japonica Group [Japonica rice]
gb|KHN06357.1|  RNA-binding protein 38                                  165   2e-43   
ref|XP_003529876.1|  PREDICTED: RNA-binding protein 24-B-like           165   2e-43   
ref|XP_001761857.1|  predicted protein                                  158   2e-43   
ref|XP_010686592.1|  PREDICTED: RNA-binding protein 38 isoform X3       162   3e-43   
ref|XP_006598882.1|  PREDICTED: RNA-binding protein 24-A-like iso...    165   3e-43   
ref|XP_010664012.1|  PREDICTED: RNA-binding protein 24-A isoform X1     164   3e-43   
ref|XP_009366606.1|  PREDICTED: RNA-binding protein 24-B isoform X2     164   3e-43   
emb|CDY31508.1|  BnaC05g16170D                                          163   3e-43   
ref|XP_009366605.1|  PREDICTED: RNA-binding protein 24-B isoform X1     164   3e-43   
ref|XP_002456962.1|  hypothetical protein SORBIDRAFT_03g046430          166   3e-43   Sorghum bicolor [broomcorn]
ref|XP_006598881.1|  PREDICTED: RNA-binding protein 24-A-like iso...    164   3e-43   
ref|XP_006598880.1|  PREDICTED: RNA-binding protein 24-A-like iso...    164   4e-43   
ref|XP_010917972.1|  PREDICTED: RNA-binding protein 24-like             164   4e-43   
ref|XP_010686584.1|  PREDICTED: RNA-binding protein 24 isoform X2       164   4e-43   
ref|XP_010686576.1|  PREDICTED: RNA-binding protein 24 isoform X1       164   4e-43   
ref|XP_007135985.1|  hypothetical protein PHAVU_009G008600g             164   5e-43   
ref|XP_009151473.1|  PREDICTED: RNA-binding protein 38 isoform X3       162   5e-43   
ref|XP_007018664.1|  RNA-binding (RRM/RBD/RNP motifs) family prot...    164   5e-43   
emb|CDX73279.1|  BnaC05g28270D                                          162   6e-43   
ref|XP_009151472.1|  PREDICTED: RNA-binding protein 24-A isoform X2     162   7e-43   
ref|XP_009151471.1|  PREDICTED: RNA-binding protein 24-A isoform X1     162   8e-43   
ref|XP_003522980.1|  PREDICTED: RNA-binding protein 24-A-like           163   8e-43   
ref|XP_008376809.1|  PREDICTED: RNA-binding protein 38-like             161   1e-42   
ref|XP_008376224.1|  PREDICTED: RNA-binding protein 24-B                163   1e-42   
ref|XP_010664015.1|  PREDICTED: deleted in azoospermia-like isofo...    162   1e-42   
gb|KHN15892.1|  RNA-binding protein 38                                  163   1e-42   
ref|XP_006581126.1|  PREDICTED: RNA-binding protein 24-B-like iso...    162   1e-42   
ref|XP_004500827.1|  PREDICTED: RNA-binding protein 24-A-like           162   1e-42   
emb|CDP07254.1|  unnamed protein product                                162   1e-42   
emb|CDY29496.1|  BnaA06g14740D                                          162   1e-42   
ref|XP_009361289.1|  PREDICTED: RNA-binding protein 38-like             161   1e-42   
ref|XP_008791369.1|  PREDICTED: RNA-binding protein 24-B-like iso...    161   2e-42   
ref|XP_006581125.1|  PREDICTED: RNA-binding protein 24-B-like iso...    162   2e-42   
ref|XP_009782742.1|  PREDICTED: RNA-binding protein 38                  162   2e-42   
ref|XP_008791368.1|  PREDICTED: RNA-binding protein 24-like isofo...    162   2e-42   
ref|XP_007018663.1|  RNA-binding family protein isoform 1               163   2e-42   
ref|XP_004140591.1|  PREDICTED: uncharacterized protein LOC101210354    162   2e-42   
ref|XP_008460001.1|  PREDICTED: RNA-binding protein 24-B                162   2e-42   
ref|XP_010270570.1|  PREDICTED: RNA-binding protein 24-A                162   3e-42   
ref|XP_009606419.1|  PREDICTED: RNA-binding protein 38                  162   3e-42   
ref|XP_008237917.1|  PREDICTED: RNA-binding protein 24 isoform X2       161   3e-42   
ref|XP_010266283.1|  PREDICTED: RNA-binding protein 38-like             162   3e-42   
ref|XP_008237916.1|  PREDICTED: RNA-binding protein 24 isoform X1       161   3e-42   
ref|XP_001770459.1|  predicted protein                                  155   4e-42   
ref|XP_009149567.1|  PREDICTED: RNA-binding protein 24-like             160   4e-42   
ref|XP_011074059.1|  PREDICTED: RNA-binding protein 24-B                161   4e-42   
ref|XP_007209452.1|  hypothetical protein PRUPE_ppa009716mg             161   4e-42   
ref|XP_010906054.1|  PREDICTED: RNA-binding protein 24-B-like           161   5e-42   
gb|KHN20082.1|  RNA-binding protein 24                                  162   5e-42   
ref|XP_008234871.1|  PREDICTED: RNA-binding protein 38-like             160   5e-42   
gb|KDP36742.1|  hypothetical protein JCGZ_08033                         160   6e-42   
gb|KEH36355.1|  RNA-binding (RRM/RBD/RNP motif) family protein          160   6e-42   
ref|XP_006843226.1|  hypothetical protein AMTR_s00080p00053460          160   6e-42   
ref|XP_004146763.1|  PREDICTED: RNA-binding protein Musashi homol...    160   7e-42   
ref|XP_007136450.1|  hypothetical protein PHAVU_009G046300g             159   7e-42   
ref|XP_008464801.1|  PREDICTED: RNA-binding protein 24-A                160   8e-42   
ref|XP_006473858.1|  PREDICTED: RNA-binding protein 24-B-like iso...    156   9e-42   
ref|XP_007039188.1|  RNA-binding family protein, putative               161   9e-42   
ref|XP_010913866.1|  PREDICTED: RNA-binding protein 38-like             160   9e-42   
ref|XP_010320483.1|  PREDICTED: RNA-binding protein 24-A isoform X2     159   9e-42   
gb|KDP46154.1|  hypothetical protein JCGZ_06665                         159   1e-41   
ref|XP_011041156.1|  PREDICTED: RNA-binding protein 24-B-like           160   1e-41   
gb|EPS64804.1|  hypothetical protein M569_09976                         156   1e-41   
ref|XP_006342180.1|  PREDICTED: RNA-binding protein 24-B-like           160   2e-41   
ref|XP_004514931.1|  PREDICTED: RNA-binding protein 38-like             159   2e-41   
ref|XP_004238460.1|  PREDICTED: RNA-binding protein 24-B isoform X1     159   2e-41   
gb|KGN47777.1|  hypothetical protein Csa_6G401470                       160   2e-41   
gb|EYU36596.1|  hypothetical protein MIMGU_mgv1a011104mg                159   2e-41   
ref|XP_004971324.1|  PREDICTED: RNA-binding protein 24-B-like           160   3e-41   
ref|XP_006473857.1|  PREDICTED: RNA-binding protein 24-B-like iso...    159   3e-41   
ref|XP_002300621.1|  RNA recognition motif-containing family protein    159   3e-41   Populus trichocarpa [western balsam poplar]
ref|XP_002893136.1|  RNA recognition motif-containing protein           158   3e-41   
ref|XP_010474365.1|  PREDICTED: RNA-binding protein 24-like             157   3e-41   
ref|XP_006435451.1|  hypothetical protein CICLE_v10003364mg             158   4e-41   
ref|XP_010459779.1|  PREDICTED: RNA-binding protein 38-like isofo...    158   4e-41   
ref|XP_010928789.1|  PREDICTED: RNA-binding protein 24-B-like           159   4e-41   
ref|XP_011034797.1|  PREDICTED: RNA-binding protein 24-B isoform X1     159   4e-41   
gb|KDO85240.1|  hypothetical protein CISIN_1g023475mg                   157   4e-41   
ref|XP_011034798.1|  PREDICTED: RNA-binding protein 24-B isoform X2     159   4e-41   
ref|XP_002307819.1|  RNA recognition motif-containing family protein    158   5e-41   
ref|XP_008656291.1|  PREDICTED: RNA-binding protein 24-like             152   5e-41   
gb|KDO85241.1|  hypothetical protein CISIN_1g023475mg                   158   5e-41   
ref|XP_010539768.1|  PREDICTED: RNA-binding protein 24-A-like iso...    158   6e-41   
ref|XP_010539767.1|  PREDICTED: RNA-binding protein 24-A-like iso...    158   6e-41   
ref|XP_002979581.1|  hypothetical protein SELMODRAFT_38604              152   6e-41   
ref|XP_006302646.1|  hypothetical protein CARUB_v10020749mg             158   7e-41   
gb|KHG27980.1|  RNA-binding 24                                          160   7e-41   
ref|XP_010416567.1|  PREDICTED: RNA-binding protein 24-B                158   7e-41   
ref|XP_009415574.1|  PREDICTED: RNA-binding protein 24-B-like iso...    158   7e-41   
gb|AES74128.2|  RNA-binding (RRM/RBD/RNP motif) family protein          160   9e-41   
ref|XP_008779610.1|  PREDICTED: RNA-binding protein 24-like             152   9e-41   
ref|XP_010927301.1|  PREDICTED: RNA-binding protein 38-like             157   9e-41   
ref|XP_003603877.1|  RNA-binding protein 24-B                           160   9e-41   
ref|XP_009415575.1|  PREDICTED: RNA-binding protein 24-B-like iso...    157   1e-40   
gb|KHG09039.1|  RNA-binding 38                                          157   1e-40   
ref|NP_564127.1|  RNA recognition motif-containing protein              157   1e-40   
gb|AAN28829.1|  At1g20880/F9H16_14                                      157   1e-40   
gb|AAK73977.1|  At1g20880/F9H16_14                                      157   1e-40   
ref|XP_002889085.1|  RNA recognition motif-containing protein           157   1e-40   
ref|XP_010498531.1|  PREDICTED: RNA-binding protein 38-like isofo...    157   2e-40   
ref|XP_010539766.1|  PREDICTED: RNA-binding protein 38-like isofo...    157   2e-40   
ref|XP_010539765.1|  PREDICTED: RNA-binding protein 38-like isofo...    157   2e-40   
ref|XP_008242111.1|  PREDICTED: RNA-binding protein 24-A-like           157   2e-40   
ref|XP_007202445.1|  hypothetical protein PRUPE_ppa009964mg             156   2e-40   
ref|XP_010477345.1|  PREDICTED: RNA-binding protein 38-like             156   2e-40   
ref|XP_008346444.1|  PREDICTED: RNA-binding protein 24-A-like iso...    157   2e-40   
ref|XP_009372631.1|  PREDICTED: RNA-binding protein 24-A-like iso...    156   2e-40   
ref|XP_008392231.1|  PREDICTED: RNA-binding protein 24-like             156   2e-40   
ref|XP_007009716.1|  RNA-binding family protein isoform 2               155   2e-40   
ref|XP_010932147.1|  PREDICTED: RNA-binding protein 24 isoform X4       155   2e-40   
ref|XP_009350786.1|  PREDICTED: RNA-binding protein 24-A-like iso...    156   2e-40   
ref|XP_010431536.1|  PREDICTED: RNA-binding protein 24-B-like           157   3e-40   
ref|XP_007009715.1|  RNA-binding family protein isoform 1               155   3e-40   
ref|NP_565132.2|  RNA recognition motif-containing protein              156   3e-40   
ref|XP_010932145.1|  PREDICTED: RNA-binding protein 24 isoform X2       156   3e-40   
ref|XP_007009717.1|  RNA-binding family protein isoform 3               155   3e-40   
ref|XP_008782828.1|  PREDICTED: RNA-binding protein 38-like             156   3e-40   
ref|XP_003526753.1|  PREDICTED: RNA-binding protein 24-A                155   3e-40   
ref|XP_010033609.1|  PREDICTED: RNA-binding protein 24-A-like iso...    155   3e-40   
gb|AAD30604.1|AC007369_14  Unknown protein                              156   3e-40   
ref|XP_010033611.1|  PREDICTED: RNA-binding protein 24-A-like iso...    155   3e-40   
gb|KEH18582.1|  RNA-binding (RRM/RBD/RNP motif) family protein          155   4e-40   
gb|KEH18581.1|  RNA-binding (RRM/RBD/RNP motif) family protein          155   4e-40   
gb|AAF16655.1|AC012394_4  putative RNA-binding protein; 16955-18423     155   4e-40   
ref|XP_011027014.1|  PREDICTED: RNA-binding protein 24-like isofo...    155   5e-40   
ref|XP_002315274.1|  RNA recognition motif-containing family protein    155   5e-40   
ref|XP_009362899.1|  PREDICTED: RNA-binding protein 24-A-like iso...    155   5e-40   
ref|XP_009362893.1|  PREDICTED: RNA-binding protein 24-A-like iso...    155   6e-40   
ref|XP_011027013.1|  PREDICTED: RNA-binding protein 24-like isofo...    155   6e-40   
ref|XP_009362896.1|  PREDICTED: RNA-binding protein 24-A-like iso...    155   6e-40   
emb|CDY31859.1|  BnaC07g15090D                                          154   6e-40   
ref|XP_009362897.1|  PREDICTED: RNA-binding protein 24-A-like iso...    154   6e-40   
ref|XP_008346442.1|  PREDICTED: RNA-binding protein 24-B-like iso...    155   7e-40   
ref|XP_010932146.1|  PREDICTED: RNA-binding protein 24 isoform X3       154   8e-40   
ref|XP_009372630.1|  PREDICTED: RNA-binding protein 24-A-like iso...    155   8e-40   
ref|XP_010541246.1|  PREDICTED: RNA-binding protein 38-like             155   9e-40   
emb|CDY33653.1|  BnaC08g19530D                                          154   9e-40   
ref|XP_010932137.1|  PREDICTED: RNA-binding protein 24 isoform X1       155   9e-40   
ref|XP_010537234.1|  PREDICTED: RNA-binding protein 24-like             155   9e-40   
ref|XP_008778197.1|  PREDICTED: RNA-binding protein 24-like             154   9e-40   
ref|XP_009350785.1|  PREDICTED: RNA-binding protein 24-A-like iso...    155   9e-40   
ref|XP_008346441.1|  PREDICTED: RNA-binding protein 24-B-like iso...    155   1e-39   
ref|XP_009372628.1|  PREDICTED: RNA-binding protein 24-A-like iso...    155   1e-39   
ref|XP_008346436.1|  PREDICTED: RNA-binding protein 24-B-like iso...    155   1e-39   
ref|NP_001241070.1|  uncharacterized protein LOC100788634               154   1e-39   
ref|XP_009372629.1|  PREDICTED: RNA-binding protein 24-A-like iso...    155   1e-39   
ref|XP_006577816.1|  PREDICTED: uncharacterized protein LOC100788...    154   1e-39   
ref|XP_010048613.1|  PREDICTED: RNA-binding protein 38-like             154   1e-39   
ref|XP_008775469.1|  PREDICTED: RNA-binding protein 24-like             154   1e-39   
ref|XP_009350783.1|  PREDICTED: RNA-binding protein 24-A-like iso...    155   1e-39   
ref|XP_009350784.1|  PREDICTED: RNA-binding protein 24-A-like iso...    155   1e-39   
gb|KHN15883.1|  RNA-binding protein 24                                  154   1e-39   
ref|XP_006599765.1|  PREDICTED: RNA-binding protein 24-like             153   1e-39   
ref|XP_010253511.1|  PREDICTED: RNA-binding protein 38-like isofo...    154   1e-39   
ref|XP_010658454.1|  PREDICTED: RNA-binding protein 38 isoform X2       153   1e-39   
ref|XP_010267439.1|  PREDICTED: RNA-binding protein 24-A-like           154   2e-39   
ref|XP_009106314.1|  PREDICTED: RNA-binding protein 24-B                154   2e-39   
ref|XP_010253512.1|  PREDICTED: RNA-binding protein 38-like isofo...    153   2e-39   
ref|XP_004300105.1|  PREDICTED: RNA-binding protein squid-like          154   2e-39   
ref|XP_002278641.2|  PREDICTED: RNA-binding protein 38 isoform X1       153   2e-39   
ref|XP_010067262.1|  PREDICTED: RNA-binding protein 38 isoform X4       154   2e-39   
ref|XP_009359636.1|  PREDICTED: RNA-binding protein 24-like             154   2e-39   
ref|XP_010920930.1|  PREDICTED: RNA-binding protein 38-like             153   2e-39   
ref|XP_010067261.1|  PREDICTED: RNA-binding protein 38 isoform X3       154   2e-39   
ref|XP_009334336.1|  PREDICTED: RNA-binding protein 38-like             154   2e-39   
ref|XP_004516563.1|  PREDICTED: RNA-binding protein 38-like isofo...    153   2e-39   
ref|XP_009334339.1|  PREDICTED: RNA-binding protein 38-like             154   2e-39   
ref|XP_006596350.1|  PREDICTED: RNA-binding protein 38-like isofo...    153   2e-39   
ref|XP_006305520.1|  hypothetical protein CARUB_v10009992mg             153   3e-39   
ref|XP_004502740.1|  PREDICTED: RNA-binding protein 24-like             152   3e-39   
gb|KHN24344.1|  RNA-binding protein 38                                  153   3e-39   
ref|XP_003615131.1|  RNA-binding protein                                153   3e-39   
gb|KFK42067.1|  hypothetical protein AALP_AA2G206900                    153   3e-39   
ref|XP_003544797.1|  PREDICTED: RNA-binding protein 38-like isofo...    153   3e-39   
ref|XP_010067260.1|  PREDICTED: RNA-binding protein 38 isoform X2       154   3e-39   
gb|KFK42066.1|  hypothetical protein AALP_AA2G206900                    153   3e-39   
gb|KHG27611.1|  RNA-binding 24                                          152   3e-39   
ref|XP_011032750.1|  PREDICTED: RNA-binding protein 24-like isofo...    152   3e-39   
gb|KDP41394.1|  hypothetical protein JCGZ_15801                         153   3e-39   
emb|CDX88283.1|  BnaC06g37270D                                          153   4e-39   
ref|XP_010067259.1|  PREDICTED: RNA-binding protein 38 isoform X1       154   4e-39   
ref|XP_002312040.1|  RNA recognition motif-containing family protein    152   4e-39   
ref|XP_006416353.1|  hypothetical protein EUTSA_v10008444mg             153   4e-39   
ref|XP_011031987.1|  PREDICTED: RNA-binding protein 24-like isofo...    152   4e-39   
ref|XP_004516562.1|  PREDICTED: RNA-binding protein 38-like isofo...    153   4e-39   
ref|XP_007141185.1|  hypothetical protein PHAVU_008G174100g             153   4e-39   
ref|XP_008802154.1|  PREDICTED: RNA-binding protein 38-like isofo...    152   5e-39   
ref|XP_008802153.1|  PREDICTED: RNA-binding protein 38-like isofo...    153   5e-39   
ref|XP_008354592.1|  PREDICTED: RNA-binding protein 24-like             152   5e-39   
gb|KHG06496.1|  RNA-binding 38                                          151   6e-39   
emb|CDX87594.1|  BnaA07g32790D                                          153   7e-39   
gb|AAC33496.1|  putative RNA-binding protein                            153   8e-39   
ref|XP_010664338.1|  PREDICTED: RNA-binding protein 38 isoform X2       152   8e-39   
ref|XP_003634414.1|  PREDICTED: RNA-binding protein 38 isoform X1       152   8e-39   
ref|XP_010507973.1|  PREDICTED: uncharacterized protein LOC104784630    154   9e-39   
ref|XP_006593561.1|  PREDICTED: RNA-binding protein 38-like             152   9e-39   
gb|KCW56472.1|  hypothetical protein EUGRSUZ_I02201                     151   1e-38   
emb|CDP01753.1|  unnamed protein product                                152   1e-38   
ref|XP_010269321.1|  PREDICTED: RNA-binding protein 38-like isofo...    152   1e-38   
ref|XP_006397868.1|  hypothetical protein EUTSA_v10001545mg             153   1e-38   
ref|NP_182201.4|  RNA-binding (RRM/RBD/RNP motifs) family protein       153   1e-38   
ref|XP_010029554.1|  PREDICTED: RNA-binding protein 24-A-like iso...    152   1e-38   
emb|CAN65953.1|  hypothetical protein VITISV_026758                     149   1e-38   
ref|XP_010269319.1|  PREDICTED: RNA-binding protein 38-like isofo...    152   1e-38   
ref|XP_006304067.1|  hypothetical protein CARUB_v10009918mg             152   1e-38   
ref|XP_006294599.1|  hypothetical protein CARUB_v10023635mg             153   1e-38   
ref|XP_010029553.1|  PREDICTED: RNA-binding protein 24-like isofo...    152   1e-38   
ref|XP_002523906.1|  RNA-binding region-containing protein, putative    151   1e-38   
ref|XP_010098613.1|  RNA-binding protein 24                             151   1e-38   
ref|XP_009378129.1|  PREDICTED: RNA-binding protein 38-like isofo...    151   1e-38   
ref|XP_009378130.1|  PREDICTED: RNA-binding protein 38-like isofo...    150   1e-38   
ref|XP_009414024.1|  PREDICTED: RNA-binding protein 38-like isofo...    150   1e-38   
gb|AAM65641.1|  unknown                                                 147   2e-38   
gb|EMS45722.1|  RNA-binding protein 38                                  153   2e-38   
emb|CDY41556.1|  BnaC04g00660D                                          151   2e-38   
ref|XP_010063164.1|  PREDICTED: RNA-binding protein 38-like             151   2e-38   
ref|XP_008372597.1|  PREDICTED: RNA-binding protein 38-like             152   2e-38   
ref|XP_009399673.1|  PREDICTED: RNA-binding protein 38-like isofo...    151   2e-38   
ref|XP_004167274.1|  PREDICTED: DAZ-associated protein 1-like           148   2e-38   
ref|XP_009142606.1|  PREDICTED: RNA-binding protein 38 isoform X2       152   2e-38   
emb|CDY41557.1|  BnaC04g00650D                                          152   2e-38   
ref|XP_009142602.1|  PREDICTED: RNA-binding protein 38 isoform X1       152   2e-38   
emb|CDX80046.1|  BnaA05g01100D                                          152   2e-38   
ref|XP_009372873.1|  PREDICTED: RNA-binding protein 38 isoform X2       151   2e-38   
ref|XP_009414023.1|  PREDICTED: RNA-binding protein 38-like isofo...    150   2e-38   
ref|XP_009372866.1|  PREDICTED: RNA-binding protein 38 isoform X1       151   2e-38   
ref|XP_004287704.1|  PREDICTED: uncharacterized protein LOC101292540    151   2e-38   
ref|XP_006390192.1|  hypothetical protein EUTSA_v10018983mg             151   2e-38   
gb|EMT18764.1|  RNA-binding protein 24                                  152   2e-38   
ref|XP_002301058.2|  hypothetical protein POPTR_0002s09830g             150   3e-38   
emb|CDP01070.1|  unnamed protein product                                150   3e-38   
ref|XP_002880263.1|  hypothetical protein ARALYDRAFT_346489             152   3e-38   
ref|XP_007018749.1|  RNA-binding (RRM/RBD/RNP motifs) family prot...    150   3e-38   
ref|XP_010545168.1|  PREDICTED: RNA-binding protein 24-like             151   3e-38   
ref|XP_010091178.1|  RNA-binding protein 24                             149   3e-38   
ref|XP_008343508.1|  PREDICTED: RNA-binding protein 24-like             150   3e-38   
gb|KDP24922.1|  hypothetical protein JCGZ_24300                         150   4e-38   
ref|XP_009386798.1|  PREDICTED: RNA-binding protein 24-like             150   4e-38   
ref|XP_009369773.1|  PREDICTED: RNA-binding protein 24-like             150   4e-38   
ref|XP_011074197.1|  PREDICTED: RNA-binding protein 38                  150   4e-38   
ref|XP_009761580.1|  PREDICTED: RNA-binding protein 38-like isofo...    150   5e-38   
ref|XP_009333745.1|  PREDICTED: RNA-binding protein 38-like             149   5e-38   
ref|XP_006416209.1|  hypothetical protein EUTSA_v10008357mg             150   5e-38   
ref|XP_009761579.1|  PREDICTED: RNA-binding protein 38-like isofo...    150   5e-38   
ref|XP_010025803.1|  PREDICTED: RNA-binding protein 24-like             150   5e-38   
ref|XP_002513935.1|  RNA-binding region-containing protein, putative    149   5e-38   
emb|CDM86675.1|  unnamed protein product                                150   5e-38   
ref|XP_008376299.1|  PREDICTED: RNA-binding protein 38-like             149   5e-38   
ref|XP_006416208.1|  hypothetical protein EUTSA_v10008357mg             150   5e-38   
ref|XP_004136431.1|  PREDICTED: uncharacterized protein LOC101207645    150   5e-38   
gb|KHG05586.1|  RNA-binding 38                                          148   6e-38   
emb|CDX96615.1|  BnaA08g21580D                                          149   6e-38   
ref|XP_010506695.1|  PREDICTED: RNA-binding protein 38-like             151   6e-38   
ref|XP_010244994.1|  PREDICTED: RNA-binding protein 38-like isofo...    149   6e-38   
ref|NP_564168.2|  RNA recognition motif-containing protein              150   7e-38   
ref|XP_009110205.1|  PREDICTED: RNA-binding protein 24-like isofo...    149   7e-38   
ref|XP_006583206.1|  PREDICTED: RNA-binding protein 24-like isofo...    149   8e-38   
ref|NP_001049774.1|  Os03g0286500                                       150   8e-38   
ref|XP_006583205.1|  PREDICTED: RNA-binding protein 24-like isofo...    149   8e-38   
ref|XP_010244993.1|  PREDICTED: RNA-binding protein 38-like isofo...    149   9e-38   
ref|XP_006364834.1|  PREDICTED: RNA-binding protein 38-like isofo...    148   9e-38   
ref|XP_010498704.1|  PREDICTED: RNA-binding protein 24-like             145   1e-37   
ref|XP_009110206.1|  PREDICTED: RNA-binding protein 24-like isofo...    146   1e-37   
gb|KDO44584.1|  hypothetical protein CISIN_1g025468mg                   148   1e-37   
ref|XP_010316497.1|  PREDICTED: RNA-binding protein 24 isoform X3       148   1e-37   
ref|XP_004232592.1|  PREDICTED: RNA-binding protein 24 isoform X1       149   1e-37   
emb|CDY21356.1|  BnaA09g30710D                                          149   1e-37   
ref|XP_006364833.1|  PREDICTED: RNA-binding protein 38-like isofo...    149   1e-37   
ref|XP_009145348.1|  PREDICTED: RNA-binding protein 38-like             149   1e-37   
ref|XP_004237923.1|  PREDICTED: RNA-binding protein 24-B                149   1e-37   
ref|XP_007220834.1|  hypothetical protein PRUPE_ppa026384mg             148   1e-37   
ref|XP_010108447.1|  RNA-binding protein 38                             149   1e-37   
ref|XP_009142447.1|  PREDICTED: RNA-binding protein 38-like             150   2e-37   
emb|CDY27523.1|  BnaC04g51640D                                          150   2e-37   
ref|XP_006436202.1|  hypothetical protein CICLE_v10032535mg             148   2e-37   
ref|XP_006485938.1|  PREDICTED: RNA-binding protein 38-like isofo...    148   2e-37   
ref|XP_010477493.1|  PREDICTED: RNA-binding protein 24                  149   2e-37   
ref|XP_008792273.1|  PREDICTED: RNA-binding protein 24-A-like iso...    148   2e-37   
emb|CDY01349.1|  BnaA07g11220D                                          147   2e-37   
ref|XP_008792267.1|  PREDICTED: RNA-binding protein 24-A-like iso...    148   2e-37   
ref|XP_009103322.1|  PREDICTED: RNA-binding protein 24-like             147   2e-37   
gb|KHG04067.1|  RNA-binding 24                                          149   2e-37   
ref|XP_006648986.1|  PREDICTED: RNA-binding protein 24-like             149   2e-37   
ref|NP_001047916.1|  Os02g0714000                                       148   2e-37   
ref|XP_006363311.1|  PREDICTED: RNA-binding protein 24-like             149   2e-37   
ref|XP_010907524.1|  PREDICTED: RNA-binding protein 24-like isofo...    149   2e-37   
ref|XP_004169901.1|  PREDICTED: uncharacterized protein LOC101231499    148   2e-37   
ref|XP_004143608.1|  PREDICTED: uncharacterized protein LOC101202850    148   2e-37   
ref|XP_008792259.1|  PREDICTED: RNA-binding protein 24-A-like iso...    148   2e-37   
gb|KFK44330.1|  hypothetical protein AALP_AA1G244200                    148   2e-37   
ref|XP_006433966.1|  hypothetical protein CICLE_v10002164mg             147   3e-37   
ref|XP_003563604.1|  PREDICTED: RNA-binding protein 24-A-like           148   3e-37   
ref|XP_010459986.1|  PREDICTED: RNA-binding protein 24-like             148   3e-37   
ref|XP_011017519.1|  PREDICTED: RNA-binding protein 38                  148   3e-37   
ref|XP_010907523.1|  PREDICTED: RNA-binding protein 24-like isofo...    149   3e-37   
ref|XP_006473008.1|  PREDICTED: RNA-binding protein 38-like             147   3e-37   
ref|XP_010316496.1|  PREDICTED: RNA-binding protein 24 isoform X2       147   3e-37   
gb|KDO81003.1|  hypothetical protein CISIN_1g039503mg                   147   3e-37   
emb|CDY46642.1|  BnaA07g10540D                                          148   3e-37   
gb|KHG16788.1|  RNA-binding 38                                          147   3e-37   



>ref|XP_009762332.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Nicotiana 
sylvestris]
Length=274

 Score =   268 bits (684),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 199/276 (72%), Positives = 217/276 (79%), Gaps = 13/276 (5%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+PE
Sbjct  6     QFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREPE  65

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgga  895
             AAMRACVDAAPVIDGRRANCNLAS+GVQRSKP+TP KH   GGGRNF VMS FQGGF  A
Sbjct  66    AAMRACVDAAPVIDGRRANCNLASMGVQRSKPTTP-KH--AGGGRNFRVMSGFQGGFQTA  122

Query  894   aaafp----spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg  727
             A        S + F HYAIQQGIPYNLYGYS YSPDYTYPTGYYSVYGG   Q+P+YGT 
Sbjct  123   AGGLGTAFPSAATFPHYAIQQGIPYNLYGYSPYSPDYTYPTGYYSVYGGAASQYPVYGT-  181

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATV--NTT  553
              +     ++AAAAFYPY+NF     G  T    AASQGYGGVQYPHHLF YSA    +T 
Sbjct  182   -AASGVLSSAAAAFYPYMNF-GEGNGGATTGYTAASQGYGGVQYPHHLFQYSAAAINSTG  239

Query  552   AGYPAQHFANPISLAHTAPMQSGLTMAALRAPLPHR  445
              GYPAQH+  PISLA +  + SG+TM  LRAP+PHR
Sbjct  240   GGYPAQHYGTPISLAPSPALHSGVTM-TLRAPIPHR  274



>ref|XP_009762333.1| PREDICTED: RNA-binding protein 24-like isoform X2 [Nicotiana 
sylvestris]
Length=273

 Score =   268 bits (684),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 199/276 (72%), Positives = 217/276 (79%), Gaps = 14/276 (5%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+PE
Sbjct  6     QFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREPE  65

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgga  895
             AAMRACVDAAPVIDGRRANCNLAS+GVQRSKP+TP KH   GGGRNF VMS FQGGF  A
Sbjct  66    AAMRACVDAAPVIDGRRANCNLASMGVQRSKPTTP-KH---GGGRNFRVMSGFQGGFQTA  121

Query  894   aaafp----spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg  727
             A        S + F HYAIQQGIPYNLYGYS YSPDYTYPTGYYSVYGG   Q+P+YGT 
Sbjct  122   AGGLGTAFPSAATFPHYAIQQGIPYNLYGYSPYSPDYTYPTGYYSVYGGAASQYPVYGT-  180

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATV--NTT  553
              +     ++AAAAFYPY+NF     G  T    AASQGYGGVQYPHHLF YSA    +T 
Sbjct  181   -AASGVLSSAAAAFYPYMNF-GEGNGGATTGYTAASQGYGGVQYPHHLFQYSAAAINSTG  238

Query  552   AGYPAQHFANPISLAHTAPMQSGLTMAALRAPLPHR  445
              GYPAQH+  PISLA +  + SG+TM  LRAP+PHR
Sbjct  239   GGYPAQHYGTPISLAPSPALHSGVTM-TLRAPIPHR  273



>ref|XP_011008590.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Populus euphratica]
Length=272

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 185/272 (68%), Positives = 204/272 (75%), Gaps = 8/272 (3%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVI DKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVIADKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVDA+PVIDGRRANCNLASLGVQRSKPSTP KH  G  GRNF VMS+FQ GFGG
Sbjct  68    DAAMRACVDASPVIDGRRANCNLASLGVQRSKPSTP-KH--GAAGRNFRVMSSFQTGFGG  124

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                    S ++F HYAIQQGIPYN+YGYSSYSPDYTYP  YY++YGG T Q+PMYGT   
Sbjct  125   GVGTAFPSAASFPHYAIQQGIPYNVYGYSSYSPDYTYPASYYNMYGGATAQYPMYGT--G  182

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                    AAAAFYPYL              +  S    GVQYPHHLF YS+  +TT GYP
Sbjct  183   HGGMMNGAAAAFYPYLQI-GEGSTGGATSYSTTSGQSYGVQYPHHLFQYSSINSTTGGYP  241

Query  540   AQHFANPISLAHTAPMQSGLTMAALRAPLPHR  445
              QH+  P+SLA TA + SG+TMA    P+PHR
Sbjct  242   -QHYGAPMSLAPTAALPSGVTMALQAPPIPHR  272



>ref|XP_011008591.1| PREDICTED: RNA-binding protein 24-like isoform X2 [Populus euphratica]
Length=270

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 184/272 (68%), Positives = 203/272 (75%), Gaps = 10/272 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVI DKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVIADKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVDA+PVIDGRRANCNLASLGVQRSKPSTP KH     GRNF VMS+FQ GFGG
Sbjct  68    DAAMRACVDASPVIDGRRANCNLASLGVQRSKPSTP-KH----AGRNFRVMSSFQTGFGG  122

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                    S ++F HYAIQQGIPYN+YGYSSYSPDYTYP  YY++YGG T Q+PMYGT   
Sbjct  123   GVGTAFPSAASFPHYAIQQGIPYNVYGYSSYSPDYTYPASYYNMYGGATAQYPMYGT--G  180

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                    AAAAFYPYL              +  S    GVQYPHHLF YS+  +TT GYP
Sbjct  181   HGGMMNGAAAAFYPYLQI-GEGSTGGATSYSTTSGQSYGVQYPHHLFQYSSINSTTGGYP  239

Query  540   AQHFANPISLAHTAPMQSGLTMAALRAPLPHR  445
              QH+  P+SLA TA + SG+TMA    P+PHR
Sbjct  240   -QHYGAPMSLAPTAALPSGVTMALQAPPIPHR  270



>gb|KDP36698.1| hypothetical protein JCGZ_07989 [Jatropha curcas]
Length=270

 Score =   263 bits (673),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 192/272 (71%), Positives = 209/272 (77%), Gaps = 10/272 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET KDTMK YFEQFGEILEAVVITDKAT RSKGYGFVTFRDP
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKDTMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFRDP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAM+ACVDAAPVIDGRRANCNLASLGVQRSKPSTP KH GGG GRNF VMS+FQ GFGG
Sbjct  68    EAAMKACVDAAPVIDGRRANCNLASLGVQRSKPSTP-KH-GGGAGRNFRVMSSFQTGFGG  125

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                    S ++F HYAIQQGIPYN+YGYS YSPDY+YPT YYSVYGG T Q+PMY  G  
Sbjct  126   GVGTAFPSAASFPHYAIQQGIPYNVYGYSPYSPDYSYPTSYYSVYGGATAQYPMY--GTG  183

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                    AA AFYPYL F     G     T  AS    G+QYPHH+F YSA +N+T GYP
Sbjct  184   PGGMMTGAATAFYPYLQF---GEGNGGAATGYASGQSYGIQYPHHMFQYSA-INSTGGYP  239

Query  540   AQHFANPISLAHTAPMQSGLTMAALRAPLPHR  445
              Q +  P+SLA TA +QSG+T+A    P+PHR
Sbjct  240   -QQYGAPMSLAPTAALQSGVTVALPAPPIPHR  270



>ref|XP_009590241.1| PREDICTED: RNA-binding protein 38-like isoform X1 [Nicotiana 
tomentosiformis]
Length=276

 Score =   263 bits (672),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 198/278 (71%), Positives = 217/278 (78%), Gaps = 15/278 (5%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+PE
Sbjct  6     QFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREPE  65

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgga  895
             AAMRACVDAAPVIDGRRANCNLAS+GVQRSKP+TP KH   GGGRNF VMS FQGGF  A
Sbjct  66    AAMRACVDAAPVIDGRRANCNLASMGVQRSKPTTP-KH--AGGGRNFRVMSGFQGGFQTA  122

Query  894   aaafp------spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYG  733
             A          S + F HYAIQQGIPYNLYGYS YS DYTYPTGYYSVYGG   Q+P+YG
Sbjct  123   AGGGGLGTAFPSAATFPHYAIQQGIPYNLYGYSPYSLDYTYPTGYYSVYGGAASQYPVYG  182

Query  732   TgasgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYS-ATVNT  556
             T  +     ++AAAAFYPY+NF     G  T    AASQGYGGVQYPHHLF YS A +N+
Sbjct  183   T--AASGVLSSAAAAFYPYMNF-GEGNGGGTTGYTAASQGYGGVQYPHHLFQYSAAAINS  239

Query  555   T-AGYPAQHFANPISLAHTAPMQSGLTMAALRAPLPHR  445
             T  GYPAQH+  PISLA +  + SG+TM  LR P+PHR
Sbjct  240   TGGGYPAQHYGTPISLAPSPALHSGVTM-TLRGPIPHR  276



>ref|XP_009590242.1| PREDICTED: RNA-binding protein 38-like isoform X2 [Nicotiana 
tomentosiformis]
Length=275

 Score =   263 bits (671),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 198/278 (71%), Positives = 217/278 (78%), Gaps = 16/278 (6%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+PE
Sbjct  6     QFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREPE  65

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgga  895
             AAMRACVDAAPVIDGRRANCNLAS+GVQRSKP+TP KH   GGGRNF VMS FQGGF  A
Sbjct  66    AAMRACVDAAPVIDGRRANCNLASMGVQRSKPTTP-KH---GGGRNFRVMSGFQGGFQTA  121

Query  894   aaafp------spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYG  733
             A          S + F HYAIQQGIPYNLYGYS YS DYTYPTGYYSVYGG   Q+P+YG
Sbjct  122   AGGGGLGTAFPSAATFPHYAIQQGIPYNLYGYSPYSLDYTYPTGYYSVYGGAASQYPVYG  181

Query  732   TgasgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYS-ATVNT  556
             T  +     ++AAAAFYPY+NF     G  T    AASQGYGGVQYPHHLF YS A +N+
Sbjct  182   T--AASGVLSSAAAAFYPYMNF-GEGNGGGTTGYTAASQGYGGVQYPHHLFQYSAAAINS  238

Query  555   T-AGYPAQHFANPISLAHTAPMQSGLTMAALRAPLPHR  445
             T  GYPAQH+  PISLA +  + SG+TM  LR P+PHR
Sbjct  239   TGGGYPAQHYGTPISLAPSPALHSGVTM-TLRGPIPHR  275



>ref|XP_011004898.1| PREDICTED: RNA-binding protein 38-like isoform X1 [Populus euphratica]
Length=272

 Score =   260 bits (665),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 187/272 (69%), Positives = 209/272 (77%), Gaps = 8/272 (3%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVDAAPVIDGRRANCNLAS+GVQRSKPSTP KH  GG GRNF VMS+FQ GFGG
Sbjct  68    DAAMRACVDAAPVIDGRRANCNLASMGVQRSKPSTP-KH-AGGAGRNFRVMSSFQTGFGG  125

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                      ++F HYAIQQG+PYN+YGYSSYSPDYTYPT YY+VYGG T Q+PMYGT   
Sbjct  126   GVGTAFPPAASFPHYAIQQGMPYNVYGYSSYSPDYTYPTSYYNVYGGATAQYPMYGT--G  183

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                    +AAAFYPYL F  G G      +   S    GVQYP++LF YSA  +TT GYP
Sbjct  184   HGGLMNGSAAAFYPYLQF--GEGSGGAATSYPTSGQSYGVQYPYNLFQYSAINSTTGGYP  241

Query  540   AQHFANPISLAHTAPMQSGLTMAALRAPLPHR  445
              QH+  P+SLA TA + SG+T+A    P+PHR
Sbjct  242   -QHYGAPMSLAPTAALPSGVTLALQAPPIPHR  272



>ref|XP_006371379.1| hypothetical protein POPTR_0019s09640g [Populus trichocarpa]
 ref|XP_011004899.1| PREDICTED: RNA-binding protein 38-like isoform X2 [Populus euphratica]
 gb|ERP49176.1| hypothetical protein POPTR_0019s09640g [Populus trichocarpa]
Length=271

 Score =   260 bits (664),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 187/272 (69%), Positives = 209/272 (77%), Gaps = 9/272 (3%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVDAAPVIDGRRANCNLAS+GVQRSKPSTP KH  GG GRNF VMS+FQ GFGG
Sbjct  68    DAAMRACVDAAPVIDGRRANCNLASMGVQRSKPSTP-KH--GGAGRNFRVMSSFQTGFGG  124

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                      ++F HYAIQQG+PYN+YGYSSYSPDYTYPT YY+VYGG T Q+PMYGT   
Sbjct  125   GVGTAFPPAASFPHYAIQQGMPYNVYGYSSYSPDYTYPTSYYNVYGGATAQYPMYGT--G  182

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                    +AAAFYPYL F  G G      +   S    GVQYP++LF YSA  +TT GYP
Sbjct  183   HGGLMNGSAAAFYPYLQF--GEGSGGAATSYPTSGQSYGVQYPYNLFQYSAINSTTGGYP  240

Query  540   AQHFANPISLAHTAPMQSGLTMAALRAPLPHR  445
              QH+  P+SLA TA + SG+T+A    P+PHR
Sbjct  241   -QHYGAPMSLAPTAALPSGVTLALQAPPIPHR  271



>ref|XP_006352100.1| PREDICTED: RNA-binding protein 24-A-like isoform X1 [Solanum 
tuberosum]
Length=264

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 186/270 (69%), Positives = 206/270 (76%), Gaps = 11/270 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+ 
Sbjct  5     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREA  64

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVDAAPVIDGRRANCNLAS+GVQRSKP+TP KH  GGGGRN  VM +   G   
Sbjct  65    EAAMRACVDAAPVIDGRRANCNLASMGVQRSKPTTP-KH--GGGGRNLRVM-SGFHGGFQ  120

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasg  718
             +A AFPS + F HYAIQQGIPYNLYGYS YSPDYTYPTGYYSVYGG   Q+ +YG+ A+ 
Sbjct  121   SATAFPSATTFPHYAIQQGIPYNLYGYSPYSPDYTYPTGYYSVYGGGNSQYGVYGSAATA  180

Query  717   llsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYPA  538
                 ++AAAAFYPY+NF     G   G          GVQYPHHLFPYSA      GYP 
Sbjct  181   SGVLSSAAAAFYPYMNF-----GEGNGNGCYTPSQGYGVQYPHHLFPYSAAA-AGPGYPT  234

Query  537   QHFANPISLAHTAPMQSGLTMAALRAPLPH  448
             QH+  PISLA +  + SG+TM  LRAP+PH
Sbjct  235   QHYGTPISLAPSPALHSGVTM-TLRAPIPH  263



>ref|XP_002510776.1| RNA-binding region-containing protein, putative [Ricinus communis]
 gb|EEF52963.1| RNA-binding region-containing protein, putative [Ricinus communis]
Length=259

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 186/257 (72%), Positives = 201/257 (78%), Gaps = 13/257 (5%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET KDTMK YFEQFGEILEAVVITDKAT RSKGYGFVTFRDP
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKDTMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFRDP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVD+APVIDGRRANCNLASLGVQRSKPSTP KH GGGGGRN  V+        G
Sbjct  68    EAAMRACVDSAPVIDGRRANCNLASLGVQRSKPSTP-KH-GGGGGRNLRVI---SSFQTG  122

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasg  718
                AFPS ++F HYAIQQGIPYN+YGYS YSP+YTYPT YY+VYGG T Q+PMYGT    
Sbjct  123   FGTAFPSAASFPHYAIQQGIPYNVYGYSPYSPEYTYPTSYYNVYGGATAQYPMYGT--GH  180

Query  717   llsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYPA  538
                 + AAAAFYPYL F    G  + G T+ +S     VQYPHHLF YSA VN+T GYP 
Sbjct  181   SGMMSGAAAAFYPYLQF----GEGSGGATSYSSSQNYNVQYPHHLFQYSA-VNSTGGYP-  234

Query  537   QHFANPISLAHTAPMQS  487
             QHF  P+SLA TA +QS
Sbjct  235   QHFGAPLSLAPTASLQS  251



>ref|XP_010063726.1| PREDICTED: RNA-binding protein 38-like [Eucalyptus grandis]
Length=270

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 181/271 (67%), Positives = 205/271 (76%), Gaps = 8/271 (3%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET KDTMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKDTMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVDA+PVIDGRRANCNLA LG+QRSKPSTP K GGGG     M      G  GG
Sbjct  68    EAAMRACVDASPVIDGRRANCNLACLGLQRSKPSTP-KTGGGGRNMRGMSGFQTGGFHGG  126

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasg  718
                AF S + F HYA+QQG P++++ YSSYSPDYTYP  YYSVYGG   Q+PMYGT    
Sbjct  127   VGTAFASAATFPHYALQQGFPFSVFRYSSYSPDYTYPANYYSVYGGAAAQYPMYGT--GP  184

Query  717   llsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYPA  538
                   AA AFYPYL+     G  ++G ++ +S    GVQYPHHLF YSA +N+T+GYPA
Sbjct  185   SGLMNGAATAFYPYLHL---AGEGSSGGSSYSSGQNYGVQYPHHLFHYSA-INSTSGYPA  240

Query  537   QHFANPISLAHTAPMQSGLTMAALRAPLPHR  445
             QH+A P+SLA T  + SG+TM AL AP+PHR
Sbjct  241   QHYAAPMSLAPTPALHSGVTM-ALHAPIPHR  270



>ref|XP_007019702.1| RNA-binding family protein isoform 2, partial [Theobroma cacao]
 gb|EOY16927.1| RNA-binding family protein isoform 2, partial [Theobroma cacao]
Length=261

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 189/263 (72%), Positives = 200/263 (76%), Gaps = 12/263 (5%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET KDTMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKDTMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP KH  GG GRNF VMS+FQ GFGG
Sbjct  68    EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP-KH--GGTGRNFRVMSSFQTGFGG  124

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                    S + F HYAIQQGIPYN+YGYS YSPDYTYPT YYSVYGG T Q+P+YG  A 
Sbjct  125   GVGTAFPSAATFPHYAIQQGIPYNVYGYSPYSPDYTYPTSYYSVYGGATAQYPVYG--AG  182

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                    A   FYPYL F    G  T G T   S    GVQYPHH F YSA VN+T  YP
Sbjct  183   PGGLMTGAGTTFYPYLQF----GEGTGGATGYTSGQGYGVQYPHHPFQYSA-VNSTGSYP  237

Query  540   AQHFANPISLAHTAPMQSGLTMA  472
              QH+  P+SLA T  +QSG+TMA
Sbjct  238   -QHYGAPMSLAPTPALQSGVTMA  259



>ref|XP_010644001.1| PREDICTED: RNA-binding protein 24 isoform X1 [Vitis vinifera]
Length=269

 Score =   253 bits (646),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 185/272 (68%), Positives = 200/272 (74%), Gaps = 11/272 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKTTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP KH   GGGRNF VM +FQ GF G
Sbjct  68    DAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP-KH---GGGRNFRVMGSFQTGFQG  123

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                    S + F HYAIQQGIPYNLYGYS YSPDYTYPT YYSVYGG   Q+P+YG    
Sbjct  124   GVGTAFPSAATFPHYAIQQGIPYNLYGYSPYSPDYTYPTSYYSVYGGAAAQYPVYGA--G  181

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                    A AAFYPYL F     G         S    GVQYPHHL  YSA +N+T GYP
Sbjct  182   PGGMMTGAGAAFYPYLQF-GEGSGGAAASGGYTSGQGYGVQYPHHLVQYSA-INSTGGYP  239

Query  540   AQHFANPISLAHTAPMQSGLTMAALRAPLPHR  445
              QH+  P+SLA T  +QSG+ M AL AP+ +R
Sbjct  240   -QHYGAPMSLAPTPALQSGVNM-ALHAPISNR  269



>ref|XP_007131315.1| hypothetical protein PHAVU_011G003400g [Phaseolus vulgaris]
 gb|ESW03309.1| hypothetical protein PHAVU_011G003400g [Phaseolus vulgaris]
Length=273

 Score =   253 bits (645),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 186/272 (68%), Positives = 206/272 (76%), Gaps = 7/272 (3%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP KH GGGGGRN  VM +FQ GFGG
Sbjct  68    EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP-KH-GGGGGRNLRVMGSFQTGFGG  125

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                +   S + F HYAIQQGIPYN+YGYS YSPDYTYPT YY VYGG T Q+P+YG+   
Sbjct  126   GVGSAFPSAATFPHYAIQQGIPYNVYGYSPYSPDYTYPTSYYGVYGGATAQYPVYGS---  182

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
             G       AAAFYPYL +G    G        +S    GV Y  HLF YS   +T AG  
Sbjct  183   GPGGMMTGAAAFYPYLQYGGEGSGGGGTSGGYSSGQGYGVNYAPHLFQYSPIASTAAGAY  242

Query  540   AQHFANPISLAHTAPMQSGLTMAALRAPLPHR  445
             AQH+  P+SLA +  +QSG+TM +L+AP+PHR
Sbjct  243   AQHYGTPMSLAPSPALQSGVTM-SLQAPIPHR  273



>ref|XP_004250742.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Solanum lycopersicum]
Length=266

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 176/271 (65%), Positives = 196/271 (72%), Gaps = 13/271 (5%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+ E
Sbjct  6     QFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREAE  65

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgga  895
             AAMRACVDAAPVIDGRRANCNLAS+GVQRSKP+TP KH   GGGRN  VM +   G    
Sbjct  66    AAMRACVDAAPVIDGRRANCNLASMGVQRSKPTTP-KH---GGGRNLRVM-SGFHGGFQT  120

Query  894   aaafpspsnfSHYAIQQGIPYNLygys-syspdytyptgyysvyggvtGQFPMYGTgasg  718
             A AFPS + F HYAIQQGIPYNLYGYS          TGYYSVYGG   Q+ +YG+ A+ 
Sbjct  121   ATAFPSATTFPHYAIQQGIPYNLYGYSPYSPDYTYPTTGYYSVYGGGNSQYGVYGSAATA  180

Query  717   llsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTA-GYP  541
                 ++AAAAFYPY+NF     G   G          GVQYPHHLFPYSA       GYP
Sbjct  181   SGVLSSAAAAFYPYMNF-----GEGNGNGCYTPSQGYGVQYPHHLFPYSAAAAAAGPGYP  235

Query  540   AQHFANPISLAHTAPMQSGLTMAALRAPLPH  448
              QH+  PISLA +  + SG+TM +LRAP+PH
Sbjct  236   TQHYGTPISLAPSPALHSGVTM-SLRAPIPH  265



>ref|XP_009762334.1| PREDICTED: RNA-binding protein 24-like isoform X3 [Nicotiana 
sylvestris]
Length=269

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 189/262 (72%), Positives = 205/262 (78%), Gaps = 12/262 (5%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+PE
Sbjct  6     QFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREPE  65

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgga  895
             AAMRACVDAAPVIDGRRANCNLAS+GVQRSKP+TP KH   GGGRNF VMS FQGGF  A
Sbjct  66    AAMRACVDAAPVIDGRRANCNLASMGVQRSKPTTP-KH--AGGGRNFRVMSGFQGGFQTA  122

Query  894   aaafp----spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg  727
             A        S + F HYAIQQGIPYNLYGYS YSPDYTYPTGYYSVYGG   Q+P+YGT 
Sbjct  123   AGGLGTAFPSAATFPHYAIQQGIPYNLYGYSPYSPDYTYPTGYYSVYGGAASQYPVYGT-  181

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATV--NTT  553
              +     ++AAAAFYPY+NF     G  T    AASQGYGGVQYPHHLF YSA    +T 
Sbjct  182   -AASGVLSSAAAAFYPYMNF-GEGNGGATTGYTAASQGYGGVQYPHHLFQYSAAAINSTG  239

Query  552   AGYPAQHFANPISLAHTAPMQS  487
              GYPAQH+  PISLA +  + S
Sbjct  240   GGYPAQHYGTPISLAPSPALHS  261



>ref|XP_002319865.1| hypothetical protein POPTR_0013s09120g [Populus trichocarpa]
 gb|EEE95788.1| hypothetical protein POPTR_0013s09120g [Populus trichocarpa]
Length=266

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 177/258 (69%), Positives = 195/258 (76%), Gaps = 8/258 (3%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVI DKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVIADKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVDA+PVIDGRRANCNLASLGVQRSKPSTP KH  G  GRNF VMS+FQ GFGG
Sbjct  68    DAAMRACVDASPVIDGRRANCNLASLGVQRSKPSTP-KH--GAAGRNFRVMSSFQTGFGG  124

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                    S ++F HYAIQQGIPYN+YGYSSYSPDYTYP  YY++YGG T Q+PMYG+   
Sbjct  125   GVGTAFPSAASFPHYAIQQGIPYNVYGYSSYSPDYTYPASYYNMYGGATAQYPMYGS--G  182

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                    AAAAFYPYL F            +  S    GVQYPHHLF YS+  +TT GYP
Sbjct  183   HGGMMNGAAAAFYPYLQF-GEGSTGGATSYSNTSGQSYGVQYPHHLFQYSSINSTTGGYP  241

Query  540   AQHFANPISLAHTAPMQS  487
              QH+  P+SLA TA + S
Sbjct  242   -QHYGAPMSLAPTAALPS  258



>ref|XP_011008592.1| PREDICTED: RNA-binding protein 24-like isoform X3 [Populus euphratica]
Length=266

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 177/258 (69%), Positives = 194/258 (75%), Gaps = 8/258 (3%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVI DKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVIADKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVDA+PVIDGRRANCNLASLGVQRSKPSTP KH  G  GRNF VMS+FQ GFGG
Sbjct  68    DAAMRACVDASPVIDGRRANCNLASLGVQRSKPSTP-KH--GAAGRNFRVMSSFQTGFGG  124

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                    S ++F HYAIQQGIPYN+YGYSSYSPDYTYP  YY++YGG T Q+PMYGT   
Sbjct  125   GVGTAFPSAASFPHYAIQQGIPYNVYGYSSYSPDYTYPASYYNMYGGATAQYPMYGT--G  182

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                    AAAAFYPYL              +  S    GVQYPHHLF YS+  +TT GYP
Sbjct  183   HGGMMNGAAAAFYPYLQI-GEGSTGGATSYSTTSGQSYGVQYPHHLFQYSSINSTTGGYP  241

Query  540   AQHFANPISLAHTAPMQS  487
              QH+  P+SLA TA + S
Sbjct  242   -QHYGAPMSLAPTAALPS  258



>ref|XP_008237806.1| PREDICTED: RNA-binding protein 38-like isoform X1 [Prunus mume]
Length=288

 Score =   248 bits (634),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 194/283 (69%), Positives = 211/283 (75%), Gaps = 14/283 (5%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+ 
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFRES  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP KHGGGG GRNF VM +FQ GFGG
Sbjct  68    EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP-KHGGGGAGRNFRVMGSFQTGFGG  126

Query  897   aaaaf--pspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg-  727
                +    + + F HYAIQQGIPYNLYGYS YSPDYTYPT YY +YGG TGQ+PMYGT  
Sbjct  127   GVGSAFPSAAATFPHYAIQQGIPYNLYGYSPYSPDYTYPTNYYGLYGGATGQYPMYGTSP  186

Query  726   -asgllsgaaaaaAFYPYLNFgegnggattgytaaasqg---ygGVQYP----HHLFPYS  571
                 +   AAAAAAFYPYL +G    G      +  S       GVQYP    HHLF YS
Sbjct  187   AGGMVTGAAAAAAAFYPYLQYGSEGNGGAAAAYSTTSGVQNYATGVQYPHHHHHHLFQYS  246

Query  570   ATVNTTAGYPAQHFANPISLAHTAPMQS-GLTMAALRAPLPHR  445
             A  +T  G   QH+  PISLA +  +QS G+TM AL AP+PHR
Sbjct  247   ALNSTGVGGGYQHYGPPISLAPSPALQSPGVTM-ALPAPIPHR  288



>ref|XP_006441811.1| hypothetical protein CICLE_v10021520mg [Citrus clementina]
 ref|XP_006478308.1| PREDICTED: RNA-binding protein 24-like isoform X3 [Citrus sinensis]
 gb|ESR55051.1| hypothetical protein CICLE_v10021520mg [Citrus clementina]
Length=285

 Score =   247 bits (631),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 182/275 (66%), Positives = 203/275 (74%), Gaps = 12/275 (4%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDKAT RSKGYGFVTFR+PEA
Sbjct  17    FGDTTYTKVFVGGLAWETQKETMEKYFEQFGEILEAVVITDKATGRSKGYGFVTFREPEA  76

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaa  892
             AM+ACVDAAPVIDGRRANCNLA LGVQRSKPSTP KHGGGG     ++ +   GGFGG  
Sbjct  77    AMKACVDAAPVIDGRRANCNLACLGVQRSKPSTP-KHGGGGRNNLRLMSTFQNGGFGGTT  135

Query  891   aafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg-----  727
                 + + F HYAIQQGIP+NLYGYS YS DYTYPT YY+VYGG   Q+PMYG G     
Sbjct  136   FPSTAAATFPHYAIQQGIPFNLYGYSPYSADYTYPTSYYNVYGGAAAQYPMYGNGHAAGG  195

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAG  547
                  + AAAAAA+YPYL F     G     T   S    GVQYPHHLFPYS T+N  AG
Sbjct  196   MMTGGAAAAAAAAYYPYLQF---GEGTGAATTGYTSGQGYGVQYPHHLFPYS-TINAAAG  251

Query  546   YPAQHFANPISLAHTAPMQSGLTMAALRA-PLPHR  445
             YP QH+  P+S+A T  +QSG+T  AL A P+PHR
Sbjct  252   YP-QHYGPPMSIAPTPALQSGVTNMALHAPPIPHR  285



>ref|XP_009590243.1| PREDICTED: RNA-binding protein 38-like isoform X3 [Nicotiana 
tomentosiformis]
Length=271

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 188/264 (71%), Positives = 204/264 (77%), Gaps = 14/264 (5%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+PE
Sbjct  6     QFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREPE  65

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgga  895
             AAMRACVDAAPVIDGRRANCNLAS+GVQRSKP+TP KH   GGGRNF VMS FQGGF  A
Sbjct  66    AAMRACVDAAPVIDGRRANCNLASMGVQRSKPTTP-KH--AGGGRNFRVMSGFQGGFQTA  122

Query  894   aaafp------spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYG  733
             A          S + F HYAIQQGIPYNLYGYS YS DYTYPTGYYSVYGG   Q+P+YG
Sbjct  123   AGGGGLGTAFPSAATFPHYAIQQGIPYNLYGYSPYSLDYTYPTGYYSVYGGAASQYPVYG  182

Query  732   TgasgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATV--N  559
             T  +     ++AAAAFYPY+NF     G  T    AASQGYGGVQYPHHLF YSA    +
Sbjct  183   T--AASGVLSSAAAAFYPYMNF-GEGNGGGTTGYTAASQGYGGVQYPHHLFQYSAAAINS  239

Query  558   TTAGYPAQHFANPISLAHTAPMQS  487
             T  GYPAQH+  PISLA +  + S
Sbjct  240   TGGGYPAQHYGTPISLAPSPALHS  263



>ref|XP_006478306.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Citrus sinensis]
 ref|XP_006478307.1| PREDICTED: RNA-binding protein 24-like isoform X2 [Citrus sinensis]
Length=286

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 180/275 (65%), Positives = 201/275 (73%), Gaps = 11/275 (4%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDKAT RSKGYGFVTFR+PEA
Sbjct  17    FGDTTYTKVFVGGLAWETQKETMEKYFEQFGEILEAVVITDKATGRSKGYGFVTFREPEA  76

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaa  892
             AM+ACVDAAPVIDGRRANCNLA LGVQRSKPSTP   GGGG     ++ +   GGFGG  
Sbjct  77    AMKACVDAAPVIDGRRANCNLACLGVQRSKPSTPKHGGGGGRNNLRLMSTFQNGGFGGTT  136

Query  891   aafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg-----  727
                 + + F HYAIQQGIP+NLYGYS YS DYTYPT YY+VYGG   Q+PMYG G     
Sbjct  137   FPSTAAATFPHYAIQQGIPFNLYGYSPYSADYTYPTSYYNVYGGAAAQYPMYGNGHAAGG  196

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAG  547
                  + AAAAAA+YPYL F     G     T   S    GVQYPHHLFPYS T+N  AG
Sbjct  197   MMTGGAAAAAAAAYYPYLQF---GEGTGAATTGYTSGQGYGVQYPHHLFPYS-TINAAAG  252

Query  546   YPAQHFANPISLAHTAPMQSGLTMAALRA-PLPHR  445
             YP QH+  P+S+A T  +QSG+T  AL A P+PHR
Sbjct  253   YP-QHYGPPMSIAPTPALQSGVTNMALHAPPIPHR  286



>ref|XP_011095164.1| PREDICTED: RNA-binding protein 24 [Sesamum indicum]
 ref|XP_011095173.1| PREDICTED: RNA-binding protein 24 [Sesamum indicum]
Length=279

 Score =   246 bits (627),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 177/279 (63%), Positives = 198/279 (71%), Gaps = 15/279 (5%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET KDTMK YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKDTMKKYFEQFGEILEAVVITDKTTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgg--gggGRNFMVMsafqggf  904
             +AAMRACVDA PVIDGRRANCNLASLGVQRSKPSTP KH    GGGGRN  V+       
Sbjct  68    DAAMRACVDATPVIDGRRANCNLASLGVQRSKPSTP-KHAAGGGGGGRNIRVVGGGGFHQ  126

Query  903   ggaaaafpspsnfS---HYAIQQGIPYNLygyss-yspdytyptgyysvyggvtGQFPMY  736
             G  A A       S   HY+IQQGIPYNLY   S YSP+Y YPT YY VYGG + Q+P+Y
Sbjct  127   GAGAGAAGFQGFASTFPHYSIQQGIPYNLYAGYSPYSPEYAYPTSYYGVYGGGSPQYPLY  186

Query  735   GTgasgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNT  556
             GT         ++AAA+YPYLN     G       +A+    GG+QYPHHLF YSA +N+
Sbjct  187   GT--GSTGGLLSSAAAYYPYLNL-SSEGTGGAAAYSASQGYAGGLQYPHHLFQYSA-INS  242

Query  555   TAGYPAQHFANPISLAHTAPMQSGLTMAALRA--PLPHR  445
             TA YP  H+  P+SLA   P+QSG+TM  L A  P+PHR
Sbjct  243   TAIYPP-HYGTPVSLAPPTPLQSGITM-TLHAPIPIPHR  279



>ref|XP_011004901.1| PREDICTED: RNA-binding protein 38-like isoform X3 [Populus euphratica]
Length=266

 Score =   245 bits (625),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 180/258 (70%), Positives = 199/258 (77%), Gaps = 8/258 (3%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVDAAPVIDGRRANCNLAS+GVQRSKPSTP KH  GG GRNF VMS+FQ GFGG
Sbjct  68    DAAMRACVDAAPVIDGRRANCNLASMGVQRSKPSTP-KH-AGGAGRNFRVMSSFQTGFGG  125

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                      ++F HYAIQQG+PYN+YGYSSYSPDYTYPT YY+VYGG T Q+PMYGT   
Sbjct  126   GVGTAFPPAASFPHYAIQQGMPYNVYGYSSYSPDYTYPTSYYNVYGGATAQYPMYGT--G  183

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                    +AAAFYPYL F  G G      +   S    GVQYP++LF YSA  +TT GYP
Sbjct  184   HGGLMNGSAAAFYPYLQF--GEGSGGAATSYPTSGQSYGVQYPYNLFQYSAINSTTGGYP  241

Query  540   AQHFANPISLAHTAPMQS  487
              QH+  P+SLA TA + S
Sbjct  242   -QHYGAPMSLAPTAALPS  258



>ref|XP_004506366.1| PREDICTED: RNA-binding protein Musashi homolog Rbp6-like isoform 
X1 [Cicer arietinum]
Length=272

 Score =   245 bits (625),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 185/273 (68%), Positives = 209/273 (77%), Gaps = 10/273 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVDAAP+IDGRRANCNLASLGVQRSKPSTP KH  GG GRNF VM +FQ GFGG
Sbjct  68    DAAMRACVDAAPIIDGRRANCNLASLGVQRSKPSTP-KH--GGTGRNFRVMGSFQTGFGG  124

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg--a  724
               +AFPS + F HYAIQQGIPYN+YGYSSYSPDY+YPT YY +YGG   Q+P+YG+G   
Sbjct  125   VGSAFPSAATFPHYAIQQGIPYNVYGYSSYSPDYSYPTSYYGLYGGAAAQYPVYGSGPAG  184

Query  723   sgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGY  544
               +   AAAAAAFYPYL +  G G          S    GV Y   +F YS  + +T GY
Sbjct  185   GMMSGAAAAAAAFYPYLQY--GEGSGGATTGGYTSGQGYGVNYQPQVFQYSP-IASTGGY  241

Query  543   PAQHFANPISLAHTAPMQSGLTMAALRAPLPHR  445
              AQH+  PISLA +  +QSG+TMA  +A +PHR
Sbjct  242   -AQHYGTPISLAPSPALQSGVTMAP-QAQIPHR  272



>ref|XP_011004902.1| PREDICTED: RNA-binding protein 38-like isoform X4 [Populus euphratica]
Length=265

 Score =   244 bits (624),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 180/258 (70%), Positives = 199/258 (77%), Gaps = 9/258 (3%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVDAAPVIDGRRANCNLAS+GVQRSKPSTP KH  GG GRNF VMS+FQ GFGG
Sbjct  68    DAAMRACVDAAPVIDGRRANCNLASMGVQRSKPSTP-KH--GGAGRNFRVMSSFQTGFGG  124

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                      ++F HYAIQQG+PYN+YGYSSYSPDYTYPT YY+VYGG T Q+PMYGT   
Sbjct  125   GVGTAFPPAASFPHYAIQQGMPYNVYGYSSYSPDYTYPTSYYNVYGGATAQYPMYGT--G  182

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                    +AAAFYPYL F  G G      +   S    GVQYP++LF YSA  +TT GYP
Sbjct  183   HGGLMNGSAAAFYPYLQF--GEGSGGAATSYPTSGQSYGVQYPYNLFQYSAINSTTGGYP  240

Query  540   AQHFANPISLAHTAPMQS  487
              QH+  P+SLA TA + S
Sbjct  241   -QHYGAPMSLAPTAALPS  257



>emb|CAN73746.1| hypothetical protein VITISV_041364 [Vitis vinifera]
Length=269

 Score =   244 bits (623),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 179/259 (69%), Positives = 191/259 (74%), Gaps = 10/259 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKTTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP KH   GGGRNF VM +FQ GF G
Sbjct  68    DAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP-KH---GGGRNFRVMGSFQTGFQG  123

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                    S + F HYAIQQGIPYNLYGYS YSPDYTYPT YYSVYGG   Q+P+YG    
Sbjct  124   GVGTAFPSAATFPHYAIQQGIPYNLYGYSPYSPDYTYPTSYYSVYGGAAAQYPVYGA--G  181

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                    A AAFYPYL F     G         S    GVQYPHHL  YSA +N+T GYP
Sbjct  182   PGGMMTGAGAAFYPYLQF-GEGSGGAAASGGYTSGQGYGVQYPHHLVQYSA-INSTGGYP  239

Query  540   AQHFANPISLAHTAPMQSG  484
              QH+  P+SLA T  +QSG
Sbjct  240   -QHYGAPMSLAPTPALQSG  257



>ref|XP_006352101.1| PREDICTED: RNA-binding protein 24-A-like isoform X2 [Solanum 
tuberosum]
Length=259

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 177/257 (69%), Positives = 195/257 (76%), Gaps = 10/257 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+ 
Sbjct  5     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREA  64

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVDAAPVIDGRRANCNLAS+GVQRSKP+TP KH  GGGGRN  VM +   G   
Sbjct  65    EAAMRACVDAAPVIDGRRANCNLASMGVQRSKPTTP-KH--GGGGRNLRVM-SGFHGGFQ  120

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasg  718
             +A AFPS + F HYAIQQGIPYNLYGYS YSPDYTYPTGYYSVYGG   Q+ +YG+ A+ 
Sbjct  121   SATAFPSATTFPHYAIQQGIPYNLYGYSPYSPDYTYPTGYYSVYGGGNSQYGVYGSAATA  180

Query  717   llsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYPA  538
                 ++AAAAFYPY+NF     G   G          GVQYPHHLFPYSA      GYP 
Sbjct  181   SGVLSSAAAAFYPYMNF-----GEGNGNGCYTPSQGYGVQYPHHLFPYSAAA-AGPGYPT  234

Query  537   QHFANPISLAHTAPMQS  487
             QH+  PISLA +  + S
Sbjct  235   QHYGTPISLAPSPALHS  251



>ref|XP_002266779.1| PREDICTED: RNA-binding protein 24 isoform X2 [Vitis vinifera]
 emb|CBI16988.3| unnamed protein product [Vitis vinifera]
Length=264

 Score =   242 bits (617),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 178/258 (69%), Positives = 190/258 (74%), Gaps = 10/258 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKTTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP KH   GGGRNF VM +FQ GF G
Sbjct  68    DAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP-KH---GGGRNFRVMGSFQTGFQG  123

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                    S + F HYAIQQGIPYNLYGYS YSPDYTYPT YYSVYGG   Q+P+YG    
Sbjct  124   GVGTAFPSAATFPHYAIQQGIPYNLYGYSPYSPDYTYPTSYYSVYGGAAAQYPVYGA--G  181

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                    A AAFYPYL F     G         S    GVQYPHHL  YSA +N+T GYP
Sbjct  182   PGGMMTGAGAAFYPYLQF-GEGSGGAAASGGYTSGQGYGVQYPHHLVQYSA-INSTGGYP  239

Query  540   AQHFANPISLAHTAPMQS  487
              QH+  P+SLA T  +QS
Sbjct  240   -QHYGAPMSLAPTPALQS  256



>ref|XP_006587725.1| PREDICTED: RNA-binding protein 24-like isoform X2 [Glycine max]
Length=272

 Score =   242 bits (617),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 187/278 (67%), Positives = 206/278 (74%), Gaps = 20/278 (7%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsa-fqggfg  901
             EAAMRACVD APVIDGRRANCNLASLGVQRSKPSTP KH  GGGGRNF VM +   G  G
Sbjct  68    EAAMRACVDPAPVIDGRRANCNLASLGVQRSKPSTP-KH--GGGGRNFRVMGSFQTGFGG  124

Query  900   gaaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
             G  ++FPS + F HYAIQQGIPYN+YGYS YSPDYTYPT YY VYGG T Q+P+YG+   
Sbjct  125   GVGSSFPSAATFPHYAIQQGIPYNVYGYSPYSPDYTYPTSYYGVYGGATAQYPVYGS---  181

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYP--HHLFPYS---ATVNT  556
                   AAAAAFYPYL       G        +S    GV YP   HLF YS   +T   
Sbjct  182   -----GAAAAAFYPYLQ-YGEGSGGGGTSGGYSSGQGYGVNYPPQAHLFQYSPIASTAAA  235

Query  555   TAGYPAQHFANP-ISLAHTAPMQSGLTMAALRAPLPHR  445
             TAGY AQH+  P +SLA +  +QSG+TM  L+AP+PHR
Sbjct  236   TAGY-AQHYGTPAMSLAPSPALQSGVTMPPLQAPIPHR  272



>gb|KHG10370.1| RNA-binding 38 [Gossypium arboreum]
Length=266

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 178/276 (64%), Positives = 195/276 (71%), Gaps = 22/276 (8%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWETHKDTMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETHKDTMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP KH     GRNF VMS FQ GFGG
Sbjct  68    DAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP-KH-----GRNFRVMSTFQTGFGG  121

Query  897   aaaafpspsnfS----HYAIQQGIPYNLygyssys-pdytyptgyysvyggvtGQFPMYG  733
                   + ++ +    HYAIQQGIP N+YGYSSYS     YPT YY+VYGG T QFPMYG
Sbjct  122   GVGTATAFASAATFPPHYAIQQGIPCNVYGYSSYSPDYSNYPTSYYNVYGGATAQFPMYG  181

Query  732   TgasgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTT  553
                            FYPYL F     G   G TA +S    G+QYPHHLF +S     T
Sbjct  182   A--GPGGLITGTGTTFYPYLQF---GEGTGGGATAYSSGQGYGLQYPHHLFQFS-----T  231

Query  552   AGYPAQHFANPISLAHTAPMQSGLTMAALRAPLPHR  445
               YP QH+  P+SLA T P+QSG+TM      +PHR
Sbjct  232   GSYP-QHYGAPMSLAPTPPVQSGVTMPLHAPAIPHR  266



>ref|XP_003605646.1| RNA-binding protein [Medicago truncatula]
 gb|AES87843.1| RNA recognition motif [Medicago truncatula]
Length=272

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 190/273 (70%), Positives = 216/273 (79%), Gaps = 10/273 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVDAAP+IDGRRANCNLASLGVQRSKPSTP KH  GGGGRN  VM +FQ GFGG
Sbjct  68    DAAMRACVDAAPIIDGRRANCNLASLGVQRSKPSTP-KH--GGGGRNIRVMGSFQTGFGG  124

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg-as  721
               +AFPS + F HYAIQQGIPYN+YGYSSYSPDY+YPT YY +YGG T Q+P+YG G A 
Sbjct  125   VGSAFPSAATFPHYAIQQGIPYNVYGYSSYSPDYSYPTSYYGMYGGATAQYPVYGNGPAG  184

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
             G+++G AAAAA+YPYL +  G G          S    GV YP  +F YS  + +T GY 
Sbjct  185   GMMTGGAAAAAYYPYLQY--GEGTGGATTGGYTSGQGYGVNYPPQVFQYSP-IASTGGY-  240

Query  540   AQHFANPISLAHT-APMQSGLTMAALRAPLPHR  445
             AQH+  PISLA + A + SG+TM AL+AP+PHR
Sbjct  241   AQHYGTPISLAPSPAALPSGVTM-ALQAPIPHR  272



>ref|XP_007019701.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY16926.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=344

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 184/258 (71%), Positives = 194/258 (75%), Gaps = 12/258 (5%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET KDTMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKDTMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP KH  GG GRNF VMS+FQ GFGG
Sbjct  68    EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP-KH--GGTGRNFRVMSSFQTGFGG  124

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                    S + F HYAIQQGIPYN+YGYS YSPDYTYPT YYSVYGG T Q+P+YG    
Sbjct  125   GVGTAFPSAATFPHYAIQQGIPYNVYGYSPYSPDYTYPTSYYSVYGGATAQYPVYGA--G  182

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                    A   FYPYL F    G  T G T   S    GVQYPHH F YSA VN+T  YP
Sbjct  183   PGGLMTGAGTTFYPYLQF----GEGTGGATGYTSGQGYGVQYPHHPFQYSA-VNSTGSYP  237

Query  540   AQHFANPISLAHTAPMQS  487
              QH+  P+SLA T  +QS
Sbjct  238   -QHYGAPMSLAPTPALQS  254



>ref|XP_008459505.1| PREDICTED: RNA-binding protein 24 isoform X3 [Cucumis melo]
Length=277

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 185/278 (67%), Positives = 202/278 (73%), Gaps = 17/278 (6%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTKVFVGGLAWETHKDTMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+P+
Sbjct  9     QFGDTTYTKVFVGGLAWETHKDTMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREPD  68

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgga  895
             AAMRACVDA+PVIDGRRANCNLASLGVQRSKPSTP KHGGGGG  NF V+S+      G 
Sbjct  69    AAMRACVDASPVIDGRRANCNLASLGVQRSKPSTP-KHGGGGGRNNFRVLSSNFQSGFGG  127

Query  894   aaafpspsnfS---HYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg-  727
                    S  +   HYAIQQGIPYNLYGYSSYSPDYTYPT YY+VYGG T Q+PMYGTG 
Sbjct  128   NVGSAFHSPTTTFPHYAIQQGIPYNLYGYSSYSPDYTYPTSYYNVYGGATAQYPMYGTGP  187

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAG  547
                L   AAAAAAFYPY  F              + Q   GVQYPHHLF YSA +N+TA 
Sbjct  188   GGILSGAAAAAAAFYPYFQF------GEGSGGGGSGQQGYGVQYPHHLFQYSAAINSTAA  241

Query  546   --YPAQHFA--NPISLAHTAPMQSGLTMAALRAPLPHR  445
               +P QH+A            + SG+TM AL AP+PHR
Sbjct  242   TTFP-QHYAAPPMSLPPTPPTLPSGVTM-ALPAPIPHR  277



>ref|XP_008391857.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Malus domestica]
Length=285

 Score =   240 bits (612),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 192/280 (69%), Positives = 211/280 (75%), Gaps = 11/280 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+ 
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREA  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNF-MVMsafqggfg  901
             EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP KHGGGGGGR+F  VM  FQ GFG
Sbjct  68    EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP-KHGGGGGGRSFGRVMGPFQTGFG  126

Query  900   gaaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg--  727
             G  +AFPS + F HYAIQQGIPYNLYGYSSYSPDYTYPT YY +YGG  GQ+PMYGT   
Sbjct  127   GVGSAFPSAATFPHYAIQQGIPYNLYGYSSYSPDYTYPTNYYGLYGGAAGQYPMYGTSPA  186

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaas---qgygGVQYPH---HLFPYSAT  565
                +   AAAAAAFYPYL++G    G        +S       GVQYPH    LF YS T
Sbjct  187   TGMVAGAAAAAAAFYPYLSYGSEGNGGAAAGAYGSSGVPSYATGVQYPHQQQQLFQYS-T  245

Query  564   VNTTAGYPAQHFANPISLAHTAPMQSGLTMAALRAPLPHR  445
             +N++     QH+  PISLA +  +QS     AL AP+PHR
Sbjct  246   MNSSGVGGYQHYGPPISLAPSPALQSPGVTVALPAPIPHR  285



>ref|XP_010252363.1| PREDICTED: RNA-binding protein 24-B-like isoform X1 [Nelumbo 
nucifera]
Length=289

 Score =   240 bits (612),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 165/276 (60%), Positives = 180/276 (65%), Gaps = 18/276 (7%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVDAAPVIDGRRANCNLASLGVQRS+PSTP      G GRNF VMS+F  G  G
Sbjct  68    EAAMRACVDAAPVIDGRRANCNLASLGVQRSRPSTPQH----GAGRNFRVMSSFHSGLQG  123

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygys-syspdytyptgyysvyggvtGQFPMYGTga  724
                    S + F HYAIQQGIPYNLYGYS          + Y    GG T Q+PMYGT  
Sbjct  124   GVGTAFPSAATFPHYAIQQGIPYNLYGYSPYSPEYSYLASYYSIYGGGATSQYPMYGT--  181

Query  723   sgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGY  544
                       AAFYPYL+F    G    G  A       G QYP HLF YS   +T  G+
Sbjct  182   GAGGMVTGTTAAFYPYLHF----GQGNGGTAAYTGGQGYGFQYPQHLFQYSGVGST--GF  235

Query  543   PAQHFANPISLAHTAPMQSGLTMA----ALRAPLPH  448
                +   P+SL+ T P Q+G+TMA     L AP PH
Sbjct  236   AHHYGGGPMSLSPTPPSQAGVTMAPTAPTLHAPTPH  271



>gb|KHN11639.1| RNA-binding protein 38 [Glycine soja]
Length=281

 Score =   237 bits (605),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 186/279 (67%), Positives = 207/279 (74%), Gaps = 13/279 (5%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsa-fqggfg  901
             EAAMRACVD APVIDGRRANCNLASLGVQRSKPSTP KH  GGGGRNF VM +   G  G
Sbjct  68    EAAMRACVDPAPVIDGRRANCNLASLGVQRSKPSTP-KH--GGGGRNFRVMGSFQTGFGG  124

Query  900   gaaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
             G  ++FPS + F HYAIQQGIPYN+YGYS YSPDYTYPT YY VYGG T Q+P+YG+G +
Sbjct  125   GVGSSFPSAATFPHYAIQQGIPYNVYGYSPYSPDYTYPTSYYGVYGGATAQYPVYGSGPA  184

Query  720   gllsgaaa-aaAFYPYLNFgegnggattgytaaasqgygGVQYP--HHLFPYS---ATVN  559
                 G  +  AAFYPYL       G        +S    GV YP   HLF YS   +T  
Sbjct  185   AAAGGMMSGGAAFYPYLQ-YGEGSGGGGTSGGYSSGQGYGVNYPPQAHLFQYSPIASTAA  243

Query  558   TTAGYPAQHFANP-ISLAHTAPMQSGLTMAALRAPLPHR  445
              TAGY AQH+  P +SLA +  +QSG+TM  L+AP+PHR
Sbjct  244   ATAGY-AQHYGTPAMSLAPSPALQSGVTMPPLQAPIPHR  281



>ref|XP_008237808.1| PREDICTED: RNA-binding protein 38-like isoform X2 [Prunus mume]
Length=283

 Score =   237 bits (604),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 186/277 (67%), Positives = 203/277 (73%), Gaps = 12/277 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+ 
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFRES  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP KHGGGG GRNF VM +FQ GFGG
Sbjct  68    EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP-KHGGGGAGRNFRVMGSFQTGFGG  126

Query  897   aaaaf--pspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg-  727
                +    + + F HYAIQQGIPYNLYGYS YSPDYTYPT YY +YGG TGQ+PMYGT  
Sbjct  127   GVGSAFPSAAATFPHYAIQQGIPYNLYGYSPYSPDYTYPTNYYGLYGGATGQYPMYGTSP  186

Query  726   -asgllsgaaaaaAFYPYLNFgegnggattgytaaasqg---ygGVQYP----HHLFPYS  571
                 +   AAAAAAFYPYL +G    G      +  S       GVQYP    HHLF YS
Sbjct  187   AGGMVTGAAAAAAAFYPYLQYGSEGNGGAAAAYSTTSGVQNYATGVQYPHHHHHHLFQYS  246

Query  570   ATVNTTAGYPAQHFANPISLAHTAPMQSGLTMAALRA  460
             A  +T  G   QH+  PISLA +  +QS +  A  +A
Sbjct  247   ALNSTGVGGGYQHYGPPISLAPSPALQSPVCFAVPQA  283



>ref|XP_008237809.1| PREDICTED: RNA-binding protein 38-like isoform X3 [Prunus mume]
Length=278

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 184/268 (69%), Positives = 199/268 (74%), Gaps = 12/268 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+ 
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFRES  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP KHGGGG GRNF VM +FQ GFGG
Sbjct  68    EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP-KHGGGGAGRNFRVMGSFQTGFGG  126

Query  897   aaaaf--pspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg-  727
                +    + + F HYAIQQGIPYNLYGYS YSPDYTYPT YY +YGG TGQ+PMYGT  
Sbjct  127   GVGSAFPSAAATFPHYAIQQGIPYNLYGYSPYSPDYTYPTNYYGLYGGATGQYPMYGTSP  186

Query  726   -asgllsgaaaaaAFYPYLNFgegnggattgytaaasqg---ygGVQYP----HHLFPYS  571
                 +   AAAAAAFYPYL +G    G      +  S       GVQYP    HHLF YS
Sbjct  187   AGGMVTGAAAAAAAFYPYLQYGSEGNGGAAAAYSTTSGVQNYATGVQYPHHHHHHLFQYS  246

Query  570   ATVNTTAGYPAQHFANPISLAHTAPMQS  487
             A  +T  G   QH+  PISLA +  +QS
Sbjct  247   ALNSTGVGGGYQHYGPPISLAPSPALQS  274



>ref|XP_007131316.1| hypothetical protein PHAVU_011G003400g [Phaseolus vulgaris]
 gb|ESW03310.1| hypothetical protein PHAVU_011G003400g [Phaseolus vulgaris]
Length=268

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 177/258 (69%), Positives = 193/258 (75%), Gaps = 6/258 (2%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP KH GGGGGRN  VM +FQ GFGG
Sbjct  68    EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP-KH-GGGGGRNLRVMGSFQTGFGG  125

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                +   S + F HYAIQQGIPYN+YGYS YSPDYTYPT YY VYGG T Q+P+YG+   
Sbjct  126   GVGSAFPSAATFPHYAIQQGIPYNVYGYSPYSPDYTYPTSYYGVYGGATAQYPVYGS---  182

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
             G       AAAFYPYL +G    G        +S    GV Y  HLF YS   +T AG  
Sbjct  183   GPGGMMTGAAAFYPYLQYGGEGSGGGGTSGGYSSGQGYGVNYAPHLFQYSPIASTAAGAY  242

Query  540   AQHFANPISLAHTAPMQS  487
             AQH+  P+SLA +  +QS
Sbjct  243   AQHYGTPMSLAPSPALQS  260



>ref|XP_008373311.1| PREDICTED: RNA-binding protein 24-A-like isoform X1 [Malus domestica]
Length=288

 Score =   235 bits (599),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 189/282 (67%), Positives = 215/282 (76%), Gaps = 12/282 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+ 
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREA  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNF--MVMsafqggf  904
             EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP   GGGGGGR+F  ++ S   G  
Sbjct  68    EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPKHGGGGGGGRSFGRVMGSFRTGFG  127

Query  903   ggaaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg-  727
             GG  +AFPS ++F HYAIQQGIPYNLYGYSSYSPDYTYPT YY +YGG  GQ+PMYGT  
Sbjct  128   GGVGSAFPSAASFPHYAIQQGIPYNLYGYSSYSPDYTYPTNYYGLYGGAAGQYPMYGTSP  187

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaas---qgygGVQYPHH-----LFPYS  571
             A+G+++GAAAAAAFYPYL++G    G        +S       GVQYPH+     LF YS
Sbjct  188   ATGMVAGAAAAAAFYPYLSYGSEGNGGAAAAAYGSSGVPSYATGVQYPHNNQQQQLFHYS  247

Query  570   ATVNTTAGYPAQHFANPISLAHTAPMQSGLTMAALRAPLPHR  445
              T+N++     QH+  PISLA +  +QS     AL AP+PHR
Sbjct  248   -TMNSSGVGGYQHYGPPISLAPSPALQSPGVTVALPAPIPHR  288



>ref|XP_004250743.1| PREDICTED: RNA-binding protein 24-like isoform X2 [Solanum lycopersicum]
Length=261

 Score =   234 bits (596),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 167/258 (65%), Positives = 184/258 (71%), Gaps = 12/258 (5%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+ E
Sbjct  6     QFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREAE  65

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgga  895
             AAMRACVDAAPVIDGRRANCNLAS+GVQRSKP+TP KH   GGGRN  VM +   G    
Sbjct  66    AAMRACVDAAPVIDGRRANCNLASMGVQRSKPTTP-KH---GGGRNLRVM-SGFHGGFQT  120

Query  894   aaafpspsnfSHYAIQQGIPYNLygys-syspdytyptgyysvyggvtGQFPMYGTgasg  718
             A AFPS + F HYAIQQGIPYNLYGYS          TGYYSVYGG   Q+ +YG+ A+ 
Sbjct  121   ATAFPSATTFPHYAIQQGIPYNLYGYSPYSPDYTYPTTGYYSVYGGGNSQYGVYGSAATA  180

Query  717   llsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTA-GYP  541
                 ++AAAAFYPY+NF     G   G          GVQYPHHLFPYSA       GYP
Sbjct  181   SGVLSSAAAAFYPYMNF-----GEGNGNGCYTPSQGYGVQYPHHLFPYSAAAAAAGPGYP  235

Query  540   AQHFANPISLAHTAPMQS  487
              QH+  PISLA +  + S
Sbjct  236   TQHYGTPISLAPSPALHS  253



>emb|CDP11532.1| unnamed protein product [Coffea canephora]
Length=288

 Score =   235 bits (599),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 173/277 (62%), Positives = 192/277 (69%), Gaps = 24/277 (9%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKTTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP +    GGGRNF VMSAFQ   GG
Sbjct  68    DAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPKQ----GGGRNFRVMSAFQAAAGG  123

Query  897   aaaafps--psnfSHYAIQQGIPYNLygys-syspdytyptgyysvyggvtGQFPMYGTg  727
                   +   + F HYAIQQGIPYNLYGYS   +      + Y    G  T Q+P+YGTG
Sbjct  124   GGYQGTAFPSATFPHYAIQQGIPYNLYGYSPYSADYTYPTSYYSIYGGTTTAQYPVYGTG  183

Query  726   asgllsgaaaaa-----------AFYPYLNFgegnggattgytaaasqgygGVQYP-HHL  583
             A+G +S                 AFYPYLNF +G+GG  T     +S GY GVQYP HHL
Sbjct  184   AAGGMSMITGGGAAAAAAAAAAAAFYPYLNFADGSGGGATAAAYTSSHGYAGVQYPNHHL  243

Query  582   FPYSATVNTTAGYPAQHF----ANPISLA-HTAPMQS  487
             F YSA +N+ AG   QH+      PISLA  T P+QS
Sbjct  244   FQYSAALNSAAGAYTQHYGAAAGTPISLAPPTPPLQS  280



>ref|XP_009366887.1| PREDICTED: RNA-binding protein 24-A isoform X1 [Pyrus x bretschneideri]
Length=288

 Score =   234 bits (598),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 188/282 (67%), Positives = 213/282 (76%), Gaps = 12/282 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+ 
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREA  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNF--MVMsafqggf  904
             EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP   GGGGGGR+F  ++ S   G  
Sbjct  68    EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPKHGGGGGGGRSFGRVMGSFRTGFG  127

Query  903   ggaaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg-  727
             GG  +AFPS + F HYAIQQGIPYNLYGYSSYSPDYTYPT YY +YGG  GQ+PMYGT  
Sbjct  128   GGVGSAFPSAATFPHYAIQQGIPYNLYGYSSYSPDYTYPTNYYGLYGGAAGQYPMYGTSP  187

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaas---qgygGVQYPH-----HLFPYS  571
             A+G+++GAAAAAAFYPYL++G    G        +S       G+QYPH      LF YS
Sbjct  188   ATGMVAGAAAAAAFYPYLSYGSEGNGGAAAAAYGSSGVPSYATGIQYPHQQQQQQLFQYS  247

Query  570   ATVNTTAGYPAQHFANPISLAHTAPMQSGLTMAALRAPLPHR  445
              T+N++     QH+  PISLA +  +QS     AL AP+PHR
Sbjct  248   -TMNSSGVGGYQHYGPPISLAPSPALQSPGVTVALPAPIPHR  288



>ref|XP_006441812.1| hypothetical protein CICLE_v10021520mg [Citrus clementina]
 ref|XP_006478310.1| PREDICTED: RNA-binding protein 24-like isoform X5 [Citrus sinensis]
 gb|ESR55052.1| hypothetical protein CICLE_v10021520mg [Citrus clementina]
Length=278

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 173/260 (67%), Positives = 192/260 (74%), Gaps = 11/260 (4%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDKAT RSKGYGFVTFR+PEA
Sbjct  17    FGDTTYTKVFVGGLAWETQKETMEKYFEQFGEILEAVVITDKATGRSKGYGFVTFREPEA  76

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaa  892
             AM+ACVDAAPVIDGRRANCNLA LGVQRSKPSTP KHGGGG     ++ +   GGFGG  
Sbjct  77    AMKACVDAAPVIDGRRANCNLACLGVQRSKPSTP-KHGGGGRNNLRLMSTFQNGGFGGTT  135

Query  891   aafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg-----  727
                 + + F HYAIQQGIP+NLYGYS YS DYTYPT YY+VYGG   Q+PMYG G     
Sbjct  136   FPSTAAATFPHYAIQQGIPFNLYGYSPYSADYTYPTSYYNVYGGAAAQYPMYGNGHAAGG  195

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAG  547
                  + AAAAAA+YPYL F     G     T   S    GVQYPHHLFPYS T+N  AG
Sbjct  196   MMTGGAAAAAAAAYYPYLQF---GEGTGAATTGYTSGQGYGVQYPHHLFPYS-TINAAAG  251

Query  546   YPAQHFANPISLAHTAPMQS  487
             YP QH+  P+S+A T  +QS
Sbjct  252   YP-QHYGPPMSIAPTPALQS  270



>ref|XP_006591951.1| PREDICTED: RNA-binding protein 24-like isoform X2 [Glycine max]
Length=272

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 183/276 (66%), Positives = 202/276 (73%), Gaps = 16/276 (6%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVD APVIDGRRANCNLASLGVQRSKPSTP KH  GG GRNF VM +FQ GFGG
Sbjct  68    EAAMRACVDPAPVIDGRRANCNLASLGVQRSKPSTP-KH--GGAGRNFRVMGSFQTGFGG  124

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMY-GTga  724
                +   S + F HYAIQQGIPYN+YGYS YSPDYTYPT YY VYGG T Q+P+Y    A
Sbjct  125   GVGSAFPSAATFPHYAIQQGIPYNVYGYSPYSPDYTYPTSYYGVYGGATAQYPVYGSGPA  184

Query  723   sgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYP--HHLFPYSATVNTTA  550
             +      +  AAFYPYL       G         S    GV YP   HLF YS  + +TA
Sbjct  185   AAAGGMMSGGAAFYPYLQ-----YGGEGSGGGGTSGQGYGVNYPPQAHLFQYSP-IASTA  238

Query  549   GYPAQHFANP-ISLAHTAPMQSGLTMAALRAPLPHR  445
             GY AQH+  P +SLA +  +QSG+TM  L+AP+PHR
Sbjct  239   GY-AQHYGTPTMSLAPSPALQSGVTM-PLQAPIPHR  272



>ref|XP_004141612.1| PREDICTED: uncharacterized protein LOC101221767 [Cucumis sativus]
Length=274

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 172/278 (62%), Positives = 189/278 (68%), Gaps = 20/278 (7%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTKVFVGGLAWETHKDTMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+P+
Sbjct  9     QFGDTTYTKVFVGGLAWETHKDTMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREPD  68

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgga  895
             AAMRACVDA+PVIDGRRANCNLASLGVQRSKPSTP KH GGGG  NF V+S+      G 
Sbjct  69    AAMRACVDASPVIDGRRANCNLASLGVQRSKPSTP-KH-GGGGRNNFRVLSSNFQSGFGG  126

Query  894   aaafpspsnfS---HYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg-  727
                    S  +   HYAIQQGIPYNL  Y          T YY+VYGG T Q+PMYGTG 
Sbjct  127   NVGSAFHSPTTTFPHYAIQQGIPYNL--YGYVKDVGFKKTSYYNVYGGATAQYPMYGTGP  184

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAG  547
                L   AAAAAAFYPY  F              + Q   GVQYPHHLF YSA +N+TA 
Sbjct  185   GGILSGAAAAAAAFYPYFQF------GEGSGGGGSGQQGYGVQYPHHLFQYSAAINSTAA  238

Query  546   --YPAQHFA--NPISLAHTAPMQSGLTMAALRAPLPHR  445
               +P QH+A            + SG+TM AL AP+PHR
Sbjct  239   TTFP-QHYAAPPMSLPPTPPTLPSGVTM-ALPAPIPHR  274



>ref|XP_008459503.1| PREDICTED: RNA-binding protein 24 isoform X1 [Cucumis melo]
Length=285

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 181/286 (63%), Positives = 198/286 (69%), Gaps = 25/286 (9%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTKVFVGGLAWETHKDTMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+P+
Sbjct  9     QFGDTTYTKVFVGGLAWETHKDTMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREPD  68

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggg--------gGRNFMVMsa  919
             AAMRACVDA+PVIDGRRANCNLASLGVQRSKPSTP KH            G  NF V+S+
Sbjct  69    AAMRACVDASPVIDGRRANCNLASLGVQRSKPSTP-KHEKKKWELTGGGGGRNNFRVLSS  127

Query  918   fqggfggaaaafpspsnfS---HYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQ  748
                   G        S  +   HYAIQQGIPYNLYGYSSYSPDYTYPT YY+VYGG T Q
Sbjct  128   NFQSGFGGNVGSAFHSPTTTFPHYAIQQGIPYNLYGYSSYSPDYTYPTSYYNVYGGATAQ  187

Query  747   FPMYGTg-asgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYS  571
             +PMYGTG    L   AAAAAAFYPY  F              + Q   GVQYPHHLF YS
Sbjct  188   YPMYGTGPGGILSGAAAAAAAFYPYFQF------GEGSGGGGSGQQGYGVQYPHHLFQYS  241

Query  570   ATVNTTAG--YPAQHFA--NPISLAHTAPMQSGLTMAALRAPLPHR  445
             A +N+TA   +P QH+A            + SG+TM AL AP+PHR
Sbjct  242   AAINSTAATTFP-QHYAAPPMSLPPTPPTLPSGVTM-ALPAPIPHR  285



>ref|XP_004173374.1| PREDICTED: RNA-binding protein 38-like [Cucumis sativus]
 ref|XP_008459506.1| PREDICTED: RNA-binding protein 24 isoform X4 [Cucumis melo]
Length=272

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 174/249 (70%), Positives = 188/249 (76%), Gaps = 14/249 (6%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTKVFVGGLAWETHKDTMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+P+
Sbjct  9     QFGDTTYTKVFVGGLAWETHKDTMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREPD  68

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgga  895
             AAMRACVDA+PVIDGRRANCNLASLGVQRSKPSTP KHGGGGG  NF V+S+      G 
Sbjct  69    AAMRACVDASPVIDGRRANCNLASLGVQRSKPSTP-KHGGGGGRNNFRVLSSNFQSGFGG  127

Query  894   aaafpspsnfS---HYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg-  727
                    S  +   HYAIQQGIPYNLYGYSSYSPDYTYPT YY+VYGG T Q+PMYGTG 
Sbjct  128   NVGSAFHSPTTTFPHYAIQQGIPYNLYGYSSYSPDYTYPTSYYNVYGGATAQYPMYGTGP  187

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAG  547
                L   AAAAAAFYPY  F              + Q   GVQYPHHLF YSA +N+TA 
Sbjct  188   GGILSGAAAAAAAFYPYFQF------GEGSGGGGSGQQGYGVQYPHHLFQYSAAINSTAA  241

Query  546   --YPAQHFA  526
               +P QH+A
Sbjct  242   TTFP-QHYA  249



>ref|XP_007200548.1| hypothetical protein PRUPE_ppa009564mg [Prunus persica]
 gb|EMJ01747.1| hypothetical protein PRUPE_ppa009564mg [Prunus persica]
Length=286

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 187/280 (67%), Positives = 202/280 (72%), Gaps = 15/280 (5%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+ 
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFRES  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP KHGGGG GRNF VM +FQ GFGG
Sbjct  68    EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP-KHGGGGAGRNFRVMGSFQTGFGG  126

Query  897   aaaafpspsnfS---HYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg  727
                    PS  +   HYAIQQGIPYNLYGYS YSPDYTYPT YY +YGG TGQ+PMYGT 
Sbjct  127   GGVGSAFPSAAATFPHYAIQQGIPYNLYGYSPYSPDYTYPTNYYGLYGGTTGQYPMYGTS  186

Query  726   --asgllsgaaaaaAFYPYLNFgegnggatt-----gytaaasqgygGVQYP----HHLF  580
                  +   AAAAAAFYPYL +G    G          T+       GVQYP    HHLF
Sbjct  187   PAGGMVTGAAAAAAAFYPYLQYGSEGNGGAAAAAAYSTTSGVQNYATGVQYPHHHHHHLF  246

Query  579   PYSATVNTTAGYPAQHFANPISLAHTAPMQSGLTMAALRA  460
              YSA  +T  G   QH+  PISLA +  +QS +  A  +A
Sbjct  247   QYSALNSTGVGGGYQHYGPPISLAPSPALQSPVCFAVPQA  286



>ref|XP_009370661.1| PREDICTED: RNA-binding protein 24-A-like isoform X1 [Pyrus x 
bretschneideri]
Length=286

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 186/280 (66%), Positives = 208/280 (74%), Gaps = 10/280 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+ 
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREA  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP   GGGGG     V     G  GG
Sbjct  68    EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPKHGGGGGGRSFGRVGPFQTGFGGG  127

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg-as  721
               +AFPS + F+HYAIQQGIPYNLYGYSSYSPDYTYPT YY +YGG  GQ+PMYGT  A+
Sbjct  128   VGSAFPSAATFAHYAIQQGIPYNLYGYSSYSPDYTYPTNYYGLYGGAAGQYPMYGTSPAT  187

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaas---qgygGVQYPH-----HLFPYSAT  565
             G+++GAAAAAAFYPYL++G    G        +S       GVQYPH      LF YS T
Sbjct  188   GMVAGAAAAAAFYPYLSYGSEGNGGAAAGAYGSSGVPSYATGVQYPHQQQQQQLFQYS-T  246

Query  564   VNTTAGYPAQHFANPISLAHTAPMQSGLTMAALRAPLPHR  445
             +N++     QH+  PISLA +  +QS     AL AP+PHR
Sbjct  247   MNSSGVGGYQHYGPPISLAPSPALQSPGVTVALPAPIPHR  286



>ref|XP_006478309.1| PREDICTED: RNA-binding protein 24-like isoform X4 [Citrus sinensis]
Length=279

 Score =   232 bits (592),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 171/260 (66%), Positives = 190/260 (73%), Gaps = 10/260 (4%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDKAT RSKGYGFVTFR+PEA
Sbjct  17    FGDTTYTKVFVGGLAWETQKETMEKYFEQFGEILEAVVITDKATGRSKGYGFVTFREPEA  76

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaa  892
             AM+ACVDAAPVIDGRRANCNLA LGVQRSKPSTP   GGGG     ++ +   GGFGG  
Sbjct  77    AMKACVDAAPVIDGRRANCNLACLGVQRSKPSTPKHGGGGGRNNLRLMSTFQNGGFGGTT  136

Query  891   aafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg-----  727
                 + + F HYAIQQGIP+NLYGYS YS DYTYPT YY+VYGG   Q+PMYG G     
Sbjct  137   FPSTAAATFPHYAIQQGIPFNLYGYSPYSADYTYPTSYYNVYGGAAAQYPMYGNGHAAGG  196

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAG  547
                  + AAAAAA+YPYL F     G     T   S    GVQYPHHLFPYS T+N  AG
Sbjct  197   MMTGGAAAAAAAAYYPYLQF---GEGTGAATTGYTSGQGYGVQYPHHLFPYS-TINAAAG  252

Query  546   YPAQHFANPISLAHTAPMQS  487
             YP QH+  P+S+A T  +QS
Sbjct  253   YP-QHYGPPMSIAPTPALQS  271



>ref|XP_004506367.1| PREDICTED: RNA-binding protein Musashi homolog Rbp6-like isoform 
X2 [Cicer arietinum]
Length=267

 Score =   232 bits (591),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 177/259 (68%), Positives = 198/259 (76%), Gaps = 9/259 (3%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVDAAP+IDGRRANCNLASLGVQRSKPSTP KH  GG GRNF VM +FQ GFGG
Sbjct  68    DAAMRACVDAAPIIDGRRANCNLASLGVQRSKPSTP-KH--GGTGRNFRVMGSFQTGFGG  124

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg--a  724
               +AFPS + F HYAIQQGIPYN+YGYSSYSPDY+YPT YY +YGG   Q+P+YG+G   
Sbjct  125   VGSAFPSAATFPHYAIQQGIPYNVYGYSSYSPDYSYPTSYYGLYGGAAAQYPVYGSGPAG  184

Query  723   sgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGY  544
               +   AAAAAAFYPYL +  G G          S    GV Y   +F YS  + +T GY
Sbjct  185   GMMSGAAAAAAAFYPYLQY--GEGSGGATTGGYTSGQGYGVNYQPQVFQYSP-IASTGGY  241

Query  543   PAQHFANPISLAHTAPMQS  487
              AQH+  PISLA +  +QS
Sbjct  242   -AQHYGTPISLAPSPALQS  259



>gb|KCW70980.1| hypothetical protein EUGRSUZ_F04089 [Eucalyptus grandis]
Length=270

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 169/261 (65%), Positives = 190/261 (73%), Gaps = 10/261 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET KDTMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKDTMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVDA+PVIDGRRANCNLA LG+QRSKPSTP   GGGG     M      G  GG
Sbjct  68    EAAMRACVDASPVIDGRRANCNLACLGLQRSKPSTPKTAGGGGRNMRGMSGFQTGGFHGG  127

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdy----typtgyysvyggvtGQFPMYGT  730
                AF S + F HYA+QQG P++L  Y S    Y    TYP  YYSVYGG   Q+PMYGT
Sbjct  128   VGTAFASAATFPHYALQQGFPFSLSLYLSLYSSYSPDYTYPANYYSVYGGAAAQYPMYGT  187

Query  729   gasgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTA  550
             G SGL++GAA A  FYPYL+         + Y++  + G   VQYPHHLF YSA +N+T+
Sbjct  188   GPSGLMNGAATA--FYPYLHLAGEGSSGGSSYSSGQNYG---VQYPHHLFHYSA-INSTS  241

Query  549   GYPAQHFANPISLAHTAPMQS  487
             GYPAQH+A P+SLA T  + S
Sbjct  242   GYPAQHYAAPMSLAPTPALHS  262



>gb|EYU22694.1| hypothetical protein MIMGU_mgv1a011474mg [Erythranthe guttata]
Length=280

 Score =   229 bits (585),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 171/277 (62%), Positives = 196/277 (71%), Gaps = 16/277 (6%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTKVFVGGLAWET KDTMKNYFEQFG+ILEAVVITDK T RSKGYGFVTFR+ +
Sbjct  13    QFGDTTYTKVFVGGLAWETQKDTMKNYFEQFGDILEAVVITDKTTGRSKGYGFVTFREAD  72

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRS-KPSTPNKHgggggGRNFMVMsafqggfgg  898
              AMRACVDA PVIDGRRANCNLASLGVQRS KPSTP KHGGGG     +     Q G   
Sbjct  73    GAMRACVDATPVIDGRRANCNLASLGVQRSTKPSTP-KHGGGGRHIRVIGGFHHQQGGFA  131

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasg  718
               AAF S + F HY++QQGIPYNLYGYS YS +Y YPT YY +YGG + Q+P+YG+    
Sbjct  132   TTAAFASATTFPHYSVQQGIPYNLYGYSPYSTEYAYPTSYYGMYGGGSAQYPVYGS----  187

Query  717   llsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHH--LFPYSATVNTTAGY  544
               S    +  +YPYLN      G+      +ASQG  GVQYPHH  LF YS  +N+T  Y
Sbjct  188   AGSNGLVSGGYYPYLNL--NEAGSGGATPYSASQGGYGVQYPHHHGLFQYSP-INSTGIY  244

Query  543   PAQHFANPISLAHTAPMQS-GLTM---AALRAPLPHR  445
             P  H+ NP+SLA   P+QS G+TM   A +  P+PHR
Sbjct  245   PT-HYGNPVSLAPPTPLQSAGMTMTLHAPIPIPIPHR  280



>ref|XP_008391858.1| PREDICTED: RNA-binding protein 24-like isoform X2 [Malus domestica]
Length=280

 Score =   229 bits (584),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 187/275 (68%), Positives = 207/275 (75%), Gaps = 11/275 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+ 
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREA  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNF-MVMsafqggfg  901
             EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP KHGGGGGGR+F  VM  FQ GFG
Sbjct  68    EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP-KHGGGGGGRSFGRVMGPFQTGFG  126

Query  900   gaaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg--  727
             G  +AFPS + F HYAIQQGIPYNLYGYSSYSPDYTYPT YY +YGG  GQ+PMYGT   
Sbjct  127   GVGSAFPSAATFPHYAIQQGIPYNLYGYSSYSPDYTYPTNYYGLYGGAAGQYPMYGTSPA  186

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaas---qgygGVQYPH---HLFPYSAT  565
                +   AAAAAAFYPYL++G    G        +S       GVQYPH    LF YS T
Sbjct  187   TGMVAGAAAAAAAFYPYLSYGSEGNGGAAAGAYGSSGVPSYATGVQYPHQQQQLFQYS-T  245

Query  564   VNTTAGYPAQHFANPISLAHTAPMQSGLTMAALRA  460
             +N++     QH+  PISLA +  +QS +  A  +A
Sbjct  246   MNSSGVGGYQHYGPPISLAPSPALQSPVCFAVPQA  280



>ref|XP_010252364.1| PREDICTED: RNA-binding protein 24-B-like isoform X2 [Nelumbo 
nucifera]
Length=262

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 156/259 (60%), Positives = 170/259 (66%), Gaps = 14/259 (5%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVDAAPVIDGRRANCNLASLGVQRS+PSTP      G GRNF VMS+F  G  G
Sbjct  68    EAAMRACVDAAPVIDGRRANCNLASLGVQRSRPSTPQH----GAGRNFRVMSSFHSGLQG  123

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygys-syspdytyptgyysvyggvtGQFPMYGTga  724
                    S + F HYAIQQGIPYNLYGYS          + Y    GG T Q+PMYGT  
Sbjct  124   GVGTAFPSAATFPHYAIQQGIPYNLYGYSPYSPEYSYLASYYSIYGGGATSQYPMYGT--  181

Query  723   sgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGY  544
                       AAFYPYL+F    G    G  A       G QYP HLF YS   +T  G+
Sbjct  182   GAGGMVTGTTAAFYPYLHF----GQGNGGTAAYTGGQGYGFQYPQHLFQYSGVGST--GF  235

Query  543   PAQHFANPISLAHTAPMQS  487
                +   P+SL+ T P Q+
Sbjct  236   AHHYGGGPMSLSPTPPSQA  254



>ref|XP_008459504.1| PREDICTED: RNA-binding protein 24 isoform X2 [Cucumis melo]
 gb|KGN52604.1| hypothetical protein Csa_5G647270 [Cucumis sativus]
Length=280

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 174/257 (68%), Positives = 189/257 (74%), Gaps = 22/257 (9%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTKVFVGGLAWETHKDTMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+P+
Sbjct  9     QFGDTTYTKVFVGGLAWETHKDTMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREPD  68

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggg--------gGRNFMVMsa  919
             AAMRACVDA+PVIDGRRANCNLASLGVQRSKPSTP KH            G  NF V+S+
Sbjct  69    AAMRACVDASPVIDGRRANCNLASLGVQRSKPSTP-KHEKKKWELTGGGGGRNNFRVLSS  127

Query  918   fqggfggaaaafpspsnfS---HYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQ  748
                   G        S  +   HYAIQQGIPYNLYGYSSYSPDYTYPT YY+VYGG T Q
Sbjct  128   NFQSGFGGNVGSAFHSPTTTFPHYAIQQGIPYNLYGYSSYSPDYTYPTSYYNVYGGATAQ  187

Query  747   FPMYGTg-asgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYS  571
             +PMYGTG    L   AAAAAAFYPY  FGEG+GG  +G           VQYPHHLF YS
Sbjct  188   YPMYGTGPGGILSGAAAAAAAFYPYFQFGEGSGGGGSGQQGYG------VQYPHHLFQYS  241

Query  570   ATVNTTAG--YPAQHFA  526
             A +N+TA   +P QH+A
Sbjct  242   AAINSTAATTFP-QHYA  257



>ref|XP_003605647.1| RNA-binding protein [Medicago truncatula]
 gb|AES87844.1| RNA recognition motif [Medicago truncatula]
Length=267

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 178/251 (71%), Positives = 199/251 (79%), Gaps = 8/251 (3%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVDAAP+IDGRRANCNLASLGVQRSKPSTP KH  GGGGRN  VM +FQ GFGG
Sbjct  68    DAAMRACVDAAPIIDGRRANCNLASLGVQRSKPSTP-KH--GGGGRNIRVMGSFQTGFGG  124

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg-as  721
               +AFPS + F HYAIQQGIPYN+YGYSSYSPDY+YPT YY +YGG T Q+P+YG G A 
Sbjct  125   VGSAFPSAATFPHYAIQQGIPYNVYGYSSYSPDYSYPTSYYGMYGGATAQYPVYGNGPAG  184

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
             G+++G AAAAA+YPYL +  G G          S    GV YP  +F YS  + +T GY 
Sbjct  185   GMMTGGAAAAAYYPYLQY--GEGTGGATTGGYTSGQGYGVNYPPQVFQYSP-IASTGGY-  240

Query  540   AQHFANPISLA  508
             AQH+  PISLA
Sbjct  241   AQHYGTPISLA  251



>ref|XP_010930548.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Elaeis guineensis]
Length=287

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 163/262 (62%), Positives = 184/262 (70%), Gaps = 16/262 (6%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET ++TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQRETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVD +PVIDGRRANCNLASLG+QRS+P+TP      GG RNF VM +FQ G  G
Sbjct  68    EAAMRACVDPSPVIDGRRANCNLASLGIQRSRPTTP----LHGGSRNFRVMKSFQAGLQG  123

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                    SP+ F HYAIQQGIPYN+YGYSSYSP+YTYPT YY+VYGG   Q+P YG    
Sbjct  124   GLGTAFPSPATFPHYAIQQGIPYNVYGYSSYSPEYTYPTSYYNVYGGGAAQYPFYG---G  180

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                       AFYPY        G   G          GVQYP  +F YSA   TTAG+ 
Sbjct  181   ATTGLVTGTTAFYPYFQL-----GQGGGAAPYPHGQGYGVQYP-QMFQYSAM--TTAGFL  232

Query  540   AQHFANPISLAHTAPMQSGLTM  475
             AQH+  P+SLA + P Q+G+TM
Sbjct  233   AQHYGGPLSLAPSPPAQAGMTM  254



>ref|XP_010112069.1| RNA-binding protein 38 [Morus notabilis]
 gb|EXC32488.1| RNA-binding protein 38 [Morus notabilis]
Length=300

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 193/301 (64%), Gaps = 38/301 (13%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMKNYFEQFG+ILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKNYFEQFGDILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVD APVIDGRRANCNLASLG QRSKPSTP    GGGGGRN   M A       
Sbjct  68    EAAMRACVDPAPVIDGRRANCNLASLGAQRSKPSTPKHAPGGGGGRNIRAMGAAGSYTHN  127

Query  897   aaaafpspsnfS------------------HY-------AIQQGIPYNLygys--syspd  799
                   + + F                   HY       AI QG+PYNLYGYS  S    
Sbjct  128   HTQTGSNGAGFGVGVGVGTTAAFASAPTFPHYAAAAAAAAIHQGLPYNLYGYSPYSPDYT  187

Query  798   ytyptgyysvyggvtGQFPMYGTgasgllsgaaaaaAFYPYLNFgegnggattgyt-aaa  622
             Y  PT YY +YGG T Q+PMYG+  +   +G      FYP L FGE    A       ++
Sbjct  188   YPTPTSYYGLYGGGTTQYPMYGS--TAGPAGGKMRGGFYPSLQFGEAGTTAAAATGYTSS  245

Query  621   sqgygGVQYPH-HLFPYSATVNTTAGYPAQHFANPISLAHTAPMQS-GLTMAALRAPLPH  448
              QGYGGVQYPH HLF YS+       YPAQH+A P+SLA +  +QS G+TMA   AP+PH
Sbjct  246   GQGYGGVQYPHGHLFQYSSA------YPAQHYATPMSLAPSPALQSAGVTMAVHHAPIPH  299

Query  447   R  445
             R
Sbjct  300   R  300



>ref|XP_008373312.1| PREDICTED: RNA-binding protein 24-A-like isoform X2 [Malus domestica]
Length=283

 Score =   224 bits (572),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 184/277 (66%), Positives = 211/277 (76%), Gaps = 12/277 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+ 
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREA  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNF--MVMsafqggf  904
             EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP   GGGGGGR+F  ++ S   G  
Sbjct  68    EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPKHGGGGGGGRSFGRVMGSFRTGFG  127

Query  903   ggaaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg-  727
             GG  +AFPS ++F HYAIQQGIPYNLYGYSSYSPDYTYPT YY +YGG  GQ+PMYGT  
Sbjct  128   GGVGSAFPSAASFPHYAIQQGIPYNLYGYSSYSPDYTYPTNYYGLYGGAAGQYPMYGTSP  187

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaas---qgygGVQYPHH-----LFPYS  571
             A+G+++GAAAAAAFYPYL++G    G        +S       GVQYPH+     LF YS
Sbjct  188   ATGMVAGAAAAAAFYPYLSYGSEGNGGAAAAAYGSSGVPSYATGVQYPHNNQQQQLFHYS  247

Query  570   ATVNTTAGYPAQHFANPISLAHTAPMQSGLTMAALRA  460
              T+N++     QH+  PISLA +  +QS +  A  +A
Sbjct  248   -TMNSSGVGGYQHYGPPISLAPSPALQSPVCFAVPQA  283



>ref|XP_009366888.1| PREDICTED: RNA-binding protein 24-A isoform X2 [Pyrus x bretschneideri]
Length=283

 Score =   224 bits (571),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 183/277 (66%), Positives = 209/277 (75%), Gaps = 12/277 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+ 
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREA  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNF--MVMsafqggf  904
             EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP   GGGGGGR+F  ++ S   G  
Sbjct  68    EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPKHGGGGGGGRSFGRVMGSFRTGFG  127

Query  903   ggaaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg-  727
             GG  +AFPS + F HYAIQQGIPYNLYGYSSYSPDYTYPT YY +YGG  GQ+PMYGT  
Sbjct  128   GGVGSAFPSAATFPHYAIQQGIPYNLYGYSSYSPDYTYPTNYYGLYGGAAGQYPMYGTSP  187

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaas---qgygGVQYPH-----HLFPYS  571
             A+G+++GAAAAAAFYPYL++G    G        +S       G+QYPH      LF YS
Sbjct  188   ATGMVAGAAAAAAFYPYLSYGSEGNGGAAAAAYGSSGVPSYATGIQYPHQQQQQQLFQYS  247

Query  570   ATVNTTAGYPAQHFANPISLAHTAPMQSGLTMAALRA  460
              T+N++     QH+  PISLA +  +QS +  A  +A
Sbjct  248   -TMNSSGVGGYQHYGPPISLAPSPALQSPVCFAVPQA  283



>ref|XP_009370662.1| PREDICTED: RNA-binding protein 24-A-like isoform X2 [Pyrus x 
bretschneideri]
Length=281

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 181/275 (66%), Positives = 204/275 (74%), Gaps = 10/275 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+ 
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREA  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP   GGGGG     V     G  GG
Sbjct  68    EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPKHGGGGGGRSFGRVGPFQTGFGGG  127

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg-as  721
               +AFPS + F+HYAIQQGIPYNLYGYSSYSPDYTYPT YY +YGG  GQ+PMYGT  A+
Sbjct  128   VGSAFPSAATFAHYAIQQGIPYNLYGYSSYSPDYTYPTNYYGLYGGAAGQYPMYGTSPAT  187

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaas---qgygGVQYPH-----HLFPYSAT  565
             G+++GAAAAAAFYPYL++G    G        +S       GVQYPH      LF YS T
Sbjct  188   GMVAGAAAAAAFYPYLSYGSEGNGGAAAGAYGSSGVPSYATGVQYPHQQQQQQLFQYS-T  246

Query  564   VNTTAGYPAQHFANPISLAHTAPMQSGLTMAALRA  460
             +N++     QH+  PISLA +  +QS +  A  +A
Sbjct  247   MNSSGVGGYQHYGPPISLAPSPALQSPVCFAVPQA  281



>ref|XP_003534424.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Glycine max]
Length=266

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 178/264 (67%), Positives = 194/264 (73%), Gaps = 20/264 (8%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsa-fqggfg  901
             EAAMRACVD APVIDGRRANCNLASLGVQRSKPSTP KH  GGGGRNF VM +   G  G
Sbjct  68    EAAMRACVDPAPVIDGRRANCNLASLGVQRSKPSTP-KH--GGGGRNFRVMGSFQTGFGG  124

Query  900   gaaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
             G  ++FPS + F HYAIQQGIPYN+YGYS YSPDYTYPT YY VYGG T Q+P+YG+   
Sbjct  125   GVGSSFPSAATFPHYAIQQGIPYNVYGYSPYSPDYTYPTSYYGVYGGATAQYPVYGS---  181

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYP--HHLFPYS---ATVNT  556
                   AAAAAFYPYL       G        +S    GV YP   HLF YS   +T   
Sbjct  182   -----GAAAAAFYPYLQ-YGEGSGGGGTSGGYSSGQGYGVNYPPQAHLFQYSPIASTAAA  235

Query  555   TAGYPAQHFANP-ISLAHTAPMQS  487
             TAGY AQH+  P +SLA +  +QS
Sbjct  236   TAGY-AQHYGTPAMSLAPSPALQS  258



>ref|XP_010912663.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Elaeis guineensis]
 ref|XP_010912664.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Elaeis guineensis]
 ref|XP_010912665.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Elaeis guineensis]
Length=293

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 159/273 (58%), Positives = 181/273 (66%), Gaps = 17/273 (6%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTK+FVGGLAWET ++TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  9     GQFGDTTYTKIFVGGLAWETQRETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  68

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             E+AMRACVD APVIDGRRANCNLASLGVQRS+P+TP      GG RNF  M +FQ G   
Sbjct  69    ESAMRACVDPAPVIDGRRANCNLASLGVQRSRPTTP----LHGGSRNFRAMKSFQAGQLQ  124

Query  897   aaaafp--spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTga  724
                     SP+ F HYAIQQGIPYN+YGYS YSP+YTYPT YY+VYGG    +P+YG   
Sbjct  125   GGMGTAFPSPATFPHYAIQQGIPYNVYGYSPYSPEYTYPTSYYNVYGGAASNYPLYG---  181

Query  723   sgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTA--  550
                      + AFYPY            G    A     G+QYP  L  YSA   T    
Sbjct  182   GATTGLVTGSTAFYPYFQL-----SQGGGAATYAHGQGFGLQYPQML-QYSAATTTAGVT  235

Query  549   GYPAQHFANPISLAHTAPMQSGLTMAALRAPLP  451
             G+  QH+  P+SLA T P Q+G+TMA     LP
Sbjct  236   GFSGQHYEGPLSLAPTPPAQAGMTMALAAPTLP  268



>ref|XP_010930549.1| PREDICTED: RNA-binding protein 24-like isoform X2 [Elaeis guineensis]
Length=258

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 160/258 (62%), Positives = 180/258 (70%), Gaps = 16/258 (6%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET ++TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQRETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVD +PVIDGRRANCNLASLG+QRS+P+TP      GG RNF VM +FQ G  G
Sbjct  68    EAAMRACVDPSPVIDGRRANCNLASLGIQRSRPTTP----LHGGSRNFRVMKSFQAGLQG  123

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                    SP+ F HYAIQQGIPYN+YGYSSYSP+YTYPT YY+VYGG   Q+P YG    
Sbjct  124   GLGTAFPSPATFPHYAIQQGIPYNVYGYSSYSPEYTYPTSYYNVYGGGAAQYPFYG---G  180

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                       AFYPY        G   G          GVQYP  +F YSA   TTAG+ 
Sbjct  181   ATTGLVTGTTAFYPYFQL-----GQGGGAAPYPHGQGYGVQYP-QMFQYSAM--TTAGFL  232

Query  540   AQHFANPISLAHTAPMQS  487
             AQH+  P+SLA + P Q+
Sbjct  233   AQHYGGPLSLAPSPPAQA  250



>ref|XP_008786462.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Phoenix dactylifera]
Length=287

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 165/270 (61%), Positives = 185/270 (69%), Gaps = 16/270 (6%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET ++TM+ YFE FGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQRETMRKYFEPFGEILEAVVITDKNTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsa-fqggfg  901
             EAAMRACVD  PVIDGRRANCNLASLG+QRS+P+TP      GG RNF VM +   G  G
Sbjct  68    EAAMRACVDPTPVIDGRRANCNLASLGIQRSRPTTP----LHGGSRNFRVMKSFQAGLQG  123

Query  900   gaaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
             G   AFPSP+ F HYAIQQGIPYN+YGYSSYSP+YTYPT YY+VYGG   Q+P YG    
Sbjct  124   GLGTAFPSPATFPHYAIQQGIPYNVYGYSSYSPEYTYPTSYYNVYGGAAAQYPFYG---G  180

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                       AFYPY        G   G          GVQYP  +F YSA   TT G+ 
Sbjct  181   ATTGLVTGTTAFYPYFQL-----GQGGGTAPYPHGQGYGVQYP-QMFQYSAM--TTTGFL  232

Query  540   AQHFANPISLAHTAPMQSGLTMAALRAPLP  451
             AQH+  P+SLA +   Q+G+TMA     LP
Sbjct  233   AQHYGGPMSLAPSPQAQAGMTMALTAPTLP  262



>ref|XP_003540599.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Glycine max]
Length=267

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 174/262 (66%), Positives = 190/262 (73%), Gaps = 15/262 (6%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVD APVIDGRRANCNLASLGVQRSKPSTP KH  GG GRNF VM +FQ GFGG
Sbjct  68    EAAMRACVDPAPVIDGRRANCNLASLGVQRSKPSTP-KH--GGAGRNFRVMGSFQTGFGG  124

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMY-GTga  724
                +   S + F HYAIQQGIPYN+YGYS YSPDYTYPT YY VYGG T Q+P+Y    A
Sbjct  125   GVGSAFPSAATFPHYAIQQGIPYNVYGYSPYSPDYTYPTSYYGVYGGATAQYPVYGSGPA  184

Query  723   sgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYP--HHLFPYSATVNTTA  550
             +      +  AAFYPYL       G         S    GV YP   HLF YS  + +TA
Sbjct  185   AAAGGMMSGGAAFYPYLQ-----YGGEGSGGGGTSGQGYGVNYPPQAHLFQYSP-IASTA  238

Query  549   GYPAQHFANP-ISLAHTAPMQS  487
             GY AQH+  P +SLA +  +QS
Sbjct  239   GY-AQHYGTPTMSLAPSPALQS  259



>ref|XP_010910324.1| PREDICTED: RNA-binding protein 24-like [Elaeis guineensis]
Length=290

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 163/269 (61%), Positives = 187/269 (70%), Gaps = 16/269 (6%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET ++TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQRETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVD  PVIDGRRANCNLASLGVQRS+P+TP     GG  R+ ++ S   G  GG
Sbjct  68    EAAMRACVDPTPVIDGRRANCNLASLGVQRSRPTTPQH---GGSRRSRVMKSFNTGLQGG  124

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasg  718
                 FPSP+ F HYAIQQGIPYN+YGYS YS +Y YPT YY++YGG   Q+P+YG    G
Sbjct  125   MGTVFPSPATFPHYAIQQGIPYNVYGYSPYSAEYAYPTNYYNLYGGSAAQYPIYG----G  180

Query  717   llsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP-  541
                     AAFYPY  F    G         AS    G+QYP  +F YS  V +TAG   
Sbjct  181   GSGMVTGTAAFYPYFQF----GQGGGSAATYASGHGYGMQYP-QMFHYSG-VASTAGLTG  234

Query  540   -AQHFANPISLAHTAPMQSGLTMAALRAP  457
              AQH+  P+S+A T   Q+G+TM AL AP
Sbjct  235   LAQHYGGPLSIAPTPSAQAGMTM-ALSAP  262



>gb|KHN32458.1| RNA-binding protein 38 [Glycine soja]
Length=278

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 174/267 (65%), Positives = 192/267 (72%), Gaps = 15/267 (6%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAM ACVD APVIDGRRANCNLASLGVQRSKPSTP KH  GG GRNF VM +FQ GFGG
Sbjct  68    EAAMGACVDPAPVIDGRRANCNLASLGVQRSKPSTP-KH--GGAGRNFRVMGSFQTGFGG  124

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMY-GTga  724
                +   S + F HYAIQQGIPYN+YGYS YSPDYTYPT YY VYGG T Q+P+Y    A
Sbjct  125   GVGSAFPSAATFPHYAIQQGIPYNVYGYSPYSPDYTYPTSYYGVYGGATAQYPVYGSGPA  184

Query  723   sgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYP--HHLFPYSATVNTTA  550
             +      +  AAFYPYL       G         S    GV YP   HLF YS  + +TA
Sbjct  185   AAAGGMMSGGAAFYPYLQ-----YGGEGSGGGGTSGQGYGVNYPPQAHLFQYSP-IASTA  238

Query  549   GYPAQHFANP-ISLAHTAPMQSGLTMA  472
             GY AQH+  P +SLA +  +QSG  ++
Sbjct  239   GY-AQHYGTPTMSLAPSPALQSGWFLS  264



>ref|XP_008795273.1| PREDICTED: RNA-binding protein 24-like isoform X2 [Phoenix dactylifera]
Length=292

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 156/273 (57%), Positives = 179/273 (66%), Gaps = 17/273 (6%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTK+FVGGLAWET ++TM+ YFE FGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKIFVGGLAWETQRETMRKYFEPFGEILEAVVITDKNTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVD APVIDGRRANCNLASLGVQRS+P+TP      GG R+F  M +FQ G   
Sbjct  68    EAAMRACVDPAPVIDGRRANCNLASLGVQRSRPTTP----LHGGNRSFRAMKSFQAGQLQ  123

Query  897   aaaafp--spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTga  724
                     SP+ F HYAIQQGIPYN+YGYS YS ++TYPT YY+VYGG   Q+P+YG   
Sbjct  124   GGMGTAFPSPATFPHYAIQQGIPYNVYGYSPYSSEHTYPTSYYNVYGGAAAQYPLYG---  180

Query  723   sgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTA--  550
                        AFYPY            G  A A     G+QYP  L  YSA   T    
Sbjct  181   GATTGLVNGTTAFYPYFEL-----SQGGGAAAYAHGQGFGLQYPQML-QYSAATATAGVT  234

Query  549   GYPAQHFANPISLAHTAPMQSGLTMAALRAPLP  451
             G+  QH+  P+SLA +   Q+G+TMA     LP
Sbjct  235   GFSGQHYGGPLSLAPSPTAQAGMTMALAAPTLP  267



>gb|KHG08243.1| RNA-binding 38 [Gossypium arboreum]
Length=239

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 151/257 (59%), Positives = 169/257 (66%), Gaps = 25/257 (10%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTT+TKVFVGGLAWET KDTMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  7     GQFGDTTFTKVFVGGLAWETQKDTMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREP  66

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVDAAPVIDGRRANCNL  LG QRSKPSTP KH    GGRN   M   +     
Sbjct  67    EAAMRACVDAAPVIDGRRANCNLGFLGAQRSKPSTP-KH----GGRNLRGM---RCFPTA  118

Query  897   aaaafpspsnfSHYAIQQGIPYNLygys-syspdytyptgyysvyggvtGQFPMYGTgas  721
              A +  +     +Y I QG+P+NLYGYS        Y T YYS+YGG TGQ+P+YG    
Sbjct  119   IAFSSAATFPPHYYGIPQGLPFNLYGYSPCSPDYSNYATNYYSLYGGATGQYPVYG----  174

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                    A  AFYPYL F     G        +S    GVQ+P HLFPYS     T  YP
Sbjct  175   -GGLMTGAGTAFYPYLQF-----GEGMAGPVYSSGQGYGVQFPQHLFPYS-----TGNYP  223

Query  540   AQHFANPISLAHTAPMQ  490
              QH+  P++LA T P+Q
Sbjct  224   -QHYGAPMALAPTPPLQ  239



>ref|XP_010912666.1| PREDICTED: RNA-binding protein 24-like isoform X2 [Elaeis guineensis]
Length=264

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 153/261 (59%), Positives = 174/261 (67%), Gaps = 17/261 (7%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTK+FVGGLAWET ++TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  9     GQFGDTTYTKIFVGGLAWETQRETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  68

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             E+AMRACVD APVIDGRRANCNLASLGVQRS+P+TP      GG RNF  M +FQ G   
Sbjct  69    ESAMRACVDPAPVIDGRRANCNLASLGVQRSRPTTP----LHGGSRNFRAMKSFQAGQLQ  124

Query  897   aaaafp--spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTga  724
                     SP+ F HYAIQQGIPYN+YGYS YSP+YTYPT YY+VYGG    +P+YG   
Sbjct  125   GGMGTAFPSPATFPHYAIQQGIPYNVYGYSPYSPEYTYPTSYYNVYGGAASNYPLYG---  181

Query  723   sgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTA--  550
                      + AFYPY            G    A     G+QYP  L  YSA   T    
Sbjct  182   GATTGLVTGSTAFYPYFQL-----SQGGGAATYAHGQGFGLQYPQML-QYSAATTTAGVT  235

Query  549   GYPAQHFANPISLAHTAPMQS  487
             G+  QH+  P+SLA T P Q+
Sbjct  236   GFSGQHYEGPLSLAPTPPAQA  256



>ref|XP_008786463.1| PREDICTED: RNA-binding protein 24-like isoform X2 [Phoenix dactylifera]
Length=258

 Score =   210 bits (535),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 156/251 (62%), Positives = 173/251 (69%), Gaps = 16/251 (6%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET ++TM+ YFE FGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQRETMRKYFEPFGEILEAVVITDKNTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVD  PVIDGRRANCNLASLG+QRS+P+TP      GG RNF VM +FQ G  G
Sbjct  68    EAAMRACVDPTPVIDGRRANCNLASLGIQRSRPTTP----LHGGSRNFRVMKSFQAGLQG  123

Query  897   aaaafp-spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgas  721
                    SP+ F HYAIQQGIPYN+YGYSSYSP+YTYPT YY+VYGG   Q+P YG    
Sbjct  124   GLGTAFPSPATFPHYAIQQGIPYNVYGYSSYSPEYTYPTSYYNVYGGAAAQYPFYG---G  180

Query  720   gllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
                       AFYPY        G   G          GVQYP  +F YSA   TT G+ 
Sbjct  181   ATTGLVTGTTAFYPYFQL-----GQGGGTAPYPHGQGYGVQYP-QMFQYSAM--TTTGFL  232

Query  540   AQHFANPISLA  508
             AQH+  P+SLA
Sbjct  233   AQHYGGPMSLA  243



>ref|XP_009405903.1| PREDICTED: RNA-binding protein 24-B-like [Musa acuminata subsp. 
malaccensis]
Length=300

 Score =   209 bits (531),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 155/277 (56%), Positives = 184/277 (66%), Gaps = 17/277 (6%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET +DTM+ YFEQFG+ILEAVVI DK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQRDTMRKYFEQFGDILEAVVINDKNTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRAC+D +PVIDGRRANCNLASLGVQRS+P+TP      GG RNF  M +FQ   G 
Sbjct  68    EAAMRACLDPSPVIDGRRANCNLASLGVQRSRPTTP----LHGGSRNFRAMKSFQAAGGI  123

Query  897   aaaafp-----spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYG  733
                        + +  +HYAIQQG+PY +YG+S YS DY YPT YY++YGG + Q+P+YG
Sbjct  124   QGGMGTAFPSPAATFPAHYAIQQGLPYYVYGFSPYSADYNYPTSYYNMYGGASAQYPLYG  183

Query  732   TgasgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTT  553
                       AAA  +YPY  F    GGAT+   A A     G+QYP  +F YSA   T 
Sbjct  184   ---GATTGMVAAATGYYPYFQF-GQGGGATSTAGAYAQGQGYGMQYP-QMFQYSAATTTA  238

Query  552   A---GYPAQHFANPISLAHTAPMQSGLTMAALRAPLP  451
             A   G+ AQ +    SLA +   Q+G+TMA     LP
Sbjct  239   AGMNGFGAQLYGVATSLAPSPTAQAGMTMALTAPSLP  275



>ref|XP_008802943.1| PREDICTED: RNA-binding protein 24 [Phoenix dactylifera]
Length=292

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 149/273 (55%), Positives = 170/273 (62%), Gaps = 17/273 (6%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET ++TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQRETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVD +PVIDGRRANCNLASLGVQRS+P+TP +HGG    R     S   G  GG
Sbjct  68    EAAMRACVDPSPVIDGRRANCNLASLGVQRSRPTTP-QHGGSRRFR--ATKSFHTGLQGG  124

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyy--svyggvtGQFPMYGTga  724
                 FPSP+ F HYAIQQGIPYN  G                 ++YGG   Q+P+YG   
Sbjct  125   MGTVFPSPATFPHYAIQQGIPYNNIGGIVSELLSGPSHRQNYYNLYGGAAAQYPIYG---  181

Query  723   sgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGY  544
              G        A FYPY  F    G          S    G+QYP  +F YS  V +TAG 
Sbjct  182   -GGSGMVTGTAGFYPYFQF----GQGGGSPATYGSGHGYGMQYP-QMFHYSG-VASTAGL  234

Query  543   PA--QHFANPISLAHTAPMQSGLTMAALRAPLP  451
                 QH+  P+S+A T   Q+G+TMA     LP
Sbjct  235   TGLTQHYGGPLSIAPTPSAQAGMTMALSAPTLP  267



>ref|XP_004970766.1| PREDICTED: RNA-binding protein 24-B-like isoform X1 [Setaria 
italica]
Length=294

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 162/271 (60%), Gaps = 13/271 (5%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDP
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVD APVIDGRRANCNLASLGVQRS+P TP +HGG    R     S   G  GG
Sbjct  68    DAAMRACVDPAPVIDGRRANCNLASLGVQRSRPPTP-QHGGTRSFRVMKSFSQQAGIQGG  126

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasg  718
               AAFPS + F HYAI QG+PY++  Y        Y             Q+P YG     
Sbjct  127   LGAAFPSHATFPHYAIPQGLPYHV--YGYSPYTPDYSYPTNFYNIYGGAQYPFYG---GA  181

Query  717   llsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPH--HLFPYSATVNTTAGY  544
                     + FYPY  F    G +    T   S     +QYP   H    S+T     G+
Sbjct  182   AAGMVTGTSPFYPYFQF----GQSGNTTTNYTSGQGYNLQYPQMFHFSTVSSTAAAVTGF  237

Query  543   PAQHFANPISLAHTAPMQSGLTMAALRAPLP  451
              AQ F  P+SLA +   Q+G+TMA     LP
Sbjct  238   -AQQFGGPLSLAASPQAQAGMTMALTAPTLP  267



>ref|XP_008795272.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Phoenix dactylifera]
Length=299

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 156/280 (56%), Positives = 179/280 (64%), Gaps = 24/280 (9%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTK+FVGGLAWET ++TM+ YFE FGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKIFVGGLAWETQRETMRKYFEPFGEILEAVVITDKNTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVD APVIDGRRANCNLASLGVQRS+P+TP      GG R+F  M +FQ G   
Sbjct  68    EAAMRACVDPAPVIDGRRANCNLASLGVQRSRPTTP----LHGGNRSFRAMKSFQAGQLQ  123

Query  897   aaaafp--spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTga  724
                     SP+ F HYAIQQGIPYN+YGYS YS ++TYPT YY+VYGG   Q+P+YG   
Sbjct  124   GGMGTAFPSPATFPHYAIQQGIPYNVYGYSPYSSEHTYPTSYYNVYGGAAAQYPLYG---  180

Query  723   sgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTA--  550
                        AFYPY            G  A A     G+QYP  L  YSA   T    
Sbjct  181   GATTGLVNGTTAFYPYFEL-----SQGGGAAAYAHGQGFGLQYPQML-QYSAATATAGVT  234

Query  549   GYPAQHFANPISLAHTAPMQ-------SGLTMAALRAPLP  451
             G+  QH+  P+SLA +   Q       +G+TMA     LP
Sbjct  235   GFSGQHYGGPLSLAPSPTAQAVCFYSKTGMTMALAAPTLP  274



>emb|CDM85227.1| unnamed protein product [Triticum aestivum]
Length=296

 Score =   206 bits (524),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 137/277 (49%), Positives = 163/277 (59%), Gaps = 23/277 (8%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDP
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             E+AMR+CVD APVIDGRRANCNLASLGVQRS+P TP      GG R+F VM +F      
Sbjct  68    ESAMRSCVDPAPVIDGRRANCNLASLGVQRSRPPTPQH----GGARSFRVMKSFGQQQAA  123

Query  897   aaaafp-----spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYG  733
                        S + F HYAI QG+PY++  Y        Y             Q+P YG
Sbjct  124   GIQGALGAAFPSQATFPHYAIPQGLPYHV--YGYSPYSPDYGYPANYYNIYGGNQYPFYG  181

Query  732   TgasgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTT  553
                          + FYPY  F    G + +     AS     +Q+P  +FP+S   +T 
Sbjct  182   ---GAGTGMVTGTSPFYPYFQF----GQSGSTTPNYASGQGYNMQFP-QMFPFSTVASTA  233

Query  552   A---GYPAQHFANPISLAHTAPMQSGLTMAALRAPLP  451
             A   G+ AQ +  P+SLA +   Q+G+TMA     LP
Sbjct  234   AAVTGF-AQQYGGPLSLAASPQAQAGMTMALTAPTLP  269



>gb|EMS52416.1| RNA-binding protein 24-B [Triticum urartu]
Length=297

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 137/278 (49%), Positives = 164/278 (59%), Gaps = 24/278 (9%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDP
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             E+AMR+CVD APVIDGRRANCNLASLGVQRS+P TP      GG R+F VM +F      
Sbjct  68    ESAMRSCVDPAPVIDGRRANCNLASLGVQRSRPPTPQH----GGARSFRVMKSFGQQQAA  123

Query  897   aaaafp------spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMY  736
             A           S + F HYAI QG+PY++  Y        Y             Q+P Y
Sbjct  124   AGIQGALGAAFPSQATFPHYAIPQGLPYHV--YGYSPYSPDYGYPANYYNIYGGNQYPFY  181

Query  735   GTgasgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNT  556
             G             + FYPY  F    G + +     A+     +Q+P  +FP+S   +T
Sbjct  182   G---GAGTGMVTGTSPFYPYFQF----GQSGSTTPNYATGQGYNMQFP-QMFPFSTVAST  233

Query  555   TA---GYPAQHFANPISLAHTAPMQSGLTMAALRAPLP  451
              A   G+ AQ +  P+SLA +   Q+G+TMA     LP
Sbjct  234   AAAVTGF-AQQYGGPLSLAASPQAQAGMTMALTAPTLP  270



>ref|XP_006645107.1| PREDICTED: RNA-binding protein 24-B-like isoform X1 [Oryza brachyantha]
Length=298

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 145/272 (53%), Positives = 170/272 (63%), Gaps = 11/272 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDP
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVD APVIDGRRANCNLASLGVQRS+P TP +HGG    R     S   G  GG
Sbjct  68    DAAMRACVDPAPVIDGRRANCNLASLGVQRSRPPTP-QHGGARSFRVMKSFSQQAGIQGG  126

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasg  718
               AAFPS + F HYAI QG+PY++  Y        Y             Q+P YG  A+ 
Sbjct  127   LGAAFPSHATFPHYAIPQGLPYHV--YGYSPYSPDYSYPTNYYNIYGGAQYPFYGAAAAA  184

Query  717   llsgaaaaaA-FYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
               +G    ++ FYPY  F    G + +  T  AS     +QYP  +F +S   +T A   
Sbjct  185   AAAGMVTGSSPFYPYFQF----GQSGSTTTNYASGQGYNLQYP-QMFHFSTVASTAAAVT  239

Query  540   --AQHFANPISLAHTAPMQSGLTMAALRAPLP  451
               AQ +  P+SLA +   Q+G+TMA     LP
Sbjct  240   GFAQQYGGPLSLAASPQAQAGMTMALTAPTLP  271



>ref|XP_008674753.1| PREDICTED: RNA-binding protein 24-B-like isoform X1 [Zea mays]
 tpg|DAA56565.1| TPA: hypothetical protein ZEAMMB73_877814 [Zea mays]
Length=295

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 135/274 (49%), Positives = 158/274 (58%), Gaps = 18/274 (7%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDP
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVD APVIDGRRANCNLASLGVQRS+P TP      GG RNF VM +F    G 
Sbjct  68    DAAMRACVDPAPVIDGRRANCNLASLGVQRSRPPTPQH----GGARNFRVMKSFNQQAGI  123

Query  897   aaaafpspsnfS---HYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg  727
                   +  + +   HYAI QG+P+++  Y        Y             Q+P YG  
Sbjct  124   QGGLGAAFPSHATFPHYAIPQGLPFHV--YGYSPYTPDYGYPTNFYNIYGGAQYPFYG--  179

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPH--HLFPYSATVNTT  553
                        + FYPY  FG+     T   +          QYP   H    S+T    
Sbjct  180   -GATAGMVTGTSPFYPYFQFGQSGNTTTNYTSGQGYNLQ---QYPQMFHFSTVSSTAAAV  235

Query  552   AGYPAQHFANPISLAHTAPMQSGLTMAALRAPLP  451
              G+ AQ +  P+SLA +   Q+G+TMA     LP
Sbjct  236   TGF-AQQYGGPLSLAASPQAQAGMTMALTAPTLP  268



>dbj|BAD81881.1| putative RRM-containing protein SEB-4 [Oryza sativa Japonica 
Group]
 dbj|BAD82096.1| putative RRM-containing protein SEB-4 [Oryza sativa Japonica 
Group]
 gb|EAY76689.1| hypothetical protein OsI_04643 [Oryza sativa Indica Group]
 gb|EAZ14353.1| hypothetical protein OsJ_04273 [Oryza sativa Japonica Group]
Length=300

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 144/274 (53%), Positives = 169/274 (62%), Gaps = 13/274 (5%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDP
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVD APVIDGRRANCNLASLGVQRS+P TP +HGG    R     S   G  GG
Sbjct  68    DAAMRACVDPAPVIDGRRANCNLASLGVQRSRPPTP-QHGGARSFRVMKSFSQQAGIQGG  126

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasg  718
               AAFPS + F HYAI QG+PY++  Y        Y             Q+P YG  A+ 
Sbjct  127   LGAAFPSHATFPHYAIPQGLPYHV--YGYSPYSPDYSYPTNYYNIYGGAQYPFYGAAAAA  184

Query  717   lls---gaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAG  547
               +       ++ FYPY  F    G + +  T  AS     +QYP  +F +S   +T A 
Sbjct  185   AAAAAGMVTGSSPFYPYFQF----GQSGSTTTNYASGQGYNLQYP-QMFHFSTVASTAAA  239

Query  546   YP--AQHFANPISLAHTAPMQSGLTMAALRAPLP  451
                 AQ +  P+SLA +   Q+G+TMA     LP
Sbjct  240   VTGFAQQYGGPLSLAASPQAQAGMTMALTAPTLP  273



>ref|XP_009421155.1| PREDICTED: RNA-binding protein 24-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=300

 Score =   204 bits (518),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 176/276 (64%), Gaps = 15/276 (5%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQRDTMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVD +PVIDGRRANCNLASLGV RSKP T       GG RNF VM +FQ G  G
Sbjct  68    EAAMRACVDPSPVIDGRRANCNLASLGVHRSKPPT----LLHGGSRNFRVMKSFQAGLQG  123

Query  897   aaaafpspsnfS---HYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg  727
                        +   HYAIQQG+PY +YG+S YS +Y Y T YY++YGG   Q+P+YG  
Sbjct  124   GVGTAFPSPAAATFPHYAIQQGLPYYVYGFSPYSAEYNYATSYYNMYGGAASQYPLYG--  181

Query  726   asgllsgaaaaaAFYP--YLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTT  553
                     A    +YP      G G GG   G  A A     G+QYP  L  YSA   T 
Sbjct  182   -GAANGVVAGTTGYYPYFQFGQGGGGGGGGGGAAAYAQGQGYGLQYPPML-QYSAVTTTA  239

Query  552   A--GYPAQHFANPISLAHTAPMQSGLTMAALRAPLP  451
                G+ AQ +  P+SLA T   Q+G+TMA     LP
Sbjct  240   GVTGFAAQLYGGPMSLAPTPTAQAGMTMAVTSPSLP  275



>gb|KDO51382.1| hypothetical protein CISIN_1g0231862mg, partial [Citrus sinensis]
 gb|KDO51383.1| hypothetical protein CISIN_1g0231862mg, partial [Citrus sinensis]
Length=159

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDKAT RSKGYGFVTFR+PEA
Sbjct  17    FGDTTYTKVFVGGLAWETQKETMEKYFEQFGEILEAVVITDKATGRSKGYGFVTFREPEA  76

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaa  892
             AM+ACVDAAPVIDGRRANCNLA LGVQRSKPSTP KHGGGG     ++ +   GGFGG  
Sbjct  77    AMKACVDAAPVIDGRRANCNLACLGVQRSKPSTP-KHGGGGRNNLRLMSTFQNGGFGGTT  135

Query  891   aafpspsnfSHYAIQQGIPYNL  826
                 + + F HYAIQQGIP+NL
Sbjct  136   FPSTAAATFPHYAIQQGIPFNL  157



>gb|KDO51379.1| hypothetical protein CISIN_1g0231862mg, partial [Citrus sinensis]
 gb|KDO51380.1| hypothetical protein CISIN_1g0231862mg, partial [Citrus sinensis]
 gb|KDO51381.1| hypothetical protein CISIN_1g0231862mg, partial [Citrus sinensis]
Length=160

 Score =   196 bits (498),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDKAT RSKGYGFVTFR+PEA
Sbjct  17    FGDTTYTKVFVGGLAWETQKETMEKYFEQFGEILEAVVITDKATGRSKGYGFVTFREPEA  76

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaa  892
             AM+ACVDAAPVIDGRRANCNLA LGVQRSKPSTP   GGGG     ++ +   GGFGG  
Sbjct  77    AMKACVDAAPVIDGRRANCNLACLGVQRSKPSTPKHGGGGGRNNLRLMSTFQNGGFGGTT  136

Query  891   aafpspsnfSHYAIQQGIPYNL  826
                 + + F HYAIQQGIP+NL
Sbjct  137   FPSTAAATFPHYAIQQGIPFNL  158



>ref|XP_010677208.1| PREDICTED: RNA-binding protein 24-B [Beta vulgaris subsp. vulgaris]
Length=289

 Score =   200 bits (509),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 121/161 (75%), Gaps = 1/161 (1%)
 Frame = -2

Query  1314  MNPVPAAsnnksssnnnmSGQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVI  1135
             M P PA     +++NNN +GQFGDTTYTKVFVGGLAWET KDT++ YF QFG+ILEAVVI
Sbjct  1     MTPAPATLVTPANNNNNNNGQFGDTTYTKVFVGGLAWETQKDTLRTYFHQFGDILEAVVI  60

Query  1134  TDKATARSKGYGFVTFRDPEAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgg  955
             TDKATARSKGYGFVTFR+PEAAMRAC+DA PVIDGRRANCNLA LG Q+SKPSTP+ H  
Sbjct  61    TDKATARSKGYGFVTFREPEAAMRACLDATPVIDGRRANCNLAFLGAQKSKPSTPSHHTT  120

Query  954   gggGRNFMVMsafqggfggaaaafpspsnfS-HYAIQQGIP  835
              G  RN   M++        A    + S    HYAIQQGIP
Sbjct  121   HGISRNVKGMNSNGESGYATAFLGATASTTFPHYAIQQGIP  161



>ref|XP_008657003.1| PREDICTED: RNA-binding protein 24-B-like isoform X1 [Zea mays]
 gb|AFW84412.1| hypothetical protein ZEAMMB73_895673 [Zea mays]
Length=290

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 159/272 (58%), Gaps = 21/272 (8%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRD 
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDS  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVD APVIDGRRANCNLASLGVQRS+P TP      GG RNF VM +F    G 
Sbjct  68    DAAMRACVDPAPVIDGRRANCNLASLGVQRSRPPTPQH----GGARNFKVMKSFSQQAGI  123

Query  897   aaaafp---spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg  727
                      S + F HYAI QG+PY++  Y        Y             Q+  YG  
Sbjct  124   QGGLGAAFPSHATFPHYAIPQGLPYHI--YGYSPYTLDYGYPTNFYNIYGGPQYTFYG--  179

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPH--HLFPYSATVNTT  553
               G        + FYPY  F    G +    T   S     +QYP   H    S+T    
Sbjct  180   --GGAGMVTGTSPFYPYFQF----GQSGNTTTNYTSGQGYNLQYPQMFHFSTVSSTAAAV  233

Query  552   AGYPAQHFANPISLAHTAPMQSGLTMAALRAP  457
              G+ AQ +  P+SLA +   Q+G+TM AL AP
Sbjct  234   NGF-AQQYGGPLSLAASPQAQAGMTM-ALAAP  263



>ref|XP_003564757.1| PREDICTED: RNA-binding protein 24-B-like isoform X1 [Brachypodium 
distachyon]
Length=293

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 135/274 (49%), Positives = 160/274 (58%), Gaps = 20/274 (7%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDP
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMR+CVD APVIDGRRANCNLASLGVQRS+P TP      GG R+F V S  Q     
Sbjct  68    DAAMRSCVDPAPVIDGRRANCNLASLGVQRSRPPTPQH----GGARSFRVKSFSQQAGIQ  123

Query  897   aaaafp--spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTga  724
                     S + F HYAI QG+PY++  Y        Y             Q+P YG   
Sbjct  124   GGLGAAFPSQATFPHYAIPQGLPYHV--YGYSPYSPDYGYPTNYYNIYGGTQYPFYG---  178

Query  723   sgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTA--  550
                       + FYPY  F    G + +  T   +     +QYP  +F +S   +T A  
Sbjct  179   GAGAGMVTGTSPFYPYFQF----GQSGSTTTNYGNGQGYNMQYP-QMFQFSTVASTPAAV  233

Query  549   -GYPAQHFANPISLAHTAPMQSGLTMAALRAPLP  451
              G+ A  +  P+SLA +   Q+G+TMA     LP
Sbjct  234   TGF-APQYGGPLSLAASPQAQAGMTMALTAPTLP  266



>ref|XP_004970767.1| PREDICTED: RNA-binding protein 24-B-like isoform X2 [Setaria 
italica]
Length=263

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 137/259 (53%), Positives = 155/259 (60%), Gaps = 13/259 (5%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDP
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVD APVIDGRRANCNLASLGVQRS+P TP +HGG    R     S   G  GG
Sbjct  68    DAAMRACVDPAPVIDGRRANCNLASLGVQRSRPPTP-QHGGTRSFRVMKSFSQQAGIQGG  126

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasg  718
               AAFPS + F HYAI QG+PY++  Y        Y             Q+P YG     
Sbjct  127   LGAAFPSHATFPHYAIPQGLPYHV--YGYSPYTPDYSYPTNFYNIYGGAQYPFYG---GA  181

Query  717   llsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPH--HLFPYSATVNTTAGY  544
                     + FYPY  F    G +    T   S     +QYP   H    S+T     G+
Sbjct  182   AAGMVTGTSPFYPYFQF----GQSGNTTTNYTSGQGYNLQYPQMFHFSTVSSTAAAVTGF  237

Query  543   PAQHFANPISLAHTAPMQS  487
              AQ F  P+SLA +   Q+
Sbjct  238   -AQQFGGPLSLAASPQAQA  255



>ref|XP_009421154.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=304

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 152/280 (54%), Positives = 173/280 (62%), Gaps = 19/280 (7%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQRDTMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVD +PVIDGRRANCNLASLGV RSKP T       GG RNF VM +FQ G  G
Sbjct  68    EAAMRACVDPSPVIDGRRANCNLASLGVHRSKPPT----LLHGGSRNFRVMKSFQAGLQG  123

Query  897   aaaafpspsnfS---HYAIQQGIPYNLygyssysp----dytyptgyysvyggvtGQFPM  739
                        +   HYAIQQG+PY +YG+S YS       +    YY++YGG   Q+P+
Sbjct  124   GVGTAFPSPAAATFPHYAIQQGLPYYVYGFSPYSAEYNYATSDYQSYYNMYGGAASQYPL  183

Query  738   YGTgasgllsgaaaaaAFYP--YLNFgegnggattgytaaasqgygGVQYPHHLFPYSAT  565
             YG          A    +YP      G G GG   G  A A     G+QYP  L  YSA 
Sbjct  184   YG---GAANGVVAGTTGYYPYFQFGQGGGGGGGGGGAAAYAQGQGYGLQYPPML-QYSAV  239

Query  564   VNTTA--GYPAQHFANPISLAHTAPMQSGLTMAALRAPLP  451
               T    G+ AQ +  P+SLA T   Q+G+TMA     LP
Sbjct  240   TTTAGVTGFAAQLYGGPMSLAPTPTAQAGMTMAVTSPSLP  279



>ref|XP_009404840.1| PREDICTED: RNA-binding protein 24-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=299

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 149/293 (51%), Positives = 176/293 (60%), Gaps = 45/293 (15%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET +DTM  YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  9     GQFGDTTYTKVFVGGLAWETQRDTMSKYFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  68

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRAC+D +PVIDGRRANCNLASLG+QRSKP+TP      GG RNF V+ +FQ G  G
Sbjct  69    EAAMRACIDPSPVIDGRRANCNLASLGLQRSKPTTP----LHGGSRNFRVVKSFQAGLQG  124

Query  897   aaaafpspsnfS------HYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMY  736
                   + +  +      HYAIQQG+PY +YG+S YS +Y Y T YY++YGG   Q+P+Y
Sbjct  125   GMGTAFASAAAAAATAFPHYAIQQGLPYYVYGFSPYSAEYNYATSYYNMYGGAATQYPLY  184

Query  735   GTgasgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPH----------H  586
                       AA    +YPY  F                QG     YPH           
Sbjct  185   ---GGAATGVAAGTTGYYPYFQF---------------GQGGAAAAYPHQGQGYGMQCPQ  226

Query  585   LFPYSATVNTTA--GYPAQHF-ANPISLAHTAPMQSGLTMA----ALRAPLPH  448
             +  YSA   T    G+P+      P+SLA +   Q+G+TMA     L  P PH
Sbjct  227   MLQYSAMTTTAGVTGFPSSLLHGAPVSLAMSPAAQAGMTMALTAPTLPNPTPH  279



>ref|XP_002456729.1| hypothetical protein SORBIDRAFT_03g041530 [Sorghum bicolor]
 gb|EES01849.1| hypothetical protein SORBIDRAFT_03g041530 [Sorghum bicolor]
Length=262

 Score =   197 bits (501),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 132/262 (50%), Positives = 154/262 (59%), Gaps = 20/262 (8%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDP
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVD APVIDGRRANCNLASLGVQRS+P TP      GG RNF VM +F    G 
Sbjct  68    DAAMRACVDPAPVIDGRRANCNLASLGVQRSRPPTPQH----GGARNFRVMKSFSQQAGI  123

Query  897   aaaafpspsnfS---HYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg  727
                   +  + +   HYAI QG+PY++     YSP                 Q+P YG  
Sbjct  124   QGGLGAAFPSHATFPHYAIPQGLPYHV---YGYSPYTPDGYPTNFYSIYGGAQYPFYG--  178

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAG  547
                        + FYPY  F    G +    T   S     +QYP  +F +S   +T A 
Sbjct  179   -GAAAGMVTGTSPFYPYFQF----GQSGNTTTNYTSGQGYNLQYP-QMFQFSTVSSTAAA  232

Query  546   YP--AQHFANPISLAHTAPMQS  487
                 AQ +  P+SLA +   Q+
Sbjct  233   VTGFAQQYGGPLSLAASPQAQA  254



>dbj|BAK00568.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=265

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 130/264 (49%), Positives = 154/264 (58%), Gaps = 21/264 (8%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDP
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMR+CVD APVIDGRRANCNLASLGVQRS+P TP      GG R+F VM +F      
Sbjct  68    DAAMRSCVDPAPVIDGRRANCNLASLGVQRSRPPTPQH----GGARSFRVMKSFGQQQAA  123

Query  897   aaaafp-----spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYG  733
                        S + F HYAI QG+PY++  Y        Y             Q+P YG
Sbjct  124   GIQGALGAAFPSQATFPHYAIPQGLPYHV--YGYSPYSPDYGFPANYYNIYGGNQYPFYG  181

Query  732   TgasgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTT  553
                          + FYPY  F    G + +     A+     +QYP  +FP+S   +T 
Sbjct  182   ---GAGTGMVTGTSPFYPYFQF----GQSGSTTPNYATGQGYNMQYP-QMFPFSTVASTA  233

Query  552   AGYP--AQHFANPISLAHTAPMQS  487
             A     AQ +  P+SLA +   Q+
Sbjct  234   AAVTGFAQQYGGPLSLAASPQAQA  257



>ref|XP_006645108.1| PREDICTED: RNA-binding protein 24-B-like isoform X2 [Oryza brachyantha]
Length=267

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 139/260 (53%), Positives = 163/260 (63%), Gaps = 11/260 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDP
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVD APVIDGRRANCNLASLGVQRS+P TP +HGG    R     S   G  GG
Sbjct  68    DAAMRACVDPAPVIDGRRANCNLASLGVQRSRPPTP-QHGGARSFRVMKSFSQQAGIQGG  126

Query  897   aaaafpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasg  718
               AAFPS + F HYAI QG+PY++  Y        Y             Q+P YG  A+ 
Sbjct  127   LGAAFPSHATFPHYAIPQGLPYHV--YGYSPYSPDYSYPTNYYNIYGGAQYPFYGAAAAA  184

Query  717   llsgaaaaaA-FYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYP  541
               +G    ++ FYPY  F    G + +  T  AS     +QYP  +F +S   +T A   
Sbjct  185   AAAGMVTGSSPFYPYFQF----GQSGSTTTNYASGQGYNLQYP-QMFHFSTVASTAAAVT  239

Query  540   --AQHFANPISLAHTAPMQS  487
               AQ +  P+SLA +   Q+
Sbjct  240   GFAQQYGGPLSLAASPQAQA  259



>ref|XP_004290274.1| PREDICTED: uncharacterized protein LOC101314616 [Fragaria vesca 
subsp. vesca]
Length=319

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 164/294 (56%), Positives = 183/294 (62%), Gaps = 37/294 (13%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTTYTKVFVGGLAWET K+TMK YFEQFG+ILEAVVITDKAT RSKGYGFVTFR+ EAAM
Sbjct  26    DTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREAEAAM  85

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKH--gggggGRNFMVMsafqggfggaa  892
             RACVDAAPVIDGRRANCNLASLGVQRSKPSTP KH  GGGGGGRNF VM+       G  
Sbjct  86    RACVDAAPVIDGRRANCNLASLGVQRSKPSTP-KHGGGGGGGGRNFRVMAGSIFQAAGGV  144

Query  891   aafpspsnfS-----------HY-AIQQGIPYNLygyssyspdytyptgy----------  778
                      +           HY AIQQGIP       +      Y              
Sbjct  145   GVGVGSGFAAASAATAFPAHHHYAAIQQGIPAAAAAAYNLYATAGYSPYSPDYTYPTNYY  204

Query  777   ysvyggvtGQFPMYGTgasgllsgaaaaaAFYPYLNFgegnggatt--gytaaasqgygG  604
                 GG T Q+PMYG    G+L+G AAAAAFYPYL +GE   G       + A + GYGG
Sbjct  205   GLYGGGATSQYPMYGA--GGMLTGGAAAAAFYPYLQYGEAANGGAAAYTTSGAQNVGYGG  262

Query  603   VQYPHH---LFPYSATVNTTAGYPAQHFANPISLAHTAPMQS-GLTMAALRAPL  454
             +QYPHH   L+ YSA      GY  QH+A  +SLA +  +QS G+TMA   APL
Sbjct  263   IQYPHHHHNLYQYSAA--GLGGY--QHYAPSMSLAPSPALQSPGVTMAVPAAPL  312



>ref|XP_009393485.1| PREDICTED: RNA-binding protein 24-A-like [Musa acuminata subsp. 
malaccensis]
Length=291

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 158/275 (57%), Positives = 183/275 (67%), Gaps = 21/275 (8%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTK+FVGGLAWET  +T++ +FEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  7     GQFGDTTYTKIFVGGLAWETQSETVRQHFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  66

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsa-fqggfg  901
              AA RACVD +PVIDGRRANCNLASLG QRS+P+TP      GG R+F V+ +   G  G
Sbjct  67    AAATRACVDPSPVIDGRRANCNLASLGAQRSRPTTP----PYGGNRSFRVVKSFHTGYQG  122

Query  900   gaaaafpspsnfSHYAIQQGIPYNLygyssy-spdytyptgyysvyggvtGQFPMYGTga  724
             G  AAFPSP++F HYAIQ G+PY L    S  S DY+YP GYYSVYGG T Q+P+YG   
Sbjct  123   GMGAAFPSPASFPHYAIQHGVPYGLLYGYSPFSSDYSYPAGYYSVYGGATAQYPVYGA--  180

Query  723   sgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGY  544
                        AFYPY  F     G+    TA AS     V YP  L  YSA V +TAG 
Sbjct  181   --AAGIMTGNTAFYPYFQF---GQGSGGTATAMASGHGYSVPYPPVLH-YSA-VASTAGL  233

Query  543   PA--QHFANPISLAHTAPMQSGLTMA----ALRAP  457
                 QHF  P+S+A T P  +G+TMA    AL +P
Sbjct  234   AGLVQHFGGPLSIAPTPPAHAGMTMALTPPALSSP  268



>ref|XP_008674754.1| PREDICTED: RNA-binding protein 24-B-like isoform X2 [Zea mays]
 tpg|DAA56566.1| TPA: hypothetical protein ZEAMMB73_877814 [Zea mays]
Length=264

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 151/262 (58%), Gaps = 18/262 (7%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDP
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVD APVIDGRRANCNLASLGVQRS+P TP      GG RNF VM +F    G 
Sbjct  68    DAAMRACVDPAPVIDGRRANCNLASLGVQRSRPPTPQH----GGARNFRVMKSFNQQAGI  123

Query  897   aaaafpspsnfS---HYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg  727
                   +  + +   HYAI QG+P+++  Y        Y             Q+P YG  
Sbjct  124   QGGLGAAFPSHATFPHYAIPQGLPFHV--YGYSPYTPDYGYPTNFYNIYGGAQYPFYG--  179

Query  726   asgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPH--HLFPYSATVNTT  553
                        + FYPY  FG+     T   +          QYP   H    S+T    
Sbjct  180   -GATAGMVTGTSPFYPYFQFGQSGNTTTNYTSGQGYNLQ---QYPQMFHFSTVSSTAAAV  235

Query  552   AGYPAQHFANPISLAHTAPMQS  487
              G+ AQ +  P+SLA +   Q+
Sbjct  236   TGF-AQQYGGPLSLAASPQAQA  256



>gb|EMT32381.1| RNA-binding protein 24-B [Aegilops tauschii]
Length=168

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 113/149 (76%), Gaps = 9/149 (6%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDP
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMR+CVD APVIDGRRANCNLASLGVQRS+P TP      GG R+F VM +F      
Sbjct  68    DAAMRSCVDPAPVIDGRRANCNLASLGVQRSRPPTPQH----GGARSFRVMKSFGQQQAA  123

Query  897   aaaafp-----spsnfSHYAIQQGIPYNL  826
                        S + F HYAI QG+PY++
Sbjct  124   GIQGALGAAFPSQATFPHYAIPQGLPYHV  152



>ref|XP_009421157.1| PREDICTED: RNA-binding protein 24-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=271

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 150/264 (57%), Positives = 171/264 (65%), Gaps = 15/264 (6%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQRDTMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVD +PVIDGRRANCNLASLGV RSKP T       GG RNF VM +FQ G  G
Sbjct  68    EAAMRACVDPSPVIDGRRANCNLASLGVHRSKPPT----LLHGGSRNFRVMKSFQAGLQG  123

Query  897   aaaafp---spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTg  727
                      + + F HYAIQQG+PY +YG+S YS +Y Y T YY++YGG   Q+P+YG  
Sbjct  124   GVGTAFPSPAAATFPHYAIQQGLPYYVYGFSPYSAEYNYATSYYNMYGGAASQYPLYG--  181

Query  726   asgllsgaaaaaAFYP--YLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTT  553
                     A    +YP      G G GG   G  A A     G+QYP  L  YSA   T 
Sbjct  182   -GAANGVVAGTTGYYPYFQFGQGGGGGGGGGGAAAYAQGQGYGLQYPPML-QYSAVTTTA  239

Query  552   A--GYPAQHFANPISLAHTAPMQS  487
                G+ AQ +  P+SLA T   Q+
Sbjct  240   GVTGFAAQLYGGPMSLAPTPTAQA  263



>ref|XP_009404842.1| PREDICTED: RNA-binding protein 24-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=270

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 115/148 (78%), Gaps = 10/148 (7%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET +DTM  YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  9     GQFGDTTYTKVFVGGLAWETQRDTMSKYFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  68

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRAC+D +PVIDGRRANCNLASLG+QRSKP+TP      GG RNF V+ +FQ G  G
Sbjct  69    EAAMRACIDPSPVIDGRRANCNLASLGLQRSKPTTP----LHGGSRNFRVVKSFQAGLQG  124

Query  897   aaaafpspsnfS------HYAIQQGIPY  832
                   + +  +      HYAIQQG+PY
Sbjct  125   GMGTAFASAAAAAATAFPHYAIQQGLPY  152



>gb|EPS71852.1| hypothetical protein M569_02910, partial [Genlisea aurea]
Length=255

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 113/148 (76%), Gaps = 5/148 (3%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET KDTMK YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  12    GQFGDTTYTKVFVGGLAWETQKDTMKKYFEQFGEILEAVVITDKTTGRSKGYGFVTFREP  71

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGR-----NFMVMsafq  913
             EAAMRACVDA PVIDGRRANCNLASLGVQRSKPS+P   GG    R     +        
Sbjct  72    EAAMRACVDATPVIDGRRANCNLASLGVQRSKPSSPKTGGGRNNTRVGGGFHHQGGYQAA  131

Query  912   ggfggaaaafpspsnfSHYAIQQGIPYN  829
                  AAAAF S + F  Y+IQQGIPYN
Sbjct  132   AAAAAAAAAFASAATFPGYSIQQGIPYN  159



>ref|XP_009404841.1| PREDICTED: RNA-binding protein 24-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=274

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 115/148 (78%), Gaps = 10/148 (7%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET +DTM  YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  9     GQFGDTTYTKVFVGGLAWETQRDTMSKYFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  68

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRAC+D +PVIDGRRANCNLASLG+QRSKP+TP      GG RNF V+ +FQ G  G
Sbjct  69    EAAMRACIDPSPVIDGRRANCNLASLGLQRSKPTTP----LHGGSRNFRVVKSFQAGLQG  124

Query  897   aaaafpspsnfS------HYAIQQGIPY  832
                   + +  +      HYAIQQG+PY
Sbjct  125   GMGTAFASAAAAAATAFPHYAIQQGLPY  152



>ref|XP_009404843.1| PREDICTED: RNA-binding protein 24-like isoform X5 [Musa acuminata 
subsp. malaccensis]
Length=266

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 115/148 (78%), Gaps = 10/148 (7%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET +DTM  YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  9     GQFGDTTYTKVFVGGLAWETQRDTMSKYFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  68

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRAC+D +PVIDGRRANCNLASLG+QRSKP+TP      GG RNF V+ +FQ G  G
Sbjct  69    EAAMRACIDPSPVIDGRRANCNLASLGLQRSKPTTP----LHGGSRNFRVVKSFQAGLQG  124

Query  897   aaaafpspsnfS------HYAIQQGIPY  832
                   + +  +      HYAIQQG+PY
Sbjct  125   GMGTAFASAAAAAATAFPHYAIQQGLPY  152



>ref|XP_009404839.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=303

 Score =   193 bits (491),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 144/297 (48%), Positives = 172/297 (58%), Gaps = 49/297 (16%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET +DTM  YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  9     GQFGDTTYTKVFVGGLAWETQRDTMSKYFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  68

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRAC+D +PVIDGRRANCNLASLG+QRSKP+TP      GG RNF V+ +FQ G  G
Sbjct  69    EAAMRACIDPSPVIDGRRANCNLASLGLQRSKPTTP----LHGGSRNFRVVKSFQAGLQG  124

Query  897   aaaafpspsnfS------HYAIQQGIPYNLyg----yssyspdytyptgyysvyggvtGQ  748
                   + +  +      HYAIQQG+PY +YG     + Y+   +    YY++YGG   Q
Sbjct  125   GMGTAFASAAAAAATAFPHYAIQQGLPYYVYGFSPYSAEYNYATSDHQSYYNMYGGAATQ  184

Query  747   FPMYGTgasgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPH-------  589
             +P+Y          AA    +YPY  F                QG     YPH       
Sbjct  185   YPLY---GGAATGVAAGTTGYYPYFQF---------------GQGGAAAAYPHQGQGYGM  226

Query  588   ---HLFPYSATVNTTA--GYPAQHF-ANPISLAHTAPMQSGLTMA----ALRAPLPH  448
                 +  YSA   T    G+P+      P+SLA +   Q+G+TMA     L  P PH
Sbjct  227   QCPQMLQYSAMTTTAGVTGFPSSLLHGAPVSLAMSPAAQAGMTMALTAPTLPNPTPH  283



>ref|XP_008657004.1| PREDICTED: RNA-binding protein 24-B-like isoform X2 [Zea mays]
 gb|AFW84413.1| hypothetical protein ZEAMMB73_895673 [Zea mays]
Length=262

 Score =   192 bits (487),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 113/147 (77%), Gaps = 7/147 (5%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRD 
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDS  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMRACVD APVIDGRRANCNLASLGVQRS+P TP      GG RNF VM +F    G 
Sbjct  68    DAAMRACVDPAPVIDGRRANCNLASLGVQRSRPPTPQH----GGARNFKVMKSFSQQAGI  123

Query  897   aaaafpspsnfS---HYAIQQGIPYNL  826
                   +  + +   HYAI QG+PY++
Sbjct  124   QGGLGAAFPSHATFPHYAIPQGLPYHI  150



>ref|XP_009421156.1| PREDICTED: RNA-binding protein 24-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=275

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 111/145 (77%), Gaps = 7/145 (5%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQRDTMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAAMRACVD +PVIDGRRANCNLASLGV RSKP T       GG RNF VM +FQ G  G
Sbjct  68    EAAMRACVDPSPVIDGRRANCNLASLGVHRSKPPT----LLHGGSRNFRVMKSFQAGLQG  123

Query  897   aaaafpspsnfS---HYAIQQGIPY  832
                        +   HYAIQQG+PY
Sbjct  124   GVGTAFPSPAAATFPHYAIQQGLPY  148



>gb|KHN39756.1| RNA-binding protein 24 [Glycine soja]
Length=134

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 93/99 (94%), Gaps = 1/99 (1%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKH  961
             EAAMRACVD APVIDGR+AN NLASLGVQRSKPSTP KH
Sbjct  68    EAAMRACVDPAPVIDGRKANYNLASLGVQRSKPSTP-KH  105



>gb|KDP24217.1| hypothetical protein JCGZ_25874 [Jatropha curcas]
Length=248

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 133/276 (48%), Positives = 155/276 (56%), Gaps = 47/276 (17%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTK+FVGGLAWET KDTMK YFEQFG+ILEAVVI DK T RSKGYGFVTF++ E
Sbjct  4     QFGDTTYTKIFVGGLAWETQKDTMKKYFEQFGDILEAVVIIDKNTGRSKGYGFVTFKEAE  63

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgga  895
             AA RACVD APVIDGRR NCNLASLGVQRSKPSTP      GG RNF VM +F    G  
Sbjct  64    AARRACVDPAPVIDGRRTNCNLASLGVQRSKPSTPQH----GGSRNFRVMKSFHSSTGFQ  119

Query  894   aaafp---spsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTga  724
                     S     HYAIQQGIPY LYGYS      T                  YG   
Sbjct  120   GGVGTPFPSTPTLPHYAIQQGIPYALYGYSPNYTCPTS----------------YYGATN  163

Query  723   sgllsgaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGY  544
             S  +   ++ ++FYPYL +                     + YP H F Y    ++    
Sbjct  164   SHYVVYGSSNSSFYPYLQY----------------GVGLDLVYPQHHFQYPIIASSGV--  205

Query  543   PAQHFANPIS---LAHTAPMQSGLTMAALRAPLPHR  445
              AQH+  P+S   + H+ P  +G +M+    P PH+
Sbjct  206   -AQHYTPPVSFNAIPHSQP-PAGASMST-SYPSPHQ  238



>ref|XP_003564756.1| PREDICTED: RNA-binding protein 24-B-like isoform X2 [Brachypodium 
distachyon]
Length=262

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 112/146 (77%), Gaps = 6/146 (4%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDP
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             +AAMR+CVD APVIDGRRANCNLASLGVQRS+P TP      GG R+F V S  Q     
Sbjct  68    DAAMRSCVDPAPVIDGRRANCNLASLGVQRSRPPTPQH----GGARSFRVKSFSQQAGIQ  123

Query  897   aaaafp--spsnfSHYAIQQGIPYNL  826
                     S + F HYAI QG+PY++
Sbjct  124   GGLGAAFPSQATFPHYAIPQGLPYHV  149



>ref|XP_002518014.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF44532.1| RNA binding protein, putative [Ricinus communis]
Length=267

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 115/147 (78%), Gaps = 7/147 (5%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             G FGDTTYTKVFVGGLAWETHK+T+KNYF+QFGEILEAVVI DK T RSKGYGFVTF++ 
Sbjct  11    GPFGDTTYTKVFVGGLAWETHKETLKNYFQQFGEILEAVVIFDKNTGRSKGYGFVTFKEA  70

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgg  898
             EAA RACVD++PVIDGRRANCNLASLGVQRSKPSTP      GG RNF VM ++Q G+  
Sbjct  71    EAARRACVDSSPVIDGRRANCNLASLGVQRSKPSTPQH----GGSRNFRVMKSYQTGYQQ  126

Query  897   aaaaf---pspsnfSHYAIQQGIPYNL  826
                      +P+   HYAIQQGIP  L
Sbjct  127   GGVGTAFPSTPTQLPHYAIQQGIPCAL  153



>gb|KDO51384.1| hypothetical protein CISIN_1g0231862mg, partial [Citrus sinensis]
Length=152

 Score =   185 bits (470),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 92/97 (95%), Gaps = 1/97 (1%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDKAT RSKGYGFVTFR+PEA
Sbjct  17    FGDTTYTKVFVGGLAWETQKETMEKYFEQFGEILEAVVITDKATGRSKGYGFVTFREPEA  76

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKH  961
             AM+ACVDAAPVIDGRRANCNLA LGVQRSKPSTP KH
Sbjct  77    AMKACVDAAPVIDGRRANCNLACLGVQRSKPSTP-KH  112



>gb|KHN24676.1| RNA-binding protein 24, partial [Glycine soja]
Length=158

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 91/98 (93%), Gaps = 1/98 (1%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTKVFVGGLAWET K+TMK YFEQFGEILEAVVITDKAT RSKGYGFVTF +PE
Sbjct  1     QFGDTTYTKVFVGGLAWETQKETMKKYFEQFGEILEAVVITDKATGRSKGYGFVTFHEPE  60

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKH  961
             AAMRACVD AP+ID R+ANCNLASLGVQRSKPSTP KH
Sbjct  61    AAMRACVDPAPIIDDRKANCNLASLGVQRSKPSTP-KH  97



>ref|XP_006598066.1| PREDICTED: RNA-binding protein 24-like, partial [Glycine max]
Length=109

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TMK YF+QFGEILEA VITDKAT RSKGYGFVTFR+P
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMKKYFKQFGEILEAAVITDKATGRSKGYGFVTFREP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKH  961
             EAAMRACVD APVIDGR+AN NLASLGVQRSKPSTP KH
Sbjct  68    EAAMRACVDPAPVIDGRKANYNLASLGVQRSKPSTP-KH  105



>gb|AFW84411.1| hypothetical protein ZEAMMB73_895673 [Zea mays]
Length=106

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRD 
Sbjct  8     GQFGDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDS  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPN  967
             +AAMRACVD APVIDGRRANCNLASLGVQRS+P TP 
Sbjct  68    DAAMRACVDPAPVIDGRRANCNLASLGVQRSRPPTPQ  104



>ref|XP_006836891.1| hypothetical protein AMTR_s00099p00115860 [Amborella trichopoda]
 gb|ERM99744.1| hypothetical protein AMTR_s00099p00115860 [Amborella trichopoda]
Length=262

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             G+FGDTTYTKVFVGGLAWET ++TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFR+P
Sbjct  9     GKFGDTTYTKVFVGGLAWETQRETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFREP  68

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             EAAMRACVDA PVIDGRRANCNLASLGVQRS+PSTP
Sbjct  69    EAAMRACVDATPVIDGRRANCNLASLGVQRSRPSTP  104



>gb|KFK44379.1| hypothetical protein AALP_AA1G249800 [Arabis alpina]
Length=245

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
              GDTTYTKVFVGGLAWETHK+TMK +FEQFGEILEAVVITDKA+ RSKGYGFVTF++ EA
Sbjct  7     LGDTTYTKVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFKEAEA  66

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVM  925
             A +ACVDA PVIDGRRANCNLASLG+QRSKPSTPN  GGGG   N  VM
Sbjct  67    ARKACVDATPVIDGRRANCNLASLGLQRSKPSTPNHGGGGGRINNMRVM  115



>ref|NP_973888.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AEE30306.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=242

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
              GDTTYTKVFVGGLAWETHK+TMK +FEQFGEILEAVVITDKA+ RSKGYGFVTFR+ EA
Sbjct  7     LGDTTYTKVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEA  66

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVM  925
             A  ACVDA PVIDGRRANCNLASLG+QRSKPSTPN HGGGG   N  VM
Sbjct  67    ARSACVDATPVIDGRRANCNLASLGLQRSKPSTPN-HGGGGRINNMRVM  114



>ref|XP_002890544.1| hypothetical protein ARALYDRAFT_889804 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66803.1| hypothetical protein ARALYDRAFT_889804 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
              GDTTYTKVFVGGLAWETHK+T+K +FEQFGEILEAVVITDKA+ RSKGYGFVTFR+ EA
Sbjct  7     LGDTTYTKVFVGGLAWETHKETLKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEA  66

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVM  925
             A RACV+A PVIDGRRANCNLASLG+QRSKPSTPN HGGGG   N  VM
Sbjct  67    ARRACVEATPVIDGRRANCNLASLGLQRSKPSTPN-HGGGGRINNMRVM  114



>ref|NP_564184.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AAK32921.1|AF367334_1 At1g22910/F19G10_13 [Arabidopsis thaliana]
 gb|AAL15396.1| At1g22910/F19G10_13 [Arabidopsis thaliana]
 gb|AEE30307.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=249

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
              GDTTYTKVFVGGLAWETHK+TMK +FEQFGEILEAVVITDKA+ RSKGYGFVTFR+ EA
Sbjct  7     LGDTTYTKVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEA  66

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVM  925
             A  ACVDA PVIDGRRANCNLASLG+QRSKPSTPN HGGGG   N  VM
Sbjct  67    ARSACVDATPVIDGRRANCNLASLGLQRSKPSTPN-HGGGGRINNMRVM  114



>ref|XP_006305319.1| hypothetical protein CARUB_v10009698mg [Capsella rubella]
 gb|EOA38217.1| hypothetical protein CARUB_v10009698mg [Capsella rubella]
Length=328

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 144/257 (56%), Positives = 171/257 (67%), Gaps = 19/257 (7%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWETHK +++NYFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  63    DTTFTKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  122

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaaaa  886
             +ACVD APVIDGRRANCNLA+ GVQRSKPS+P       G R   V S F+  FG AA A
Sbjct  123   KACVDPAPVIDGRRANCNLAAFGVQRSKPSSP-----IHGPRGMKVTSPFKTHFGAAAPA  177

Query  885   fpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasgllsg  706
              PSP  FSHY +    P+     SSYS DY YPT YY+VYGG T Q PMYG+    +   
Sbjct  178   MPSPLPFSHYTLPYTNPFGF---SSYSMDYNYPTSYYNVYGGATAQHPMYGS--GPMTGV  232

Query  705   aaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYPAQHFA  526
             A AAA FYPYL F                 GY  V YP+H+F YSA  ++T G    H  
Sbjct  233   APAAAGFYPYLQF---------AEGNGPVTGYAPVHYPNHMFHYSALASSTGGNYPHHNG  283

Query  525   NPISLAHTAPMQSGLTM  475
             +P+SLA +  + SGL++
Sbjct  284   SPVSLAPSPVIPSGLSI  300



>ref|XP_006305320.1| hypothetical protein CARUB_v10009698mg [Capsella rubella]
 gb|EOA38218.1| hypothetical protein CARUB_v10009698mg [Capsella rubella]
Length=331

 Score =   181 bits (458),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 173/258 (67%), Gaps = 18/258 (7%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWETHK +++NYFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  63    DTTFTKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  122

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTP-NKHgggggGRNFMVMsafqggfggaaa  889
             +ACVD APVIDGRRANCNLA+ GVQRSKPS+P + H    G R   V S F+  FG AA 
Sbjct  123   KACVDPAPVIDGRRANCNLAAFGVQRSKPSSPIHGH---AGPRGMKVTSPFKTHFGAAAP  179

Query  888   afpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasglls  709
             A PSP  FSHY +    P+     SSYS DY YPT YY+VYGG T Q PMYG+    +  
Sbjct  180   AMPSPLPFSHYTLPYTNPFGF---SSYSMDYNYPTSYYNVYGGATAQHPMYGS--GPMTG  234

Query  708   gaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYPAQHF  529
              A AAA FYPYL F                 GY  V YP+H+F YSA  ++T G    H 
Sbjct  235   VAPAAAGFYPYLQF---------AEGNGPVTGYAPVHYPNHMFHYSALASSTGGNYPHHN  285

Query  528   ANPISLAHTAPMQSGLTM  475
              +P+SLA +  + SGL++
Sbjct  286   GSPVSLAPSPVIPSGLSI  303



>ref|XP_009103214.1| PREDICTED: RNA-binding protein 38-like isoform X3 [Brassica rapa]
Length=244

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
              GDTTYTKVFVGGLAWETHKDT+K +FEQFGEILEAVVITDKA+ RSKGYGFVTF++ +A
Sbjct  7     LGDTTYTKVFVGGLAWETHKDTLKKHFEQFGEILEAVVITDKASGRSKGYGFVTFKEADA  66

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVM  925
             A +ACVDA PVIDGRRANCNLASLG+QRSKPSTPN   GGG   N  VM
Sbjct  67    ASKACVDATPVIDGRRANCNLASLGLQRSKPSTPNHVLGGGRINNMRVM  115



>ref|XP_009103211.1| PREDICTED: RNA-binding protein 38-like isoform X1 [Brassica rapa]
Length=251

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
              GDTTYTKVFVGGLAWETHKDT+K +FEQFGEILEAVVITDKA+ RSKGYGFVTF++ +A
Sbjct  7     LGDTTYTKVFVGGLAWETHKDTLKKHFEQFGEILEAVVITDKASGRSKGYGFVTFKEADA  66

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVM  925
             A +ACVDA PVIDGRRANCNLASLG+QRSKPSTPN   GGG   N  VM
Sbjct  67    ASKACVDATPVIDGRRANCNLASLGLQRSKPSTPNHVLGGGRINNMRVM  115



>ref|XP_010460060.1| PREDICTED: RNA-binding protein 38-like isoform X2 [Camelina sativa]
 ref|XP_010477566.1| PREDICTED: RNA-binding protein 38-like isoform X2 [Camelina sativa]
Length=242

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
              GDTTYTKVFVGGLAWET K+T+K +FEQFGEILEAVVITDKA+ RSKGYGFVTFR+ EA
Sbjct  7     LGDTTYTKVFVGGLAWETQKETLKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEA  66

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVM  925
             A RACVDA PVIDGRRANCNLASLG+QRSKPSTPN HGGGG   N  VM
Sbjct  67    ARRACVDATPVIDGRRANCNLASLGLQRSKPSTPN-HGGGGRINNMRVM  114



>ref|XP_010460059.1| PREDICTED: RNA-binding protein 38-like isoform X1 [Camelina sativa]
 ref|XP_010477565.1| PREDICTED: RNA-binding protein 38-like isoform X1 [Camelina sativa]
Length=249

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
              GDTTYTKVFVGGLAWET K+T+K +FEQFGEILEAVVITDKA+ RSKGYGFVTFR+ EA
Sbjct  7     LGDTTYTKVFVGGLAWETQKETLKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEA  66

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVM  925
             A RACVDA PVIDGRRANCNLASLG+QRSKPSTPN HGGGG   N  VM
Sbjct  67    ARRACVDATPVIDGRRANCNLASLGLQRSKPSTPN-HGGGGRINNMRVM  114



>ref|XP_006303296.1| hypothetical protein CARUB_v10010106mg [Capsella rubella]
 gb|EOA36194.1| hypothetical protein CARUB_v10010106mg [Capsella rubella]
Length=236

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
              GDTTYTKVFVGGLAWET K+T+K +FEQFGEILEAVVITDK++ RSKGYGFVTFR+ EA
Sbjct  7     LGDTTYTKVFVGGLAWETQKETLKKHFEQFGEILEAVVITDKSSGRSKGYGFVTFREAEA  66

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVM  925
             A RACVDA PVIDGRRANCNLASLG+QRSKPSTPN HGGGG   N  VM
Sbjct  67    ARRACVDATPVIDGRRANCNLASLGLQRSKPSTPN-HGGGGRINNMRVM  114



>ref|XP_009103212.1| PREDICTED: RNA-binding protein 38-like isoform X2 [Brassica rapa]
Length=249

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
              GDTTYTKVFVGGLAWETHKDT+K +FEQFGEILEAVVITDKA+ RSKGYGFVTF++ +A
Sbjct  7     LGDTTYTKVFVGGLAWETHKDTLKKHFEQFGEILEAVVITDKASGRSKGYGFVTFKEADA  66

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPN  967
             A +ACVDA PVIDGRRANCNLASLG+QRSKPSTPN
Sbjct  67    ASKACVDATPVIDGRRANCNLASLGLQRSKPSTPN  101



>emb|CDY25759.1| BnaA07g10230D [Brassica napus]
Length=249

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
              GDTTYTKVFVGGLAWETHKDT+K +FEQFGEILEAVVITDKA+ RSKGYGFVTF++ +A
Sbjct  7     LGDTTYTKVFVGGLAWETHKDTLKKHFEQFGEILEAVVITDKASGRSKGYGFVTFKEADA  66

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPN  967
             A +ACVDA PVIDGRRANCNLASLG+QRSKPSTPN
Sbjct  67    ASKACVDATPVIDGRRANCNLASLGLQRSKPSTPN  101



>ref|XP_010478773.1| PREDICTED: RNA-binding protein 24-like isoform X2 [Camelina sativa]
Length=250

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 142/246 (58%), Positives = 167/246 (68%), Gaps = 15/246 (6%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWETHK +++NYFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  5     DTTFTKVFVGGLAWETHKISLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  64

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaaaa  886
             +ACVD APVIDGRRANCNLA+ GVQRSKPS+P  HG  GG     V S F+  FG AA A
Sbjct  65    KACVDPAPVIDGRRANCNLAAFGVQRSKPSSP-VHGHAGGRGAIKVTSPFKTHFGAAATA  123

Query  885   fpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasgllsg  706
              PSP  FSHY +    P+     SSY+ DY YPT YY+VYGG T Q PMYG+    +   
Sbjct  124   MPSPLPFSHYTLPYTNPFGF---SSYTMDYNYPTSYYNVYGGATAQHPMYGS--GPMTGV  178

Query  705   aaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYPAQHFA  526
             AAAAA FYPYL F                 GY  + YP+H+F YSA  ++T G    H  
Sbjct  179   AAAAAGFYPYLQF---------AEGNGPVTGYAPLHYPNHMFHYSALASSTGGNYPHHNG  229

Query  525   NPISLA  508
             +P+SLA
Sbjct  230   SPVSLA  235



>ref|XP_006303297.1| hypothetical protein CARUB_v10010106mg [Capsella rubella]
 gb|EOA36195.1| hypothetical protein CARUB_v10010106mg [Capsella rubella]
Length=249

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
              GDTTYTKVFVGGLAWET K+T+K +FEQFGEILEAVVITDK++ RSKGYGFVTFR+ EA
Sbjct  7     LGDTTYTKVFVGGLAWETQKETLKKHFEQFGEILEAVVITDKSSGRSKGYGFVTFREAEA  66

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVM  925
             A RACVDA PVIDGRRANCNLASLG+QRSKPSTPN HGGGG   N  VM
Sbjct  67    ARRACVDATPVIDGRRANCNLASLGLQRSKPSTPN-HGGGGRINNMRVM  114



>ref|XP_006416143.1| hypothetical protein EUTSA_v10008564mg [Eutrema salsugineum]
 gb|ESQ34496.1| hypothetical protein EUTSA_v10008564mg [Eutrema salsugineum]
Length=245

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -2

Query  1248  GDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAA  1069
             GDTTYTKVFVGGLAWETHK+TMK +FEQFG+I EAVVITDKA+ RSKGYGFVTF++ EAA
Sbjct  9     GDTTYTKVFVGGLAWETHKETMKKHFEQFGDIFEAVVITDKASGRSKGYGFVTFKEAEAA  68

Query  1068  MRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVM  925
              RACVDA P+IDGRRANCNLASLG+QRSKPSTPN  GGGG   N  VM
Sbjct  69    RRACVDATPMIDGRRANCNLASLGLQRSKPSTPNHGGGGGRINNMRVM  116



>ref|NP_973889.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AEE30308.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=347

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
              GDTTYTKVFVGGLAWETHK+TMK +FEQFGEILEAVVITDKA+ RSKGYGFVTFR+ EA
Sbjct  7     LGDTTYTKVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEA  66

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVM  925
             A  ACVDA PVIDGRRANCNLASLG+QRSKPSTPN HGGGG   N  VM
Sbjct  67    ARSACVDATPVIDGRRANCNLASLGLQRSKPSTPN-HGGGGRINNMRVM  114



>ref|XP_010478772.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Camelina sativa]
Length=251

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 166/246 (67%), Gaps = 14/246 (6%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWETHK +++NYFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  5     DTTFTKVFVGGLAWETHKISLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  64

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaaaa  886
             +ACVD APVIDGRRANCNLA+ GVQRSKPS+P   G  GG     V S F+  FG AA A
Sbjct  65    KACVDPAPVIDGRRANCNLAAFGVQRSKPSSPVHVGHAGGRGAIKVTSPFKTHFGAAATA  124

Query  885   fpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasgllsg  706
              PSP  FSHY +    P+     SSY+ DY YPT YY+VYGG T Q PMYG+    +   
Sbjct  125   MPSPLPFSHYTLPYTNPFGF---SSYTMDYNYPTSYYNVYGGATAQHPMYGS--GPMTGV  179

Query  705   aaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYPAQHFA  526
             AAAAA FYPYL F                 GY  + YP+H+F YSA  ++T G    H  
Sbjct  180   AAAAAGFYPYLQF---------AEGNGPVTGYAPLHYPNHMFHYSALASSTGGNYPHHNG  230

Query  525   NPISLA  508
             +P+SLA
Sbjct  231   SPVSLA  236



>ref|XP_006416144.1| hypothetical protein EUTSA_v10008564mg [Eutrema salsugineum]
 gb|ESQ34497.1| hypothetical protein EUTSA_v10008564mg [Eutrema salsugineum]
Length=252

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -2

Query  1248  GDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAA  1069
             GDTTYTKVFVGGLAWETHK+TMK +FEQFG+I EAVVITDKA+ RSKGYGFVTF++ EAA
Sbjct  9     GDTTYTKVFVGGLAWETHKETMKKHFEQFGDIFEAVVITDKASGRSKGYGFVTFKEAEAA  68

Query  1068  MRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVM  925
              RACVDA P+IDGRRANCNLASLG+QRSKPSTPN  GGGG   N  VM
Sbjct  69    RRACVDATPMIDGRRANCNLASLGLQRSKPSTPNHGGGGGRINNMRVM  116



>gb|ABK24496.1| unknown [Picea sitchensis]
Length=295

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWET K+TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDPE+AM
Sbjct  21    DTTFTKVFVGGLAWETQKETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPESAM  80

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPN  967
             RACVD++P+IDGRRANCNLASLG QRS+PSTP 
Sbjct  81    RACVDSSPIIDGRRANCNLASLGAQRSRPSTPQ  113



>gb|AAB72160.1| unknown [Arabidopsis thaliana]
Length=340

 Score =   179 bits (453),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
              GDTTYTKVFVGGLAWETHK+TMK +FEQFGEILEAVVITDKA+ RSKGYGFVTFR+ EA
Sbjct  22    LGDTTYTKVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEA  81

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPN  967
             A  ACVDA PVIDGRRANCNLASLG+QRSKPSTPN
Sbjct  82    ARSACVDATPVIDGRRANCNLASLGLQRSKPSTPN  116



>emb|CDY67263.1| BnaCnng54160D [Brassica napus]
Length=328

 Score =   177 bits (450),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
              GDTTYTKVFVGGLAWETHKDT+K +FEQFGEILEAVVITDKA+ RSKGYGFVTF++ +A
Sbjct  7     LGDTTYTKVFVGGLAWETHKDTLKKHFEQFGEILEAVVITDKASGRSKGYGFVTFKEADA  66

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPN  967
             A +ACVDA PVIDGRRANCNLASLG+QRSKPSTPN
Sbjct  67    ASKACVDATPVIDGRRANCNLASLGLQRSKPSTPN  101



>ref|XP_010542626.1| PREDICTED: RNA-binding protein 38 isoform X2 [Tarenaya hassleriana]
Length=234

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 153/247 (62%), Gaps = 27/247 (11%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWETHK +++NYFEQFG+ILEAVVITDK T RSKGYGFVTFR+ EAA 
Sbjct  3     DTTFTKVFVGGLAWETHKHSLRNYFEQFGDILEAVVITDKTTGRSKGYGFVTFREAEAAQ  62

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaaaa  886
             +ACVD +PVIDGRRANCNLA+ GVQRSKPS+PN      GGR   V              
Sbjct  63    KACVDPSPVIDGRRANCNLAAFGVQRSKPSSPNH--VQAGGRGIKV--------ASPFKT  112

Query  885   fpspsnfSHYAIQQGIPY-NLygyssyspdytyptgyysvyggvtGQFPMYGTgasglls  709
                 +   H A+   +PY NL+GYSSY  DY YPT YY+VYGG   Q PMYG        
Sbjct  113   HFGGTAAFHSAL---LPYSNLFGYSSYPMDYNYPTSYYNVYGGAAAQHPMYGN----GTM  165

Query  708   gaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYPAQHF  529
                AA AFYPYL F               + GY  V YP+HLF YSA  ++       H 
Sbjct  166   AGMAATAFYPYLQF---------AEGNGPATGYASVHYPNHLFHYSALASSPGSNYPHHN  216

Query  528   ANPISLA  508
              +P+SLA
Sbjct  217   GSPVSLA  223



>ref|XP_006305318.1| hypothetical protein CARUB_v10009698mg [Capsella rubella]
 gb|EOA38216.1| hypothetical protein CARUB_v10009698mg [Capsella rubella]
Length=307

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 142/247 (57%), Positives = 166/247 (67%), Gaps = 18/247 (7%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWETHK +++NYFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  63    DTTFTKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  122

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTP-NKHgggggGRNFMVMsafqggfggaaa  889
             +ACVD APVIDGRRANCNLA+ GVQRSKPS+P + H    G R   V S F+  FG AA 
Sbjct  123   KACVDPAPVIDGRRANCNLAAFGVQRSKPSSPIHGH---AGPRGMKVTSPFKTHFGAAAP  179

Query  888   afpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasglls  709
             A PSP  FSHY +    P+     SSYS DY YPT YY+VYGG T Q PMYG+    +  
Sbjct  180   AMPSPLPFSHYTLPYTNPFGF---SSYSMDYNYPTSYYNVYGGATAQHPMYGS--GPMTG  234

Query  708   gaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYPAQHF  529
              A AAA FYPYL F                 GY  V YP+H+F YSA  ++T G    H 
Sbjct  235   VAPAAAGFYPYLQF---------AEGNGPVTGYAPVHYPNHMFHYSALASSTGGNYPHHN  285

Query  528   ANPISLA  508
              +P+SLA
Sbjct  286   GSPVSLA  292



>ref|XP_010542619.1| PREDICTED: RNA-binding protein 38 isoform X1 [Tarenaya hassleriana]
Length=238

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 153/247 (62%), Gaps = 27/247 (11%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWETHK +++NYFEQFG+ILEAVVITDK T RSKGYGFVTFR+ EAA 
Sbjct  3     DTTFTKVFVGGLAWETHKHSLRNYFEQFGDILEAVVITDKTTGRSKGYGFVTFREAEAAQ  62

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaaaa  886
             +ACVD +PVIDGRRANCNLA+ GVQRSKPS+PN      GGR   V              
Sbjct  63    KACVDPSPVIDGRRANCNLAAFGVQRSKPSSPNH--VQAGGRGIKV--------ASPFKT  112

Query  885   fpspsnfSHYAIQQGIPY-NLygyssyspdytyptgyysvyggvtGQFPMYGTgasglls  709
                 +   H A+   +PY NL+GYSSY  DY YPT YY+VYGG   Q PMYG        
Sbjct  113   HFGGTAAFHSAL---LPYSNLFGYSSYPMDYNYPTSYYNVYGGAAAQHPMYGN----GTM  165

Query  708   gaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYPAQHF  529
                AA AFYPYL F               + GY  V YP+HLF YSA  ++       H 
Sbjct  166   AGMAATAFYPYLQF---------AEGNGPATGYASVHYPNHLFHYSALASSPGSNYPHHN  216

Query  528   ANPISLA  508
              +P+SLA
Sbjct  217   GSPVSLA  223



>ref|XP_010498781.1| PREDICTED: RNA-binding protein 38-like isoform X2 [Camelina sativa]
Length=239

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
              GDTTYTKVFVGGLAWET K+T+K +FEQFGEILEAVVITDKA+ RSKGYGFVTFR+ EA
Sbjct  7     LGDTTYTKVFVGGLAWETQKETLKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEA  66

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVM  925
             A RACVDA PVIDGRRANCNLA +G+QRSKPSTPN HGGGG   N  VM
Sbjct  67    ARRACVDATPVIDGRRANCNLAYIGLQRSKPSTPN-HGGGGRINNMRVM  114



>emb|CDY69197.1| BnaAnng29640D, partial [Brassica napus]
Length=225

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTTYTKVFVGGLAWET KDTMK +FEQFGEILEAVVITDKA+ RSKGYGFVTF++ EAA 
Sbjct  3     DTTYTKVFVGGLAWETDKDTMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFKEAEAAR  62

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPN  967
             RACVD  PVIDGRRANCNLASLG+QRSKPSTPN
Sbjct  63    RACVDGTPVIDGRRANCNLASLGLQRSKPSTPN  95



>ref|XP_010498780.1| PREDICTED: RNA-binding protein 38-like isoform X1 [Camelina sativa]
Length=246

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
              GDTTYTKVFVGGLAWET K+T+K +FEQFGEILEAVVITDKA+ RSKGYGFVTFR+ EA
Sbjct  7     LGDTTYTKVFVGGLAWETQKETLKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEA  66

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVM  925
             A RACVDA PVIDGRRANCNLA +G+QRSKPSTPN HGGGG   N  VM
Sbjct  67    ARRACVDATPVIDGRRANCNLAYIGLQRSKPSTPN-HGGGGRINNMRVM  114



>ref|XP_006603346.1| PREDICTED: RNA-binding protein 24-A-like [Glycine max]
Length=275

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 89/99 (90%), Gaps = 1/99 (1%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTT+TKVFVGGLA ET K+TMK YFEQFGEILEA VITDKAT RSKGYGFVTF +P
Sbjct  117   GQFGDTTFTKVFVGGLASETQKETMKKYFEQFGEILEAAVITDKATGRSKGYGFVTFHEP  176

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKH  961
             EAAMRACVD AP+ID  +ANCNLASLGVQRSKPSTP KH
Sbjct  177   EAAMRACVDPAPIIDDGKANCNLASLGVQRSKPSTP-KH  214



>emb|CDY04769.1| BnaC05g18200D [Brassica napus]
Length=237

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTTYTKVFVGGLAWET KDTMK +FEQFGEILEAVVITDKA+ RSKGYGFVTF++ EAA 
Sbjct  3     DTTYTKVFVGGLAWETDKDTMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFKEAEAAR  62

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFM  931
             RACVD  PVIDGRRANCNLASLG+QRSKPSTPN  G     R  M
Sbjct  63    RACVDGTPVIDGRRANCNLASLGLQRSKPSTPNHGGRINNMRVMM  107



>ref|XP_009115581.1| PREDICTED: RNA-binding protein 24 [Brassica rapa]
Length=239

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTTYTKVFVGGLAWET KDTMK +FEQFGEILEAVVITDKA+ RSKGYGFVTF++ EAA 
Sbjct  3     DTTYTKVFVGGLAWETDKDTMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFKEAEAAR  62

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPN  967
             RACVD  PVIDGRRANCNLASLG+QRSKPSTPN
Sbjct  63    RACVDGTPVIDGRRANCNLASLGLQRSKPSTPN  95



>ref|XP_010499898.1| PREDICTED: RNA-binding protein 24-like isoform X3 [Camelina sativa]
Length=247

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 140/246 (57%), Positives = 163/246 (66%), Gaps = 14/246 (6%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWETHK ++ NYFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  5     DTTFTKVFVGGLAWETHKLSLGNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  64

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaaaa  886
             +ACVD APVIDGRRANCNLA+ GVQRSKPS+P   G  GG     V S F+  FG AA A
Sbjct  65    KACVDPAPVIDGRRANCNLAAFGVQRSKPSSPVHVGHAGGRGGLKVTSPFKTHFGAAATA  124

Query  885   fpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasgllsg  706
              PSP  FSHY +    P+     SSY+ DY YPT YY+VYGG T Q PMY +    +   
Sbjct  125   MPSPLPFSHYTLPYTNPFGF---SSYTMDYNYPTRYYNVYGGATAQHPMYSS--GPMTGV  179

Query  705   aaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYPAQHFA  526
             AAAAA FYPYL F                 GY  + YP+H+F YSA  ++T G    H  
Sbjct  180   AAAAAGFYPYLQF---------AEGNGPVTGYAPLHYPNHMFHYSALASSTGGNYPHHNG  230

Query  525   NPISLA  508
              P+SLA
Sbjct  231   TPVSLA  236



>ref|XP_010499895.1| PREDICTED: RNA-binding protein 24-like isoform X2 [Camelina sativa]
Length=250

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 164/246 (67%), Gaps = 15/246 (6%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWETHK ++ NYFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  5     DTTFTKVFVGGLAWETHKLSLGNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  64

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaaaa  886
             +ACVD APVIDGRRANCNLA+ GVQRSKPS+P  HG  GG     V S F+  FG AA A
Sbjct  65    KACVDPAPVIDGRRANCNLAAFGVQRSKPSSP-VHGHAGGRGGLKVTSPFKTHFGAAATA  123

Query  885   fpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasgllsg  706
              PSP  FSHY +    P+     SSY+ DY YPT YY+VYGG T Q PMY +    +   
Sbjct  124   MPSPLPFSHYTLPYTNPFGF---SSYTMDYNYPTRYYNVYGGATAQHPMYSS--GPMTGV  178

Query  705   aaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYPAQHFA  526
             AAAAA FYPYL F                 GY  + YP+H+F YSA  ++T G    H  
Sbjct  179   AAAAAGFYPYLQF---------AEGNGPVTGYAPLHYPNHMFHYSALASSTGGNYPHHNG  229

Query  525   NPISLA  508
              P+SLA
Sbjct  230   TPVSLA  235



>ref|XP_010499894.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Camelina sativa]
Length=251

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 140/246 (57%), Positives = 163/246 (66%), Gaps = 14/246 (6%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWETHK ++ NYFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  5     DTTFTKVFVGGLAWETHKLSLGNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  64

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaaaa  886
             +ACVD APVIDGRRANCNLA+ GVQRSKPS+P   G  GG     V S F+  FG AA A
Sbjct  65    KACVDPAPVIDGRRANCNLAAFGVQRSKPSSPVHVGHAGGRGGLKVTSPFKTHFGAAATA  124

Query  885   fpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasgllsg  706
              PSP  FSHY +    P+     SSY+ DY YPT YY+VYGG T Q PMY +    +   
Sbjct  125   MPSPLPFSHYTLPYTNPFGF---SSYTMDYNYPTRYYNVYGGATAQHPMYSS--GPMTGV  179

Query  705   aaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYPAQHFA  526
             AAAAA FYPYL F                 GY  + YP+H+F YSA  ++T G    H  
Sbjct  180   AAAAAGFYPYLQF---------AEGNGPVTGYAPLHYPNHMFHYSALASSTGGNYPHHNG  230

Query  525   NPISLA  508
              P+SLA
Sbjct  231   TPVSLA  236



>ref|XP_010461180.1| PREDICTED: RNA-binding protein 24-like isoform X3 [Camelina sativa]
Length=247

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 141/247 (57%), Positives = 167/247 (68%), Gaps = 16/247 (6%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWETHK +++NYFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  5     DTTFTKVFVGGLAWETHKISLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  64

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaaaa  886
             +ACVD APVIDGRRANCNLA+ GVQRSKPS+P   G  GG     V S F+  FG AA A
Sbjct  65    KACVDPAPVIDGRRANCNLAAFGVQRSKPSSPVHVGHAGGRGGLKVTSPFKTHFGAAATA  124

Query  885   fpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasgllsg  706
              PSP  FSHY +    P+     SSY+ DY YPT YY+VYGG T Q PM+ +    +   
Sbjct  125   MPSPLPFSHYTLPYTNPFGF---SSYTMDYNYPTSYYNVYGGATAQHPMHSS--GPMTGV  179

Query  705   aaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAG-YPAQHF  529
             AAAAA FYPYL F                 GY  + YP+H+F YSA  ++T G YP Q+ 
Sbjct  180   AAAAAGFYPYLQF---------AEGNGPVTGYAPLHYPNHMFHYSALASSTGGNYPHQN-  229

Query  528   ANPISLA  508
               P+SLA
Sbjct  230   GTPVSLA  236



>ref|XP_010252040.1| PREDICTED: RNA-binding protein 24-B-like isoform X3 [Nelumbo 
nucifera]
Length=272

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTK+FVGGLAWET ++TM+ YFEQFGEI EAVVITDK T RSKGYGFVTF+DP
Sbjct  17    GQFGDTTYTKIFVGGLAWETQRETMRRYFEQFGEIQEAVVITDKNTGRSKGYGFVTFKDP  76

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKH  961
             +AA RAC + +PVIDGRR NCNLASLG  R+ PSTP +H
Sbjct  77    DAATRACQNPSPVIDGRRTNCNLASLGAHRNHPSTPQQH  115



>gb|AAG51218.1|AC051630_15 RNA-binding protein; 68390-68829 [Arabidopsis thaliana]
Length=117

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWETHK +++NYFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  3     DTTFTKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  62

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             +ACVD APVIDGRRANCNLA+ GVQRSKPS+P
Sbjct  63    KACVDPAPVIDGRRANCNLAAFGVQRSKPSSP  94



>ref|XP_010252048.1| PREDICTED: RNA-binding protein 38-like isoform X4 [Nelumbo nucifera]
Length=271

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTK+FVGGLAWET ++TM+ YFEQFGEI EAVVITDK T RSKGYGFVTF+DP
Sbjct  17    GQFGDTTYTKIFVGGLAWETQRETMRRYFEQFGEIQEAVVITDKNTGRSKGYGFVTFKDP  76

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKH  961
             +AA RAC + +PVIDGRR NCNLASLG  R+ PSTP +H
Sbjct  77    DAATRACQNPSPVIDGRRTNCNLASLGAHRNHPSTPQQH  115



>ref|XP_010461178.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Camelina sativa]
Length=251

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 141/247 (57%), Positives = 167/247 (68%), Gaps = 16/247 (6%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWETHK +++NYFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  5     DTTFTKVFVGGLAWETHKISLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  64

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaaaa  886
             +ACVD APVIDGRRANCNLA+ GVQRSKPS+P   G  GG     V S F+  FG AA A
Sbjct  65    KACVDPAPVIDGRRANCNLAAFGVQRSKPSSPVHVGHAGGRGGLKVTSPFKTHFGAAATA  124

Query  885   fpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasgllsg  706
              PSP  FSHY +    P+     SSY+ DY YPT YY+VYGG T Q PM+ +    +   
Sbjct  125   MPSPLPFSHYTLPYTNPFGF---SSYTMDYNYPTSYYNVYGGATAQHPMHSS--GPMTGV  179

Query  705   aaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAG-YPAQHF  529
             AAAAA FYPYL F                 GY  + YP+H+F YSA  ++T G YP Q+ 
Sbjct  180   AAAAAGFYPYLQF---------AEGNGPVTGYAPLHYPNHMFHYSALASSTGGNYPHQN-  229

Query  528   ANPISLA  508
               P+SLA
Sbjct  230   GTPVSLA  236



>ref|XP_010461179.1| PREDICTED: RNA-binding protein 24-like isoform X2 [Camelina sativa]
Length=250

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 142/247 (57%), Positives = 168/247 (68%), Gaps = 17/247 (7%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWETHK +++NYFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  5     DTTFTKVFVGGLAWETHKISLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  64

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaaaa  886
             +ACVD APVIDGRRANCNLA+ GVQRSKPS+P  HG  GG     V S F+  FG AA A
Sbjct  65    KACVDPAPVIDGRRANCNLAAFGVQRSKPSSP-VHGHAGGRGGLKVTSPFKTHFGAAATA  123

Query  885   fpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasgllsg  706
              PSP  FSHY +    P+     SSY+ DY YPT YY+VYGG T Q PM+ +    +   
Sbjct  124   MPSPLPFSHYTLPYTNPFGF---SSYTMDYNYPTSYYNVYGGATAQHPMHSS--GPMTGV  178

Query  705   aaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAG-YPAQHF  529
             AAAAA FYPYL F                 GY  + YP+H+F YSA  ++T G YP Q+ 
Sbjct  179   AAAAAGFYPYLQF---------AEGNGPVTGYAPLHYPNHMFHYSALASSTGGNYPHQN-  228

Query  528   ANPISLA  508
               P+SLA
Sbjct  229   GTPVSLA  235



>ref|XP_006415084.1| hypothetical protein EUTSA_v10008315mg [Eutrema salsugineum]
 gb|ESQ33437.1| hypothetical protein EUTSA_v10008315mg [Eutrema salsugineum]
Length=301

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 142/247 (57%), Positives = 171/247 (69%), Gaps = 20/247 (8%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWETHK +++NYFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  59    DTTFTKVFVGGLAWETHKISLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  118

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTP-NKHgggggGRNFMVMsafqggfggaaa  889
             +ACVD APVIDGRRANCNLA+ GVQRSKPS+P + H GG G +    +++      GA A
Sbjct  119   KACVDPAPVIDGRRANCNLAAFGVQRSKPSSPIHGHAGGRGVK----VTSPFKTHFGAPA  174

Query  888   afpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasglls  709
             A PSP  FSHYA+    P+     SSYS DY YPT YY+VYGG T Q PMYG+   G ++
Sbjct  175   ALPSPLPFSHYALPYTNPFGF---SSYSMDYNYPTSYYNVYGGATAQHPMYGS---GPMT  228

Query  708   gaaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYPAQHF  529
             G AAAAAFYPYL F             A   GY  + YP+H+F YS   ++T G    H 
Sbjct  229   GVAAAAAFYPYLQF---------AEANAPVTGYAPLHYPNHMFHYSPLASSTGGNYPHHN  279

Query  528   ANPISLA  508
              +P+SLA
Sbjct  280   GSPVSLA  286



>ref|XP_010252031.1| PREDICTED: RNA-binding protein 24-like isoform X2 [Nelumbo nucifera]
Length=280

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTK+FVGGLAWET ++TM+ YFEQFGEI EAVVITDK T RSKGYGFVTF+DP
Sbjct  17    GQFGDTTYTKIFVGGLAWETQRETMRRYFEQFGEIQEAVVITDKNTGRSKGYGFVTFKDP  76

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKH  961
             +AA RAC + +PVIDGRR NCNLASLG  R+ PSTP +H
Sbjct  77    DAATRACQNPSPVIDGRRTNCNLASLGAHRNHPSTPQQH  115



>ref|XP_010252022.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Nelumbo nucifera]
Length=281

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTTYTK+FVGGLAWET ++TM+ YFEQFGEI EAVVITDK T RSKGYGFVTF+DP
Sbjct  17    GQFGDTTYTKIFVGGLAWETQRETMRRYFEQFGEIQEAVVITDKNTGRSKGYGFVTFKDP  76

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKH  961
             +AA RAC + +PVIDGRR NCNLASLG  R+ PSTP +H
Sbjct  77    DAATRACQNPSPVIDGRRTNCNLASLGAHRNHPSTPQQH  115



>ref|XP_010689715.1| PREDICTED: RNA-binding protein 24 [Beta vulgaris subsp. vulgaris]
Length=301

 Score =   171 bits (434),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTTYTK+FVGGLAWET +DTMK YFEQFGEILEAVVITDKAT RSKGYGFVTF+DPEAA 
Sbjct  27    DTTYTKIFVGGLAWETQRDTMKIYFEQFGEILEAVVITDKATGRSKGYGFVTFKDPEAAF  86

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKH  961
             RAC + +PVIDGRRANCNLASLG Q+++P TP  H
Sbjct  87    RACQNPSPVIDGRRANCNLASLGAQKNRPPTPQHH  121



>ref|XP_006833255.1| hypothetical protein AMTR_s00113p00116350 [Amborella trichopoda]
 gb|ERM98533.1| hypothetical protein AMTR_s00113p00116350 [Amborella trichopoda]
Length=290

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             +FGDTTYTK+FVGGLAWET ++TM+ YFEQFGEI EAVVITDK T RSKGYGFVTF+D +
Sbjct  8     KFGDTTYTKIFVGGLAWETQRETMRRYFEQFGEIQEAVVITDKNTGRSKGYGFVTFKDAD  67

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPN  967
             AAMRAC+D +PVIDGRRANCNLAS+GV RS+PSTP 
Sbjct  68    AAMRACLDPSPVIDGRRANCNLASMGVTRSRPSTPQ  103



>ref|XP_007051436.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOX95593.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=314

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQ+ DTT+TK+FVGGLAWET +DTM+ YF+QFGEILEAVVITDK T RSKGYGFVTF+DP
Sbjct  16    GQYNDTTFTKIFVGGLAWETQRDTMRRYFDQFGEILEAVVITDKNTGRSKGYGFVTFKDP  75

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             EAAMRAC + +P+IDGRRANCNLASLG Q+++P TP
Sbjct  76    EAAMRACQNPSPIIDGRRANCNLASLGAQKTRPPTP  111



>ref|XP_007051437.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOX95594.1| RNA-binding family protein isoform 2 [Theobroma cacao]
Length=315

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQ+ DTT+TK+FVGGLAWET +DTM+ YF+QFGEILEAVVITDK T RSKGYGFVTF+DP
Sbjct  16    GQYNDTTFTKIFVGGLAWETQRDTMRRYFDQFGEILEAVVITDKNTGRSKGYGFVTFKDP  75

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             EAAMRAC + +P+IDGRRANCNLASLG Q+++P TP
Sbjct  76    EAAMRACQNPSPIIDGRRANCNLASLGAQKTRPPTP  111



>ref|XP_002301439.2| hypothetical protein POPTR_0002s17990g [Populus trichocarpa]
 gb|EEE80712.2| hypothetical protein POPTR_0002s17990g [Populus trichocarpa]
Length=293

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQ+ DTT+TK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DP
Sbjct  16    GQYNDTTFTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDP  75

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPN  967
             +AAMRAC + +PVIDGRRANCNLASLG Q+++P TP 
Sbjct  76    DAAMRACQNPSPVIDGRRANCNLASLGAQKTRPPTPQ  112



>ref|XP_002974002.1| hypothetical protein SELMODRAFT_100311, partial [Selaginella 
moellendorffii]
 ref|XP_002983494.1| hypothetical protein SELMODRAFT_118403, partial [Selaginella 
moellendorffii]
 gb|EFJ15395.1| hypothetical protein SELMODRAFT_118403, partial [Selaginella 
moellendorffii]
 gb|EFJ24957.1| hypothetical protein SELMODRAFT_100311, partial [Selaginella 
moellendorffii]
Length=122

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             G FGDTTYTKVFVGGLAWET +D M+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDP
Sbjct  16    GPFGDTTYTKVFVGGLAWETQRDAMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDP  75

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKP  979
             EAA RACVD AP+IDGR+ANCNLASLG +  +P
Sbjct  76    EAARRACVDPAPIIDGRQANCNLASLGARAPRP  108



>ref|XP_011025379.1| PREDICTED: RNA-binding protein 24-B isoform X2 [Populus euphratica]
Length=261

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQ+ DTT+TK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DP
Sbjct  16    GQYNDTTFTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDP  75

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPN  967
             +AAM+AC + +PVIDGRRANCNLASLG Q+++P TP 
Sbjct  76    DAAMKACQNPSPVIDGRRANCNLASLGAQKTRPPTPQ  112



>ref|XP_008233052.1| PREDICTED: RNA-binding protein 24-B [Prunus mume]
Length=290

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQ+ DTT+TK+FVGGLAWET ++TM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+D 
Sbjct  18    GQYNDTTFTKIFVGGLAWETQRETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDS  77

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKH  961
             EAAMRAC + +PVIDGRRANCNLASLG Q+++P TP++ 
Sbjct  78    EAAMRACQNPSPVIDGRRANCNLASLGAQKTRPQTPHQQ  116



>ref|XP_002267504.2| PREDICTED: RNA-binding protein 38 isoform X2 [Vitis vinifera]
 emb|CBI38707.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQF DTTYTK+FVGGLAWET +DTM+ YFEQFGEI EAVVITDK T RSKGYGFVTF+DP
Sbjct  8     GQFNDTTYTKIFVGGLAWETQRDTMRRYFEQFGEIQEAVVITDKNTGRSKGYGFVTFKDP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             +AAMRAC + +PVIDGRRANCNLASLG  +++P TP
Sbjct  68    DAAMRACQNPSPVIDGRRANCNLASLGAHKTRPPTP  103



>ref|XP_007220153.1| hypothetical protein PRUPE_ppa018603mg, partial [Prunus persica]
 gb|EMJ21352.1| hypothetical protein PRUPE_ppa018603mg, partial [Prunus persica]
Length=122

 Score =   164 bits (415),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDT++TK+FVGGL WET +DTMK YFEQFGEILEAVVITDK TARSKGYGFVTF+DPE
Sbjct  22    QFGDTSHTKIFVGGLPWETQRDTMKRYFEQFGEILEAVVITDKITARSKGYGFVTFKDPE  81

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKH  961
             AA RAC +  P+IDGRRANCNLA+LG Q++  +TP  H
Sbjct  82    AAGRACENPNPIIDGRRANCNLAALGAQKNHSATPQPH  119



>ref|NP_973958.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AAK63994.1| At1g33470/F10C21_14 [Arabidopsis thaliana]
 gb|AAL76151.1| At1g33470/F10C21_14 [Arabidopsis thaliana]
 gb|AEE31597.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=244

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 142/246 (58%), Positives = 163/246 (66%), Gaps = 19/246 (8%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWETHK +++NYFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  3     DTTFTKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  62

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaaaa  886
             +ACVD APVIDGRRANCNLA+ GVQRSKPS+P    G  GGR   V S F+  FG AA A
Sbjct  63    KACVDPAPVIDGRRANCNLAAFGVQRSKPSSPIH--GHVGGRGMKVTSPFKTHFGTAATA  120

Query  885   fpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasgllsg  706
              PSP  FSHY +    P+     SSYS DY YPT YY+VYGG T Q PMYG+        
Sbjct  121   IPSPLPFSHYTLPYTNPFGF---SSYSMDYNYPTSYYNVYGGATAQHPMYGS-GPMTGVA  176

Query  705   aaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYPAQHFA  526
             AA AA FYPYL F                 GY  + YP+H+F YSA       YP  H  
Sbjct  177   AAPAAGFYPYLQF---------AEGNGPVTGYAPLHYPNHMFHYSA---PGGNYP-HHNG  223

Query  525   NPISLA  508
             +P+SLA
Sbjct  224   SPVSLA  229



>ref|XP_010661490.1| PREDICTED: RNA-binding protein 38 isoform X1 [Vitis vinifera]
 ref|XP_010661491.1| PREDICTED: RNA-binding protein 38 isoform X1 [Vitis vinifera]
Length=275

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQF DTTYTK+FVGGLAWET +DTM+ YFEQFGEI EAVVITDK T RSKGYGFVTF+DP
Sbjct  16    GQFNDTTYTKIFVGGLAWETQRDTMRRYFEQFGEIQEAVVITDKNTGRSKGYGFVTFKDP  75

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPN  967
             +AAMRAC + +PVIDGRRANCNLASLG  +++P TP 
Sbjct  76    DAAMRACQNPSPVIDGRRANCNLASLGAHKTRPPTPQ  112



>ref|NP_174613.2| RNA recognition motif-containing protein [Arabidopsis thaliana]
 dbj|BAD44161.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31596.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=245

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 155/246 (63%), Gaps = 18/246 (7%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWETHK +++NYFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  3     DTTFTKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  62

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaaaa  886
             +ACVD APVIDGRRANCNLA+ GVQRSKPS+P    G  GGR   V S F+  FG AA A
Sbjct  63    KACVDPAPVIDGRRANCNLAAFGVQRSKPSSPIH--GHVGGRGMKVTSPFKTHFGTAATA  120

Query  885   fpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasgllsg  706
              PSP  FSHY +    P+     S           YY+VYGG T Q PMYG+        
Sbjct  121   IPSPLPFSHYTLPYTNPFGF--SSYSMDYNYPTQSYYNVYGGATAQHPMYGS-GPMTGVA  177

Query  705   aaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYPAQHFA  526
             AA AA FYPYL F                 GY  + YP+H+F YSA       YP  H  
Sbjct  178   AAPAAGFYPYLQF---------AEGNGPVTGYAPLHYPNHMFHYSA---PGGNYP-HHNG  224

Query  525   NPISLA  508
             +P+SLA
Sbjct  225   SPVSLA  230



>ref|XP_007221059.1| hypothetical protein PRUPE_ppa016222mg [Prunus persica]
 gb|EMJ22258.1| hypothetical protein PRUPE_ppa016222mg [Prunus persica]
Length=286

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQ+ DTT+TK+FVGGLAWET ++TM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+D 
Sbjct  18    GQYNDTTFTKIFVGGLAWETQRETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDS  77

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKH  961
             EAAMRAC + +PVIDGRRANCNLASLG Q+++P TP++ 
Sbjct  78    EAAMRACQNPSPVIDGRRANCNLASLGAQKTRPPTPHQQ  116



>ref|XP_011025377.1| PREDICTED: RNA-binding protein 24-B isoform X1 [Populus euphratica]
Length=293

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQ+ DTT+TK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DP
Sbjct  16    GQYNDTTFTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDP  75

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPN  967
             +AAM+AC + +PVIDGRRANCNLASLG Q+++P TP 
Sbjct  76    DAAMKACQNPSPVIDGRRANCNLASLGAQKTRPPTPQ  112



>ref|XP_010267393.1| PREDICTED: RNA-binding protein 38-like isoform X3 [Nelumbo nucifera]
Length=275

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTT+TK+FVGGLAWET ++TM+ YFEQFGEI EAVVITDK T +SKGYGFVTF+DP
Sbjct  16    GQFGDTTFTKIFVGGLAWETQRETMRRYFEQFGEIQEAVVITDKNTGKSKGYGFVTFKDP  75

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPST  973
             +AAMRAC D +PVIDGRRANCNLASLG  R+ PST
Sbjct  76    DAAMRACQDPSPVIDGRRANCNLASLGAHRNHPST  110



>ref|XP_010267392.1| PREDICTED: RNA-binding protein 38-like isoform X2 [Nelumbo nucifera]
Length=277

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTT+TK+FVGGLAWET ++TM+ YFEQFGEI EAVVITDK T +SKGYGFVTF+DP
Sbjct  16    GQFGDTTFTKIFVGGLAWETQRETMRRYFEQFGEIQEAVVITDKNTGKSKGYGFVTFKDP  75

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPST  973
             +AAMRAC D +PVIDGRRANCNLASLG  R+ PST
Sbjct  76    DAAMRACQDPSPVIDGRRANCNLASLGAHRNHPST  110



>ref|XP_010267391.1| PREDICTED: RNA-binding protein 38-like isoform X1 [Nelumbo nucifera]
Length=281

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTT+TK+FVGGLAWET ++TM+ YFEQFGEI EAVVITDK T +SKGYGFVTF+DP
Sbjct  16    GQFGDTTFTKIFVGGLAWETQRETMRRYFEQFGEIQEAVVITDKNTGKSKGYGFVTFKDP  75

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPST  973
             +AAMRAC D +PVIDGRRANCNLASLG  R+ PST
Sbjct  76    DAAMRACQDPSPVIDGRRANCNLASLGAHRNHPST  110



>ref|XP_002891043.1| RNA recognition motif-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH67302.1| RNA recognition motif-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=246

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 156/246 (63%), Gaps = 17/246 (7%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWETHK +++NYFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  3     DTTFTKVFVGGLAWETHKISLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  62

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfggaaaa  886
             +ACVD APVIDGRRANCNLA+ GVQRSKPS+P  HG  GG     V S F+  FG AAAA
Sbjct  63    KACVDPAPVIDGRRANCNLAAFGVQRSKPSSP-IHGHAGGRGGMKVTSPFKTHFGAAAAA  121

Query  885   fpspsnfSHYAIQQGIPYNLygyssyspdytyptgyysvyggvtGQFPMYGTgasgllsg  706
              PSP  FSHY +    P+     S           YY+VYGG T Q PMYG+        
Sbjct  122   IPSPLPFSHYTLPYTNPFGF--SSYSMDYNYPTQSYYNVYGGATAQHPMYGS-GPMTGVA  178

Query  705   aaaaaAFYPYLNFgegnggattgytaaasqgygGVQYPHHLFPYSATVNTTAGYPAQHFA  526
             AA AA FYPYL F                 GY  + YP+H+F YSA       YP  H  
Sbjct  179   AATAAGFYPYLQF---------AEGNGPITGYAPLHYPNHMFHYSA---PGGNYP-HHNG  225

Query  525   NPISLA  508
             +P+SLA
Sbjct  226   SPVSLA  231



>ref|XP_010107154.1| RNA-binding protein 38 [Morus notabilis]
 gb|EXC13675.1| RNA-binding protein 38 [Morus notabilis]
Length=259

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQ+ DTT+TK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DP
Sbjct  16    GQYNDTTFTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDP  75

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             +AAMRAC + +PVIDGRRANCNLASLG  + +P TP
Sbjct  76    DAAMRACQNPSPVIDGRRANCNLASLGAHKPRPPTP  111



>ref|XP_010267394.1| PREDICTED: RNA-binding protein 38-like isoform X4 [Nelumbo nucifera]
Length=273

 Score =   168 bits (425),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQFGDTT+TK+FVGGLAWET ++TM+ YFEQFGEI EAVVITDK T +SKGYGFVTF+DP
Sbjct  8     GQFGDTTFTKIFVGGLAWETQRETMRRYFEQFGEIQEAVVITDKNTGKSKGYGFVTFKDP  67

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPST  973
             +AAMRAC D +PVIDGRRANCNLASLG  R+ PST
Sbjct  68    DAAMRACQDPSPVIDGRRANCNLASLGAHRNHPST  102



>ref|XP_008353173.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 38-like [Malus 
domestica]
Length=292

 Score =   169 bits (427),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQ+ DTT+TK+FVGGLAWET ++TM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DP
Sbjct  20    GQYNDTTFTKIFVGGLAWETQRETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDP  79

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPST  973
             EAAMRAC + +PVIDGRRANCNLASLG Q+++P T
Sbjct  80    EAAMRACQNPSPVIDGRRANCNLASLGAQKTRPPT  114



>ref|XP_002320228.2| hypothetical protein POPTR_0014s10090g [Populus trichocarpa]
 gb|EEE98543.2| hypothetical protein POPTR_0014s10090g [Populus trichocarpa]
Length=294

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             Q+ DTTYTK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DPE
Sbjct  18    QYNDTTYTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDPE  77

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             AA+RAC + +PVIDGRRANCNLASLG Q+++P TP
Sbjct  78    AAVRACQNPSPVIDGRRANCNLASLGGQKNRPPTP  112



>gb|EAZ14898.1| hypothetical protein OsJ_04828 [Oryza sativa Japonica Group]
Length=151

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 99/144 (69%), Gaps = 9/144 (6%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTT TKVFVGGLAWET K+ M+ YFEQFG+ILEAVVITDK T RSKGYGFVTFR+PE
Sbjct  14    QFGDTTLTKVFVGGLAWETQKEGMRGYFEQFGDILEAVVITDKNTGRSKGYGFVTFREPE  73

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKHgggggGRNFMVMsafqggfgga  895
             AAM+AC D  PVIDGRRANCNLA LGVQRSK +  +     G  R    +          
Sbjct  74    AAMKACFDPYPVIDGRRANCNLAYLGVQRSKAAAASLQPYAGHMRAMKSI--------IQ  125

Query  894   aaafpspsnfSHYAIQQGIP-YNL  826
                  +  + + + IQQGIP YN+
Sbjct  126   TGGGGASLSMADHGIQQGIPTYNV  149



>ref|XP_007135311.1| hypothetical protein PHAVU_010G118600g [Phaseolus vulgaris]
 gb|ESW07305.1| hypothetical protein PHAVU_010G118600g [Phaseolus vulgaris]
Length=297

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             Q+ DTT+TK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDPE
Sbjct  17    QYNDTTFTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPE  76

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPST  973
             AAMRAC + +PVIDGRRANCNLASLG  +++P+T
Sbjct  77    AAMRACQNPSPVIDGRRANCNLASLGANKNRPAT  110



>ref|XP_007135310.1| hypothetical protein PHAVU_010G118600g [Phaseolus vulgaris]
 gb|ESW07304.1| hypothetical protein PHAVU_010G118600g [Phaseolus vulgaris]
Length=295

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             Q+ DTT+TK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDPE
Sbjct  17    QYNDTTFTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPE  76

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPST  973
             AAMRAC + +PVIDGRRANCNLASLG  +++P+T
Sbjct  77    AAMRACQNPSPVIDGRRANCNLASLGANKNRPAT  110



>ref|XP_006444735.1| hypothetical protein CICLE_v10021586mg [Citrus clementina]
 ref|XP_006491361.1| PREDICTED: RNA-binding protein 24-like [Citrus sinensis]
 gb|ESR57975.1| hypothetical protein CICLE_v10021586mg [Citrus clementina]
 gb|KDO86600.1| hypothetical protein CISIN_1g023688mg [Citrus sinensis]
Length=278

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             G + DTT+TK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DP
Sbjct  16    GDYNDTTFTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDP  75

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             EAAMRAC + +PVIDGRRANCNLASLG  +++P TP
Sbjct  76    EAAMRACQNPSPVIDGRRANCNLASLGAHKTRPPTP  111



>ref|XP_010662927.1| PREDICTED: RNA-binding protein 24, partial [Vitis vinifera]
Length=274

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTK+FVGGLAWETH++T+K YFEQFGEILEAVVITDK + +SKGYGFVTF+DP+
Sbjct  22    QFGDTTYTKIFVGGLAWETHRETLKRYFEQFGEILEAVVITDKVSGKSKGYGFVTFKDPD  81

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKP  979
             +AMRAC D +PVIDGRRANCN+ASLG  +++P
Sbjct  82    SAMRACQDPSPVIDGRRANCNIASLGAHKTRP  113



>gb|KDP28419.1| hypothetical protein JCGZ_14190 [Jatropha curcas]
Length=296

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQ+ DTT+TK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DP
Sbjct  22    GQYNDTTFTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDP  81

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             ++AMRAC + +PVIDGRRANCNLASLG  +++P TP
Sbjct  82    DSAMRACQNPSPVIDGRRANCNLASLGAHKTRPPTP  117



>ref|XP_004306619.1| PREDICTED: uncharacterized protein LOC101297372 [Fragaria vesca 
subsp. vesca]
Length=283

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             Q+ DTT+TK+FVGGLAWET ++TM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DPE
Sbjct  22    QYNDTTFTKIFVGGLAWETQRETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDPE  81

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPST  973
             AAMRAC + +PVIDGRRANCNLASLG Q+++P T
Sbjct  82    AAMRACQNPSPVIDGRRANCNLASLGAQKTRPPT  115



>gb|ABK93394.1| unknown [Populus trichocarpa]
Length=294

 Score =   167 bits (422),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             Q+ DTTYTK+FVGGLAWET +D M+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DPE
Sbjct  18    QYNDTTYTKIFVGGLAWETQRDAMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDPE  77

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             AA+RAC + +PVIDGRRANCNLASLG Q+++P TP
Sbjct  78    AAVRACQNPSPVIDGRRANCNLASLGGQKNRPPTP  112



>gb|KHG03974.1| RNA-binding 38 [Gossypium arboreum]
Length=329

 Score =   167 bits (423),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 87/99 (88%), Gaps = 2/99 (2%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQ+ DTT+TK+FVGGLAWET +DTMK YFEQFGEI+EAVVITDK T RSKGYGFVTF+DP
Sbjct  32    GQYNDTTFTKIFVGGLAWETQRDTMKRYFEQFGEIIEAVVITDKNTGRSKGYGFVTFKDP  91

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKH  961
             +AAMRAC + +P IDGRRANCNLASLG Q+++P  P +H
Sbjct  92    DAAMRACQNPSPTIDGRRANCNLASLGAQKTRP--PPQH  128



>ref|XP_011039250.1| PREDICTED: RNA-binding protein 24-B-like isoform X2 [Populus 
euphratica]
Length=298

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             + DTT+TK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DPEA
Sbjct  19    YNDTTFTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFQDPEA  78

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             A+RAC + +PVIDGRRANCNLASLG QR++P TP
Sbjct  79    AVRACQNPSPVIDGRRANCNLASLGGQRNRPPTP  112



>ref|XP_011039241.1| PREDICTED: RNA-binding protein 24-B-like isoform X1 [Populus 
euphratica]
Length=299

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             + DTT+TK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DPEA
Sbjct  19    YNDTTFTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFQDPEA  78

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             A+RAC + +PVIDGRRANCNLASLG QR++P TP
Sbjct  79    AVRACQNPSPVIDGRRANCNLASLGGQRNRPPTP  112



>ref|XP_006849958.1| hypothetical protein AMTR_s00022p00143970 [Amborella trichopoda]
 gb|ERN11539.1| hypothetical protein AMTR_s00022p00143970 [Amborella trichopoda]
Length=296

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 82/94 (87%), Gaps = 2/94 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTT+TKVFVGGLAWET  DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDPEA
Sbjct  35    FGDTTFTKVFVGGLAWETQSDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPEA  94

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             A RAC D +P+IDGRRANCNLASLG  R +PS P
Sbjct  95    ARRACADPSPIIDGRRANCNLASLG--RPRPSPP  126



>ref|XP_002515069.1| RNA-binding region-containing protein, putative [Ricinus communis]
 gb|EEF47053.1| RNA-binding region-containing protein, putative [Ricinus communis]
Length=291

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQ+ DTT+TK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DP
Sbjct  16    GQYNDTTFTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDP  75

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPN  967
             EAA+RAC + +PVIDGRRANCNLASLG  +++  TP 
Sbjct  76    EAAIRACQNPSPVIDGRRANCNLASLGAHKTRSPTPQ  112



>ref|XP_010094513.1| RNA-binding protein 24 [Morus notabilis]
 gb|EXB56267.1| RNA-binding protein 24 [Morus notabilis]
Length=286

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 81/94 (86%), Gaps = 2/94 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET  DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTFR+PEA
Sbjct  29    FGDTTYTKVFVGGLAWETQSDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFREPEA  88

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             A RAC D APVIDGRRANCNLASLG  R +P  P
Sbjct  89    ARRACADPAPVIDGRRANCNLASLG--RPRPPMP  120



>ref|XP_006645362.1| PREDICTED: RNA-binding protein 24-like [Oryza brachyantha]
Length=303

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTT TKVFVGGLAWET K+ M+ YFEQFG+ILEAVVITDK T RSKGYGFVTFR+PE
Sbjct  13    QFGDTTLTKVFVGGLAWETQKEGMRGYFEQFGDILEAVVITDKNTGRSKGYGFVTFREPE  72

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSK  982
             AAM+AC D  PVIDGRRANCNLA LGVQRSK
Sbjct  73    AAMKACFDPYPVIDGRRANCNLAYLGVQRSK  103



>ref|NP_001045454.1| Os01g0958500 [Oryza sativa Japonica Group]
 dbj|BAD88161.1| RNA recognition motif (RRM)-containing protein-like [Oryza sativa 
Japonica Group]
 dbj|BAD87112.1| RNA recognition motif (RRM)-containing protein-like [Oryza sativa 
Japonica Group]
 dbj|BAF07368.1| Os01g0958500 [Oryza sativa Japonica Group]
 dbj|BAG93219.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72199.1| hypothetical protein OsI_05278 [Oryza sativa Indica Group]
Length=310

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTT TKVFVGGLAWET K+ M+ YFEQFG+ILEAVVITDK T RSKGYGFVTFR+PE
Sbjct  14    QFGDTTLTKVFVGGLAWETQKEGMRGYFEQFGDILEAVVITDKNTGRSKGYGFVTFREPE  73

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSK  982
             AAM+AC D  PVIDGRRANCNLA LGVQRSK
Sbjct  74    AAMKACFDPYPVIDGRRANCNLAYLGVQRSK  104



>gb|KHN06357.1| RNA-binding protein 38 [Glycine soja]
Length=296

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             Q+ DTT+TK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DPE
Sbjct  17    QYNDTTFTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDPE  76

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPST  973
             +AMRAC + +PVIDGRRANCNLASLG  +++P T
Sbjct  77    SAMRACQNPSPVIDGRRANCNLASLGASKNRPPT  110



>ref|XP_003529876.1| PREDICTED: RNA-binding protein 24-B-like [Glycine max]
Length=296

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             Q+ DTT+TK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DPE
Sbjct  17    QYNDTTFTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDPE  76

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPST  973
             +AMRAC + +PVIDGRRANCNLASLG  +++P T
Sbjct  77    SAMRACQNPSPVIDGRRANCNLASLGASKNRPPT  110



>ref|XP_001761857.1| predicted protein [Physcomitrella patens]
 gb|EDQ73298.1| predicted protein [Physcomitrella patens]
Length=89

 Score =   158 bits (400),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTTYTKVFVGGLAWET +DTM+ +FEQFG+ILEAVVITDK T RSKGYGFVTFRD E+A 
Sbjct  1     DTTYTKVFVGGLAWETQRDTMRRHFEQFGDILEAVVITDKNTGRSKGYGFVTFRDAESAR  60

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKP  979
             +ACVDA P+IDGRRANCNLASLG  R +P
Sbjct  61    KACVDATPIIDGRRANCNLASLGAHRHRP  89



>ref|XP_010686592.1| PREDICTED: RNA-binding protein 38 isoform X3 [Beta vulgaris subsp. 
vulgaris]
Length=228

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTKVFVGGLAWET  +TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDPE
Sbjct  26    QFGDTTYTKVFVGGLAWETQSETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPE  85

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKH  961
             AA RAC D  P+IDGRRANCNLASLG  R +P+    H
Sbjct  86    AARRACADPTPIIDGRRANCNLASLG--RPRPALSFGH  121



>ref|XP_006598882.1| PREDICTED: RNA-binding protein 24-A-like isoform X3 [Glycine 
max]
Length=297

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             Q+ DTT+TK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DPE
Sbjct  17    QYNDTTFTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDPE  76

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPST  973
             +AMRAC + +PVIDGRRANCNLASLG  +++P T
Sbjct  77    SAMRACQNPSPVIDGRRANCNLASLGASKNRPPT  110



>ref|XP_010664012.1| PREDICTED: RNA-binding protein 24-A isoform X1 [Vitis vinifera]
 ref|XP_010664014.1| PREDICTED: RNA-binding protein 24-A isoform X1 [Vitis vinifera]
Length=285

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 82/92 (89%), Gaps = 2/92 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET  +TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDPE+
Sbjct  26    FGDTTYTKVFVGGLAWETQSETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPES  85

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPS  976
             A RAC+D AP+IDGRRANCNLASLG  R +PS
Sbjct  86    ARRACLDPAPIIDGRRANCNLASLG--RPRPS  115



>ref|XP_009366606.1| PREDICTED: RNA-binding protein 24-B isoform X2 [Pyrus x bretschneideri]
Length=283

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQ+ DTT+TK+FVGGLAWET ++TM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DP
Sbjct  12    GQYNDTTFTKIFVGGLAWETQRETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDP  71

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             EAA+RAC + +PVIDGRRANCNLA LG Q+++P  P
Sbjct  72    EAAVRACQNPSPVIDGRRANCNLAFLGAQKTRPPIP  107



>emb|CDY31508.1| BnaC05g16170D [Brassica napus]
Length=250

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWETH DT++ +FE FG+ILEAVVITDK T RSKGYGFVTFRDPEA
Sbjct  10    FGDTTYTKVFVGGLAWETHSDTLRRHFEPFGDILEAVVITDKNTGRSKGYGFVTFRDPEA  69

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQR  988
             A RACVDA P+IDGRRANCNLASLG  R
Sbjct  70    ARRACVDATPIIDGRRANCNLASLGRPR  97



>ref|XP_009366605.1| PREDICTED: RNA-binding protein 24-B isoform X1 [Pyrus x bretschneideri]
Length=293

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQ+ DTT+TK+FVGGLAWET ++TM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DP
Sbjct  20    GQYNDTTFTKIFVGGLAWETQRETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDP  79

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             EAA+RAC + +PVIDGRRANCNLA LG Q+++P  P
Sbjct  80    EAAVRACQNPSPVIDGRRANCNLAFLGAQKTRPPIP  115



>ref|XP_002456962.1| hypothetical protein SORBIDRAFT_03g046430 [Sorghum bicolor]
 gb|EES02082.1| hypothetical protein SORBIDRAFT_03g046430 [Sorghum bicolor]
Length=334

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTT+TKVFVGGLAWETHK+ M+ YF+QFG+ILEAVVITDK T RSKGYGFVTFR+PE
Sbjct  15    QFGDTTFTKVFVGGLAWETHKEGMRAYFQQFGDILEAVVITDKNTGRSKGYGFVTFREPE  74

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSK  982
             AA+RAC+D  PVIDGRRANCNLA LGV +SK
Sbjct  75    AALRACIDPYPVIDGRRANCNLAYLGVNKSK  105



>ref|XP_006598881.1| PREDICTED: RNA-binding protein 24-A-like isoform X2 [Glycine 
max]
Length=299

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             Q+ DTT+TK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DPE
Sbjct  17    QYNDTTFTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDPE  76

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPST  973
             +AMRAC + +PVIDGRRANCNLASLG  +++P T
Sbjct  77    SAMRACQNPSPVIDGRRANCNLASLGASKNRPPT  110



>ref|XP_006598880.1| PREDICTED: RNA-binding protein 24-A-like isoform X1 [Glycine 
max]
Length=301

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             Q+ DTT+TK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DPE
Sbjct  17    QYNDTTFTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDPE  76

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPST  973
             +AMRAC + +PVIDGRRANCNLASLG  +++P T
Sbjct  77    SAMRACQNPSPVIDGRRANCNLASLGASKNRPPT  110



>ref|XP_010917972.1| PREDICTED: RNA-binding protein 24-like [Elaeis guineensis]
Length=281

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTTYTK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DP++AM
Sbjct  21    DTTYTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDPDSAM  80

Query  1065  RACVDAAPVIDGRRANCNLASLGV-QRSKPSTP  970
             RAC D +PVIDGRRANCNLASLG   R++P TP
Sbjct  81    RACQDPSPVIDGRRANCNLASLGASHRTRPPTP  113



>ref|XP_010686584.1| PREDICTED: RNA-binding protein 24 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=280

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTKVFVGGLAWET  +TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDPE
Sbjct  26    QFGDTTYTKVFVGGLAWETQSETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPE  85

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQR  988
             AA RAC D  P+IDGRRANCNLASLG  R
Sbjct  86    AARRACADPTPIIDGRRANCNLASLGRPR  114



>ref|XP_010686576.1| PREDICTED: RNA-binding protein 24 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=287

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTTYTKVFVGGLAWET  +TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDPE
Sbjct  26    QFGDTTYTKVFVGGLAWETQSETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPE  85

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQR  988
             AA RAC D  P+IDGRRANCNLASLG  R
Sbjct  86    AARRACADPTPIIDGRRANCNLASLGRPR  114



>ref|XP_007135985.1| hypothetical protein PHAVU_009G008600g [Phaseolus vulgaris]
 gb|ESW07979.1| hypothetical protein PHAVU_009G008600g [Phaseolus vulgaris]
Length=283

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 80/94 (85%), Gaps = 2/94 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET  +TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDPEA
Sbjct  26    FGDTTYTKVFVGGLAWETQSETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPEA  85

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             A RAC D  PVIDGRRANCNLASLG  R +P  P
Sbjct  86    ARRACADPTPVIDGRRANCNLASLG--RPRPPLP  117



>ref|XP_009151473.1| PREDICTED: RNA-binding protein 38 isoform X3 [Brassica rapa]
Length=242

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWET+K ++++YFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  3     DTTFTKVFVGGLAWETNKVSLRSYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  62

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             +AC+D APVIDGRRANCNLA+ GVQRSKPS+P
Sbjct  63    KACIDPAPVIDGRRANCNLAAFGVQRSKPSSP  94



>ref|XP_007018664.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 2 [Theobroma 
cacao]
 gb|EOY15889.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 2 [Theobroma 
cacao]
Length=284

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 80/94 (85%), Gaps = 2/94 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET  +TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDPEA
Sbjct  26    FGDTTYTKVFVGGLAWETQSETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPEA  85

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             A RAC D  P+IDGRRANCNLASLG  R +P  P
Sbjct  86    ARRACADPTPIIDGRRANCNLASLG--RPRPPVP  117



>emb|CDX73279.1| BnaC05g28270D [Brassica napus]
Length=242

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWET+K ++++YFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  3     DTTFTKVFVGGLAWETNKVSLRSYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  62

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             +AC+D APVIDGRRANCNLA+ GVQRSKPS+P
Sbjct  63    KACIDPAPVIDGRRANCNLAAFGVQRSKPSSP  94



>ref|XP_009151472.1| PREDICTED: RNA-binding protein 24-A isoform X2 [Brassica rapa]
Length=261

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWET+K ++++YFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  3     DTTFTKVFVGGLAWETNKVSLRSYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  62

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             +AC+D APVIDGRRANCNLA+ GVQRSKPS+P
Sbjct  63    KACIDPAPVIDGRRANCNLAAFGVQRSKPSSP  94



>ref|XP_009151471.1| PREDICTED: RNA-binding protein 24-A isoform X1 [Brassica rapa]
Length=265

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWET+K ++++YFEQFG+I+EAVVITDK++ RSKGYGFVTF DPEAA 
Sbjct  3     DTTFTKVFVGGLAWETNKVSLRSYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQ  62

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             +AC+D APVIDGRRANCNLA+ GVQRSKPS+P
Sbjct  63    KACIDPAPVIDGRRANCNLAAFGVQRSKPSSP  94



>ref|XP_003522980.1| PREDICTED: RNA-binding protein 24-A-like [Glycine max]
 gb|KHN33768.1| RNA-binding protein 24 [Glycine soja]
Length=286

 Score =   163 bits (413),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 81/94 (86%), Gaps = 2/94 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET  +TM+ YF+QFGEILEAVVITDK T RSKGYGFVTFRDPEA
Sbjct  26    FGDTTYTKVFVGGLAWETQSETMRRYFDQFGEILEAVVITDKNTGRSKGYGFVTFRDPEA  85

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             A RAC D +PVIDGRRANCNLASLG  R +P  P
Sbjct  86    ARRACADPSPVIDGRRANCNLASLG--RPRPPLP  117



>ref|XP_008376809.1| PREDICTED: RNA-binding protein 38-like [Malus domestica]
 ref|XP_008347263.1| PREDICTED: RNA-binding protein 38-like [Malus domestica]
Length=233

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTT TK+FVGGL WET   TM+ YFEQFGEILEAVVITDK TARSKGYGFVTF+DPE
Sbjct  13    QFGDTTKTKIFVGGLPWETRVGTMRRYFEQFGEILEAVVITDKFTARSKGYGFVTFKDPE  72

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             +AMRAC +  P+IDGRRANCNLA LG Q+++P+TP
Sbjct  73    SAMRACENPNPIIDGRRANCNLAVLGAQKNRPTTP  107



>ref|XP_008376224.1| PREDICTED: RNA-binding protein 24-B [Malus domestica]
Length=293

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQ+ DTT+TK+FVGGLAWET ++TM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DP
Sbjct  20    GQYNDTTFTKIFVGGLAWETQRETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDP  79

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKP  979
             EAA+RAC + +PVIDGRRANCNLA LG Q+++P
Sbjct  80    EAAVRACQNPSPVIDGRRANCNLAFLGAQKTRP  112



>ref|XP_010664015.1| PREDICTED: deleted in azoospermia-like isoform X2 [Vitis vinifera]
 emb|CBI40768.3| unnamed protein product [Vitis vinifera]
Length=275

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 82/92 (89%), Gaps = 2/92 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET  +TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDPE+
Sbjct  26    FGDTTYTKVFVGGLAWETQSETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPES  85

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPS  976
             A RAC+D AP+IDGRRANCNLASLG  R +PS
Sbjct  86    ARRACLDPAPIIDGRRANCNLASLG--RPRPS  115



>gb|KHN15892.1| RNA-binding protein 38 [Glycine soja]
Length=301

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             Q+ DTT+TK+FVGGLAWET +DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DPE
Sbjct  17    QYNDTTFTKIFVGGLAWETQRDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDPE  76

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPST  973
             +AMRAC +  PVIDGRRANCNLASLG  +++P T
Sbjct  77    SAMRACQNPFPVIDGRRANCNLASLGASKNRPPT  110



>ref|XP_006581126.1| PREDICTED: RNA-binding protein 24-B-like isoform X2 [Glycine 
max]
Length=276

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 80/94 (85%), Gaps = 2/94 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET  +TM+ YF+QFGEILEAVVITDK T RSKGYGFVTFRDPEA
Sbjct  26    FGDTTYTKVFVGGLAWETQSETMRRYFDQFGEILEAVVITDKNTGRSKGYGFVTFRDPEA  85

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             A RAC D  PVIDGRRANCNLASLG  R +P  P
Sbjct  86    ARRACADPTPVIDGRRANCNLASLG--RPRPPLP  117



>ref|XP_004500827.1| PREDICTED: RNA-binding protein 24-A-like [Cicer arietinum]
Length=290

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 81/94 (86%), Gaps = 2/94 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET  +TM+ YFEQFG+ILEAVVITDK T RSKGYGFVTFRDPEA
Sbjct  26    FGDTTYTKVFVGGLAWETQSETMRRYFEQFGDILEAVVITDKNTGRSKGYGFVTFRDPEA  85

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             A RAC D +PVIDGRRANCNLASLG  R +P  P
Sbjct  86    ARRACADPSPVIDGRRANCNLASLG--RPRPPLP  117



>emb|CDP07254.1| unnamed protein product [Coffea canephora]
Length=292

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 81/94 (86%), Gaps = 2/94 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTT+TKVFVGGLAWET  DTM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDPE+
Sbjct  33    FGDTTFTKVFVGGLAWETQSDTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPES  92

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             A RAC D  P+IDGRRANCNLASLG  R +P+ P
Sbjct  93    ARRACADPTPIIDGRRANCNLASLG--RPRPALP  124



>emb|CDY29496.1| BnaA06g14740D [Brassica napus]
Length=261

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET  DT++ +FE FG+ILEAVVITDK TARSKGYGFVTFRDPEA
Sbjct  18    FGDTTYTKVFVGGLAWETQSDTLRRHFEPFGDILEAVVITDKNTARSKGYGFVTFRDPEA  77

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQR  988
             A RACVDA P+IDGRRANCNLASLG  R
Sbjct  78    ARRACVDATPIIDGRRANCNLASLGRPR  105



>ref|XP_009361289.1| PREDICTED: RNA-binding protein 38-like [Pyrus x bretschneideri]
Length=232

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDTT TK+FVGGL W+T  DTM+ YFEQFGEILEAVVITDK TARSKGYGFVTF+DPE
Sbjct  13    QFGDTTKTKIFVGGLPWQTRVDTMRRYFEQFGEILEAVVITDKFTARSKGYGFVTFKDPE  72

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             +A+RAC +  P+IDGRRANCNLA LG Q+++P+TP
Sbjct  73    SAVRACENPNPIIDGRRANCNLAVLGAQKNRPTTP  107



>ref|XP_008791369.1| PREDICTED: RNA-binding protein 24-B-like isoform X2 [Phoenix 
dactylifera]
 ref|XP_008777965.1| PREDICTED: RNA-binding protein 24-B-like isoform X2 [Phoenix 
dactylifera]
Length=254

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 83/95 (87%), Gaps = 1/95 (1%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTTYTK+FVGGLAWET +DTM  YF+QFGEILEAVVITDK T RSKGYGFVTF+DP++AM
Sbjct  21    DTTYTKIFVGGLAWETQRDTMHRYFQQFGEILEAVVITDKNTGRSKGYGFVTFKDPDSAM  80

Query  1065  RACVDAAPVIDGRRANCNLASLGV-QRSKPSTPNK  964
             RAC D +PVIDGRRANCNLASLG   R++P TP +
Sbjct  81    RACQDPSPVIDGRRANCNLASLGASHRTRPPTPRR  115



>ref|XP_006581125.1| PREDICTED: RNA-binding protein 24-B-like isoform X1 [Glycine 
max]
Length=286

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 80/94 (85%), Gaps = 2/94 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET  +TM+ YF+QFGEILEAVVITDK T RSKGYGFVTFRDPEA
Sbjct  26    FGDTTYTKVFVGGLAWETQSETMRRYFDQFGEILEAVVITDKNTGRSKGYGFVTFRDPEA  85

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             A RAC D  PVIDGRRANCNLASLG  R +P  P
Sbjct  86    ARRACADPTPVIDGRRANCNLASLG--RPRPPLP  117



>ref|XP_009782742.1| PREDICTED: RNA-binding protein 38 [Nicotiana sylvestris]
Length=282

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 83/94 (88%), Gaps = 2/94 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTT+TKVFVGGLAWET  +T++ YFEQFG+ILEAVVITDK TARSKGYGFVTFRDPE+
Sbjct  23    FGDTTFTKVFVGGLAWETQSETLRRYFEQFGDILEAVVITDKNTARSKGYGFVTFRDPES  82

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             A RAC D AP+IDGRRANCNLASLG  R +P+ P
Sbjct  83    ARRACADPAPIIDGRRANCNLASLG--RPRPTVP  114



>ref|XP_008791368.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Phoenix dactylifera]
 ref|XP_008777964.1| PREDICTED: RNA-binding protein 24-like isoform X1 [Phoenix dactylifera]
Length=278

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 83/95 (87%), Gaps = 1/95 (1%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTTYTK+FVGGLAWET +DTM  YF+QFGEILEAVVITDK T RSKGYGFVTF+DP++AM
Sbjct  21    DTTYTKIFVGGLAWETQRDTMHRYFQQFGEILEAVVITDKNTGRSKGYGFVTFKDPDSAM  80

Query  1065  RACVDAAPVIDGRRANCNLASLGV-QRSKPSTPNK  964
             RAC D +PVIDGRRANCNLASLG   R++P TP +
Sbjct  81    RACQDPSPVIDGRRANCNLASLGASHRTRPPTPRR  115



>ref|XP_007018663.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY15888.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=319

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 80/94 (85%), Gaps = 2/94 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET  +TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDPEA
Sbjct  26    FGDTTYTKVFVGGLAWETQSETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPEA  85

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             A RAC D  P+IDGRRANCNLASLG  R +P  P
Sbjct  86    ARRACADPTPIIDGRRANCNLASLG--RPRPPVP  117



>ref|XP_004140591.1| PREDICTED: uncharacterized protein LOC101210354 [Cucumis sativus]
 ref|XP_004157571.1| PREDICTED: uncharacterized LOC101210354 [Cucumis sativus]
 gb|KGN46345.1| hypothetical protein Csa_6G087740 [Cucumis sativus]
Length=286

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQ+ DTT+TK+FVGGLAWET + TM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DP
Sbjct  23    GQYNDTTFTKIFVGGLAWETQRHTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDP  82

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             +AA+RAC + +PVIDGRRANCNLASLG  +  P TP
Sbjct  83    DAAIRACQNPSPVIDGRRANCNLASLGAHKPHPPTP  118



>ref|XP_008460001.1| PREDICTED: RNA-binding protein 24-B [Cucumis melo]
Length=286

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -2

Query  1257  GQFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDP  1078
             GQ+ DTT+TK+FVGGLAWET + TM+ YFEQFGEILEAVVITDK T RSKGYGFVTF+DP
Sbjct  23    GQYNDTTFTKIFVGGLAWETQRHTMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDP  82

Query  1077  EAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             +AA+RAC + +PVIDGRRANCNLASLG  +  P TP
Sbjct  83    DAAIRACQNPSPVIDGRRANCNLASLGAHKPHPPTP  118



>ref|XP_010270570.1| PREDICTED: RNA-binding protein 24-A [Nelumbo nucifera]
Length=286

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 80/94 (85%), Gaps = 2/94 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET  +TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDPE+
Sbjct  28    FGDTTYTKVFVGGLAWETQSETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPES  87

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             A RAC D  PVIDGRRANCNLASLG  R +P  P
Sbjct  88    ARRACADPTPVIDGRRANCNLASLG--RPRPFIP  119



>ref|XP_009606419.1| PREDICTED: RNA-binding protein 38 [Nicotiana tomentosiformis]
Length=282

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 83/94 (88%), Gaps = 2/94 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTT+TKVFVGGLAWET  +T++ YFEQFGEILEAVVITDK TARSKGYGFVTFR+PE+
Sbjct  23    FGDTTFTKVFVGGLAWETQSETLRRYFEQFGEILEAVVITDKNTARSKGYGFVTFRNPES  82

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             A RAC D AP+IDGRRANCNLASLG  R +P+ P
Sbjct  83    ARRACADPAPIIDGRRANCNLASLG--RPRPTVP  114



>ref|XP_008237917.1| PREDICTED: RNA-binding protein 24 isoform X2 [Prunus mume]
Length=259

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 80/91 (88%), Gaps = 2/91 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWETH DTM+ YFEQFGEILEAVVI+DK T RSKGYGFVTFR+PEA
Sbjct  24    FGDTTYTKVFVGGLAWETHSDTMRRYFEQFGEILEAVVISDKNTGRSKGYGFVTFREPEA  83

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKP  979
             A RAC D  PVIDGRRANCNLASL  +R +P
Sbjct  84    AARACADPTPVIDGRRANCNLASL--RRPRP  112



>ref|XP_010266283.1| PREDICTED: RNA-binding protein 38-like [Nelumbo nucifera]
Length=287

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 81/94 (86%), Gaps = 2/94 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET  +TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDPE+
Sbjct  28    FGDTTYTKVFVGGLAWETQSETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPES  87

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             A RAC D +PVIDGRRANCNLASLG  R +P  P
Sbjct  88    ARRACADPSPVIDGRRANCNLASLG--RPRPFLP  119



>ref|XP_008237916.1| PREDICTED: RNA-binding protein 24 isoform X1 [Prunus mume]
Length=281

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 80/91 (88%), Gaps = 2/91 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWETH DTM+ YFEQFGEILEAVVI+DK T RSKGYGFVTFR+PEA
Sbjct  24    FGDTTYTKVFVGGLAWETHSDTMRRYFEQFGEILEAVVISDKNTGRSKGYGFVTFREPEA  83

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKP  979
             A RAC D  PVIDGRRANCNLASL  +R +P
Sbjct  84    AARACADPTPVIDGRRANCNLASL--RRPRP  112



>ref|XP_001770459.1| predicted protein [Physcomitrella patens]
 gb|EDQ64628.1| predicted protein [Physcomitrella patens]
Length=89

 Score =   155 bits (391),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTT+TKVFVGGLAWET +DTM+ +FEQFG+ILEAVVITDK T RSKGYGFVTFRD E+A 
Sbjct  1     DTTFTKVFVGGLAWETQRDTMRRHFEQFGDILEAVVITDKNTGRSKGYGFVTFRDSESAK  60

Query  1065  RACVDAAPVIDGRRANCNLASLGVQRSKP  979
             +AC DA P+IDGRRANCNLASLG  R +P
Sbjct  61    KACEDATPIIDGRRANCNLASLGAHRHRP  89



>ref|XP_009149567.1| PREDICTED: RNA-binding protein 24-like [Brassica rapa]
Length=261

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET  DT++ +FE FG+ILEAVVITDK T RSKGYGFVTFRDPEA
Sbjct  18    FGDTTYTKVFVGGLAWETQSDTLRRHFEPFGDILEAVVITDKNTGRSKGYGFVTFRDPEA  77

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQR  988
             A RACVDA P+IDGRRANCNLASLG  R
Sbjct  78    ARRACVDATPIIDGRRANCNLASLGRPR  105



>ref|XP_011074059.1| PREDICTED: RNA-binding protein 24-B [Sesamum indicum]
Length=294

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 81/94 (86%), Gaps = 2/94 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTT+TKVFVGGLAWET  +TM+ YFEQFGEILEAVVITDK T RSKGYGFVTFRDPE+
Sbjct  35    FGDTTFTKVFVGGLAWETQSETMRRYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPES  94

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             A RAC D  P+IDGRRANCNLASLG  R +P+ P
Sbjct  95    ARRACADPTPIIDGRRANCNLASLG--RPRPAVP  126



>ref|XP_007209452.1| hypothetical protein PRUPE_ppa009716mg [Prunus persica]
 gb|EMJ10651.1| hypothetical protein PRUPE_ppa009716mg [Prunus persica]
Length=281

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 80/91 (88%), Gaps = 2/91 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWETH DTM+ YFEQFGEILEAVVI+DK T RSKGYGFVTFR+PEA
Sbjct  24    FGDTTYTKVFVGGLAWETHSDTMRRYFEQFGEILEAVVISDKNTGRSKGYGFVTFREPEA  83

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKP  979
             A RAC D  P+IDGRRANCNLASL  +R +P
Sbjct  84    AARACADPTPIIDGRRANCNLASL--RRPRP  112



>ref|XP_010906054.1| PREDICTED: RNA-binding protein 24-B-like [Elaeis guineensis]
Length=275

 Score =   161 bits (407),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 81/94 (86%), Gaps = 1/94 (1%)
 Frame = -2

Query  1245  DTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEAAM  1066
             DTTYTK+FVGGLAWET +DTM  YFEQFGEILEAVVITDK T RSKGYGFVTF+DP++AM
Sbjct  20    DTTYTKIFVGGLAWETQRDTMHRYFEQFGEILEAVVITDKNTGRSKGYGFVTFKDPDSAM  79

Query  1065  RACVDAAPVIDGRRANCNLASLGV-QRSKPSTPN  967
             RAC D +PVIDGRRANCNLAS G   R++PS P 
Sbjct  80    RACQDPSPVIDGRRANCNLASFGTAHRTRPSNPQ  113



>gb|KHN20082.1| RNA-binding protein 24 [Glycine soja]
Length=317

 Score =   162 bits (409),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 80/94 (85%), Gaps = 2/94 (2%)
 Frame = -2

Query  1251  FGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPEA  1072
             FGDTTYTKVFVGGLAWET  +TM+ YF+QFGEILEAVVITDK T RSKGYGFVTFRDPEA
Sbjct  26    FGDTTYTKVFVGGLAWETQSETMRRYFDQFGEILEAVVITDKNTGRSKGYGFVTFRDPEA  85

Query  1071  AMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             A RAC D  PVIDGRRANCNLASLG  R +P  P
Sbjct  86    ARRACADPTPVIDGRRANCNLASLG--RPRPPLP  117



>ref|XP_008234871.1| PREDICTED: RNA-binding protein 38-like [Prunus mume]
Length=273

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  1254  QFGDTTYTKVFVGGLAWETHKDTMKNYFEQFGEILEAVVITDKATARSKGYGFVTFRDPE  1075
             QFGDT++TK+FVGGL WET +DTMK+YFEQFGEILEAVVITDK TARSKGYGFVTF+DPE
Sbjct  14    QFGDTSHTKIFVGGLPWETQRDTMKSYFEQFGEILEAVVITDKITARSKGYGFVTFKDPE  73

Query  1074  AAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTP  970
             AA RAC +  P+IDGR ANCNLA+LG Q++  +TP
Sbjct  74    AAGRACENPNPIIDGRTANCNLAALGAQKNHSATP  108



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3488421182128