BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24935_g1_i4 len=1096 path=[3957:0-160 @1217@!:161-798 1851:799-822
1875:823-865 308:866-867 790:868-960 4377:961-964 2012:965-1095]

Length=1096
                                                                      Score     E

ref|XP_009797527.1|  PREDICTED: uncharacterized protein LOC104243...    477   8e-164   
ref|XP_004238852.1|  PREDICTED: uncharacterized protein LOC101257662    474   1e-162   
ref|XP_006344222.1|  PREDICTED: uncharacterized protein LOC102605940    473   4e-162   
ref|XP_009596678.1|  PREDICTED: uncharacterized protein LOC104092...    473   6e-162   
gb|KDP38038.1|  hypothetical protein JCGZ_04681                         472   4e-161   
gb|KHG11580.1|  putative lipoprotein                                    468   2e-160   
ref|XP_004298461.1|  PREDICTED: uncharacterized lipoprotein syc11...    465   5e-160   
ref|XP_011072080.1|  PREDICTED: uncharacterized protein LOC105157367    466   2e-159   
ref|XP_002531070.1|  conserved hypothetical protein                     461   8e-159   Ricinus communis
ref|XP_008339574.1|  PREDICTED: uncharacterized protein LOC103402612    462   4e-158   
ref|XP_007045100.1|  Uncharacterized protein isoform 1                  461   1e-157   
emb|CDP00750.1|  unnamed protein product                                461   4e-157   
ref|XP_006378455.1|  hypothetical protein POPTR_0010s12430g             459   9e-157   
gb|KEH40542.1|  DUF3326 family protein                                  458   1e-156   
ref|XP_008467151.1|  PREDICTED: uncharacterized protein LOC103504573    459   1e-156   
gb|KGN51510.1|  hypothetical protein Csa_5G571530                       458   2e-156   
ref|XP_009357770.1|  PREDICTED: uncharacterized protein LOC103948462    457   4e-156   
ref|XP_011038673.1|  PREDICTED: uncharacterized protein LOC105135486    457   6e-156   
ref|XP_003533109.1|  PREDICTED: uncharacterized protein LOC100787317    456   8e-156   
gb|EYU22304.1|  hypothetical protein MIMGU_mgv1a005518mg                451   6e-153   
ref|XP_007153288.1|  hypothetical protein PHAVU_003G022800g             449   7e-153   
ref|XP_010667199.1|  PREDICTED: uncharacterized protein LOC104884274    447   5e-152   
ref|XP_004150481.1|  PREDICTED: uncharacterized lipoprotein syc11...    445   8e-151   
ref|XP_004498326.1|  PREDICTED: uncharacterized lipoprotein syc11...    443   1e-150   
ref|XP_007227476.1|  hypothetical protein PRUPE_ppa006456mg             442   3e-150   
ref|XP_008243344.1|  PREDICTED: uncharacterized protein LOC103341579    440   2e-149   
ref|XP_010916350.1|  PREDICTED: uncharacterized protein LOC105041...    440   3e-149   
ref|XP_006845280.1|  hypothetical protein AMTR_s00005p00266220          440   3e-149   
gb|EYU22303.1|  hypothetical protein MIMGU_mgv1a005518mg                439   4e-148   
ref|XP_002455248.1|  hypothetical protein SORBIDRAFT_03g007150          436   2e-147   Sorghum bicolor [broomcorn]
emb|CBI26918.3|  unnamed protein product                                432   3e-147   
ref|XP_009797528.1|  PREDICTED: uncharacterized protein LOC104243...    427   1e-145   
ref|NP_001041903.2|  Os01g0127400                                       429   3e-145   Oryza sativa Japonica Group [Japonica rice]
gb|EEC69865.1|  hypothetical protein OsI_00224                          432   1e-144   Oryza sativa Indica Group [Indian rice]
tpg|DAA53628.1|  TPA: hypothetical protein ZEAMMB73_031072              428   2e-144   
ref|XP_004968053.1|  PREDICTED: uncharacterized protein LOC101753270    427   3e-144   
ref|XP_009596679.1|  PREDICTED: uncharacterized protein LOC104092...    423   8e-144   
gb|EEE53796.1|  hypothetical protein OsJ_00220                          431   9e-144   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010093407.1|  hypothetical protein L484_022976                   425   2e-143   
ref|XP_009410055.1|  PREDICTED: uncharacterized protein LOC103992...    425   3e-143   
ref|XP_010066636.1|  PREDICTED: uncharacterized protein LOC104453726    424   6e-143   
ref|XP_002315891.2|  hypothetical protein POPTR_0010s12430g             417   1e-140   Populus trichocarpa [western balsam poplar]
ref|XP_003565282.1|  PREDICTED: uncharacterized protein LOC100825804    413   1e-138   
ref|XP_001782982.1|  predicted protein                                  414   6e-138   
gb|ABR16294.1|  unknown                                                 408   2e-136   Picea sitchensis
ref|XP_004171155.1|  PREDICTED: uncharacterized lipoprotein syc11...    403   1e-135   
gb|EPS71703.1|  hypothetical protein M569_03054                         401   1e-134   
dbj|BAJ87524.1|  predicted protein                                      392   2e-131   
ref|XP_009410064.1|  PREDICTED: uncharacterized protein LOC103992...    385   6e-129   
ref|XP_002993429.1|  hypothetical protein SELMODRAFT_431494             389   3e-128   
ref|XP_002982233.1|  hypothetical protein SELMODRAFT_421627             389   1e-127   
gb|KCW64608.1|  hypothetical protein EUGRSUZ_G02196                     379   2e-126   
emb|CAN78467.1|  hypothetical protein VITISV_028235                     365   2e-120   Vitis vinifera
ref|XP_010916351.1|  PREDICTED: uncharacterized protein LOC105041...    343   6e-112   
gb|ACF86863.1|  unknown                                                 343   1e-111   Zea mays [maize]
ref|WP_007357629.1|  MULTISPECIES: hypothetical protein                 338   3e-110   
ref|XP_007045102.1|  Uncharacterized protein isoform 3                  333   4e-109   
ref|WP_009556274.1|  Protein of unknown function (DUF3326)              329   1e-106   
ref|WP_009783196.1|  hypothetical protein                               329   2e-106   
ref|WP_008275905.1|  hypothetical protein                               327   4e-106   
ref|WP_006631119.1|  hypothetical protein                               325   5e-105   
ref|WP_006100868.1|  hypothetical protein                               324   1e-104   
ref|WP_026798524.1|  MULTISPECIES: hypothetical protein                 324   1e-104   
ref|WP_023066375.1|  hypothetical protein                               323   4e-104   
ref|WP_013322779.1|  hypothetical protein                               323   4e-104   
ref|WP_015183134.1|  hypothetical protein                               323   7e-104   
ref|WP_007307784.1|  hypothetical protein                               322   7e-104   
ref|WP_007312815.1|  hypothetical protein                               322   8e-104   
ref|WP_026798259.1|  MULTISPECIES: hypothetical protein                 322   1e-103   
ref|WP_017311189.1|  hypothetical protein                               320   6e-103   
ref|WP_015134782.1|  hypothetical protein                               319   1e-102   
ref|WP_026720919.1|  hypothetical protein                               319   1e-102   
tpg|DAA53629.1|  TPA: hypothetical protein ZEAMMB73_031072              316   2e-102   
ref|WP_027248848.1|  hypothetical protein                               318   2e-102   
ref|WP_035997385.1|  hypothetical protein                               318   3e-102   
ref|NP_001141216.1|  hypothetical protein                               315   4e-102   Zea mays [maize]
ref|WP_015116898.1|  hypothetical protein                               316   9e-102   
ref|WP_012598023.1|  hypothetical protein                               315   3e-101   
ref|WP_030007425.1|  hypothetical protein                               314   7e-101   
ref|WP_015230129.1|  hypothetical protein                               314   9e-101   
ref|WP_012595868.1|  hypothetical protein                               314   1e-100   
ref|WP_039730206.1|  hypothetical protein                               313   1e-100   
ref|WP_015784728.1|  hypothetical protein                               313   2e-100   
ref|WP_033374264.1|  hypothetical protein                               313   2e-100   
ref|WP_009543076.1|  MULTISPECIES: hypothetical protein                 313   2e-100   
ref|WP_012308227.1|  hypothetical protein                               312   3e-100   
ref|WP_016861945.1|  hypothetical protein                               312   3e-100   
ref|WP_017293497.1|  hypothetical protein                               312   5e-100   
ref|WP_017314371.1|  hypothetical protein                               312   7e-100   
ref|WP_015194845.1|  hypothetical protein                               311   9e-100   
ref|WP_024544776.1|  hypothetical protein                               311   1e-99    
ref|WP_019499684.1|  hypothetical protein                               310   2e-99    
ref|WP_015158688.1|  Protein of unknown function (DUF3326)              310   2e-99    
ref|WP_002802418.1|  hypothetical protein                               308   1e-98    
ref|WP_039716645.1|  hypothetical protein                               308   2e-98    
ref|WP_008191858.1|  hypothetical protein                               308   2e-98    
ref|WP_016871549.1|  hypothetical protein                               308   2e-98    
ref|WP_009457281.1|  hypothetical protein                               308   2e-98    
ref|WP_039740062.1|  hypothetical protein                               308   3e-98    
dbj|BAP16999.1|  hypothetical protein ETSB_0104                         308   3e-98    
ref|WP_015227354.1|  hypothetical protein                               307   3e-98    
dbj|GAL94388.1|  hypothetical protein N44_02968                         307   4e-98    
ref|WP_006512525.1|  Protein of unknown function (DUF3326)              307   5e-98    
ref|WP_008196916.1|  hypothetical protein                               306   7e-98    
ref|WP_036480121.1|  hypothetical protein                               306   7e-98    
ref|WP_015154383.1|  hypothetical protein                               307   8e-98    
dbj|BAM54996.1|  hypothetical protein BEST7613_6065                     306   9e-98    
ref|WP_016515684.1|  hypothetical protein                               306   1e-97    
ref|WP_017286664.1|  hypothetical protein                               306   1e-97    
ref|WP_002785777.1|  hypothetical protein                               305   2e-97    
ref|WP_015219502.1|  hypothetical protein                               305   2e-97    
ref|WP_023074452.1|  hypothetical protein                               305   2e-97    
ref|WP_002771087.1|  hypothetical protein                               305   2e-97    
ref|WP_027842366.1|  hypothetical protein                               305   3e-97    
ref|WP_002782645.1|  hypothetical protein                               305   3e-97    
ref|WP_006621874.1|  MULTISPECIES: hypothetical protein                 305   3e-97    
ref|WP_002734977.1|  putative lipoprotein                               305   4e-97    
ref|WP_002762816.1|  hypothetical protein                               304   5e-97    
ref|WP_029637806.1|  hypothetical protein [                             304   5e-97    
gb|EMT07294.1|  hypothetical protein F775_11719                         305   7e-97    
dbj|BAG48274.1|  hypothetical protein MAE_08375                         304   8e-97    Microcystis aeruginosa NIES-843
ref|WP_002752635.1|  hypothetical protein                               303   9e-97    
ref|WP_002775622.1|  hypothetical protein                               303   9e-97    
ref|WP_010872915.1|  hypothetical protein                               303   1e-96    
ref|WP_019492864.1|  hypothetical protein                               303   1e-96    
ref|WP_012629812.1|  hypothetical protein                               303   1e-96    
ref|WP_008313378.1|  Protein of unknown function (DUF3326)              303   1e-96    
ref|WP_016873218.1|  hypothetical protein                               303   2e-96    
ref|WP_015202946.1|  hypothetical protein                               303   2e-96    
ref|WP_002792374.1|  hypothetical protein                               303   2e-96    
ref|WP_011612448.1|  hypothetical protein                               303   2e-96    
ref|WP_004163183.1|  hypothetical protein                               302   2e-96    
ref|WP_017659713.1|  hypothetical protein                               302   3e-96    
gb|EDX87671.1|  hypothetical protein S7335_5381                         302   4e-96    Synechococcus sp. PCC 7335
ref|WP_038016502.1|  hypothetical protein                               302   5e-96    
ref|WP_024968968.1|  hypothetical protein                               301   5e-96    
ref|WP_017720725.1|  hypothetical protein                               301   6e-96    
ref|WP_015221805.1|  hypothetical protein                               301   8e-96    
ref|WP_002749344.1|  putative lipoprotein                               301   9e-96    
ref|WP_036021466.1|  hypothetical protein                               300   2e-95    
ref|WP_015143380.1|  hypothetical protein                               300   2e-95    
ref|WP_009630743.1|  Protein of unknown function (DUF3326)              300   2e-95    
ref|WP_006618621.1|  hypothetical protein                               300   2e-95    
ref|WP_015172389.1|  hypothetical protein                               300   2e-95    
ref|WP_019508954.1|  hypothetical protein                               300   3e-95    
gb|EKV03311.1|  Protein of unknown function (DUF3326)                   300   4e-95    
ref|WP_038530386.1|  hypothetical protein                               298   1e-94    
ref|WP_035372229.1|  hypothetical protein                               298   1e-94    
ref|WP_009625382.1|  hypothetical protein                               296   4e-94    
ref|WP_035994181.1|  hypothetical protein                               296   5e-94    
ref|WP_010994960.1|  hypothetical protein                               295   1e-93    
ref|WP_012408583.1|  hypothetical protein                               295   2e-93    
ref|WP_006529474.1|  Protein of unknown function (DUF3326)              295   2e-93    
ref|WP_038084800.1|  hypothetical protein                               295   3e-93    
gb|EMS50023.1|  hypothetical protein TRIUR3_20384                       290   3e-93    
ref|WP_037220213.1|  hypothetical protein                               295   3e-93    
emb|CDN13340.1|  FIG01149963: hypothetical protein                      295   3e-93    
ref|WP_012953577.1|  hypothetical protein                               294   5e-93    
ref|XP_002994394.1|  hypothetical protein SELMODRAFT_432315             297   8e-93    
ref|WP_018399932.1|  hypothetical protein                               293   9e-93    
ref|WP_022609137.1|  protein of unknown function (DUF3326)              293   1e-92    
ref|WP_013192930.1|  hypothetical protein                               292   1e-92    
ref|WP_015130268.1|  hypothetical protein                               293   2e-92    
gb|AHJ27893.1|  hypothetical protein NSP_15590                          292   3e-92    
ref|WP_006197949.1|  hypothetical protein                               292   3e-92    
ref|WP_017749379.1|  hypothetical protein                               292   3e-92    
ref|WP_015140985.1|  hypothetical protein                               292   4e-92    
ref|WP_015148776.1|  hypothetical protein                               291   4e-92    
ref|WP_015186570.1|  hypothetical protein                               291   5e-92    
ref|WP_015081184.1|  hypothetical protein                               291   6e-92    
ref|WP_008232449.1|  hypothetical protein                               291   1e-91    
ref|WP_011243486.1|  hypothetical protein                               290   2e-91    
ref|WP_011317440.1|  hypothetical protein                               289   3e-91    
ref|WP_035156368.1|  hypothetical protein                               289   3e-91    
gb|KFF41084.1|  Protein of unknown function (DUF3326)                   289   4e-91    
ref|WP_016949734.1|  hypothetical protein                               289   5e-91    
ref|WP_015208251.1|  Protein of unknown function (DUF3326)              288   6e-91    
ref|WP_011056519.1|  hypothetical protein                               288   7e-91    
ref|WP_015200523.1|  hypothetical protein                               288   7e-91    
ref|WP_029315190.1|  hypothetical protein                               287   2e-90    
ref|WP_015175653.1|  hypothetical protein                               289   3e-90    
ref|WP_016867217.1|  hypothetical protein                               285   1e-89    
ref|WP_027401381.1|  hypothetical protein                               285   1e-89    
ref|WP_026734663.1|  hypothetical protein                               285   2e-89    
ref|WP_028082450.1|  hypothetical protein                               284   3e-89    
ref|WP_011429974.1|  hypothetical protein                               284   5e-89    
ref|WP_012163142.1|  hypothetical protein                               281   2e-88    
ref|WP_026101359.1|  hypothetical protein                               282   2e-88    
ref|WP_015167604.1|  hypothetical protein                               281   4e-88    
ref|WP_015124467.1|  hypothetical protein                               281   4e-88    
ref|WP_039200324.1|  hypothetical protein                               281   7e-88    
ref|WP_015216277.1|  hypothetical protein                               280   1e-87    
ref|WP_017710888.1|  hypothetical protein                               280   1e-87    
ref|WP_024124060.1|  protein of unknown function DUF3326                276   2e-86    
ref|WP_015163572.1|  hypothetical protein                               276   4e-86    
ref|WP_017654438.1|  hypothetical protein                               275   1e-85    
ref|WP_015113228.1|  hypothetical protein                               274   3e-85    
ref|WP_009344242.1|  hypothetical protein                               273   6e-85    
ref|WP_006275911.1|  hypothetical protein                               271   4e-84    
ref|WP_011433038.1|  hypothetical protein                               267   6e-82    
ref|XP_005707042.1|  hypothetical protein Gasu_21940                    266   1e-81    
ref|WP_011140560.1|  hypothetical protein                               258   2e-79    
emb|CBN76959.1|  conserved unknown protein                              260   3e-79    
ref|XP_005713541.1|  unnamed protein product                            259   2e-78    
ref|WP_036901027.1|  hypothetical protein                               256   3e-78    
ref|WP_011365126.1|  hypothetical protein                               254   7e-78    
ref|WP_011620217.1|  hypothetical protein                               253   3e-77    
ref|WP_006171972.1|  hypothetical protein                               253   6e-77    
ref|WP_006854316.1|  hypothetical protein                               251   2e-76    
ref|WP_028952763.1|  hypothetical protein                               251   2e-76    
gb|AHF64590.1|  hypothetical protein Syncc8109_2264                     249   1e-75    
gb|AII46051.1|  hypothetical protein KR49_06245                         248   2e-75    
ref|XP_010658567.1|  PREDICTED: uncharacterized protein LOC100854...    241   4e-75    
ref|WP_009790490.1|  hypothetical protein                               246   1e-74    
ref|WP_007101644.1|  hypothetical protein                               246   2e-74    
ref|WP_017324593.1|  hypothetical protein                               246   2e-74    
ref|WP_038553214.1|  hypothetical protein                               246   3e-74    
ref|WP_011359310.1|  hypothetical protein                               245   4e-74    
ref|WP_007098839.1|  hypothetical protein                               244   1e-73    
ref|WP_006043310.1|  hypothetical protein                               244   2e-73    
ref|WP_023172333.1|  hypothetical protein                               243   3e-73    
ref|WP_011130831.1|  hypothetical protein                               243   8e-73    
ref|WP_011825162.1|  hypothetical protein                               242   1e-72    
ref|WP_036905544.1|  hypothetical protein                               239   1e-71    
ref|WP_038546488.1|  hypothetical protein                               239   1e-71    
ref|WP_011295324.1|  hypothetical protein                               237   8e-71    
ref|WP_038654090.1|  hypothetical protein                               235   4e-70    
ref|WP_011127370.1|  hypothetical protein                               234   9e-70    
gb|KGG10860.1|  hypothetical protein EV04_1822                          233   3e-69    
ref|WP_011824388.1|  hypothetical protein                               233   4e-69    
ref|WP_036911410.1|  MULTISPECIES: hypothetical protein                 231   1e-68    
ref|WP_019480249.1|  hypothetical protein                               231   1e-68    
ref|WP_036892609.1|  MULTISPECIES: hypothetical protein                 231   1e-68    
ref|WP_011125751.1|  hypothetical protein                               231   1e-68    
ref|WP_036899511.1|  hypothetical protein                               231   1e-68    
gb|KGG28390.1|  hypothetical protein EV13_1632                          231   2e-68    
ref|XP_005794327.1|  hypothetical protein EMIHUDRAFT_308248             231   3e-68    
gb|EWM25222.1|  Protein of unknown function DUF3326                     240   5e-68    
ref|WP_011820928.1|  hypothetical protein                               228   1e-67    
ref|WP_011133076.1|  hypothetical protein                               228   1e-67    
ref|WP_019475351.1|  hypothetical protein                               228   1e-67    
ref|WP_010315328.1|  hypothetical protein                               228   2e-67    
ref|WP_019476279.1|  hypothetical protein                               228   2e-67    
emb|CBI26920.3|  unnamed protein product                                220   7e-67    
ref|WP_025980005.1|  hypothetical protein                               226   8e-67    
ref|WP_011933905.1|  hypothetical protein                               226   1e-66    
ref|WP_025975988.1|  hypothetical protein                               226   1e-66    
ref|WP_025923519.1|  hypothetical protein                               226   2e-66    
ref|WP_035829530.1|  hypothetical protein                               225   2e-66    
gb|ABE11100.1|  conserved hypothetical protein                          224   6e-66    uncultured Prochlorococcus marinus clone HF10-11D6
ref|YP_002048868.1|  hypothetical protein PCC_0208                      223   9e-66    Paulinella chromatophora
ref|WP_021833505.1|  hypothetical protein                               221   9e-66    
ref|WP_012196118.1|  hypothetical protein                               222   5e-65    
ref|WP_025946388.1|  hypothetical protein                               222   5e-65    
ref|WP_032520152.1|  hypothetical protein                               221   7e-65    
ref|WP_025972525.1|  hypothetical protein                               221   8e-65    
ref|WP_012008350.1|  hypothetical protein                               221   1e-64    
ref|WP_032524988.1|  hypothetical protein                               221   1e-64    
gb|AIQ95796.1|  hypothetical protein EW14_1787                          221   1e-64    
ref|WP_025961480.1|  hypothetical protein                               221   1e-64    
ref|WP_002805655.1|  hypothetical protein                               221   1e-64    
ref|WP_025933963.1|  hypothetical protein                               221   1e-64    
ref|WP_025938653.1|  hypothetical protein                               220   1e-64    
ref|WP_025956140.1|  MULTISPECIES: hypothetical protein                 220   2e-64    
ref|WP_025913841.1|  hypothetical protein                               220   2e-64    
ref|WP_025932162.1|  hypothetical protein                               220   2e-64    
ref|WP_025882315.1|  MULTISPECIES: hypothetical protein                 220   2e-64    
ref|WP_025963919.1|  hypothetical protein                               219   3e-64    
ref|WP_025954872.1|  hypothetical protein                               219   3e-64    
ref|WP_011863559.1|  hypothetical protein                               219   4e-64    
ref|WP_025889316.1|  MULTISPECIES: hypothetical protein                 219   4e-64    
ref|WP_025944888.1|  hypothetical protein                               219   5e-64    
ref|WP_032518134.1|  hypothetical protein                               219   5e-64    
ref|WP_025944175.1|  hypothetical protein                               219   7e-64    
ref|WP_025960591.1|  hypothetical protein                               219   7e-64    
ref|WP_025940914.1|  hypothetical protein                               218   8e-64    
ref|WP_025926986.1|  hypothetical protein                               218   8e-64    
ref|WP_025894974.1|  MULTISPECIES: hypothetical protein                 218   8e-64    
ref|WP_010310923.1|  hypothetical protein                               218   9e-64    
ref|WP_025920918.1|  MULTISPECIES: hypothetical protein                 218   1e-63    
ref|WP_011819062.1|  hypothetical protein                               218   1e-63    
ref|WP_025973523.1|  hypothetical protein                               218   1e-63    
ref|XP_005535086.1|  hypothetical protein, conserved                    222   1e-63    
ref|WP_025924871.1|  hypothetical protein                               218   1e-63    
ref|WP_025956979.1|  MULTISPECIES: hypothetical protein                 218   1e-63    
ref|WP_025958556.1|  MULTISPECIES: hypothetical protein                 218   1e-63    
ref|WP_025965912.1|  hypothetical protein                               218   2e-63    
ref|WP_025974099.1|  hypothetical protein                               218   2e-63    
ref|WP_025979427.1|  hypothetical protein                               218   2e-63    
ref|WP_032522085.1|  hypothetical protein                               217   2e-63    
ref|WP_025915063.1|  hypothetical protein                               217   2e-63    
ref|WP_036919143.1|  MULTISPECIES: hypothetical protein                 217   3e-63    
ref|WP_032513292.1|  hypothetical protein                               216   6e-63    
ref|WP_025943019.1|  MULTISPECIES: hypothetical protein                 216   7e-63    
ref|WP_025930846.1|  hypothetical protein                               216   9e-63    
ref|WP_025935431.1|  hypothetical protein                               215   1e-62    
ref|WP_011377083.1|  hypothetical protein                               215   2e-62    
ref|WP_032516275.1|  hypothetical protein                               214   2e-62    
ref|WP_019476831.1|  hypothetical protein                               213   6e-62    
emb|CAA28931.1|  unnamed protein product                                208   1e-61    
ref|WP_032527371.1|  hypothetical protein                               212   2e-61    
ref|WP_015110610.1|  hypothetical protein                               212   2e-61    
ref|WP_019475848.1|  hypothetical protein                               206   4e-59    
ref|XP_005826536.1|  hypothetical protein GUITHDRAFT_158393             202   4e-58    
ref|WP_011936289.1|  hypothetical protein                               201   3e-57    
ref|XP_010658609.1|  PREDICTED: uncharacterized protein LOC100854...    191   4e-56    
ref|WP_025781208.1|  hypothetical protein                               197   1e-55    
ref|XP_008797863.1|  PREDICTED: uncharacterized protein LOC103712931    180   1e-48    
ref|WP_021916611.1|  putative uncharacterized protein                   172   2e-46    
ref|WP_021945481.1|  uncharacterized protein                            167   1e-44    
ref|WP_022022220.1|  putative uncharacterized protein                   163   4e-43    
ref|WP_022483281.1|  uncharacterized protein                            161   2e-42    
ref|WP_021864745.1|  putative uncharacterized protein                   159   1e-41    
gb|EKE02589.1|  hypothetical protein ACD_20C00357G0012                  159   2e-41    
ref|WP_025937585.1|  hypothetical protein                               154   3e-41    
ref|WP_022485327.1|  putative uncharacterized protein                   156   1e-40    
ref|WP_022457614.1|  putative uncharacterized protein                   156   2e-40    
ref|WP_022440933.1|  putative uncharacterized protein                   156   2e-40    
ref|WP_022247737.1|  uncharacterized protein                            156   3e-40    
emb|CDM92755.1|  conserved protein of unknown function                  149   5e-40    
ref|XP_008780019.1|  PREDICTED: uncharacterized protein LOC103699790    147   1e-39    
emb|CAJ73925.1|  conserved hypothetical protein                         153   3e-39    
ref|WP_022492604.1|  putative uncharacterized protein                   149   5e-38    
emb|CDM92754.1|  conserved protein of unknown function                  140   4e-36    
dbj|BAJ85077.1|  predicted protein                                      138   3e-35    
ref|WP_011613431.1|  hypothetical protein                               135   1e-32    
ref|WP_012189428.1|  hypothetical protein                               130   2e-30    
ref|WP_025974749.1|  hypothetical protein                               118   4e-28    
ref|WP_025974748.1|  hypothetical protein                               110   6e-25    
ref|WP_025981080.1|  hypothetical protein                               108   7e-25    
ref|WP_007290916.1|  hypothetical protein                               113   2e-24    
ref|WP_015670274.1|  hypothetical protein                               112   3e-24    
ref|WP_006999619.1|  hypothetical protein                               108   8e-23    
ref|WP_015603026.1|  hypothetical protein                               105   5e-22    
ref|WP_006028827.1|  hypothetical protein                               105   6e-22    
ref|WP_009896976.1|  hypothetical protein                               102   8e-21    
ref|WP_009907672.1|  hypothetical protein                               102   9e-21    
ref|WP_009900232.1|  hypothetical protein                               102   1e-20    
ref|WP_029980618.1|  hypothetical protein                             94.0    4e-20    
ref|WP_038727387.1|  high light inducible protein                       100   6e-20    
ref|WP_004542401.1|  hypothetical protein                             99.4    1e-19    
ref|WP_038733212.1|  high light inducible protein                     99.0    1e-19    
gb|AIV55413.1|  hypothetical protein Y603_3966                        99.0    1e-19    
ref|WP_038735172.1|  high light inducible protein                     98.6    2e-19    
ref|WP_009925761.1|  MULTISPECIES: hypothetical protein               98.6    2e-19    
ref|WP_038727836.1|  high light inducible protein                     98.6    2e-19    
gb|AHE31120.1|  hypothetical protein BBJ_5230                         98.6    2e-19    
ref|WP_004525383.1|  hypothetical protein                             98.6    2e-19    
gb|KGS16950.1|  hypothetical protein X989_5636                        98.6    2e-19    
ref|WP_038779500.1|  high light inducible protein                     98.2    2e-19    
ref|WP_038739670.1|  high light inducible protein                     98.2    2e-19    
ref|WP_038762804.1|  high light inducible protein                     98.2    2e-19    
ref|WP_038792677.1|  high light inducible protein                     98.2    2e-19    
ref|WP_038767610.1|  high light inducible protein                     98.2    2e-19    
ref|WP_038784147.1|  high light inducible protein                     98.2    2e-19    
gb|KGD58274.1|  hypothetical protein DP49_5771                        98.2    3e-19    
ref|WP_038790002.1|  high light inducible protein                     98.2    3e-19    
ref|WP_038787637.1|  high light inducible protein                     98.2    3e-19    
ref|WP_038740204.1|  MULTISPECIES: high light inducible protein       98.2    3e-19    
ref|WP_028201349.1|  hypothetical protein                             98.2    3e-19    
ref|WP_011853403.1|  hypothetical protein                             98.2    3e-19    
ref|WP_038770835.1|  high light inducible protein                     98.2    3e-19    
ref|WP_004537316.1|  MULTISPECIES: hypothetical protein               97.8    4e-19    
ref|WP_004539471.1|  hypothetical protein                             97.8    4e-19    
ref|WP_028358862.1|  hypothetical protein                             97.8    4e-19    
gb|KGW46757.1|  hypothetical protein Y049_5965                        97.8    4e-19    
ref|WP_038755472.1|  high light inducible protein                     97.4    4e-19    
ref|WP_038735232.1|  high light inducible protein                     97.4    5e-19    
gb|KGV31082.1|  hypothetical protein X985_5801                        97.4    5e-19    
ref|WP_038753497.1|  high light inducible protein                     97.4    5e-19    
ref|WP_038716158.1|  high light inducible protein                     97.4    6e-19    
ref|WP_025942010.1|  hypothetical protein                             91.3    6e-19    
ref|WP_038792683.1|  high light inducible protein                     97.1    6e-19    
ref|WP_004528753.1|  MULTISPECIES: hypothetical protein               96.7    8e-19    
ref|WP_038746841.1|  high light inducible protein                     96.3    1e-18    
ref|WP_038779497.1|  high light inducible protein                     95.9    1e-18    
ref|WP_038783717.1|  high light inducible protein                     95.9    2e-18    
ref|WP_038760263.1|  high light inducible protein                     95.9    2e-18    
ref|WP_004201013.1|  hypothetical protein                             95.9    2e-18    
ref|WP_009934587.1|  hypothetical protein                             95.5    2e-18    
gb|AIS90942.1|  hypothetical protein BBU_4582                         95.1    3e-18    
gb|KGX45787.1|  hypothetical protein Y600_4799                        95.1    5e-18    
ref|WP_029634151.1|  hypothetical protein [                           94.0    6e-18    
ref|WP_004548806.1|  hypothetical protein                             94.4    6e-18    
ref|WP_038779917.1|  high light inducible protein                     94.0    7e-18    
ref|WP_038800373.1|  high light inducible protein                     93.6    1e-17    
ref|WP_019488536.1|  hypothetical protein                             91.7    4e-17    
ref|WP_015217170.1|  hypothetical protein                             91.3    6e-17    
ref|NP_001232849.1|  uncharacterized protein LOC100384411             85.9    7e-17    
ref|WP_015211361.1|  Protein of unknown function (DUF3326)            90.5    1e-16    
gb|KGU75039.1|  hypothetical protein X883_3535                        89.7    3e-16    
ref|WP_008188144.1|  hypothetical protein                             85.5    6e-15    
ref|WP_006277018.1|  hypothetical protein                             79.0    1e-12    
ref|WP_025942009.1|  hypothetical protein                             73.6    2e-12    
ref|WP_029977154.1|  hypothetical protein                             57.8    4e-07    
ref|XP_006579195.1|  PREDICTED: FKBP12-interacting protein of 37 ...  56.2    4e-06    
gb|KGT02203.1|  hypothetical protein JT30_6070                        55.8    7e-06    
ref|WP_021832715.1|  hypothetical protein                             52.0    3e-05    
ref|WP_029976276.1|  hypothetical protein                             49.7    3e-04    



>ref|XP_009797527.1| PREDICTED: uncharacterized protein LOC104243942 isoform X1 [Nicotiana 
sylvestris]
Length=413

 Score =   477 bits (1227),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 255/312 (82%), Positives = 277/312 (89%), Gaps = 1/312 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GAAIGGYAGDALPVARA SSVVDCLI+HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  51    MIVPTGVGAAIGGYAGDALPVARALSSVVDCLISHPNVLNAAMLYWPMPNALYVEGYALD  110

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEGLW L+PVHQNRVGLV DAGIE++L IRHLQVVDA RASLGL  V YTVTD PL+V
Sbjct  111   RFAEGLWGLQPVHQNRVGLVFDAGIEKELLIRHLQVVDATRASLGLPIVGYTVTDTPLLV  170

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKWVDP  GQSTGRIQ PDSLLRAVE L   S VNAVAVVARFPDDD ED+DDYRQG+G+
Sbjct  171   EKWVDPTSGQSTGRIQRPDSLLRAVETLQNKSKVNAVAVVARFPDDDTEDLDDYRQGVGV  230

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEAVISHLVVK+FQIPCAHAPA+ PPQLS S+CPKS +EEIG+TFLPCVLA L T
Sbjct  231   DLLAGVEAVISHLVVKNFQIPCAHAPAVLPPQLSMSLCPKSAAEEIGFTFLPCVLAELST  290

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL+KG     ++CI A DVDSVI+PIDACGGDG LAFAN KR++PLIIAVEEN+TVL
Sbjct  291   APQYLVKGNN-FSEDCIVAGDVDSVIVPIDACGGDGVLAFANGKRHKPLIIAVEENQTVL  349

Query  196   NDTPERLGIEAV  161
             NDTP+ LGIEAV
Sbjct  350   NDTPDSLGIEAV  361



>ref|XP_004238852.1| PREDICTED: uncharacterized protein LOC101257662 [Solanum lycopersicum]
Length=413

 Score =   474 bits (1220),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 255/312 (82%), Positives = 275/312 (88%), Gaps = 1/312 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GAAIGGYAGDALPVARA SSVVDCLI+HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  51    MIVPTGVGAAIGGYAGDALPVARALSSVVDCLISHPNVLNAAMLYWPMPNALYVEGYALD  110

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEGLW L+PVHQNRVGLV DAGIEE+L +RHLQVVDA RASLGL  V YTVTD PL+V
Sbjct  111   RFAEGLWTLQPVHQNRVGLVFDAGIEEELLMRHLQVVDATRASLGLPIVGYTVTDTPLLV  170

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKWVDP  GQSTGRIQ PDSLLRAVE L     V+AVAVVARFPDDD +D+DDYRQG+GI
Sbjct  171   EKWVDPTSGQSTGRIQRPDSLLRAVENLRNECKVDAVAVVARFPDDDTKDLDDYRQGVGI  230

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEAVISHLVVK+FQIPCAHAPA+ PPQL+ +VCPKS +EEIG+TFLPCVLAGL T
Sbjct  231   DLLAGVEAVISHLVVKNFQIPCAHAPAVLPPQLNMAVCPKSAAEEIGFTFLPCVLAGLST  290

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL+K       NCI A DVDSVILPIDAC GDGALAFAN KRN+PLIIAVEEN+TVL
Sbjct  291   APQYLVKANN-YSDNCIVAGDVDSVILPIDACCGDGALAFANRKRNKPLIIAVEENQTVL  349

Query  196   NDTPERLGIEAV  161
             NDTP+ LGIEAV
Sbjct  350   NDTPDSLGIEAV  361



>ref|XP_006344222.1| PREDICTED: uncharacterized protein LOC102605940 [Solanum tuberosum]
Length=413

 Score =   473 bits (1216),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 255/313 (81%), Positives = 276/313 (88%), Gaps = 1/313 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GAAIGGYAGDALPVARA SS+VDCLI+HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  51    MIVPTGVGAAIGGYAGDALPVARALSSLVDCLISHPNVLNAAMLYWPMPNALYVEGYALD  110

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEGLWAL+PVHQNRVGLV DAGIEE L +RHLQVVDA RASLGL  V YTVTD PL+V
Sbjct  111   RFAEGLWALQPVHQNRVGLVFDAGIEEGLLMRHLQVVDATRASLGLPIVGYTVTDTPLLV  170

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKWVDP  GQSTGRIQ PDSLLRAVE L     V+A+AVVARFPDDD ED+DDYRQG+GI
Sbjct  171   EKWVDPTSGQSTGRIQRPDSLLRAVENLQNECKVDALAVVARFPDDDTEDLDDYRQGVGI  230

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEAVISHLVVK+FQIPCAHAPA+ PPQL+ +VCPKS +EEIG+TFLPCVLAGL T
Sbjct  231   DLLAGVEAVISHLVVKNFQIPCAHAPAVLPPQLNMAVCPKSAAEEIGFTFLPCVLAGLST  290

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL+KG      +CI A DVDSVILPIDAC GDGALAFAN KRN+PLIIAVEEN+TVL
Sbjct  291   APQYLVKGNN-FSDDCIVAGDVDSVILPIDACRGDGALAFANRKRNKPLIIAVEENQTVL  349

Query  196   NDTPERLGIEAVS  158
             NDTP+ LGIEAV 
Sbjct  350   NDTPDSLGIEAVK  362



>ref|XP_009596678.1| PREDICTED: uncharacterized protein LOC104092718 isoform X1 [Nicotiana 
tomentosiformis]
Length=418

 Score =   473 bits (1216),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 252/312 (81%), Positives = 276/312 (88%), Gaps = 1/312 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GAAIGGYAGDALPVARA SSVVDCLI+HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  51    MIVPTGVGAAIGGYAGDALPVARALSSVVDCLISHPNVLNAAMLYWPMPNALYVEGYALD  110

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEGLW L+PVHQNRVGLV DAGIE++L IRHLQVVDA RASLGL  V YTVTD PL+V
Sbjct  111   RFAEGLWGLQPVHQNRVGLVFDAGIEKELLIRHLQVVDATRASLGLPIVGYTVTDTPLLV  170

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKWVDP  GQSTGRIQ PDSLLRAVE L     VNAVAVVARFPDDD ED+DDYRQG+G+
Sbjct  171   EKWVDPTSGQSTGRIQRPDSLLRAVENLQNKFKVNAVAVVARFPDDDTEDLDDYRQGVGV  230

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEAVISHLVVK+FQ PCAHAPA+ PPQL+ S+CPKS +EEIG+TFLPCVLAGL T
Sbjct  231   DLLAGVEAVISHLVVKNFQFPCAHAPAVLPPQLNISLCPKSAAEEIGFTFLPCVLAGLST  290

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL+KG     ++CI A DVDSVI+PIDACGGDG LAFAN KR++PLIIAVEEN+TVL
Sbjct  291   APQYLVKGNN-FSEDCIVAGDVDSVIVPIDACGGDGVLAFANGKRHKPLIIAVEENQTVL  349

Query  196   NDTPERLGIEAV  161
             N+TP+ LGIEAV
Sbjct  350   NETPDSLGIEAV  361



>gb|KDP38038.1| hypothetical protein JCGZ_04681 [Jatropha curcas]
Length=461

 Score =   472 bits (1215),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 248/313 (79%), Positives = 276/313 (88%), Gaps = 0/313 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GA IGG+AGDALPVARA SSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD
Sbjct  101   MIVPTGVGAVIGGFAGDALPVARALSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  160

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA+GLWAL+PVHQN+VGLVLD GIEE+LRIRHLQV DA RASLGL  VEY +TD PL V
Sbjct  161   RFAQGLWALQPVHQNKVGLVLDKGIEEELRIRHLQVADATRASLGLPVVEYIITDTPLEV  220

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKWVDPK GQSTGRI+NP SLLRAV+ LV  S VNA+AVV RFPDDD +DIDDYRQGMGI
Sbjct  221   EKWVDPKSGQSTGRIKNPSSLLRAVQTLVVQSQVNAIAVVGRFPDDDIDDIDDYRQGMGI  280

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D+LAGVEAVISHLVVK FQIPCAHAPA+ P  L+ S+CPKS +EEIGYTFLPCVLAGL  
Sbjct  281   DVLAGVEAVISHLVVKEFQIPCAHAPAMQPLPLTPSLCPKSAAEEIGYTFLPCVLAGLSR  340

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL+  ++   K C+ ASDVDSV+LP+DACGGDGALAFA SK+++PLII VEEN TVL
Sbjct  341   APQYLVNNSQFSEKGCLLASDVDSVVLPVDACGGDGALAFARSKQHKPLIITVEENVTVL  400

Query  196   NDTPERLGIEAVS  158
             N TP++LGIEAV+
Sbjct  401   NSTPDKLGIEAVT  413



>gb|KHG11580.1| putative lipoprotein [Gossypium arboreum]
Length=413

 Score =   468 bits (1205),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 247/312 (79%), Positives = 275/312 (88%), Gaps = 0/312 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GA+IGG+AGDALPVAR  SSVVDCLI+HPNVLNAAMLYWPM NV+YVEGYALD
Sbjct  50    MIVPTGVGASIGGFAGDALPVARVLSSVVDCLISHPNVLNAAMLYWPMPNVMYVEGYALD  109

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA+GLWAL+PVHQN+VGLVLDAGIEE LR+RHLQV DA RASLGL  VEY VTD PL V
Sbjct  110   RFAQGLWALQPVHQNKVGLVLDAGIEEHLRVRHLQVADATRASLGLPVVEYAVTDTPLEV  169

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKWV+P  GQSTGRI++PDSLLRAVE LVK S V+AVAVV RFPDD+ +D+DDYR G+GI
Sbjct  170   EKWVNPTTGQSTGRIKHPDSLLRAVENLVKRSQVDAVAVVGRFPDDEVDDLDDYRLGIGI  229

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D LAGVEA+ISHLVVK FQIPCAHAPALSP  L++S+ PKS +EEIGYTFLPCVLAGL  
Sbjct  230   DTLAGVEAIISHLVVKEFQIPCAHAPALSPLPLTSSLSPKSAAEEIGYTFLPCVLAGLSN  289

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL+K  E L K CI ASDVDSVILP+DACGGDGALAFA SKRN+PLII VEENETVL
Sbjct  290   APQYLVKNPESLAKGCILASDVDSVILPVDACGGDGALAFARSKRNKPLIICVEENETVL  349

Query  196   NDTPERLGIEAV  161
             NDT ++LGI+ V
Sbjct  350   NDTADKLGIKVV  361



>ref|XP_004298461.1| PREDICTED: uncharacterized lipoprotein syc1174_c-like [Fragaria 
vesca subsp. vesca]
Length=363

 Score =   465 bits (1197),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 250/313 (80%), Positives = 275/313 (88%), Gaps = 1/313 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GAAIGGYAGDALPVARA SSVVDCLITHPNVLNAAMLYWPM N LYVEG+ALD
Sbjct  1     MIVPTGVGAAIGGYAGDALPVARALSSVVDCLITHPNVLNAAMLYWPMPNALYVEGFALD  60

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG+WAL+PVHQN+VGLVLD GIEE+LR+RHLQV DAARASLGL  VEY VTD PL V
Sbjct  61    RFAEGVWALKPVHQNKVGLVLDCGIEEELRLRHLQVADAARASLGLPVVEYVVTDTPLQV  120

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKW+DPK GQSTGRI++P+SLLRAV+ L+K S VNAVAVV RFPDDD ED DDYRQGMGI
Sbjct  121   EKWIDPKSGQSTGRIKHPESLLRAVQALIKRSQVNAVAVVGRFPDDDFEDTDDYRQGMGI  180

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEAVISHLVVK FQIPCAHAPAL P  LS S+CPKS +EE+GYTFLPCVLAGL  
Sbjct  181   DLLAGVEAVISHLVVKEFQIPCAHAPALLPVPLSPSLCPKSAAEELGYTFLPCVLAGLSN  240

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL+K +E     C+ ASDVDSVILPIDAC G GALAFA SK N+PLII VEENETVL
Sbjct  241   APQYLVKNSES-EHGCVLASDVDSVILPIDACAGPGALAFAQSKANKPLIIVVEENETVL  299

Query  196   NDTPERLGIEAVS  158
             +DTP+++GIEA+ 
Sbjct  300   DDTPDKVGIEAIK  312



>ref|XP_011072080.1| PREDICTED: uncharacterized protein LOC105157367 [Sesamum indicum]
Length=428

 Score =   466 bits (1200),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 274/313 (88%), Gaps = 1/313 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GA +GGYAGDALPVAR  +SVVDCLI+HPNVLNAAMLYWPM NVLYVEGYALD
Sbjct  50    MIVPTGVGATVGGYAGDALPVARTLASVVDCLISHPNVLNAAMLYWPMPNVLYVEGYALD  109

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEGLWAL+PVHQN+VGLVLDAGIEE+LRIRHLQVVDA RASLGL  VEY VTD  L V
Sbjct  110   RFAEGLWALQPVHQNKVGLVLDAGIEEELRIRHLQVVDATRASLGLPIVEYIVTDAALQV  169

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedid-DYRQGMG  560
             EKW+DPK GQSTGRIQ PDSLLRAVE LV+ S VNA+AVVARFPDDD +D   +YRQG G
Sbjct  170   EKWIDPKSGQSTGRIQRPDSLLRAVEILVERSGVNAIAVVARFPDDDTDDDVENYRQGKG  229

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +DLLAGVEAVISHLVVK F IPCAHAPAL P  LS S+CPKS +EEIGYTFLPCVLAGL 
Sbjct  230   VDLLAGVEAVISHLVVKKFGIPCAHAPALLPFSLSPSLCPKSAAEEIGYTFLPCVLAGLS  289

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
             TAPQYL++     GK+ I ASDVDSVILPIDACGGDGALAFA+ K N+PL+IAVEENETV
Sbjct  290   TAPQYLVQNFNSTGKDYILASDVDSVILPIDACGGDGALAFASRKTNKPLLIAVEENETV  349

Query  199   LNDTPERLGIEAV  161
             L+DTPE+LGI AV
Sbjct  350   LSDTPEKLGIPAV  362



>ref|XP_002531070.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31331.1| conserved hypothetical protein [Ricinus communis]
Length=332

 Score =   461 bits (1186),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 245/316 (78%), Positives = 275/316 (87%), Gaps = 1/316 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GA+IGG+AGDALPVARA +SVVDCLITHPNVLNAA LYWPM+NVLYVEGYALD
Sbjct  16    MIVPTGVGASIGGFAGDALPVARALASVVDCLITHPNVLNAATLYWPMANVLYVEGYALD  75

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA+ LWAL+PVHQN+VGLVLD+GIEE+LRIRHLQV DA RASLGL  VEY VTD PL V
Sbjct  76    RFAQSLWALQPVHQNKVGLVLDSGIEEELRIRHLQVADATRASLGLPVVEYIVTDTPLEV  135

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKWVDPK GQSTGRI++P SLLRAV+ LV  S VNA+AVVARFPDDD  D+D+YRQGMGI
Sbjct  136   EKWVDPKSGQSTGRIKHPCSLLRAVQTLVNQSQVNAIAVVARFPDDDVVDVDEYRQGMGI  195

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D+LAGVEAVISHLVVK FQIPCAHAPA+ P  L+ S+CPKS +EEIGYTFLPCVLAGL  
Sbjct  196   DVLAGVEAVISHLVVKEFQIPCAHAPAMLPLPLTLSLCPKSAAEEIGYTFLPCVLAGLSR  255

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL K ++   K C+  SDVDSVILPIDACGGDGALAFA  K+N+PLIIAVEEN TVL
Sbjct  256   APQYLAKDSQFFEKGCLVGSDVDSVILPIDACGGDGALAFAR-KQNKPLIIAVEENVTVL  314

Query  196   NDTPERLGIEAVSTRY  149
             + TP++LGIEAV   +
Sbjct  315   DSTPDKLGIEAVCNEF  330



>ref|XP_008339574.1| PREDICTED: uncharacterized protein LOC103402612 [Malus domestica]
 ref|XP_008339575.1| PREDICTED: uncharacterized protein LOC103402612 [Malus domestica]
Length=407

 Score =   462 bits (1189),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 254/314 (81%), Positives = 273/314 (87%), Gaps = 2/314 (1%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTGIGAAIGGYAGDALPVAR  SSVVDCLI HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  47    MIVPTGIGAAIGGYAGDALPVARTLSSVVDCLIAHPNVLNAAMLYWPMPNALYVEGYALD  106

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEGLW L PVHQN+VGLVLD GIEE+LR+RHLQV DAARASLGL  VEY VTD PL V
Sbjct  107   RFAEGLWGLMPVHQNKVGLVLDCGIEEELRVRHLQVADAARASLGLPVVEYVVTDTPLQV  166

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             EKWVDPK GQSTGRI++PDSLLRAV+ LVK S VNAVAVV RFP DDD +D DDYRQGMG
Sbjct  167   EKWVDPKTGQSTGRIKHPDSLLRAVQALVKRSQVNAVAVVGRFPDDDDVQDTDDYRQGMG  226

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             IDLLAGVEAVISHLVVK FQIPCAHAPALSP  ++ S+CPKS +EE+GYTFLPCVLAGL 
Sbjct  227   IDLLAGVEAVISHLVVKEFQIPCAHAPALSPLPMTPSLCPKSAAEELGYTFLPCVLAGLS  286

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQYL+K +E     CI ASDVDSVILPIDA GG GALAFA SKRN+PLIIAVEEN TV
Sbjct  287   NAPQYLVKNSES-ENGCILASDVDSVILPIDAFGGHGALAFARSKRNKPLIIAVEENVTV  345

Query  199   LNDTPERLGIEAVS  158
             L+DTP++ GIEAV+
Sbjct  346   LDDTPDKFGIEAVN  359



>ref|XP_007045100.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007045101.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY00932.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY00933.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=414

 Score =   461 bits (1187),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 242/313 (77%), Positives = 276/313 (88%), Gaps = 0/313 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GA+IGG+AGDALPVARA SSVVDCLI+HPNVLNAAMLYWPM NV+YVEGYALD
Sbjct  51    MIVPTGVGASIGGFAGDALPVARALSSVVDCLISHPNVLNAAMLYWPMPNVMYVEGYALD  110

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA+GLWAL+PVHQN+VGLVLDAGIEE L+IRHLQV DA+RASLGL  VEY VTD PL V
Sbjct  111   RFAQGLWALQPVHQNKVGLVLDAGIEEYLQIRHLQVADASRASLGLPVVEYVVTDTPLEV  170

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKWV+P  GQSTGRI++PDSLLRAV+ LVK S V+AVAVV RFPDD+ +++DDYRQG+GI
Sbjct  171   EKWVNPTTGQSTGRIKHPDSLLRAVKNLVKRSQVDAVAVVGRFPDDEVDNLDDYRQGIGI  230

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D+LAGVEAVISHLVVK FQIPCAHAPALSP  L++S+CPKS +EEIGYTFLPCVLAGL  
Sbjct  231   DILAGVEAVISHLVVKEFQIPCAHAPALSPLPLTSSLCPKSAAEEIGYTFLPCVLAGLSN  290

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             AP+YL+K  E   K CI ASDVDS+ILPIDAC GD  LAFA +K+N+PLII VEENETVL
Sbjct  291   APRYLVKNPEFSEKGCILASDVDSIILPIDACAGDATLAFARNKKNKPLIICVEENETVL  350

Query  196   NDTPERLGIEAVS  158
             NDT ++LGI+ V 
Sbjct  351   NDTADKLGIKVVK  363



>emb|CDP00750.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   461 bits (1186),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 243/313 (78%), Positives = 277/313 (88%), Gaps = 0/313 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GAAIGGYAGDALPVARA S+VVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD
Sbjct  84    MIVPTGVGAAIGGYAGDALPVARALSTVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  143

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEGLWAL+PVHQNRVGL+LDAG+EEDLR+RHLQV DA RASLGL  VE  VTD PL V
Sbjct  144   RFAEGLWALQPVHQNRVGLILDAGLEEDLRLRHLQVADATRASLGLPIVECMVTDTPLKV  203

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             E W+DP+ GQSTGRI++PDSLLRAVE L+  S V AVAVVARFPDDD  DID YRQG GI
Sbjct  204   EIWIDPESGQSTGRIKHPDSLLRAVETLITRSRVTAVAVVARFPDDDIGDIDAYRQGKGI  263

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D+LAGVEA+ISHLVVK+F IPCAH+PA+SP  +S  +CPKS +EEIGYTFLPCVLAGL  
Sbjct  264   DILAGVEAIISHLVVKNFNIPCAHSPAVSPAPVSYPLCPKSAAEEIGYTFLPCVLAGLSG  323

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL+K +E L + CI++ DVDSVILPI+ACGGDGA AFA++++ +PLIIAV+ENETVL
Sbjct  324   APQYLVKTSEFLERGCITSRDVDSVILPINACGGDGARAFASNQKIKPLIIAVKENETVL  383

Query  196   NDTPERLGIEAVS  158
             +DTP +LGIEAV+
Sbjct  384   SDTPTKLGIEAVT  396



>ref|XP_006378455.1| hypothetical protein POPTR_0010s12430g [Populus trichocarpa]
 gb|ERP56252.1| hypothetical protein POPTR_0010s12430g [Populus trichocarpa]
Length=410

 Score =   459 bits (1180),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 243/313 (78%), Positives = 272/313 (87%), Gaps = 0/313 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GA+IGG+AGDALPVARA S+VVDCLITHPNVLNAAMLYWPM NVLYVEGYALD
Sbjct  47    MIVPTGVGASIGGFAGDALPVARALSTVVDCLITHPNVLNAAMLYWPMPNVLYVEGYALD  106

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEGLWAL+PVHQN+VGLVLD GIEE+LRI HLQV DA RASLGL  +EY VTD PL V
Sbjct  107   RFAEGLWALQPVHQNKVGLVLDGGIEEELRIHHLQVADATRASLGLPVLEYIVTDTPLEV  166

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKWVD K GQSTGRI++P +LLRAV+ L+  S VNAVAVV RFPDDD ED+DDYRQG+GI
Sbjct  167   EKWVDSKTGQSTGRIKHPGALLRAVQTLINRSQVNAVAVVGRFPDDDVEDVDDYRQGVGI  226

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEAVISHLVVK FQIPCAHAPA+ P  L+  +CPKS +EEIGYTFLPCVL GL  
Sbjct  227   DLLAGVEAVISHLVVKKFQIPCAHAPAMLPLLLTEDLCPKSAAEEIGYTFLPCVLTGLSK  286

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL+K ++ L K C+ ASDVDSV+LPI+AC GDGALAFA SK N+PLII VEENETVL
Sbjct  287   APQYLVKDSQSLEKGCLLASDVDSVVLPINACAGDGALAFARSKINKPLIITVEENETVL  346

Query  196   NDTPERLGIEAVS  158
             +DTP++LGIE V 
Sbjct  347   DDTPDKLGIETVK  359



>gb|KEH40542.1| DUF3326 family protein [Medicago truncatula]
Length=407

 Score =   458 bits (1179),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 240/310 (77%), Positives = 272/310 (88%), Gaps = 0/310 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG GAAIGG+AGDALPVARA SSVVDCLITHPNVLNAAMLYWPM N LYVEGYALD
Sbjct  44    MIVPTGTGAAIGGFAGDALPVARALSSVVDCLITHPNVLNAAMLYWPMPNALYVEGYALD  103

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG WAL+PVHQNRVG+VLDAGIEE+LRIR LQV DAARASLGL  VEYTVTD PL V
Sbjct  104   RFAEGSWALQPVHQNRVGIVLDAGIEEELRIRQLQVADAARASLGLPVVEYTVTDTPLEV  163

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKW+DPK G+STGRI++PDSLLRAV+ LV  S VNAVAVV RFPDDD +D+D+YRQG+G+
Sbjct  164   EKWIDPKTGKSTGRIKHPDSLLRAVQTLVNRSKVNAVAVVGRFPDDDTDDVDEYRQGLGV  223

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEAVISHLVVK FQIPCAHAPA++P  LS S+ PKS +EEIGYTFLPCVLAGL  
Sbjct  224   DLLAGVEAVISHLVVKEFQIPCAHAPAMAPIPLSLSLSPKSAAEEIGYTFLPCVLAGLSK  283

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL+  +E + K CI AS+VDS++LP DACGG+G LAFA + +N+PLII VEENETVL
Sbjct  284   APQYLVMHSESMEKGCILASEVDSIVLPKDACGGEGTLAFARNAKNKPLIITVEENETVL  343

Query  196   NDTPERLGIE  167
             +DT ++LG+E
Sbjct  344   DDTADKLGLE  353



>ref|XP_008467151.1| PREDICTED: uncharacterized protein LOC103504573 [Cucumis melo]
Length=411

 Score =   459 bits (1180),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 242/312 (78%), Positives = 275/312 (88%), Gaps = 0/312 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GAAIGGYAGDALPVARA +SVVDCLITHPNVLNAAMLYWPM NVLYVEGYALD
Sbjct  47    MIVPTGVGAAIGGYAGDALPVARALASVVDCLITHPNVLNAAMLYWPMQNVLYVEGYALD  106

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG WAL+PVHQNRVGLVLDAG+E++LRIRHLQV DAARASLGL  +EY VTD PL+V
Sbjct  107   RFAEGSWALQPVHQNRVGLVLDAGMEKELRIRHLQVADAARASLGLPVMEYVVTDTPLVV  166

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKW+D   GQSTGRI++P SLLRAV+ L+  S VNAVAVV RFPDDD E+ D+YRQGMG+
Sbjct  167   EKWIDLTTGQSTGRIRHPASLLRAVQTLINRSKVNAVAVVGRFPDDDVEEADNYRQGMGV  226

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D LAGVEA+ISHLVVK FQIPCAHAPALSP  L TS+ PKS +EE+G+TFLPCVL+GL  
Sbjct  227   DTLAGVEAIISHLVVKEFQIPCAHAPALSPTPLCTSLSPKSAAEELGFTFLPCVLSGLSN  286

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL K  + LGK+C+ A+DVDSVI+PI+ACGGDG LAFA SK+ +PLIIAVEEN+TVL
Sbjct  287   APQYLSKNFDSLGKDCLLANDVDSVIVPINACGGDGTLAFARSKQYKPLIIAVEENDTVL  346

Query  196   NDTPERLGIEAV  161
             +D+PE LGIEAV
Sbjct  347   SDSPESLGIEAV  358



>gb|KGN51510.1| hypothetical protein Csa_5G571530 [Cucumis sativus]
Length=414

 Score =   458 bits (1179),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 241/312 (77%), Positives = 275/312 (88%), Gaps = 0/312 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GAAIGGYAGDALPVARA +SVVDCLITHPNVLNAAMLYWPM NVLYVEGYALD
Sbjct  51    MIVPTGVGAAIGGYAGDALPVARALASVVDCLITHPNVLNAAMLYWPMQNVLYVEGYALD  110

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG WAL+PVHQNRVGLVLDAG+E++L+IRHLQV DAARASLGL  +EY VTD PL+V
Sbjct  111   RFAEGSWALQPVHQNRVGLVLDAGMEKELQIRHLQVADAARASLGLPVMEYVVTDTPLVV  170

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKW+D   GQSTGRI++P SLLRAV+ L+  S VNAVAVV RFPDDD E+ D YRQGMG+
Sbjct  171   EKWIDRTTGQSTGRIRHPASLLRAVQTLMNRSKVNAVAVVGRFPDDDVEEEDSYRQGMGV  230

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D LAGVEA+ISHLVVK FQIPCAHAPALSP  L TS+ PKS +EE+G+TFLPCVL+GL  
Sbjct  231   DTLAGVEAIISHLVVKEFQIPCAHAPALSPTPLCTSLSPKSAAEELGFTFLPCVLSGLSN  290

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL K ++ LGK+C+ A+DVDSVI+PI+ACGGDG LAFA SK+ +PLIIAVEEN+TVL
Sbjct  291   APQYLSKNSDSLGKDCLLANDVDSVIVPINACGGDGTLAFARSKQYKPLIIAVEENDTVL  350

Query  196   NDTPERLGIEAV  161
             +D+PE LGIEAV
Sbjct  351   SDSPESLGIEAV  362



>ref|XP_009357770.1| PREDICTED: uncharacterized protein LOC103948462 [Pyrus x bretschneideri]
 ref|XP_009357775.1| PREDICTED: uncharacterized protein LOC103948462 [Pyrus x bretschneideri]
Length=407

 Score =   457 bits (1176),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 250/314 (80%), Positives = 270/314 (86%), Gaps = 2/314 (1%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTGIGAAIGG AGDALPVAR  SSVVDCLI HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  47    MIVPTGIGAAIGGSAGDALPVARTLSSVVDCLIAHPNVLNAAMLYWPMPNALYVEGYALD  106

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEGLW L PVHQN+VGLVLD GIEE+LR+RHLQV DAARASLGL  VEY VTD PL V
Sbjct  107   RFAEGLWGLMPVHQNKVGLVLDCGIEEELRVRHLQVADAARASLGLPVVEYVVTDTPLQV  166

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             EKWVDPK  QSTGRI++PDSLLRAV+ LVK S VNAVAVV RFP DDD  D DDYRQGMG
Sbjct  167   EKWVDPKTRQSTGRIKHPDSLLRAVQALVKHSQVNAVAVVGRFPDDDDVHDTDDYRQGMG  226

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             IDLLAGVEAVISHLVVK FQIPCAHAPALSP  ++ S+CPKS +EE+GYTFLPCVLAGL 
Sbjct  227   IDLLAGVEAVISHLVVKEFQIPCAHAPALSPLPMTPSLCPKSAAEELGYTFLPCVLAGLS  286

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQYL+K +E     CI ASDVDSVILP DA GG GA+AFA SKRN+PLIIAV+ENETV
Sbjct  287   NAPQYLVKNSES-ENGCILASDVDSVILPRDAFGGHGAIAFARSKRNKPLIIAVDENETV  345

Query  199   LNDTPERLGIEAVS  158
             L+DTP++ GIEAV+
Sbjct  346   LDDTPDKFGIEAVN  359



>ref|XP_011038673.1| PREDICTED: uncharacterized protein LOC105135486 [Populus euphratica]
Length=410

 Score =   457 bits (1175),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 242/313 (77%), Positives = 271/313 (87%), Gaps = 0/313 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GA+IGG+AGDALPVARA S+VVDCLITHPNVLNAAMLYWPM NVLYVEGYALD
Sbjct  47    MIVPTGVGASIGGFAGDALPVARALSTVVDCLITHPNVLNAAMLYWPMPNVLYVEGYALD  106

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEGLWAL+PVHQN+VGLVLD GIEE+LRI HLQV DA RASLGL  +EY VTD PL V
Sbjct  107   RFAEGLWALQPVHQNKVGLVLDGGIEEELRIHHLQVADATRASLGLPVLEYIVTDTPLEV  166

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKWVD K GQSTGRI++P +LLRAV+ L+  S VNAVAVV RFPDDD ED+DDYRQG+GI
Sbjct  167   EKWVDSKTGQSTGRIKHPGALLRAVQTLINRSQVNAVAVVGRFPDDDVEDVDDYRQGVGI  226

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEAVISHLVVK FQIPCAHAPA+ P  L+  +CPKS +EEIGYTFLPCVL GL  
Sbjct  227   DLLAGVEAVISHLVVKEFQIPCAHAPAMLPLLLTEDLCPKSAAEEIGYTFLPCVLTGLSK  286

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL+K ++ L K C+ ASDVDSV+LPI+AC GDGALAFA  K N+PLII VEENETVL
Sbjct  287   APQYLVKDSQSLEKGCLLASDVDSVVLPINACAGDGALAFARGKINKPLIITVEENETVL  346

Query  196   NDTPERLGIEAVS  158
             +DTP++LGIE V 
Sbjct  347   DDTPDKLGIETVK  359



>ref|XP_003533109.1| PREDICTED: uncharacterized protein LOC100787317 [Glycine max]
 gb|KHN36418.1| Putative lipoprotein [Glycine soja]
Length=410

 Score =   456 bits (1174),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 244/310 (79%), Positives = 271/310 (87%), Gaps = 0/310 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTGIGAAIGGYAGDALPVARA SSVVDCLI+HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  47    MIVPTGIGAAIGGYAGDALPVARALSSVVDCLISHPNVLNAAMLYWPMPNALYVEGYALD  106

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEGLWAL+PVHQNRVGLVLDAGIE++LRIR LQV DAARASLGL  VEY VTD+PL V
Sbjct  107   RFAEGLWALQPVHQNRVGLVLDAGIEDELRIRQLQVADAARASLGLPVVEYIVTDIPLKV  166

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKWVDP+ GQSTGRI++PDSLLRAV  L+  S VNA+AVV RFPDDD +D+DDYRQGMGI
Sbjct  167   EKWVDPETGQSTGRIKHPDSLLRAVHTLLSRSKVNAIAVVGRFPDDDTDDVDDYRQGMGI  226

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEAVISHLVVK FQIPCAHAPA+SP  +S S+ PKS +EEIGYTFLPCVLAGL  
Sbjct  227   DLLAGVEAVISHLVVKEFQIPCAHAPAMSPLPMSLSLSPKSAAEEIGYTFLPCVLAGLSN  286

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL+  ++ L K CI ASDVDSVILP DACGGD +LAFA +K  +PLII VEEN+TVL
Sbjct  287   APQYLVMDSKCLEKGCILASDVDSVILPKDACGGDASLAFARNKNKKPLIITVEENQTVL  346

Query  196   NDTPERLGIE  167
             +DT ++ G+E
Sbjct  347   DDTADKFGLE  356



>gb|EYU22304.1| hypothetical protein MIMGU_mgv1a005518mg [Erythranthe guttata]
Length=477

 Score =   451 bits (1161),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 249/318 (78%), Positives = 278/318 (87%), Gaps = 7/318 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GAAIGGYAGDALPVARA +SVVDCLI+HPNVLNAAMLYWPMSNVLYVEGYALD
Sbjct  100   MIVPTGVGAAIGGYAGDALPVARALASVVDCLISHPNVLNAAMLYWPMSNVLYVEGYALD  159

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEGLW LEPVHQN+VGLVLDAGIEE LR+RHLQVVDAARASLGL  +EYTVTD  L V
Sbjct  160   RFAEGLWGLEPVHQNKVGLVLDAGIEESLRVRHLQVVDAARASLGLPVIEYTVTDAALQV  219

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP--ddddedidDYRQGM  563
             EKW+DPK GQSTGRIQ PDSLLRAV  LV+ S VNAVAVVARFP  D+ D+D+++YRQG 
Sbjct  220   EKWIDPKSGQSTGRIQRPDSLLRAVGTLVERSGVNAVAVVARFPDDDNSDDDVENYRQGK  279

Query  562   GIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGL  383
             GID+LAGVEAVISHLVV+ F+IPCAHAPAL P  LS S+CPKS +EEIGYTFLPCVLAGL
Sbjct  280   GIDVLAGVEAVISHLVVEKFKIPCAHAPALLPFPLSPSLCPKSAAEEIGYTFLPCVLAGL  339

Query  382   GTAPQYLIKGTEILGK---NCISASDVDSVILPIDACGGDGALAFANSKRN-RPLIIAVE  215
              +APQYL++  E LG+   + +  SDVDSVILP+DA GGD ALAFA+ + N RPLIIAVE
Sbjct  340   SSAPQYLVQ-KESLGRMSSSIVVGSDVDSVILPVDAFGGDAALAFASMRNNRRPLIIAVE  398

Query  214   ENETVLNDTPERLGIEAV  161
             ENETVL+DTPE+LGI AV
Sbjct  399   ENETVLSDTPEKLGITAV  416



>ref|XP_007153288.1| hypothetical protein PHAVU_003G022800g [Phaseolus vulgaris]
 gb|ESW25282.1| hypothetical protein PHAVU_003G022800g [Phaseolus vulgaris]
Length=401

 Score =   449 bits (1154),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 241/310 (78%), Positives = 264/310 (85%), Gaps = 0/310 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTGI AAIGGYAGDALPVARA SSVVDCLI+HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  43    MIVPTGIAAAIGGYAGDALPVARALSSVVDCLISHPNVLNAAMLYWPMPNALYVEGYALD  102

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG WAL+PVHQNRVGLVLDAGIEE+LR+R LQV DA RASLGL  VEYTVTD PL V
Sbjct  103   RFAEGSWALQPVHQNRVGLVLDAGIEEELRVRQLQVADAVRASLGLPVVEYTVTDTPLKV  162

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKWVDPK GQSTGRI++PDSL RAV  LVK S VNA+AVV RFPDD+ +D+DDYR GMGI
Sbjct  163   EKWVDPKTGQSTGRIKHPDSLSRAVNTLVKRSKVNAIAVVGRFPDDEIDDVDDYRLGMGI  222

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEAVISH VVK FQIPCAHAPA+SP  +S S+ PKS +EEIGYTFLPCVLAGL  
Sbjct  223   DLLAGVEAVISHQVVKEFQIPCAHAPAMSPLPMSLSLSPKSAAEEIGYTFLPCVLAGLSN  282

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL   ++ L K CI A+DVDSVILP DACGGD  LAFA +K  +PLII VEENETVL
Sbjct  283   APQYLAMDSKSLEKGCILANDVDSVILPKDACGGDACLAFARNKSKKPLIITVEENETVL  342

Query  196   NDTPERLGIE  167
             +DT ++ G+E
Sbjct  343   DDTADKFGLE  352



>ref|XP_010667199.1| PREDICTED: uncharacterized protein LOC104884274 [Beta vulgaris 
subsp. vulgaris]
Length=412

 Score =   447 bits (1150),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 237/313 (76%), Positives = 266/313 (85%), Gaps = 0/313 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GAAIGGYAGDALPVARA +SVVDCLI+HPN LNAAMLYWPM N LYVEGYALD
Sbjct  53    MIVPTGVGAAIGGYAGDALPVARALASVVDCLISHPNALNAAMLYWPMPNTLYVEGYALD  112

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA+G WALEPVHQNRVGLVLDA IE +LR+RHLQV DAARASLGL  +EYTVTD PL V
Sbjct  113   QFAKGAWALEPVHQNRVGLVLDAAIEMELRMRHLQVADAARASLGLPVLEYTVTDQPLEV  172

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKW+DPK GQSTGRI++PDSLLRAV+ LV  S VNAVAVV RFPDDD+  + DYRQG+G+
Sbjct  173   EKWIDPKTGQSTGRIKHPDSLLRAVQSLVDRSQVNAVAVVGRFPDDDENSMHDYRQGIGV  232

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D LAGVEA+ISHLVVK FQIPCAHAPAL P  L+ SV PKS +EEIGYTFLPCVLAGL  
Sbjct  233   DTLAGVEAIISHLVVKEFQIPCAHAPALLPVPLNQSVSPKSAAEEIGYTFLPCVLAGLSN  292

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL+  ++     CI A+DVDSVILPIDAC G+G L+FA  K+N+PLIIAVEEN TVL
Sbjct  293   APQYLVTNSDARDNGCIFANDVDSVILPIDACAGNGVLSFAKKKKNKPLIIAVEENTTVL  352

Query  196   NDTPERLGIEAVS  158
              DTP+RL IE V+
Sbjct  353   IDTPDRLHIETVN  365



>ref|XP_004150481.1| PREDICTED: uncharacterized lipoprotein syc1174_c-like [Cucumis 
sativus]
Length=439

 Score =   445 bits (1144),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 241/337 (72%), Positives = 275/337 (82%), Gaps = 25/337 (7%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GAAIGGYAGDALPVARA +SVVDCLITHPNVLNAAMLYWPM NVLYVEGYALD
Sbjct  51    MIVPTGVGAAIGGYAGDALPVARALASVVDCLITHPNVLNAAMLYWPMQNVLYVEGYALD  110

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLM-  740
             RFAEG WAL+PVHQNRVGLVLDAG+E++L+IRHLQV DAARASLGL  +EY VTD PL+ 
Sbjct  111   RFAEGSWALQPVHQNRVGLVLDAGMEKELQIRHLQVADAARASLGLPVMEYVVTDTPLVY  170

Query  739   ------------------------VEKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVN  632
                                     VEKW+D   GQSTGRI++P SLLRAV+ L+  S VN
Sbjct  171   ESHKLANFEYFDYEEHYEVMLSRSVEKWIDRTTGQSTGRIRHPASLLRAVQTLMNRSKVN  230

Query  631   AVAVVARFPddddedidDYRQGMGIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLST  452
             AVAVV RFPDDD E+ D YRQGMG+D LAGVEA+ISHLVVK FQIPCAHAPALSP  L T
Sbjct  231   AVAVVGRFPDDDVEEEDSYRQGMGVDTLAGVEAIISHLVVKEFQIPCAHAPALSPTPLCT  290

Query  451   SVCPKSVSEEIGYTFLPCVLAGLGTAPQYLIKGTEILGKNCISASDVDSVILPIDACGGD  272
             S+ PKS +EE+G+TFLPCVL+GL  APQYL K ++ LGK+C+ A+DVDSVI+PI+ACGGD
Sbjct  291   SLSPKSAAEELGFTFLPCVLSGLSNAPQYLSKNSDSLGKDCLLANDVDSVIVPINACGGD  350

Query  271   GALAFANSKRNRPLIIAVEENETVLNDTPERLGIEAV  161
             G LAFA SK+ +PLIIAVEEN+TVL+D+PE LGIEAV
Sbjct  351   GTLAFARSKQYKPLIIAVEENDTVLSDSPESLGIEAV  387



>ref|XP_004498326.1| PREDICTED: uncharacterized lipoprotein syc1174_c-like [Cicer 
arietinum]
Length=408

 Score =   443 bits (1140),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 241/312 (77%), Positives = 271/312 (87%), Gaps = 0/312 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTGIGAAIGG+AGDALPVARA SS+VDCLITHPNVLNAAMLYWPM N LYVEGYALD
Sbjct  45    MIVPTGIGAAIGGFAGDALPVARALSSLVDCLITHPNVLNAAMLYWPMPNALYVEGYALD  104

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG WAL+PVHQNRVG+VLDAGIEE+LRIR LQV DAARASLGL  VEY VTD PL V
Sbjct  105   RFAEGSWALQPVHQNRVGIVLDAGIEEELRIRQLQVADAARASLGLPVVEYIVTDTPLEV  164

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKW+DPK G+STGRI++PDSLLRAV+ LV  S VNA+AVV RFPDD+ +D+D+YRQG+G+
Sbjct  165   EKWIDPKTGKSTGRIKHPDSLLRAVQTLVNRSKVNAIAVVGRFPDDESDDVDEYRQGLGV  224

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEAVISHLVVK FQIPCAHAPA++P  LS S+ PKS +EEIGYTFLPCVLAGL  
Sbjct  225   DLLAGVEAVISHLVVKEFQIPCAHAPAMAPLPLSLSLSPKSAAEEIGYTFLPCVLAGLSK  284

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL+  +E   K CI ASDVDSVILP DACGGDG LAFA + +++PLII VEENETVL
Sbjct  285   APQYLVNNSESTEKGCIFASDVDSVILPKDACGGDGTLAFARNGKHKPLIITVEENETVL  344

Query  196   NDTPERLGIEAV  161
             +DT  +LG EA+
Sbjct  345   DDTAYKLGFEAL  356



>ref|XP_007227476.1| hypothetical protein PRUPE_ppa006456mg [Prunus persica]
 gb|EMJ28675.1| hypothetical protein PRUPE_ppa006456mg [Prunus persica]
Length=411

 Score =   442 bits (1138),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 251/314 (80%), Positives = 274/314 (87%), Gaps = 2/314 (1%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTGIGAAIGGYAGDALPVAR  SSVVDCLITHPNVLNAAMLYWPM N LYVEGYALD
Sbjct  47    MIVPTGIGAAIGGYAGDALPVARTLSSVVDCLITHPNVLNAAMLYWPMPNALYVEGYALD  106

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG W L PVHQNRVGLVLD+GIEE+LR+RHLQV DAARASLGL  VEY VTD PL V
Sbjct  107   RFAEGSWGLMPVHQNRVGLVLDSGIEEELRVRHLQVADAARASLGLPVVEYVVTDTPLQV  166

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARF-PddddedidDYRQGMG  560
             EKW+DPK GQSTGRI++PDSLLRAV+ L+K S VNA+AVV RF  DDD +D DDYR+GMG
Sbjct  167   EKWIDPKSGQSTGRIKHPDSLLRAVQALLKRSQVNAIAVVGRFTDDDDVQDTDDYRKGMG  226

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             IDLLAGVEAVISHLVVK FQIPCAHAPALSP  LS S+CPKS +EE+GYTFLPCVLAGL 
Sbjct  227   IDLLAGVEAVISHLVVKEFQIPCAHAPALSPLPLSPSLCPKSAAEELGYTFLPCVLAGLS  286

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQYL+K +E     CI ASDVDSVILP+DA GGDG LAFA SKRN+PLIIAVEENETV
Sbjct  287   NAPQYLVKNSES-ENGCILASDVDSVILPVDAFGGDGVLAFARSKRNKPLIIAVEENETV  345

Query  199   LNDTPERLGIEAVS  158
             L+DTP+++G+EAV 
Sbjct  346   LDDTPDKVGVEAVK  359



>ref|XP_008243344.1| PREDICTED: uncharacterized protein LOC103341579 [Prunus mume]
Length=405

 Score =   440 bits (1131),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 250/314 (80%), Positives = 273/314 (87%), Gaps = 2/314 (1%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTGIGAAIGGYAGDALPVAR  SSVVDCLITHPNVLNAAMLYWPM N LYVEGYALD
Sbjct  47    MIVPTGIGAAIGGYAGDALPVARTLSSVVDCLITHPNVLNAAMLYWPMPNALYVEGYALD  106

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG W L PVHQNRVGLVLD+GIEE+LR+RHLQV DAARASLGL  VEY VTD PL V
Sbjct  107   RFAEGSWGLMPVHQNRVGLVLDSGIEEELRVRHLQVADAARASLGLPVVEYVVTDTPLQV  166

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             EKW+DPK GQSTGRI++PDSLLRAV+ L+K S VNA+AVV RF  DDD +D DDYR+GMG
Sbjct  167   EKWIDPKSGQSTGRIKHPDSLLRAVQALLKRSQVNAIAVVGRFSDDDDVQDTDDYRKGMG  226

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             IDLLAGVEAVISHLVVK FQIPCAHAPALSP  LS S+CPKS +EE+GYTFLPCVLAGL 
Sbjct  227   IDLLAGVEAVISHLVVKEFQIPCAHAPALSPLPLSPSLCPKSAAEELGYTFLPCVLAGLS  286

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQYL+K +E     CI ASDVDSVILP+DA GGDG LAFA SKRN+PLIIAVEEN TV
Sbjct  287   NAPQYLVKNSES-ENGCILASDVDSVILPVDAFGGDGVLAFARSKRNKPLIIAVEENGTV  345

Query  199   LNDTPERLGIEAVS  158
             L+DTP+++G+EAV 
Sbjct  346   LDDTPDKVGVEAVK  359



>ref|XP_010916350.1| PREDICTED: uncharacterized protein LOC105041190 isoform X1 [Elaeis 
guineensis]
Length=425

 Score =   440 bits (1132),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 233/313 (74%), Positives = 268/313 (86%), Gaps = 1/313 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GA+IGG+AGDALPVAR  +SV DC+I+HPNVLNAAMLYWPM NVLYVEGYALD
Sbjct  55    LIVPTGVGASIGGFAGDALPVARTLASVADCVISHPNVLNAAMLYWPMPNVLYVEGYALD  114

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG WAL+PVHQN+VGLVLDAG+EE+LRIRHLQV DA RASLGL  VEY VTD PL V
Sbjct  115   RFAEGSWALQPVHQNKVGLVLDAGMEEELRIRHLQVADATRASLGLPIVEYMVTDAPLKV  174

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             E W+DPKCG+STGRI++PDSLLRAV+ LV  S +NAVAVV RFPDDD ED++DYR G G+
Sbjct  175   ETWIDPKCGKSTGRIKHPDSLLRAVQTLVSHSHINAVAVVGRFPDDDMEDMEDYRLGKGV  234

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D LAGVEA+ISHLVVK FQIPCAHAPA+SP  L T + P+S +EE+GYTFLPCVLAGL  
Sbjct  235   DSLAGVEAIISHLVVKEFQIPCAHAPAVSPIPLRTLLSPRSAAEELGYTFLPCVLAGLSC  294

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANS-KRNRPLIIAVEENETV  200
             APQY+ K    L  +CI+AS+VDSV+LP DACGGDGALAFA S   N+PLIIAV+ENETV
Sbjct  295   APQYVTKKHGSLDSDCIAASNVDSVMLPADACGGDGALAFARSMTNNKPLIIAVQENETV  354

Query  199   LNDTPERLGIEAV  161
             L+DTPE+ GIE V
Sbjct  355   LDDTPEKFGIEVV  367



>ref|XP_006845280.1| hypothetical protein AMTR_s00005p00266220 [Amborella trichopoda]
 gb|ERN06955.1| hypothetical protein AMTR_s00005p00266220 [Amborella trichopoda]
Length=413

 Score =   440 bits (1131),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 235/312 (75%), Positives = 269/312 (86%), Gaps = 0/312 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GA+IGGYAGDALPVARA SS+VD LI+HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  52    LIVPTGVGASIGGYAGDALPVARALSSIVDTLISHPNVLNAAMLYWPMPNTLYVEGYALD  111

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG+WAL+PV QN+VGLVLD+GIEE+LRIRHLQV DAARASLGL   +Y VTD PL V
Sbjct  112   RFAEGIWALQPVLQNKVGLVLDSGIEEELRIRHLQVADAARASLGLPLWDYIVTDTPLEV  171

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKWV+P  GQSTGRI++PDSLLR+V+ LV+ S VNAVAVV RFPDD  EDIDDYR G GI
Sbjct  172   EKWVNPVSGQSTGRIRHPDSLLRSVDSLVRYSQVNAVAVVGRFPDDGLEDIDDYRHGKGI  231

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEAVISHLVV+ FQIPCAHAPALSP  L  ++CPKS +EEIGYTFLPC+LAGL  
Sbjct  232   DLLAGVEAVISHLVVQKFQIPCAHAPALSPVPLDPTLCPKSAAEEIGYTFLPCILAGLSR  291

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQY+++G       C+ +SDVDSVI+PIDACGG+G LAFA   + +PLIIAVEENETVL
Sbjct  292   APQYVVRGAGSSESGCLLSSDVDSVIVPIDACGGEGTLAFAKQAKKKPLIIAVEENETVL  351

Query  196   NDTPERLGIEAV  161
             N+TP++LGIEAV
Sbjct  352   NETPDKLGIEAV  363



>gb|EYU22303.1| hypothetical protein MIMGU_mgv1a005518mg [Erythranthe guttata]
Length=480

 Score =   439 bits (1130),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 246/321 (77%), Positives = 276/321 (86%), Gaps = 10/321 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVL---NAAMLYWPMSNVLYVEGY  926
             MIVPTG+GAAIGGYAGDALPVARA +SVVDCLI+HPN+L     AMLYWPMSNVLYVEGY
Sbjct  100   MIVPTGVGAAIGGYAGDALPVARALASVVDCLISHPNLLLFFIKAMLYWPMSNVLYVEGY  159

Query  925   ALDRFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLP  746
             ALDRFAEGLW LEPVHQN+VGLVLDAGIEE LR+RHLQVVDAARASLGL  +EYTVTD  
Sbjct  160   ALDRFAEGLWGLEPVHQNKVGLVLDAGIEESLRVRHLQVVDAARASLGLPVIEYTVTDAA  219

Query  745   LMVEKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP--ddddedidDYR  572
             L VEKW+DPK GQSTGRIQ PDSLLRAV  LV+ S VNAVAVVARFP  D+ D+D+++YR
Sbjct  220   LQVEKWIDPKSGQSTGRIQRPDSLLRAVGTLVERSGVNAVAVVARFPDDDNSDDDVENYR  279

Query  571   QGMGIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVL  392
             QG GID+LAGVEAVISHLVV+ F+IPCAHAPAL P  LS S+CPKS +EEIGYTFLPCVL
Sbjct  280   QGKGIDVLAGVEAVISHLVVEKFKIPCAHAPALLPFPLSPSLCPKSAAEEIGYTFLPCVL  339

Query  391   AGLGTAPQYLIKGTEILGK---NCISASDVDSVILPIDACGGDGALAFANSKRN-RPLII  224
             AGL +APQYL++  E LG+   + +  SDVDSVILP+DA GGD ALAFA+ + N RPLII
Sbjct  340   AGLSSAPQYLVQ-KESLGRMSSSIVVGSDVDSVILPVDAFGGDAALAFASMRNNRRPLII  398

Query  223   AVEENETVLNDTPERLGIEAV  161
             AVEENETVL+DTPE+LGI AV
Sbjct  399   AVEENETVLSDTPEKLGITAV  419



>ref|XP_002455248.1| hypothetical protein SORBIDRAFT_03g007150 [Sorghum bicolor]
 gb|EES00368.1| hypothetical protein SORBIDRAFT_03g007150 [Sorghum bicolor]
Length=428

 Score =   436 bits (1120),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 228/316 (72%), Positives = 267/316 (84%), Gaps = 2/316 (1%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GAA+GG+AGDALPVARA + V DC+I+HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  50    LIVPTGVGAAVGGFAGDALPVARALAGVADCVISHPNVLNAAMLYWPMPNTLYVEGYALD  109

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG WAL+PVHQN+VGLVLD+GIEEDLR+RHLQV DA RASLGL  VEY VTD PL +
Sbjct  110   RFAEGSWALQPVHQNKVGLVLDSGIEEDLRLRHLQVADATRASLGLPVVEYIVTDAPLEI  169

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             + W DP+CG+STG + N DSLLRAV+ LV  SDVNAVAVVARFPDDD ED D YR+G G+
Sbjct  170   KTWFDPRCGKSTGSVGNSDSLLRAVDALVTHSDVNAVAVVARFPDDDPEDSDCYREGKGV  229

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEA+ISHL+VK F+IPCAHAPA+ PP LS SVCP+S +EEIGYTFLPCVLAGL  
Sbjct  230   DLLAGVEAIISHLIVKEFKIPCAHAPAVLPPSLSPSVCPRSAAEEIGYTFLPCVLAGLSN  289

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFAN-SKRNRPLIIAVEENETV  200
             APQY+++    L   CI A  VDSVILP D+CGGDG LAFA  +++N+PLII V+ENETV
Sbjct  290   APQYVMRKGS-LDNGCIVAGAVDSVILPKDSCGGDGTLAFARAARKNKPLIITVQENETV  348

Query  199   LNDTPERLGIEAVSTR  152
             L+DTP++ GIEA++ R
Sbjct  349   LDDTPDKFGIEALNVR  364



>emb|CBI26918.3| unnamed protein product [Vitis vinifera]
Length=338

 Score =   432 bits (1110),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 224/296 (76%), Positives = 248/296 (84%), Gaps = 2/296 (1%)
 Frame = -1

Query  1039  PVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALDRFAEGLWALEPVHQNRVGL  860
             PVARA +SVVDCLI+HPNVLNAAMLYWP+ NVLYV GYALDRFAEGLWAL+PVHQNRVGL
Sbjct  39    PVARALASVVDCLISHPNVLNAAMLYWPVPNVLYVVGYALDRFAEGLWALQPVHQNRVGL  98

Query  859   VLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMVEKWVDPKCGQSTGRIQNPD  680
             VLDA IE +LR+RHLQV DA RASLGL  +EY VTD PL+VEKWVDPK GQSTGRI++PD
Sbjct  99    VLDAAIEGELRLRHLQVADATRASLGLPVLEYIVTDTPLLVEKWVDPKSGQSTGRIKHPD  158

Query  679   SLLRAVEKLVKGSDVNAVAVVARFPddddedidDYR--QGMGIDLLAGVEAVISHLVVKH  506
             SL RAV+ LV  + VNAVAVV  F DDD +D D  R  Q  GID LAGVEAVISHLVVK 
Sbjct  159   SLPRAVQTLVNRTKVNAVAVVGCFSDDDLKDADYLRLNQCWGIDDLAGVEAVISHLVVKE  218

Query  505   FQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGTAPQYLIKGTEILGKNCI  326
             FQIPCAHAPALSP  LS S+CPKS ++EIGYTFL CVLAGL  APQY++K +E L K CI
Sbjct  219   FQIPCAHAPALSPFPLSLSLCPKSAAKEIGYTFLLCVLAGLSNAPQYVVKNSESLEKGCI  278

Query  325   SASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVLNDTPERLGIEAVS  158
              ASDVDSVILP+DAC GDGALAFA SK+++PLII VEENETVLNDTPE+ GIE V 
Sbjct  279   LASDVDSVILPMDACEGDGALAFARSKKDKPLIITVEENETVLNDTPEKYGIEVVK  334



>ref|XP_009797528.1| PREDICTED: uncharacterized protein LOC104243942 isoform X2 [Nicotiana 
sylvestris]
Length=321

 Score =   427 bits (1098),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 216/271 (80%), Positives = 236/271 (87%), Gaps = 1/271 (0%)
 Frame = -1

Query  970  MLYWPMSNVLYVEGYALDRFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARA  791
            MLYWPM N LYVEGYALDRFAEGLW L+PVHQNRVGLV DAGIE++L IRHLQVVDA RA
Sbjct  1    MLYWPMPNALYVEGYALDRFAEGLWGLQPVHQNRVGLVFDAGIEKELLIRHLQVVDATRA  60

Query  790  SLGLSFVEYTVTDLPLMVEKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVAR  611
            SLGL  V YTVTD PL+VEKWVDP  GQSTGRIQ PDSLLRAVE L   S VNAVAVVAR
Sbjct  61   SLGLPIVGYTVTDTPLLVEKWVDPTSGQSTGRIQRPDSLLRAVETLQNKSKVNAVAVVAR  120

Query  610  FPddddedidDYRQGMGIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSV  431
            FPDDD ED+DDYRQG+G+DLLAGVEAVISHLVVK+FQIPCAHAPA+ PPQLS S+CPKS 
Sbjct  121  FPDDDTEDLDDYRQGVGVDLLAGVEAVISHLVVKNFQIPCAHAPAVLPPQLSMSLCPKSA  180

Query  430  SEEIGYTFLPCVLAGLGTAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFAN  251
            +EEIG+TFLPCVLA L TAPQYL+KG     ++CI A DVDSVI+PIDACGGDG LAFAN
Sbjct  181  AEEIGFTFLPCVLAELSTAPQYLVKGNN-FSEDCIVAGDVDSVIVPIDACGGDGVLAFAN  239

Query  250  SKRNRPLIIAVEENETVLNDTPERLGIEAVS  158
             KR++PLIIAVEEN+TVLNDTP+ LGIEAV 
Sbjct  240  GKRHKPLIIAVEENQTVLNDTPDSLGIEAVK  270



>ref|NP_001041903.2| Os01g0127400 [Oryza sativa Japonica Group]
 dbj|BAF03817.2| Os01g0127400 [Oryza sativa Japonica Group]
Length=397

 Score =   429 bits (1103),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 225/316 (71%), Positives = 266/316 (84%), Gaps = 1/316 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             ++VPTG+GAA+GG+AGDALPVARA  +V DC+I+HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  48    LVVPTGVGAAVGGFAGDALPVARALGAVADCVISHPNVLNAAMLYWPMPNTLYVEGYALD  107

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG WAL+PVHQN+VGLVLD+GIEE+LR+RHLQV DAARASLGL  VEY VTD PL +
Sbjct  108   RFAEGSWALQPVHQNKVGLVLDSGIEEELRLRHLQVADAARASLGLPVVEYIVTDTPLEI  167

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             + W DPKCG+STG + N DSLLRAVE LV  SDVNAVAVVARFPDDD ED D YR+G G+
Sbjct  168   KTWFDPKCGKSTGSVGNSDSLLRAVEALVNRSDVNAVAVVARFPDDDPEDSDCYREGKGV  227

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEA+ISHL+VK F+IP AHAPA+ PP LS SV P+S +EEIG+TFLPCVLAGL  
Sbjct  228   DLLAGVEAIISHLIVKKFKIPAAHAPAVLPPVLSLSVSPRSAAEEIGHTFLPCVLAGLSN  287

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANS-KRNRPLIIAVEENETV  200
             APQY+++    +   CI ASDVDSVILP DACGGDG +AFA +  +N+PLII V+ENETV
Sbjct  288   APQYVMRRNGNMDNGCIVASDVDSVILPKDACGGDGTIAFARTATKNKPLIITVQENETV  347

Query  199   LNDTPERLGIEAVSTR  152
             L+DTP++  IEA++ +
Sbjct  348   LDDTPDKFNIEALNVQ  363



>gb|EEC69865.1| hypothetical protein OsI_00224 [Oryza sativa Indica Group]
Length=536

 Score =   432 bits (1112),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 227/316 (72%), Positives = 267/316 (84%), Gaps = 1/316 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             ++VPTG+GAA+GG+AGDALPVARA  +V DC+I+HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  48    LVVPTGVGAAVGGFAGDALPVARALGAVADCVISHPNVLNAAMLYWPMPNTLYVEGYALD  107

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG WAL+PVHQN+VGLVLD+GIEE+LR+RHLQV DAARASLGL  VEY VTD PL +
Sbjct  108   RFAEGSWALQPVHQNKVGLVLDSGIEEELRLRHLQVADAARASLGLPVVEYIVTDTPLEI  167

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             + W DPKCG+STG + N DSLLRAVE LV  SDVNAVAVVARFPDDD ED D YR+G G+
Sbjct  168   KTWFDPKCGKSTGSVGNSDSLLRAVEALVNRSDVNAVAVVARFPDDDPEDSDCYREGKGV  227

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEA+ISHL+VK F+IP AHAPA+ PP LS SV P+S +EEIG+TFLPCVLAGL  
Sbjct  228   DLLAGVEAIISHLIVKKFKIPAAHAPAVLPPVLSLSVSPRSAAEEIGHTFLPCVLAGLSN  287

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANS-KRNRPLIIAVEENETV  200
             APQY+++    +   CI ASDVDSVILP DACGGDG +AFA +  +N+PLII V+ENETV
Sbjct  288   APQYVMRRNGNMDNGCIVASDVDSVILPKDACGGDGTIAFARTATKNKPLIITVQENETV  347

Query  199   LNDTPERLGIEAVSTR  152
             L+DTP++  IEAVS++
Sbjct  348   LDDTPDKFNIEAVSSQ  363



>tpg|DAA53628.1| TPA: hypothetical protein ZEAMMB73_031072 [Zea mays]
Length=428

 Score =   428 bits (1101),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 224/316 (71%), Positives = 267/316 (84%), Gaps = 2/316 (1%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTG+GAA+GG+AGDALPVARA + V DC+I+HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  50    LIIPTGVGAAVGGFAGDALPVARAVAGVADCVISHPNVLNAAMLYWPMPNTLYVEGYALD  109

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG WAL+PVHQN+VGLVLD+GIEEDLR+RHLQ+ DA RASLGL  VEY VTD PL +
Sbjct  110   RFAEGSWALQPVHQNKVGLVLDSGIEEDLRLRHLQIADATRASLGLPVVEYIVTDAPLEI  169

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             + W DP+CG+STG + N DSLLRAV+ LVK SDVNAVAVVARFPDDD ED D YR+G G+
Sbjct  170   KTWFDPRCGKSTGSVGNSDSLLRAVDALVKHSDVNAVAVVARFPDDDPEDSDCYREGKGV  229

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEA+ISHLVVK F+IP AHAPA+ PP LS  VCP+S +EEIG+TFLPCVLAGL  
Sbjct  230   DLLAGVEAIISHLVVKEFKIPSAHAPAVLPPPLSPLVCPRSAAEEIGHTFLPCVLAGLSN  289

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFAN-SKRNRPLIIAVEENETV  200
             APQY+++ +  L   CI A DVDSVILP D+CGGDG LAFA  +++++PLII V+ENETV
Sbjct  290   APQYVMR-SGTLDHGCIVAGDVDSVILPKDSCGGDGTLAFARAARKDKPLIITVQENETV  348

Query  199   LNDTPERLGIEAVSTR  152
             L+DTP++ GIE ++ R
Sbjct  349   LDDTPDKFGIEVLNVR  364



>ref|XP_004968053.1| PREDICTED: uncharacterized protein LOC101753270 [Setaria italica]
Length=429

 Score =   427 bits (1099),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 223/316 (71%), Positives = 265/316 (84%), Gaps = 1/316 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GAA+GG+AGDALPVAR  ++V DC+I+HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  50    LIVPTGVGAAVGGFAGDALPVARTLAAVSDCVISHPNVLNAAMLYWPMPNTLYVEGYALD  109

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG WAL+PVHQN+VGLVLD+GIEEDLR+RHLQV DAARASLGL  VEY VTD PL +
Sbjct  110   RFAEGSWALQPVHQNKVGLVLDSGIEEDLRLRHLQVADAARASLGLPVVEYIVTDAPLEI  169

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             + W DPKCG+STG + N DSLLRAV+ LV  +DVNAVAVV RFPDDD ED D YR+G G+
Sbjct  170   KTWFDPKCGKSTGSVGNSDSLLRAVDTLVNHADVNAVAVVTRFPDDDPEDSDCYREGKGV  229

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEA+ISHL+VK F+IP AHAPA+ PP LS  VCP+S +EEIGYTFLPCVLAGL  
Sbjct  230   DLLAGVEAIISHLIVKEFKIPAAHAPAVLPPPLSPLVCPRSAAEEIGYTFLPCVLAGLSN  289

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFAN-SKRNRPLIIAVEENETV  200
             APQY+++    L   C+ A DVDSVILP D+CGGDG LAFA  +++++PLII V+ENETV
Sbjct  290   APQYVMRRQGTLDSGCMVAGDVDSVILPKDSCGGDGTLAFARAARKHKPLIITVQENETV  349

Query  199   LNDTPERLGIEAVSTR  152
             L+DTP++  IEA++ R
Sbjct  350   LDDTPDKFSIEALNVR  365



>ref|XP_009596679.1| PREDICTED: uncharacterized protein LOC104092718 isoform X2 [Nicotiana 
tomentosiformis]
Length=326

 Score =   423 bits (1087),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 213/271 (79%), Positives = 235/271 (87%), Gaps = 1/271 (0%)
 Frame = -1

Query  970  MLYWPMSNVLYVEGYALDRFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARA  791
            MLYWPM N LYVEGYALDRFAEGLW L+PVHQNRVGLV DAGIE++L IRHLQVVDA RA
Sbjct  1    MLYWPMPNALYVEGYALDRFAEGLWGLQPVHQNRVGLVFDAGIEKELLIRHLQVVDATRA  60

Query  790  SLGLSFVEYTVTDLPLMVEKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVAR  611
            SLGL  V YTVTD PL+VEKWVDP  GQSTGRIQ PDSLLRAVE L     VNAVAVVAR
Sbjct  61   SLGLPIVGYTVTDTPLLVEKWVDPTSGQSTGRIQRPDSLLRAVENLQNKFKVNAVAVVAR  120

Query  610  FPddddedidDYRQGMGIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSV  431
            FPDDD ED+DDYRQG+G+DLLAGVEAVISHLVVK+FQ PCAHAPA+ PPQL+ S+CPKS 
Sbjct  121  FPDDDTEDLDDYRQGVGVDLLAGVEAVISHLVVKNFQFPCAHAPAVLPPQLNISLCPKSA  180

Query  430  SEEIGYTFLPCVLAGLGTAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFAN  251
            +EEIG+TFLPCVLAGL TAPQYL+KG     ++CI A DVDSVI+PIDACGGDG LAFAN
Sbjct  181  AEEIGFTFLPCVLAGLSTAPQYLVKGNN-FSEDCIVAGDVDSVIVPIDACGGDGVLAFAN  239

Query  250  SKRNRPLIIAVEENETVLNDTPERLGIEAVS  158
             KR++PLIIAVEEN+TVLN+TP+ LGIEAV 
Sbjct  240  GKRHKPLIIAVEENQTVLNETPDSLGIEAVK  270



>gb|EEE53796.1| hypothetical protein OsJ_00220 [Oryza sativa Japonica Group]
Length=562

 Score =   431 bits (1109),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 227/316 (72%), Positives = 267/316 (84%), Gaps = 1/316 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             ++VPTG+GAA+GG+AGDALPVARA  +V DC+I+HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  74    LVVPTGVGAAVGGFAGDALPVARALGAVADCVISHPNVLNAAMLYWPMPNTLYVEGYALD  133

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG WAL+PVHQN+VGLVLD+GIEE+LR+RHLQV DAARASLGL  VEY VTD PL +
Sbjct  134   RFAEGSWALQPVHQNKVGLVLDSGIEEELRLRHLQVADAARASLGLPVVEYIVTDTPLEI  193

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             + W DPKCG+STG + N DSLLRAVE LV  SDVNAVAVVARFPDDD ED D YR+G G+
Sbjct  194   KTWFDPKCGKSTGSVGNSDSLLRAVEALVNRSDVNAVAVVARFPDDDPEDSDCYREGKGV  253

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEA+ISHL+VK F+IP AHAPA+ PP LS SV P+S +EEIG+TFLPCVLAGL  
Sbjct  254   DLLAGVEAIISHLIVKKFKIPAAHAPAVLPPVLSLSVSPRSAAEEIGHTFLPCVLAGLSN  313

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANS-KRNRPLIIAVEENETV  200
             APQY+++    +   CI ASDVDSVILP DACGGDG +AFA +  +N+PLII V+ENETV
Sbjct  314   APQYVMRRNGNMDNGCIVASDVDSVILPKDACGGDGTIAFARTATKNKPLIITVQENETV  373

Query  199   LNDTPERLGIEAVSTR  152
             L+DTP++  IEAVS++
Sbjct  374   LDDTPDKFNIEAVSSQ  389



>ref|XP_010093407.1| hypothetical protein L484_022976 [Morus notabilis]
 gb|EXB54001.1| hypothetical protein L484_022976 [Morus notabilis]
Length=426

 Score =   425 bits (1093),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 244/322 (76%), Positives = 270/322 (84%), Gaps = 10/322 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GAAIGGYAGDALPVARA SSVVDCLI+HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  49    MIVPTGVGAAIGGYAGDALPVARALSSVVDCLISHPNVLNAAMLYWPMPNALYVEGYALD  108

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEGLWAL+PVHQN+VGLVLDAGIEE+LR RHLQV DAARASLGL  VEY VTD PL V
Sbjct  109   RFAEGLWALQPVHQNKVGLVLDAGIEEELRFRHLQVADAARASLGLPVVEYVVTDAPLEV  168

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             E W +PK GQSTGRI++PD+LLRAV+ LV  S V+A+AVV RFPD+D ++ DDYRQG+GI
Sbjct  169   EMWANPKSGQSTGRIKHPDALLRAVQSLVNLSGVDAIAVVGRFPDEDIQETDDYRQGVGI  228

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEE----------IGYTF  407
             D+LAGVEA+ISHLVV+ F IPCAHAPAL PP L  S+ PKS +EE          +GYTF
Sbjct  229   DILAGVEAIISHLVVREFCIPCAHAPALLPPPLCPSLSPKSAAEEFIDLSSSQQQLGYTF  288

Query  406   LPCVLAGLGTAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLI  227
             LPCVLAGL  APQYL   +  L K CI ASDVDSVILPIDACGGDGALAFA S+R +PLI
Sbjct  289   LPCVLAGLSNAPQYLDLKSASLEKGCILASDVDSVILPIDACGGDGALAFACSERKKPLI  348

Query  226   IAVEENETVLNDTPERLGIEAV  161
             IAVEENETVL+DTP  LGIEAV
Sbjct  349   IAVEENETVLHDTPNNLGIEAV  370



>ref|XP_009410055.1| PREDICTED: uncharacterized protein LOC103992171 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=415

 Score =   425 bits (1092),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 233/315 (74%), Positives = 262/315 (83%), Gaps = 1/315 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GA+IGG+AGDALPVAR  +SV DC+I+HPNVLNAAMLYWPM NVLYVEGYALD
Sbjct  54    LIVPTGVGASIGGFAGDALPVARTLASVADCVISHPNVLNAAMLYWPMPNVLYVEGYALD  113

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEGLWAL+PVHQN++GLV DAG+EE+LRI HLQV DAARASLGL  +EY VTD PL V
Sbjct  114   RFAEGLWALQPVHQNKIGLVFDAGMEEELRICHLQVADAARASLGLPLMEYIVTDSPLKV  173

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKW+DP CG+STGRIQ+PDSLLRAV  LV  S VNAVAVV RFP DDDE  +DYRQG GI
Sbjct  174   EKWIDPNCGKSTGRIQHPDSLLRAVHTLVSQSQVNAVAVVGRFP-DDDEGTEDYRQGKGI  232

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D LAGVEAVISHLVVK FQIPCAHAPAL P  LS+SV P+S +EEIGYTFLPCVLAGL  
Sbjct  233   DTLAGVEAVISHLVVKEFQIPCAHAPALFPDSLSSSVSPRSAAEEIGYTFLPCVLAGLSA  292

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQY+           + A DVDSVILP DACGGDGALAFA +K N+PLI+AV+ENETVL
Sbjct  293   APQYVTAENRSYNDGYLIAGDVDSVILPADACGGDGALAFARAKNNKPLIVAVQENETVL  352

Query  196   NDTPERLGIEAVSTR  152
              DTPE++GI A   +
Sbjct  353   KDTPEKVGIRATKVQ  367



>ref|XP_010066636.1| PREDICTED: uncharacterized protein LOC104453726 [Eucalyptus grandis]
 ref|XP_010066637.1| PREDICTED: uncharacterized protein LOC104453726 [Eucalyptus grandis]
 gb|KCW64607.1| hypothetical protein EUGRSUZ_G02196 [Eucalyptus grandis]
Length=423

 Score =   424 bits (1090),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 232/312 (74%), Positives = 267/312 (86%), Gaps = 1/312 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GA+IGGYAGDALP+AR  SSVVDCLI+HPNVLNAAMLYWPM NVLYVEG+ALD
Sbjct  49    MIVPTGVGASIGGYAGDALPIARTLSSVVDCLISHPNVLNAAMLYWPMPNVLYVEGHALD  108

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FAEG WAL+PVHQN+VGLVLDA IEE+LR+RHLQV DA RASLGL  +EY VTD  L V
Sbjct  109   QFAEGSWALQPVHQNKVGLVLDAAIEEELRVRHLQVADATRASLGLPVLEYIVTDTALEV  168

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKW+DP+ G STGRI++P +LLRAV+ LV    VNA+AVV RFPDDD +D DDYRQGMGI
Sbjct  169   EKWIDPENGHSTGRIKHPGALLRAVQTLVSRGKVNAIAVVGRFPDDDLDDTDDYRQGMGI  228

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D +AGVEA+ISHLVVK FQIPCAHAPA+ P  LS S+ PKS +EE+GYTFLPCVLAGL  
Sbjct  229   DDIAGVEALISHLVVKEFQIPCAHAPAMLPLPLSLSLSPKSAAEELGYTFLPCVLAGLSN  288

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQYL+  +E + K CI +SDVDSV+LPIDACGGDGALAFA  K+ +PLII VEENETVL
Sbjct  289   APQYLVDKSEFMEKRCILSSDVDSVVLPIDACGGDGALAFARRKK-KPLIIVVEENETVL  347

Query  196   NDTPERLGIEAV  161
             +DTP++L IEAV
Sbjct  348   SDTPDKLQIEAV  359



>ref|XP_002315891.2| hypothetical protein POPTR_0010s12430g [Populus trichocarpa]
 gb|EEF02062.2| hypothetical protein POPTR_0010s12430g [Populus trichocarpa]
Length=374

 Score =   417 bits (1071),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 224/289 (78%), Positives = 250/289 (87%), Gaps = 0/289 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GA+IGG+AGDALPVARA S+VVDCLITHPNVLNAAMLYWPM NVLYVEGYALD
Sbjct  47    MIVPTGVGASIGGFAGDALPVARALSTVVDCLITHPNVLNAAMLYWPMPNVLYVEGYALD  106

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEGLWAL+PVHQN+VGLVLD GIEE+LRI HLQV DA RASLGL  +EY VTD PL V
Sbjct  107   RFAEGLWALQPVHQNKVGLVLDGGIEEELRIHHLQVADATRASLGLPVLEYIVTDTPLEV  166

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKWVD K GQSTGRI++P +LLRAV+ L+  S VNAVAVV RFPDDD ED+DDYRQG+GI
Sbjct  167   EKWVDSKTGQSTGRIKHPGALLRAVQTLINRSQVNAVAVVGRFPDDDVEDVDDYRQGVGI  226

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEAVISHLVVK FQIPCAHAPA+ P  L+  +CPKS +EEIGYTFLPCVL GL  
Sbjct  227   DLLAGVEAVISHLVVKKFQIPCAHAPAMLPLLLTEDLCPKSAAEEIGYTFLPCVLTGLSK  286

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPL  230
             APQYL+K ++ L K C+ ASDVDSV+LPI+AC GDGALAFA SK N+ L
Sbjct  287   APQYLVKDSQSLEKGCLLASDVDSVVLPINACAGDGALAFARSKINKNL  335



>ref|XP_003565282.1| PREDICTED: uncharacterized protein LOC100825804 [Brachypodium 
distachyon]
Length=431

 Score =   413 bits (1062),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 225/314 (72%), Positives = 264/314 (84%), Gaps = 1/314 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             ++VPTG+GAA+GG+AGDALPVARA S+V DC+I+HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  55    LVVPTGVGAAVGGFAGDALPVARALSAVADCVISHPNVLNAAMLYWPMPNALYVEGYALD  114

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG WAL+PVHQN+VGLVLD+GIEE+LR+RHLQV DAARASLGL  VEYTVTD PL +
Sbjct  115   RFAEGAWALQPVHQNKVGLVLDSGIEEELRLRHLQVADAARASLGLPVVEYTVTDAPLEI  174

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             + W DP+CG+STG + N DSLLRAV+ LV  S VNAVAVVARFPDDD ED D YR+G G+
Sbjct  175   KTWFDPECGKSTGSVGNSDSLLRAVDTLVNHSGVNAVAVVARFPDDDPEDSDCYREGKGV  234

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEA+ISHL+VK F+IP AHAPA+ PP LS SV P+S +EEIGYTFLPCVL+GL  
Sbjct  235   DLLAGVEAIISHLIVKEFKIPAAHAPAVLPPPLSPSVSPRSAAEEIGYTFLPCVLSGLSN  294

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKR-NRPLIIAVEENETV  200
             APQY+ +        CI ASDVDSVILP DACGGDG LAFA + R N+PLII V+ENETV
Sbjct  295   APQYVTRRQGTFDAGCIVASDVDSVILPKDACGGDGTLAFARTTRNNKPLIITVQENETV  354

Query  199   LNDTPERLGIEAVS  158
             L+DTP++  I+A++
Sbjct  355   LDDTPDKFSIDALN  368



>ref|XP_001782982.1| predicted protein [Physcomitrella patens]
 gb|EDQ52228.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   414 bits (1063),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 213/309 (69%), Positives = 252/309 (82%), Gaps = 1/309 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG GA IGG+AGD+LPVARA SSVVDCLITHPNVLN AML+WPM++ LYVEGYALD
Sbjct  107   MIVPTGTGATIGGFAGDSLPVARAMSSVVDCLITHPNVLNGAMLHWPMASTLYVEGYALD  166

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG W L+PVHQNRVGL+LD GIEE+L  RHLQV DA RA+LGL  +EYT+TD PL V
Sbjct  167   RFAEGYWGLQPVHQNRVGLILDMGIEEELIQRHLQVADATRATLGLPVLEYTITDAPLQV  226

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKW+DP+ G STGR+  PDSLLRAVE L+KG+ V+AVAVV RFPDD  +++ DYRQG G+
Sbjct  227   EKWLDPRTGTSTGRLGRPDSLLRAVETLMKGASVDAVAVVGRFPDDSVDELVDYRQGQGV  286

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D+LAGVEAVISH+VVK F IPCAHAPALSP  L  S+ P+S +EEIGYTFLPCVLAGL  
Sbjct  287   DVLAGVEAVISHMVVKEFGIPCAHAPALSPLPLDASISPRSAAEEIGYTFLPCVLAGLSK  346

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQ+ I+ T   G   + A DVD V++P +ACGG+G LA       +PL+IAVEENETVL
Sbjct  347   APQF-IERTNRSGAGTVWADDVDCVVVPANACGGEGTLALCRKSGRKPLLIAVEENETVL  405

Query  196   NDTPERLGI  170
             +DTPE++G+
Sbjct  406   DDTPEKMGL  414



>gb|ABR16294.1| unknown [Picea sitchensis]
Length=433

 Score =   408 bits (1048),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 227/316 (72%), Positives = 263/316 (83%), Gaps = 4/316 (1%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GAAIGG+AGDALPVARA +SVVDCLI+HPNVLNAAMLYWPM NVLYVEGYALD
Sbjct  59    MIVPTGVGAAIGGFAGDALPVARAMASVVDCLISHPNVLNAAMLYWPMPNVLYVEGYALD  118

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEGLW L+PVHQN+VGLVLDAGIEEDLR+RHLQV DAA+ASLGL  VE   TD+PL V
Sbjct  119   RFAEGLWGLQPVHQNKVGLVLDAGIEEDLRVRHLQVADAAQASLGLPIVECVTTDVPLQV  178

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKWVD + GQSTGR+ +PDSLLRAV+ LV  ++VNA+AVV RFPDD  ++++DYRQG GI
Sbjct  179   EKWVDAQTGQSTGRLGHPDSLLRAVDTLVNCANVNAIAVVGRFPDDSLDELEDYRQGKGI  238

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D+LAGVEA+ISHL+V+ F IPCAHAPAL P  L   V P+S +EEIGYTFLPCVLAGL  
Sbjct  239   DVLAGVEAIISHLIVREFHIPCAHAPALLPLPLDPLVSPRSAAEEIGYTFLPCVLAGLSR  298

Query  376   APQYLIKGTEILGK----NCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEEN  209
             APQY+++  E   K    +CI ASDVDSV++PIDACGG G LAF     + PL+IAVEEN
Sbjct  299   APQYVVQKEESPHKVSRHSCIWASDVDSVVVPIDACGGAGTLAFGQKAGSLPLMIAVEEN  358

Query  208   ETVLNDTPERLGIEAV  161
             ETVLNDTPE+L +  V
Sbjct  359   ETVLNDTPEKLELNVV  374



>ref|XP_004171155.1| PREDICTED: uncharacterized lipoprotein syc1174_c-like, partial 
[Cucumis sativus]
Length=362

 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 220/312 (71%), Positives = 251/312 (80%), Gaps = 25/312 (8%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GAAIGGYAGDALPVARA +SVVDCLITHPNVLNAAMLYWPM NVLYVEGYALD
Sbjct  51    MIVPTGVGAAIGGYAGDALPVARALASVVDCLITHPNVLNAAMLYWPMQNVLYVEGYALD  110

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLM-  740
             RFAEG WAL+PVHQNRVGLVLDAG+E++L+IRHLQV DAARASLGL  +EY VTD PL+ 
Sbjct  111   RFAEGSWALQPVHQNRVGLVLDAGMEKELQIRHLQVADAARASLGLPVMEYVVTDTPLVY  170

Query  739   ------------------------VEKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVN  632
                                     VEKW+D   GQSTGRI++P SLLRAV+ L+  S VN
Sbjct  171   ESHKLANFEYFDYEEHYEVMLSRSVEKWIDRTTGQSTGRIRHPASLLRAVQTLMNRSKVN  230

Query  631   AVAVVARFPddddedidDYRQGMGIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLST  452
             AVAVV RFPDDD E+ D YRQGMG+D LAGVEA+ISHLVVK FQIPCAHAPALSP  L T
Sbjct  231   AVAVVGRFPDDDVEEEDSYRQGMGVDTLAGVEAIISHLVVKEFQIPCAHAPALSPTPLCT  290

Query  451   SVCPKSVSEEIGYTFLPCVLAGLGTAPQYLIKGTEILGKNCISASDVDSVILPIDACGGD  272
             S+ PKS +EE+G+TFLPCVL+GL  APQYL K ++ LGK+C+ A+DVDSVI+PI+ACGGD
Sbjct  291   SLSPKSAAEELGFTFLPCVLSGLSNAPQYLSKNSDSLGKDCLLANDVDSVIVPINACGGD  350

Query  271   GALAFANSKRNR  236
             G LAFA SK+ +
Sbjct  351   GTLAFARSKQYK  362



>gb|EPS71703.1| hypothetical protein M569_03054, partial [Genlisea aurea]
Length=362

 Score =   401 bits (1030),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 218/317 (69%), Positives = 259/317 (82%), Gaps = 3/317 (1%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+ A IGGYAGDALPVARA +SVVDCLI+HPNVLNAAMLYWPM NVLYVEGYALD
Sbjct  16    MIVPTGVAAKIGGYAGDALPVARALASVVDCLISHPNVLNAAMLYWPMPNVLYVEGYALD  75

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEGLWAL+PV+ N++G++LDAGIE++L +RHLQVVDAARASLGL+  +  VTD PL V
Sbjct  76    RFAEGLWALQPVNHNKIGVILDAGIEKELLLRHLQVVDAARASLGLNVSDCIVTDSPLQV  135

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             +KW+DPK GQS+GRI++P SLLRAVE L+  S V+AVAVV RFPDDD +  ++YRQG GI
Sbjct  136   QKWIDPKTGQSSGRIKHPGSLLRAVENLIATSGVDAVAVVTRFPDDDTDYEENYRQGKGI  195

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D+LAGVEAVISH+VV+ F+IPCAHAPA+ P  LS S+ PK+ +EEIGYTFLPCVLAGL +
Sbjct  196   DVLAGVEAVISHMVVERFRIPCAHAPAVLPFPLSPSLSPKAAAEEIGYTFLPCVLAGLSS  255

Query  376   APQYLIKGTEILG-KNCISASDVDSVILPIDACGGDGALAFANSKRN--RPLIIAVEENE  206
             AP+Y  K     G    I + DVDSVILPIDA GGD AL+FA  + +  RPL+I VEEN 
Sbjct  256   APRYSDKQDSRSGLSRAIVSDDVDSVILPIDAFGGDAALSFARREPSIRRPLMIGVEENG  315

Query  205   TVLNDTPERLGIEAVST  155
             TVL  TP++LGI AV  
Sbjct  316   TVLEGTPDKLGIRAVKA  332



>dbj|BAJ87524.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=363

 Score =   392 bits (1008),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 222/312 (71%), Positives = 261/312 (84%), Gaps = 1/312 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             ++VPTG+GAA+GG+AGDALPV+RA ++V DC+I+HPNVLNAAMLYWP  N LYVEGYALD
Sbjct  47    LVVPTGVGAAVGGFAGDALPVSRALAAVSDCVISHPNVLNAAMLYWPTPNTLYVEGYALD  106

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG WAL+PVHQNRVGLVLD+GIEE+LR+RHLQV DAARASLGL  VEY VTD PL +
Sbjct  107   RFAEGAWALQPVHQNRVGLVLDSGIEEELRLRHLQVADAARASLGLPVVEYAVTDAPLEI  166

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             + W DP+CG+STG + N DSLLRAV+ LV  + VNAVAVVARFPDDD ED D YR+G G+
Sbjct  167   KTWFDPECGKSTGSVGNSDSLLRAVDALVNQAGVNAVAVVARFPDDDPEDSDCYREGKGV  226

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEA+ISHL+VK F+IP AHAPA+ PP LS  V P+S +EEIGYTFLPCVLAGL T
Sbjct  227   DLLAGVEAIISHLIVKEFKIPAAHAPAVLPPPLSPLVSPRSAAEEIGYTFLPCVLAGLST  286

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKR-NRPLIIAVEENETV  200
             APQY+ +        CI +SDVDSVILP DACGGDGALAF+ + R N+PLII V+ENETV
Sbjct  287   APQYVTRRQGTFDGGCIVSSDVDSVILPRDACGGDGALAFSRTARKNKPLIITVQENETV  346

Query  199   LNDTPERLGIEA  164
             L+DTP++  IEA
Sbjct  347   LDDTPDKFSIEA  358



>ref|XP_009410064.1| PREDICTED: uncharacterized protein LOC103992171 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=320

 Score =   385 bits (988),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 201/273 (74%), Positives = 223/273 (82%), Gaps = 1/273 (0%)
 Frame = -1

Query  970  MLYWPMSNVLYVEGYALDRFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARA  791
            MLYWPM NVLYVEGYALDRFAEGLWAL+PVHQN++GLV DAG+EE+LRI HLQV DAARA
Sbjct  1    MLYWPMPNVLYVEGYALDRFAEGLWALQPVHQNKIGLVFDAGMEEELRICHLQVADAARA  60

Query  790  SLGLSFVEYTVTDLPLMVEKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVAR  611
            SLGL  +EY VTD PL VEKW+DP CG+STGRIQ+PDSLLRAV  LV  S VNAVAVV R
Sbjct  61   SLGLPLMEYIVTDSPLKVEKWIDPNCGKSTGRIQHPDSLLRAVHTLVSQSQVNAVAVVGR  120

Query  610  FPddddedidDYRQGMGIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSV  431
            FP DDDE  +DYRQG GID LAGVEAVISHLVVK FQIPCAHAPAL P  LS+SV P+S 
Sbjct  121  FP-DDDEGTEDYRQGKGIDTLAGVEAVISHLVVKEFQIPCAHAPALFPDSLSSSVSPRSA  179

Query  430  SEEIGYTFLPCVLAGLGTAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFAN  251
            +EEIGYTFLPCVLAGL  APQY+           + A DVDSVILP DACGGDGALAFA 
Sbjct  180  AEEIGYTFLPCVLAGLSAAPQYVTAENRSYNDGYLIAGDVDSVILPADACGGDGALAFAR  239

Query  250  SKRNRPLIIAVEENETVLNDTPERLGIEAVSTR  152
            +K N+PLI+AV+ENETVL DTPE++GI A   +
Sbjct  240  AKNNKPLIVAVQENETVLKDTPEKVGIRATKVQ  272



>ref|XP_002993429.1| hypothetical protein SELMODRAFT_431494 [Selaginella moellendorffii]
 gb|EFJ05522.1| hypothetical protein SELMODRAFT_431494 [Selaginella moellendorffii]
Length=496

 Score =   389 bits (1000),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 217/312 (70%), Positives = 251/312 (80%), Gaps = 1/312 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG GA IGGYAGDALPVARA +S+VDCLITHPNVLN AMLYWPMSN LYVEGYALD
Sbjct  46    LIVPTGTGACIGGYAGDALPVARALASIVDCLITHPNVLNGAMLYWPMSNALYVEGYALD  105

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVH+N+VGLVLDAGIE+DLR+RHLQV DAA A+LG S  E+ VTD  L V
Sbjct  106   RFAAGAWGLSPVHRNKVGLVLDAGIEQDLRLRHLQVADAAAATLGTSIFEHVVTDASLQV  165

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKW+D K G STGRI   DSLLRAVEKLV+ + ++AVAVVARFPDDD E + DYRQG G+
Sbjct  166   EKWIDDKTGASTGRIARSDSLLRAVEKLVRDAAIDAVAVVARFPDDDVEVLKDYRQGQGV  225

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D LAGVEAVIS +VV  F IPCAHAPAL+P    +SV P+S +EEIGYTFLP VLAGL  
Sbjct  226   DALAGVEAVISKMVVSEFHIPCAHAPALAPLPFDSSVSPRSAAEEIGYTFLPSVLAGLSK  285

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQY+ + ++    + I A DVD+V++P++ACGGDG  AF+   R +PLIIAVEEN TVL
Sbjct  286   APQYVSRDSDHR-PHRIWAEDVDAVLVPVNACGGDGVRAFSKKARQKPLIIAVEENVTVL  344

Query  196   NDTPERLGIEAV  161
             NDTPE+L IEAV
Sbjct  345   NDTPEKLQIEAV  356



>ref|XP_002982233.1| hypothetical protein SELMODRAFT_421627 [Selaginella moellendorffii]
 ref|XP_002982235.1| hypothetical protein SELMODRAFT_421631 [Selaginella moellendorffii]
 gb|EFJ16901.1| hypothetical protein SELMODRAFT_421627 [Selaginella moellendorffii]
 gb|EFJ16903.1| hypothetical protein SELMODRAFT_421631 [Selaginella moellendorffii]
Length=516

 Score =   389 bits (998),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 217/312 (70%), Positives = 251/312 (80%), Gaps = 1/312 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG GA IGGYAGDALPVARA +S+VDCLITHPNVLN AMLYWPMSN LYVEGYALD
Sbjct  46    LIVPTGTGACIGGYAGDALPVARALASIVDCLITHPNVLNGAMLYWPMSNALYVEGYALD  105

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVH+N+VGLVLDAGIE+DLR+RHLQV DAA A+LG S  E+ VTD  L V
Sbjct  106   RFAAGAWGLSPVHRNKVGLVLDAGIEQDLRLRHLQVADAAAATLGTSIFEHVVTDASLQV  165

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKW+D K G STGRI   DSLLRAVEKLV+ + ++AVAVVARFPDDD E + DYRQG G+
Sbjct  166   EKWIDGKTGASTGRIARSDSLLRAVEKLVRDAAIDAVAVVARFPDDDVEVLKDYRQGQGV  225

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D LAGVEAVIS +VV  F IPCAHAPAL+P    +SV P+S +EEIGYTFLP VLAGL  
Sbjct  226   DALAGVEAVISKMVVSEFHIPCAHAPALAPLPFDSSVSPRSAAEEIGYTFLPSVLAGLSK  285

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQY+ + ++    + I A DVD+V++P++ACGGDG  AF+   R +PLIIAVEEN TVL
Sbjct  286   APQYVSRDSDHR-PHRIWAEDVDAVLVPVNACGGDGVRAFSKKARQKPLIIAVEENVTVL  344

Query  196   NDTPERLGIEAV  161
             NDTPE+L IEAV
Sbjct  345   NDTPEKLQIEAV  356



>gb|KCW64608.1| hypothetical protein EUGRSUZ_G02196 [Eucalyptus grandis]
Length=333

 Score =   379 bits (973),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 196/271 (72%), Positives = 227/271 (84%), Gaps = 1/271 (0%)
 Frame = -1

Query  970  MLYWPMSNVLYVEGYALDRFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARA  791
            MLYWPM NVLYVEG+ALD+FAEG WAL+PVHQN+VGLVLDA IEE+LR+RHLQV DA RA
Sbjct  1    MLYWPMPNVLYVEGHALDQFAEGSWALQPVHQNKVGLVLDAAIEEELRVRHLQVADATRA  60

Query  790  SLGLSFVEYTVTDLPLMVEKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVAR  611
            SLGL  +EY VTD  L VEKW+DP+ G STGRI++P +LLRAV+ LV    VNA+AVV R
Sbjct  61   SLGLPVLEYIVTDTALEVEKWIDPENGHSTGRIKHPGALLRAVQTLVSRGKVNAIAVVGR  120

Query  610  FPddddedidDYRQGMGIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSV  431
            FPDDD +D DDYRQGMGID +AGVEA+ISHLVVK FQIPCAHAPA+ P  LS S+ PKS 
Sbjct  121  FPDDDLDDTDDYRQGMGIDDIAGVEALISHLVVKEFQIPCAHAPAMLPLPLSLSLSPKSA  180

Query  430  SEEIGYTFLPCVLAGLGTAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFAN  251
            +EE+GYTFLPCVLAGL  APQYL+  +E + K CI +SDVDSV+LPIDACGGDGALAFA 
Sbjct  181  AEELGYTFLPCVLAGLSNAPQYLVDKSEFMEKRCILSSDVDSVVLPIDACGGDGALAFAR  240

Query  250  SKRNRPLIIAVEENETVLNDTPERLGIEAVS  158
             K+ +PLII VEENETVL+DTP++L IEAV 
Sbjct  241  RKK-KPLIIVVEENETVLSDTPDKLQIEAVK  270



>emb|CAN78467.1| hypothetical protein VITISV_028235 [Vitis vinifera]
Length=379

 Score =   365 bits (937),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 191/278 (69%), Positives = 212/278 (76%), Gaps = 27/278 (10%)
 Frame = -1

Query  988  NVLNAAMLYWPMSNVLYVEGYALDRFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQV  809
             VLNAAML WP+ NVLYV GYALDRFAEGLWAL+ VHQNRVGLVLDA IE +LR+ HLQV
Sbjct  63   RVLNAAMLXWPVPNVLYVVGYALDRFAEGLWALQXVHQNRVGLVLDAAIEGELRLXHLQV  122

Query  808  VDAARASLGLSFVEYTVTDLPLMVEKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNA  629
             DA RASLGL  +EY VTD PL+VEKWVDPK GQSTGRI++PDSL RAV+ LV  +    
Sbjct  123  ADATRASLGLPVLEYIVTDTPLLVEKWVDPKSGQSTGRIKHPDSLPRAVQTLVNRTK---  179

Query  628  VAVVARFPddddedidDYRQGMGIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTS  449
                                  GID LAGVEAVISHLVVK FQIPCAHAPALSP  LS S
Sbjct  180  ----------------------GIDDLAGVEAVISHLVVKEFQIPCAHAPALSPFPLSLS  217

Query  448  VCPKSVSEEIGYTFLPCVLAGLGTAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDG  269
            +CPKS ++EIGYTFL CVLAGL  APQY++K +E L K CI ASDVDSVILP+DAC GDG
Sbjct  218  LCPKSAAKEIGYTFLLCVLAGLSNAPQYVVKNSESLEKGCILASDVDSVILPMDACEGDG  277

Query  268  ALAFANSKRNR--PLIIAVEENETVLNDTPERLGIEAV  161
            ALAFA SK+++  PLII VEENETVLNDTPE+ GIE V
Sbjct  278  ALAFARSKKDKMQPLIITVEENETVLNDTPEKYGIEVV  315



>ref|XP_010916351.1| PREDICTED: uncharacterized protein LOC105041190 isoform X2 [Elaeis 
guineensis]
Length=386

 Score =   343 bits (881),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 198/313 (63%), Positives = 231/313 (74%), Gaps = 40/313 (13%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GA+IGG+AGDALPVAR  +SV DC+I+HPNV                      
Sbjct  55    LIVPTGVGASIGGFAGDALPVARTLASVADCVISHPNV----------------------  92

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
                              GLVLDAG+EE+LRIRHLQV DA RASLGL  VEY VTD PL V
Sbjct  93    -----------------GLVLDAGMEEELRIRHLQVADATRASLGLPIVEYMVTDAPLKV  135

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             E W+DPKCG+STGRI++PDSLLRAV+ LV  S +NAVAVV RFPDDD ED++DYR G G+
Sbjct  136   ETWIDPKCGKSTGRIKHPDSLLRAVQTLVSHSHINAVAVVGRFPDDDMEDMEDYRLGKGV  195

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D LAGVEA+ISHLVVK FQIPCAHAPA+SP  L T + P+S +EE+GYTFLPCVLAGL  
Sbjct  196   DSLAGVEAIISHLVVKEFQIPCAHAPAVSPIPLRTLLSPRSAAEELGYTFLPCVLAGLSC  255

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANS-KRNRPLIIAVEENETV  200
             APQY+ K    L  +CI+AS+VDSV+LP DACGGDGALAFA S   N+PLIIAV+ENETV
Sbjct  256   APQYVTKKHGSLDSDCIAASNVDSVMLPADACGGDGALAFARSMTNNKPLIIAVQENETV  315

Query  199   LNDTPERLGIEAV  161
             L+DTPE+ GIE V
Sbjct  316   LDDTPEKFGIEVV  328



>gb|ACF86863.1| unknown [Zea mays]
 tpg|DAA53630.1| TPA: hypothetical protein ZEAMMB73_031072 [Zea mays]
Length=385

 Score =   343 bits (879),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 191/316 (60%), Positives = 231/316 (73%), Gaps = 45/316 (14%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTG+GAA+GG+AGDALPVARA + V DC+I+HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  50    LIIPTGVGAAVGGFAGDALPVARAVAGVADCVISHPNVLNAAMLYWPMPNTLYVEGYALD  109

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG WAL+PVHQN++                                           
Sbjct  110   RFAEGSWALQPVHQNKI-------------------------------------------  126

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             + W DP+CG+STG + N DSLLRAV+ LVK SDVNAVAVVARFPDDD ED D YR+G G+
Sbjct  127   KTWFDPRCGKSTGSVGNSDSLLRAVDALVKHSDVNAVAVVARFPDDDPEDSDCYREGKGV  186

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             DLLAGVEA+ISHLVVK F+IP AHAPA+ PP LS  VCP+S +EEIG+TFLPCVLAGL  
Sbjct  187   DLLAGVEAIISHLVVKEFKIPSAHAPAVLPPPLSPLVCPRSAAEEIGHTFLPCVLAGLSN  246

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFAN-SKRNRPLIIAVEENETV  200
             APQY+++ +  L   CI A DVDSVILP D+CGGDG LAFA  +++++PLII V+ENETV
Sbjct  247   APQYVMR-SGTLDHGCIVAGDVDSVILPKDSCGGDGTLAFARAARKDKPLIITVQENETV  305

Query  199   LNDTPERLGIEAVSTR  152
             L+DTP++ GIE ++ R
Sbjct  306   LDDTPDKFGIEVLNVR  321



>ref|WP_007357629.1| MULTISPECIES: hypothetical protein [Kamptonema]
 emb|CBN58451.1| conserved exported hypothetical protein [ [[Oscillatoria] sp. 
PCC 6506]
Length=357

 Score =   338 bits (868),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 188/342 (55%), Positives = 243/342 (71%), Gaps = 6/342 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GA+IGGYAGDALPVARA + + D LITHPNVLN A LYWP+ N LYVEGYALD
Sbjct  10    LIVPTGVGASIGGYAGDALPVARAIAQICDTLITHPNVLNGAQLYWPLPNALYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L+PVHQNR+GL+LD+GIE DL++RHLQ  DAARA+LG++  +Y +TD+PL V
Sbjct  70    KFASGCWGLQPVHQNRIGLILDSGIEPDLQLRHLQAADAARATLGINITDYVLTDMPLEV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLRA E L+K + V A+AV+ARFP D+    +  YR G G
Sbjct  130   ELRTS-NSGASWGTIANPDSLLRAAEGLIKQAKVEAIAVIARFPDDEGSTQLQQYRYGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+VK F+IPCAHAPAL P  L + +  +S +EEIGYTFLPCVLAGL 
Sbjct  189   VDPLAGAEAVISHLIVKTFKIPCAHAPALLPLPLDSQISARSAAEEIGYTFLPCVLAGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++ +  E + ++ I+A+DVD+V++P  ACGG   L+    +R+   IIAV EN+T 
Sbjct  249   KAPQFVTE--EKITQSPITAADVDAVVIPATACGGSAILSLI--QRSAVQIIAVAENQTQ  304

Query  199   LNDTPERLGIEAVSTRYLGNSFYLLYLCDLRGCP*TTYPVIP  74
             +  TP++LGI+A+       +  +L        P   +P IP
Sbjct  305   MQATPDKLGIKALQVNSYLEALGVLVAHKAGINPAMLHPKIP  346



>ref|XP_007045102.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY00934.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=294

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GA+IGG+AGDALPVARA SSVVDCLI+HPNVLNAAMLYWPM NV+YVEGYALD
Sbjct  51    MIVPTGVGASIGGFAGDALPVARALSSVVDCLISHPNVLNAAMLYWPMPNVMYVEGYALD  110

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA+GLWAL+PVHQN+VGLVLDAGIEE L+IRHLQV DA+RASLGL  VEY VTD PL V
Sbjct  111   RFAQGLWALQPVHQNKVGLVLDAGIEEYLQIRHLQVADASRASLGLPVVEYVVTDTPLEV  170

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             EKWV+P  GQSTGRI++PDSLLRAV+ LVK S V+AVAVV RFPDD+ +++DDYRQG+GI
Sbjct  171   EKWVNPTTGQSTGRIKHPDSLLRAVKNLVKRSQVDAVAVVGRFPDDEVDNLDDYRQGIGI  230

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEE  422
             D+LAGVEAVISHLVVK FQIPCAHAPALSP  L++S+CPKS +EE
Sbjct  231   DILAGVEAVISHLVVKEFQIPCAHAPALSPLPLTSSLCPKSAAEE  275



>ref|WP_009556274.1| Protein of unknown function (DUF3326) [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ69364.1| Protein of unknown function (DUF3326) [Oscillatoriales cyanobacterium 
JSC-12]
Length=357

 Score =   329 bits (844),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 184/313 (59%), Positives = 225/313 (72%), Gaps = 3/313 (1%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVAR+ + V D LITHPNVLN A LYW + N LYVEG+ LD
Sbjct  9     LIVPTGIGAAIGGYAGDALPVARSLAQVSDWLITHPNVLNGAQLYWNLPNALYVEGFGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L  VHQNRVGL+LD GIE DLR+RHLQV DAARA+LGL+  +Y VTD PL V
Sbjct  69    QFAAGNWGLALVHQNRVGLILDQGIEADLRVRHLQVADAARATLGLNLTDYVVTDAPLGV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdddde-didDYRQGMG  560
                     G + G I NPDSLLRA E+ ++ +   A+AVV RFPDD     + +YRQG G
Sbjct  129   AL-KTAASGATWGTIANPDSLLRAAERAIQAAGATAIAVVTRFPDDPGTCALQNYRQGKG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F+IPCAHAPAL+P  L  ++ P+S +EE+GYTFLPCVL GL 
Sbjct  188   VDPLAGAEAVISHLIVREFRIPCAHAPALAPLPLDPTISPRSAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ+ ++    L ++ I A  VD+V++P  ACGG   +   NS+  RPLIIAV EN T 
Sbjct  248   RAPQF-VQSANNLTQDQIWADQVDAVVIPATACGGSAIMHLGNSRVGRPLIIAVRENYTT  306

Query  199   LNDTPERLGIEAV  161
             +   PERLGI +V
Sbjct  307   MQVPPERLGIASV  319



>ref|WP_009783196.1| hypothetical protein [Lyngbya sp. PCC 8106]
 gb|EAW38315.1| hypothetical protein L8106_09836 [Lyngbya sp. PCC 8106]
Length=361

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 227/318 (71%), Gaps = 9/318 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GAAIGGYAGDALPVARA S V D LITHPNVLN A LYWP+SNV YVEGYALD
Sbjct  9     LIVPTGVGAAIGGYAGDALPVARAMSQVCDRLITHPNVLNGAQLYWPLSNVFYVEGYALD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA+G W L+PVHQNRVGL+LD  IE +LR RHLQV DAARA+LGLS  +Y VTD P+ V
Sbjct  69    QFAKGSWGLQPVHQNRVGLLLDQAIEPELRQRHLQVADAARATLGLSLTDYVVTDAPIEV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPd-dddedidDYRQGMG  560
             E       G S G I NP SLLR  E L+K +  NA+AVV RFP+  +   ++ YR G G
Sbjct  129   ELRTT-ASGASWGTIGNPGSLLRGAEVLIKKAKANAIAVVTRFPEDQESLALEQYRHGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F IPCAHAPALS   L   + P+S +EE+GYTFLPCVL GL 
Sbjct  188   VDPLAGAEAVISHLIVRQFNIPCAHAPALSTLPLDPDLSPRSAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLIKGTEILG----KNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEE  212
              APQ++    E  G     + I  + VD+V++P  ACGG   L+F++ +     IIAVEE
Sbjct  248   RAPQFVTPAFETPGSHFSSDLIWGNTVDAVVVPATACGGSAILSFSHHQTQ---IIAVEE  304

Query  211   NETVLNDTPERLGIEAVS  158
             N+T +  +PE LGI+A++
Sbjct  305   NQTQMQVSPESLGIKAIT  322



>ref|WP_008275905.1| hypothetical protein [Cyanothece sp. CCY0110]
 gb|EAZ91084.1| hypothetical protein CY0110_27770 [Cyanothece sp. CCY0110]
Length=350

 Score =   327 bits (839),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 187/314 (60%), Positives = 227/314 (72%), Gaps = 9/314 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVA+A + V D LITHPNVLN A LYWP+ N LYVEGY LD
Sbjct  10    LIVPTGIGAAIGGYAGDALPVAKAMAKVCDRLITHPNVLNGAQLYWPLDNTLYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG W L PVHQNRVGL+LD GIE +LR RH+Q  DA RA+LGL+  +Y VTD+PL V
Sbjct  70    RFAEGNWGLNPVHQNRVGLILDRGIEPELRTRHIQAADATRATLGLTLTDYVVTDIPLEV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I +PDSLLRA +KL+  S   A+AVVARFP D D   +D+YR G G
Sbjct  130   ELRT-ANSGASWGTISHPDSLLRAAQKLITKSKAEAIAVVARFPDDVDSLVLDNYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAGVEAVISHLVV+ F+IPCAHAPAL P  +  ++ P++ +EE+GYTFLPCVL GL 
Sbjct  189   VDPLAGVEAVISHLVVREFRIPCAHAPALEPLPVDDTISPRAAAEELGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++ +         I    VD++++P  ACGG G L+F  S+RN   II V +N T 
Sbjct  249   RAPQFVTQPQ----SQSIWVDQVDALVIPHTACGGSGILSF--SQRNT-RIITVTDNTTT  301

Query  199   LNDTPERLGIEAVS  158
             LN TPE LG+EA++
Sbjct  302   LNVTPENLGMEAIT  315



>ref|WP_006631119.1| hypothetical protein [Microcoleus vaginatus]
 gb|EGK90143.1| LOW QUALITY PROTEIN: hypothetical protein MicvaDRAFT_3955 [Microcoleus 
vaginatus FGP-2]
Length=355

 Score =   325 bits (833),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 181/313 (58%), Positives = 231/313 (74%), Gaps = 4/313 (1%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GA+IGG+AGDALPVARA + + D LITHPNVLN A LYWP+ N LYVEGYALD
Sbjct  10    LIVPTGVGASIGGFAGDALPVARAIAQISDTLITHPNVLNGAQLYWPIPNALYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L+PVHQNR+GL+LD+ IE DL++RHLQ VDA RA+LGL+  +  +TD  L V
Sbjct  70    KFAAGCWGLQPVHQNRIGLILDSAIEPDLQLRHLQAVDATRATLGLNITDCVLTDRSLQV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E  +  + G S G I NPDSLLRA EKL+K + V A+AVVARFP D+    +++YR+G G
Sbjct  130   ELRIS-ESGASWGTIGNPDSLLRAAEKLIKQARVEAIAVVARFPDDEGSLALENYRRGKG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ F+IPCAHAPALS   L   + P+S +EEIGYTFLPCVLAGL 
Sbjct  189   VDPLAGAEAVISHLVVRTFKIPCAHAPALSALPLDPHLSPRSAAEEIGYTFLPCVLAGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ +   ++   +  I+   VD+V++P  ACGG   L+   S R+   IIAV +N+T 
Sbjct  249   KAPQLVAPESQQHNQLSITVDRVDAVVIPATACGGSAILSL--SGRSSVQIIAVGDNKTQ  306

Query  199   LNDTPERLGIEAV  161
             +  TPE+LGI+A+
Sbjct  307   MQATPEKLGIKAL  319



>ref|WP_006100868.1| hypothetical protein [Coleofasciculus chthonoplastes]
 gb|EDX75728.1| hypothetical protein MC7420_6383 [Coleofasciculus chthonoplastes 
PCC 7420]
Length=350

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 184/313 (59%), Positives = 224/313 (72%), Gaps = 8/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGA+IGGYAGDALPVARA + V D LITHPNVLN A LYW + N LYVEGY LD
Sbjct  8     LIVPTGIGASIGGYAGDALPVARAIAQVCDRLITHPNVLNGAQLYWNLPNALYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L+PVHQNRVGL+LD GIE DLR+RHLQ  DA RA+LGL+  +Y +TD PL V
Sbjct  68    KFAAGCWGLQPVHQNRVGLILDQGIEPDLRLRHLQAADATRATLGLNLTDYVITDAPLNV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E    P  G S G I NPDSLLR+ E L++ +   A+AVVARFP D   E ++ YRQG G
Sbjct  128   ELRTAPS-GASWGTIGNPDSLLRSAEVLIQQAKAEAIAVVARFPDDLGSEALEAYRQGQG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ FQIPCAHAPAL P  L  ++ P+S +EE+GYTFLPCVL GL 
Sbjct  187   VDPLAGAEAVISHLIVQTFQIPCAHAPALMPLPLEPTLSPRSAAEELGYTFLPCVLVGLS  246

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ+ +K  +      I A DVD+V++P  ACGG   L+ +  +     IIAVE+N+T 
Sbjct  247   RAPQFQVKRRQ---PGEIWAEDVDAVVIPASACGGSALLSLSQLRTQ---IIAVEDNQTS  300

Query  199   LNDTPERLGIEAV  161
             +   PE L I+AV
Sbjct  301   MQVPPEPLAIKAV  313



>ref|WP_026798524.1| MULTISPECIES: hypothetical protein [Planktothrix]
Length=371

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 184/322 (57%), Positives = 227/322 (70%), Gaps = 14/322 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD LPVARA + V D LITHPNVLN A LYWPM N LYVEG+ALD
Sbjct  9     LIIPTGIGAAIGGYAGDGLPVARAIAQVADTLITHPNVLNGAQLYWPMPNTLYVEGFALD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             + A G W L+PVHQNRVGL+LD  IE +LR+RHLQV DAARA+LGL+  +Y VTD PL V
Sbjct  69    QLAAGNWGLQPVHQNRVGLLLDQAIEPELRLRHLQVADAARATLGLTLTDYVVTDAPLNV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPd-dddedidDYRQGMG  560
                     G S G I NPDSLLRA E+L+K +   A+AVVARFP+ ++   ++ YR G G
Sbjct  129   AIRTS-TSGASWGTIGNPDSLLRAAERLIKEAKAEAIAVVARFPEPENSGVLEAYRHGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ FQIP AHAPALSP  +   + P+S +EE+GYTFLPCVL GL 
Sbjct  188   VDPLAGAEAVISHLIVRTFQIPSAHAPALSPLAIDPELSPRSAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNR--------PLII  224
              APQ++   T + G   I A  VD++++P  ACGG   L+F+  +  R        P II
Sbjct  248   RAPQFV--NTAMAG--TIWADQVDAIVVPATACGGSAVLSFSRDEPRRVSEPRRVWPQII  303

Query  223   AVEENETVLNDTPERLGIEAVS  158
             AV EN+T +  TPE+LGI A+ 
Sbjct  304   AVGENQTRMQVTPEQLGINAIQ  325



>ref|WP_023066375.1| hypothetical protein [Lyngbya aestuarii]
 gb|ERT07361.1| hypothetical protein M595_2598 [Lyngbya aestuarii BL J]
Length=361

 Score =   323 bits (827),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 184/318 (58%), Positives = 225/318 (71%), Gaps = 9/318 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GAAIGGYAGDALPVARA S V D LITHPNVLN A LYWP+SNV YVEGYALD
Sbjct  9     LIVPTGVGAAIGGYAGDALPVARAMSQVCDRLITHPNVLNGAQLYWPLSNVFYVEGYALD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L+PVHQNRVGL+LD  IE +LR RHLQV DAARA+LGLS  +Y VTD P+ V
Sbjct  69    QFARGNWGLQPVHQNRVGLLLDQAIEPELRQRHLQVADAARATLGLSLTDYVVTDAPIDV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPd-dddedidDYRQGMG  560
             E       G S G I NP SLLR    L++ +  NA+AVV RFP+  D   ++ YR G G
Sbjct  129   ELRT-AASGGSWGTIGNPGSLLRGATALIEKAKANAIAVVTRFPEDQDSLALEHYRHGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F IPCAHAPALS   L   + P+S +EE+GYTFLPCVL GL 
Sbjct  188   VDPLAGAEAVISHLIVRQFNIPCAHAPALSTLPLDPDLSPRSAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLIKGTEILG----KNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEE  212
              APQ++    E  G     + I  + VD+V++P  ACGG   L+F++ +     IIAVEE
Sbjct  248   RAPQFVTPAFETPGSHFSSDLIWGNTVDAVVVPATACGGSAILSFSDHQTQ---IIAVEE  304

Query  211   NETVLNDTPERLGIEAVS  158
             N+T +  +PE LGI+A++
Sbjct  305   NQTQMQVSPESLGIKAIT  322



>ref|WP_013322779.1| hypothetical protein [Cyanothece sp. PCC 7822]
 ref|YP_003887949.1| hypothetical protein Cyan7822_2707 [Cyanothece sp. PCC 7822]
 gb|ADN14674.1| conserved hypothetical protein [Cyanothece sp. PCC 7822]
Length=358

 Score =   323 bits (827),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 181/313 (58%), Positives = 225/313 (72%), Gaps = 5/313 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGA IGGYAGDALPVARA +S+ D LITHPNVLN A LYW + N  YVEGY LD
Sbjct  9     LIVPTGIGATIGGYAGDALPVARAIASICDRLITHPNVLNGAQLYWNLPNTFYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA+G W LEPVHQNR+GL+LD  IE +LR+RHLQ  DA RA+LGL+  +Y +TD PL V
Sbjct  69    QFAKGEWGLEPVHQNRIGLILDRAIEPELRLRHLQAADATRATLGLNLTDYVITDAPLEV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             E  +  + G S G I N  SLLRA E L++ +   A+AVVARFPDD D E + +YR G G
Sbjct  129   ELRMS-ESGASWGTIGNSGSLLRAAETLIQQARAEAIAVVARFPDDPDSEALQNYRYGGG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+H +IP AHAPAL P  L  ++ P+S +EE+GYTFLPCVL GL 
Sbjct  188   VDALAGAEAVISHLIVRHLRIPAAHAPALMPLPLDENISPRSAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++ K         + A+DVD+VI+P DACGG   L+F+  K     IIAV+EN+T 
Sbjct  248   RAPQFVRKSAISFTSGTVWANDVDAVIIPADACGGSAILSFSQEKAQ---IIAVQENKTQ  304

Query  199   LNDTPERLGIEAV  161
             +   PE LGI+A+
Sbjct  305   MQVAPEALGIKAI  317



>ref|WP_015183134.1| hypothetical protein [Microcoleus sp. PCC 7113]
 ref|YP_007122396.1| hypothetical protein Mic7113_3252 [Microcoleus sp. PCC 7113]
 gb|AFZ18990.1| Protein of unknown function (DUF3326) [Microcoleus sp. PCC 7113]
Length=375

 Score =   323 bits (827),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 186/324 (57%), Positives = 232/324 (72%), Gaps = 15/324 (5%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTG+GAAIGGYAGDALPVARA S++ D LITHPNVLN A LYW + N LYVEGYALD
Sbjct  10    LIIPTGVGAAIGGYAGDALPVARAISAICDRLITHPNVLNGAQLYWNLPNALYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G   L+PVHQNRVGL+LD GIE +LR+RHLQV DAARA+LGL+  +Y VTD PL V
Sbjct  70    KFASGCIGLQPVHQNRVGLILDQGIEPELRLRHLQVADAARATLGLNLTDYVVTDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLR+ E L++ +  +A+AVVARFP D   E +  YR G G
Sbjct  130   ELRT-AASGASWGTIGNPDSLLRSAEVLIEQAKADAIAVVARFPDDLGSEALQAYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ FQ+PCAHAPAL P  L   + P+S +EE+GYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLIVRTFQVPCAHAPALMPLPLDPDLSPRSAAEELGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTE-----ILGKNCIS------ASDVDSVILPIDACGGDGALAFANSKRNRP  233
              APQ++ +        +  +N  S      ASDVD+V++P  ACGG   L+   S+++R 
Sbjct  249   RAPQFVERQNPNPNFLVQTQNFTSLPGDIWASDVDAVVVPASACGGSALLSL--SRQSRT  306

Query  232   LIIAVEENETVLNDTPERLGIEAV  161
              IIAVEEN+T +  +PE LGI+A+
Sbjct  307   QIIAVEENQTSMQVSPEDLGIQAI  330



>ref|WP_007307784.1| hypothetical protein [Crocosphaera watsonii]
 gb|EAM48433.1| hypothetical protein CwatDRAFT_1101 [Crocosphaera watsonii WH 
8501]
Length=350

 Score =   322 bits (824),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 180/314 (57%), Positives = 225/314 (72%), Gaps = 9/314 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVA+A + V   LITHPNVLN A LYWP+ N+ YVEGY LD
Sbjct  10    LIVPTGIGAAIGGYAGDALPVAKAMAKVCHRLITHPNVLNGAQLYWPLDNIFYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA+G W L+PVHQNRVGL+LD GIE +LR RH+Q  DA RA+LGL+  +Y VTD PL V
Sbjct  70    RFAQGRWGLKPVHQNRVGLILDRGIEPELRTRHIQAADATRATLGLTLTDYVVTDTPLEV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I +P+SLLRA +KL+  S   A+AVVARFP D D  ++D+YR G G
Sbjct  130   ELRT-ADSGASWGTIGHPESLLRAADKLISKSKAEAIAVVARFPDDVDSVELDNYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F IPCAHAPAL P ++  S+ P++ +EE+GYTFLPCVL GL 
Sbjct  189   VDTLAGAEAVISHLIVREFAIPCAHAPALEPLEVDESISPRAAAEELGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++ +       N I A +VD+V++P  ACGG   L+F+        II V++N T 
Sbjct  249   RAPQFVSQPQ----TNSIWADEVDAVVIPHTACGGSAILSFSGGNTR---IITVKDNTTA  301

Query  199   LNDTPERLGIEAVS  158
             LN TPE LG+E ++
Sbjct  302   LNVTPEYLGMETIT  315



>ref|WP_007312815.1| hypothetical protein [Crocosphaera watsonii]
 gb|EHJ10220.1| hypothetical protein CWATWH0003_5026 [Crocosphaera watsonii WH 
0003]
 emb|CCQ64347.1| hypothetical protein CWATWH0401_1420 [Crocosphaera watsonii WH 
0401]
 emb|CCQ49819.1| FIG00563009: hypothetical protein [Crocosphaera watsonii WH 8502]
 emb|CCQ68711.1| hypothetical protein CWATWH0402_411 [Crocosphaera watsonii WH 
0402]
Length=350

 Score =   322 bits (824),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 180/314 (57%), Positives = 225/314 (72%), Gaps = 9/314 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVA+A + V   LITHPNVLN A LYWP+ N+ YVEGY LD
Sbjct  10    LIVPTGIGAAIGGYAGDALPVAKAMAKVCHRLITHPNVLNGAQLYWPLDNIFYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA+G W L+PVHQNRVGL+LD GIE +LR RH+Q  DA RA+LGL+  +Y VTD PL V
Sbjct  70    RFAQGRWGLKPVHQNRVGLILDRGIEPELRTRHIQAADATRATLGLTLTDYVVTDTPLEV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I +P+SLLRA +KL+  S   A+AVVARFP D D  ++D+YR G G
Sbjct  130   ELRT-ADSGASWGTIGHPESLLRAADKLISKSKAEAIAVVARFPDDVDSVELDNYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F IPCAHAPAL P ++  S+ P++ +EE+GYTFLPCVL GL 
Sbjct  189   VDTLAGAEAVISHLIVREFAIPCAHAPALEPLEVDESISPRAAAEELGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++ +       N I A +VD+V++P  ACGG   L+F+        II V++N T 
Sbjct  249   RAPQFVSQPQ----TNSIWADEVDAVVIPHTACGGSAILSFSGGNTR---IITVKDNTTA  301

Query  199   LNDTPERLGIEAVS  158
             LN TPE LG+E ++
Sbjct  302   LNVTPEYLGMETIT  315



>ref|WP_026798259.1| MULTISPECIES: hypothetical protein [Planktothrix]
Length=377

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 184/328 (56%), Positives = 227/328 (69%), Gaps = 20/328 (6%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD LPVARA + V D LITHPNVLN A LYWPM N LYVEG+ALD
Sbjct  9     LIIPTGIGAAIGGYAGDGLPVARAIAQVADTLITHPNVLNGAQLYWPMPNTLYVEGFALD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             + A G W L+PVHQNRVGL+LD  IE +LR+RHLQV DAARA+LGL+  +Y VTD PL V
Sbjct  69    QLAAGNWGLQPVHQNRVGLLLDQAIEPELRLRHLQVADAARATLGLTLTDYVVTDAPLNV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPd-dddedidDYRQGMG  560
                     G S G I NPDSLLRA E+L+K +   A+AVVARFP+ ++   ++ YR G G
Sbjct  129   AIRTS-TSGASWGTIGNPDSLLRAAERLIKEAKAEAIAVVARFPEPENSGVLEAYRHGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ FQIP AHAPALSP  +   + P+S +EE+GYTFLPCVL GL 
Sbjct  188   VDPLAGAEAVISHLIVRTFQIPSAHAPALSPLAIDPELSPRSAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNR------------  236
              APQ++   T + G   I A  VD++++P  ACGG   L+F+  +  R            
Sbjct  248   RAPQFV--NTAMAG--TIWADQVDAIVVPATACGGSAVLSFSRDEPRRVSEPRRVSEPRR  303

Query  235   --PLIIAVEENETVLNDTPERLGIEAVS  158
               P IIAV EN+T +  TPE+LGI A+ 
Sbjct  304   VWPQIIAVGENQTRMQVTPEQLGINAIQ  331



>ref|WP_017311189.1| hypothetical protein [Fischerella sp. PCC 9339]
Length=353

 Score =   320 bits (819),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 181/314 (58%), Positives = 224/314 (71%), Gaps = 6/314 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVA+  + V D LITHPNV+N A LYW + N  YVEGY LD
Sbjct  8     LIVPTGIGAAIGGYAGDALPVAKTIAQVCDRLITHPNVMNGATLYWNLPNAFYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVHQNR+GL+LD GIE +LR+R+LQ  DAARA+LGLS  +Y VTD PL V
Sbjct  68    KFAAGCWGLRPVHQNRIGLLLDQGIEPELRLRNLQAADAARATLGLSLTDYVVTDAPLNV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E     + G S G I NPDSLLRA E L+  +   A+AVVARFP + D++   +YR G G
Sbjct  128   ELRTS-ESGASWGTIGNPDSLLRAAEILINKAGAEAIAVVARFPDNIDEQADQNYRHGKG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISHLVV+ FQIPCAHAPA  PP L   + P+S +EE+GYTFLPCVL GL 
Sbjct  187   VDPIAGAEAVISHLVVRQFQIPCAHAPAFLPPSLDPDLSPRSAAEELGYTFLPCVLVGLS  246

Query  379   TAPQYLIKGTE-ILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ++++GTE IL    I A+ VD+VI+P  ACG     A  N  + + LI+ V EN T
Sbjct  247   RAPQFIVRGTEQILEPKDIWANQVDAVIVPATACGSS---ALLNLSQTQSLIVTVRENHT  303

Query  202   VLNDTPERLGIEAV  161
             +L   P+ LGI+++
Sbjct  304   LLQVPPQPLGIKSI  317



>ref|WP_015134782.1| hypothetical protein [Leptolyngbya sp. PCC 7376]
 ref|YP_007071862.1| hypothetical protein Lepto7376_2770 [Leptolyngbya sp. PCC 7376]
 gb|AFY39028.1| hypothetical protein Lepto7376_2770 [Leptolyngbya sp. PCC 7376]
Length=357

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 182/313 (58%), Positives = 226/313 (72%), Gaps = 6/313 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGA IGGYAGD LP AR  S V D LITHPNVLN A L+W MSN LYVEGY LD
Sbjct  14    LIIPTGIGAKIGGYAGDGLPTARLVSQVCDRLITHPNVLNGAQLFWNMSNALYVEGYGLD  73

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV QNRVG++LD GIEE+LR+RH+Q  DA RA+LGLS  +Y VTD PL V
Sbjct  74    QFAAGNWGLRPVRQNRVGMILDQGIEEELRLRHIQAADACRATLGLSVTDYVVTDAPLNV  133

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                +  + G S G I N  SLLRA EKL+  + V A+AVVARFP D+D E +  YRQG G
Sbjct  134   NLKLS-ETGASWGTIDNVGSLLRAAEKLITQAKVEAIAVVARFPDDEDSELLAQYRQGEG  192

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+VK FQIPCAHAPAL+P  +   + PK+ +EE+GYTFLPCVLAGL 
Sbjct  193   VDGLAGAEAVISHLLVKKFQIPCAHAPALAPIPIEPDLSPKTAAEELGYTFLPCVLAGLS  252

Query  379   TAPQYLI-KGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ+++ + T  L  + I +  VDS+++P  ACGG   L+ +++K    LIIAV EN+T
Sbjct  253   HAPQFVVDRKTPTLQNHGIWSDTVDSLVIPASACGGSAVLSLSHTKT---LIIAVNENDT  309

Query  202   VLNDTPERLGIEA  164
              L+  PE +G++A
Sbjct  310   ALSIFPETIGVQA  322



>ref|WP_026720919.1| hypothetical protein [Fischerella sp. PCC 9431]
Length=361

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 180/314 (57%), Positives = 222/314 (71%), Gaps = 6/314 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVA+  + V D LITHPNV+N A LYW + N  YVEGY LD
Sbjct  8     LIVPTGIGAAIGGYAGDALPVAKTIAQVCDRLITHPNVMNGATLYWNLPNAFYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVHQNR+GL+LD GIE +LR+RHLQ  DAARA+LGLS  +Y VTD PL V
Sbjct  68    KFAAGCWGLRPVHQNRIGLLLDQGIETELRLRHLQAADAARATLGLSLTDYVVTDAPLNV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E     + G S G I NPDSLLRA E L+  +   A+AVVARFP + +++   +YR G G
Sbjct  128   ELRTS-ESGASWGTIGNPDSLLRAAEILINKAGAEAIAVVARFPDEINEQADQNYRHGKG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISHLVV+ FQIPCAHAPA  PP L   + P+S +EE+GYTFLPCVL GL 
Sbjct  187   VDPIAGAEAVISHLVVRQFQIPCAHAPAFLPPSLDPDLSPRSAAEELGYTFLPCVLVGLS  246

Query  379   TAPQYLIKGT-EILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ++++ T +I     I A+ VD+VI+P  ACG     A  N  + R LI+ V EN T
Sbjct  247   RAPQFIVRETKQIPQPTDIWANQVDAVIVPASACGSS---ALLNLSQTRSLIVTVRENHT  303

Query  202   VLNDTPERLGIEAV  161
             +L   P+ LGI++V
Sbjct  304   LLQVPPQPLGIKSV  317



>tpg|DAA53629.1| TPA: hypothetical protein ZEAMMB73_031072 [Zea mays]
Length=291

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 171/239 (72%), Positives = 199/239 (83%), Gaps = 9/239 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTG+GAA+GG+AGDALPVARA + V DC+I+HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  50    LIIPTGVGAAVGGFAGDALPVARAVAGVADCVISHPNVLNAAMLYWPMPNTLYVEGYALD  109

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG WAL+PVHQN+VGLVLD+GIEEDLR+RHLQ+ DA RASLGL  VEY VTD PL +
Sbjct  110   RFAEGSWALQPVHQNKVGLVLDSGIEEDLRLRHLQIADATRASLGLPVVEYIVTDAPLEI  169

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             + W DP+CG+STG + N DSLLRAV+ LVK SDVNAVAVVARFPDDD ED D YR+G G+
Sbjct  170   KTWFDPRCGKSTGSVGNSDSLLRAVDALVKHSDVNAVAVVARFPDDDPEDSDCYREGKGV  229

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEI---------GYTF  407
             DLLAGVEA+ISHLVVK F+IP AHAPA+ PP LS  VCP+S +EE+         GYT+
Sbjct  230   DLLAGVEAIISHLVVKEFKIPSAHAPAVLPPPLSPLVCPRSAAEEVYVYRCVTTSGYTY  288



>ref|WP_027248848.1| hypothetical protein [Planktothrix agardhii]
 gb|KEI68537.1| hypothetical protein A19Y_3803 [Planktothrix agardhii NIVA-CYA 
126/8]
Length=364

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 181/325 (56%), Positives = 223/325 (69%), Gaps = 17/325 (5%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD LPVARA + V D LITHPNVLN A LYWPM+N LYVEGYALD
Sbjct  9     LIIPTGIGAAIGGYAGDGLPVARAIAQVADTLITHPNVLNGAQLYWPMANTLYVEGYALD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L+PVH NRVGL+LD  IE +LR+RHLQV DAARA+LGL+  +Y VTD PL V
Sbjct  69    QFAAGTWGLQPVHCNRVGLLLDQAIEPELRLRHLQVADAARATLGLTLTDYVVTDAPLNV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPd-dddedidDYRQGMG  560
                     G S G I NPDSLLRA E+L+K +   A+AVVARFP+ ++   ++ YR G G
Sbjct  129   AIRTS-TSGASWGTIGNPDSLLRAAERLIKDAKAEAIAVVARFPEPENIGVLEAYRHGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ FQIP AHAPALSP  +   + P+S +EE+GYTFLPCVL GL 
Sbjct  188   VDPLAGAEAVISHLIVRTFQIPTAHAPALSPLAIDPQLSPRSAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFAN-----------SKRNRP  233
              APQ++           I A  VD++++P  ACGG   L+F                +  
Sbjct  248   RAPQFVTTHK----AETIWADQVDAIVVPATACGGAAVLSFGQDAPIAFGMASPGHVSTT  303

Query  232   LIIAVEENETVLNDTPERLGIEAVS  158
              IIAV EN+T +  TPE+LGI+A+ 
Sbjct  304   QIIAVGENQTRMEVTPEQLGIKAIQ  328



>ref|WP_035997385.1| hypothetical protein [Leptolyngbya sp. JSC-1]
Length=358

 Score =   318 bits (814),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 188/316 (59%), Positives = 225/316 (71%), Gaps = 7/316 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             ++VPTG+GAAIGGYAGDALPVARA + VVD LITHPNVLN A LYWP+ N LY EGY LD
Sbjct  10    LLVPTGVGAAIGGYAGDALPVARALAQVVDRLITHPNVLNGAQLYWPLPNALYTEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVHQNRVGLVLD  IE +LR+RHLQV DAARA+LGLS  +Y VTD PL V
Sbjct  70    QFAAGEWGLRPVHQNRVGLVLDQAIELELRVRHLQVADAARATLGLSLTDYVVTDAPLGV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             E       G + G I  P SLLRAVEKL K +   A+AVVARFPDD   E +  YR G G
Sbjct  130   ELRTA-ASGATWGTIHQPASLLRAVEKL-KDAKAEAIAVVARFPDDPGTEALQLYRHGKG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQ+PCAHAPALSP  L  S+ P+S +EE+GYTFLPCVL GL 
Sbjct  188   VDPLAGAEAVISHLVVRTFQLPCAHAPALSPLPLDPSLSPRSAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ + + T    ++ I A  VD++I+P  ACGG   L+F+ S      II V++N T 
Sbjct  248   RAPQLIDQRTSPRAQD-IWADQVDALIVPETACGGSAVLSFSQSATQ---IITVKDNSTR  303

Query  199   LNDTPERLGIEAVSTR  152
             L  T E LGI++++ +
Sbjct  304   LKVTAEALGIQSLTVQ  319



>ref|NP_001141216.1| hypothetical protein [Zea mays]
 gb|ACF85739.1| unknown [Zea mays]
 tpg|DAA53627.1| TPA: hypothetical protein ZEAMMB73_031072 [Zea mays]
Length=275

 Score =   315 bits (806),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 194/225 (86%), Gaps = 0/225 (0%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTG+GAA+GG+AGDALPVARA + V DC+I+HPNVLNAAMLYWPM N LYVEGYALD
Sbjct  50    LIIPTGVGAAVGGFAGDALPVARAVAGVADCVISHPNVLNAAMLYWPMPNTLYVEGYALD  109

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFAEG WAL+PVHQN+VGLVLD+GIEEDLR+RHLQ+ DA RASLGL  VEY VTD PL +
Sbjct  110   RFAEGSWALQPVHQNKVGLVLDSGIEEDLRLRHLQIADATRASLGLPVVEYIVTDAPLEI  169

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             + W DP+CG+STG + N DSLLRAV+ LVK SDVNAVAVVARFPDDD ED D YR+G G+
Sbjct  170   KTWFDPRCGKSTGSVGNSDSLLRAVDALVKHSDVNAVAVVARFPDDDPEDSDCYREGKGV  229

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEE  422
             DLLAGVEA+ISHLVVK F+IP AHAPA+ PP LS  VCP+S +EE
Sbjct  230   DLLAGVEAIISHLVVKEFKIPSAHAPAVLPPPLSPLVCPRSAAEE  274



>ref|WP_015116898.1| hypothetical protein [Rivularia sp. PCC 7116]
 ref|YP_007053867.1| hypothetical protein Riv7116_0733 [Rivularia sp. PCC 7116]
 gb|AFY53320.1| Protein of unknown function (DUF3326) [Rivularia sp. PCC 7116]
Length=352

 Score =   316 bits (810),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 175/315 (56%), Positives = 225/315 (71%), Gaps = 6/315 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTG+GAAIGGYAGDALPVA+A + V D LITHPNVLN AMLYW + N LYVEGY +D
Sbjct  8     LIIPTGVGAAIGGYAGDALPVAKAMAEVCDVLITHPNVLNGAMLYWNLPNALYVEGYGID  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +F +G W L+PVHQN++GL+ D GIE DLR+R++Q  DA RA+LGL+  +Y VTD PL V
Sbjct  68    QFCQGYWGLQPVHQNKIGLIFDQGIEPDLRLRNIQATDAGRATLGLNLTDYVVTDAPLNV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E     + G S G I NPDSLLRA E L+  +D NA+AVVARFP   D E   +YR+G G
Sbjct  128   E-LRSAESGASWGTIGNPDSLLRAAEVLINKADANAIAVVARFPDYIDREAEQNYREGKG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISHL+V+ FQIPCAH+P  SPP L  ++ P+S +EEIGYTFLP VL GL 
Sbjct  187   VDPIAGAEAVISHLIVREFQIPCAHSPIFSPPPLDANLSPRSAAEEIGYTFLPSVLVGLS  246

Query  379   TAPQYLIKGTEILGKNC-ISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ++ +  E   +N  I  + VD+V++P +ACG    L+   S+RN   II VEEN+T
Sbjct  247   RAPQFVNRECEGFSRNNDIWVNQVDAVVVPANACGSSALLSL--SRRNTQ-IITVEENQT  303

Query  202   VLNDTPERLGIEAVS  158
              +   P  LG++ +S
Sbjct  304   QMQVFPHALGMKTIS  318



>ref|WP_012598023.1| hypothetical protein [Cyanothece sp. PCC 7424]
 ref|YP_002375944.1| hypothetical protein PCC7424_0615 [Cyanothece sp. PCC 7424]
 gb|ACK69076.1| conserved hypothetical protein [Cyanothece sp. PCC 7424]
Length=359

 Score =   315 bits (807),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 180/314 (57%), Positives = 223/314 (71%), Gaps = 6/314 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVARA SS+ D LITHPNVLN A LYW + N  YVEGY LD
Sbjct  9     LIVPTGIGAAIGGYAGDALPVARAVSSICDRLITHPNVLNGAQLYWNLPNTYYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA+G W L+PVHQNRVGL+LD GIE DLR+RHLQ  DA RA+LGL+  +Y +TD PL V
Sbjct  69    QFAQGNWGLKPVHQNRVGLILDQGIESDLRLRHLQAADATRATLGLNLTDYVITDAPLQV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             E     + G S G I NP SLLRA E L++ +   A+A+VARFPDD D   + +YR G G
Sbjct  129   ELRT-AESGASWGTIGNPGSLLRAAETLIEQARAQAIAIVARFPDDPDSLALQNYRYGCG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F+IP AHAPAL P  L  ++ P+S +EE+GYTFLPCVL GL 
Sbjct  188   VDALAGAEAVISHLIVRSFKIPAAHAPALMPLPLDENISPRSAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLIKGTEILG-KNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ+++K          I +  VD+VI+P +ACGG   L+F        LIIAV++N+T
Sbjct  248   RAPQFILKTDNYSPVSETIWSDSVDAVIIPANACGGSATLSFTAQNS---LIIAVQDNKT  304

Query  202   VLNDTPERLGIEAV  161
              +   PE LGI+ +
Sbjct  305   QMQVPPEALGIKGI  318



>ref|WP_030007425.1| hypothetical protein [Synechococcus sp. NKBG042902]
Length=342

 Score =   314 bits (804),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 179/312 (57%), Positives = 223/312 (71%), Gaps = 7/312 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGA IGGYAGD +P+AR  + V D LITHPNVLN A L+WPM+N  YVEGY LD
Sbjct  2     LIIPTGIGAKIGGYAGDGIPIARLMAQVCDRLITHPNVLNGAQLFWPMANTFYVEGYGLD  61

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV QN+VGL+LD GIE +L+ RH+Q  +A RA+LGL   +Y VTD PL V
Sbjct  62    QFAAGNWGLRPVRQNKVGLLLDQGIEAELKTRHIQGAEACRATLGLLITDYVVTDAPLNV  121

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                V  + G S G I+N  SLLRA EKL+  + V A+AVVARFP D+D E +  YRQG G
Sbjct  122   TLKVS-ETGVSWGTIENVGSLLRAAEKLITQAKVEAIAVVARFPDDEDSELLAQYRQGSG  180

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+VK FQIPCAHAPALSP  +   + PK+ +EE+GYTFLPC+LAGL 
Sbjct  181   VDALAGAEAVISHLLVKKFQIPCAHAPALSPLPIEPELSPKAAAEELGYTFLPCILAGLS  240

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++ KG    G+  I A  VDS+++P  ACGG   L+ A ++    LIIAV EN+T 
Sbjct  241   YAPQFVTKGDRQAGE--IWADQVDSLVIPASACGGSAVLSLAQTQT---LIIAVNENDTA  295

Query  199   LNDTPERLGIEA  164
             L+  PE +GI+A
Sbjct  296   LSIFPESVGIKA  307



>ref|WP_015230129.1| hypothetical protein [Dactylococcopsis salina]
 ref|YP_007172496.1| hypothetical protein Dacsa_2550 [Dactylococcopsis salina PCC 
8305]
 gb|AFZ51139.1| Protein of unknown function (DUF3326) [Dactylococcopsis salina 
PCC 8305]
Length=357

 Score =   314 bits (804),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 182/333 (55%), Positives = 228/333 (68%), Gaps = 12/333 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGA IGGYAGDALP+AR+ + + D LITHPNVLN A LYW + N+ YVEGY LD
Sbjct  10    LIVPTGIGAKIGGYAGDALPIARSIAQISDHLITHPNVLNGAQLYWSLPNMYYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA   W L PVHQNRVGL+LD GIE DLR+RHLQ  +A + +LGL+  +Y VTD PL V
Sbjct  70    QFAANRWGLRPVHQNRVGLILDQGIEPDLRLRHLQAAEAVKTTLGLNIGDYIVTDTPLGV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             +       G S G I +PDSLLRA   L++ + V+A+AVVARFP D   E + +YRQG G
Sbjct  130   QLQT-AHSGASWGTIAHPDSLLRAAATLIETAKVSAIAVVARFPDDMATETLANYRQGKG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EA+ISHL+V+ FQIPCAHAPALSP  +  +V P++ +EE+GYTFLPCVL GL 
Sbjct  189   VDALAGAEAIISHLIVREFQIPCAHAPALSPLPVDETVSPRAAAEELGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ +   T I     +    VD+V++P DACGG   L F+ S+     IIAVE+N T 
Sbjct  249   RAPQLI---TSIDQSTDLQGKQVDAVVIPADACGGSSILNFSQSEAK---IIAVEDNATT  302

Query  199   LNDTPERLGIEAVS-TRYLGNSFYLLYLCDLRG  104
             +  +PE LGI+ +  T YL     L  L  LRG
Sbjct  303   MTVSPESLGIKTIRVTSYLEA---LGVLVTLRG  332



>ref|WP_012595868.1| hypothetical protein [Cyanothece sp. PCC 8801]
 ref|YP_002372757.1| hypothetical protein PCC8801_2596 [Cyanothece sp. PCC 8801]
 gb|ACK66601.1| conserved hypothetical protein [Cyanothece sp. PCC 8801]
Length=363

 Score =   314 bits (804),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 180/317 (57%), Positives = 224/317 (71%), Gaps = 9/317 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVARA S V D LITHPNVLN A LYW + NVLYVEGY LD
Sbjct  12    LIVPTGIGAAIGGYAGDALPVARAMSQVCDRLITHPNVLNGAQLYWNLPNVLYVEGYGLD  71

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA+G W L+  HQNRVGL+LD GIE +LR+RHLQ  DA RA+LGL   +Y +TD PL V
Sbjct  72    RFAQGDWGLKSTHQNRVGLILDQGIEPELRLRHLQAADATRATLGLDLTDYILTDAPLNV  131

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSL+RA E L+  +  +A+A+VARFP + D   +++YR G G
Sbjct  132   ELRT-ASSGASWGTIGNPDSLVRAAETLITQAKADAIAIVARFPDNIDSLALNNYRHGQG  190

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F IP AHAPAL P  L  ++ P+S +EE+GYTFLPCVL GL 
Sbjct  191   VDPLAGAEAVISHLIVRQFSIPTAHAPALMPLPLDATISPRSAAEELGYTFLPCVLVGLS  250

Query  379   TAPQYLIKGTEI--LGK--NCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEE  212
              AP+++ +  E   LG+  + I   +VD+V++P  ACGG   L+F+        II V +
Sbjct  251   RAPRFVRREKESFNLGRSSDIIWGDEVDAVVIPETACGGSAILSFSQQNTR---IITVAD  307

Query  211   NETVLNDTPERLGIEAV  161
             N+T LN TPE LGI+A+
Sbjct  308   NKTQLNVTPESLGIQAI  324



>ref|WP_039730206.1| hypothetical protein, partial [Lyngbya confervoides]
Length=343

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 176/316 (56%), Positives = 223/316 (71%), Gaps = 8/316 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GAAIGGYAGDALPV RA + V D +ITHPNVLN A LYWP+ N LYVEGY LD
Sbjct  10    LIVPTGVGAAIGGYAGDALPVVRAIAQVADTVITHPNVLNGAQLYWPLPNALYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVH+NR+GL+LD+ IEE LR RH+Q  DAARA+LGL+  +Y VTD P+ V
Sbjct  70    QFAAGQWGLRPVHRNRIGLLLDSEIEESLRWRHVQAADAARATLGLAMTDYVVTDAPVRV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddd-dedidDYRQGMG  560
                     G + G I NP +LLRA E+LV+     A+AVV RFP+++    + +YRQG G
Sbjct  130   TLQT-ADSGATWGTIANPGTLLRAAERLVQ-LGAEAIAVVVRFPEEEDAIALQNYRQGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+H QIPCAHAPALSP  L  ++ PKS +EE+G+TFLPCVLAGL 
Sbjct  188   VDPLAGAEAVISHLLVRHLQIPCAHAPALSPLPLDPTLSPKSAAEELGHTFLPCVLAGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++  G   +G   ++   VD+VI P  A GG G L+ + +      +IAVEEN T 
Sbjct  248   RAPQFVTSGDRPMG--IVNRDQVDAVIAPATAFGGSGVLSLSGTAAQ---LIAVEENTTT  302

Query  199   LNDTPERLGIEAVSTR  152
             L  TPE++G+ A+  R
Sbjct  303   LTITPEKVGVNALRVR  318



>ref|WP_015784728.1| hypothetical protein [Cyanothece sp. PCC 8802]
 ref|YP_003139167.1| hypothetical protein Cyan8802_3510 [Cyanothece sp. PCC 8802]
 gb|ACV02332.1| conserved hypothetical protein [Cyanothece sp. PCC 8802]
Length=363

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 180/317 (57%), Positives = 224/317 (71%), Gaps = 9/317 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVARA S V D LITHPNVLN A LYW + NVLYVEGY LD
Sbjct  12    LIVPTGIGAAIGGYAGDALPVARAMSQVCDRLITHPNVLNGAQLYWNLPNVLYVEGYGLD  71

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA+G W L+  HQNRVGL+LD GIE +LR+RHLQ  DA RA+LGL   +Y +TD PL V
Sbjct  72    RFAQGDWGLKSTHQNRVGLILDQGIEPELRLRHLQAADATRATLGLDLTDYILTDAPLNV  131

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSL+RA E L+  +  +A+A+VARFP + D   +++YR G G
Sbjct  132   ELRT-ASSGASWGTIGNPDSLVRAAETLITQAKADAIAIVARFPDNIDSLALNNYRHGQG  190

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F IP AHAPAL P  L  ++ P+S +EE+GYTFLPCVL GL 
Sbjct  191   VDPLAGAEAVISHLIVRQFSIPTAHAPALMPLPLDATISPRSAAEELGYTFLPCVLVGLS  250

Query  379   TAPQYLIKGTEI--LGK--NCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEE  212
              AP+++ +  E   LG+  + I   +VD+V++P  ACGG   L+F+        II V +
Sbjct  251   RAPRFVRREEESFNLGRSSDIIWGHEVDAVVIPETACGGSAILSFSQQNTR---IITVAD  307

Query  211   NETVLNDTPERLGIEAV  161
             N+T LN TPE LGI+A+
Sbjct  308   NKTQLNVTPESLGIQAI  324



>ref|WP_033374264.1| hypothetical protein [Spirulina subsalsa]
Length=347

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 174/313 (56%), Positives = 225/313 (72%), Gaps = 8/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GA+IGGYAGDALPVARA + + D LITHPNVLN A LYW   ++ YVEGY LD
Sbjct  11    LIVPTGVGASIGGYAGDALPVARAMAEICDRLITHPNVLNGAQLYWSSPHLFYVEGYGLD  70

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA+G W L+PVHQNRVGL+LD+GIE DL++RH+Q  +A +A+LGL   +Y +TD PL V
Sbjct  71    QFAQGHWGLQPVHQNRVGLILDSGIEPDLQLRHIQAAEATKATLGLPVTDYILTDAPLGV  130

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E    P  G S G +  PDSLLRA E+L+  S VNA+AVVARFP D +   + +YR G G
Sbjct  131   ELRTAPS-GASWGTLARPDSLLRAAEQLIHQSRVNAIAVVARFPDDLESTALQNYRHGSG  189

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F+IPCAHAPALSP  L   + P++ +EE+GYTFLPCVL GL 
Sbjct  190   VDPLAGAEAVISHLIVRQFKIPCAHAPALSPLPLDPQLSPRAAAEELGYTFLPCVLVGLA  249

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++  G     +  I A  VD++++P +ACGG   LA +++     L+IAV  NET 
Sbjct  250   RAPQFVTAGQNRTPEQ-IWADHVDAIVVPANACGGGATLALSHT-----LVIAVGANETR  303

Query  199   LNDTPERLGIEAV  161
             +   PE LGI+A+
Sbjct  304   MQVPPEPLGIKAI  316



>ref|WP_009543076.1| MULTISPECIES: hypothetical protein [Cyanothece]
 ref|YP_001801547.1| hypothetical protein cce_0129 [Cyanothece sp. ATCC 51142]
 gb|ACB49481.1| unknown [Cyanothece sp. ATCC 51142]
Length=350

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 179/314 (57%), Positives = 219/314 (70%), Gaps = 9/314 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVA+A + V D LITHPNVLN A LYWP+ N  YVEGY LD
Sbjct  10    LIVPTGIGAAIGGYAGDALPVAKAMAQVCDRLITHPNVLNGAQLYWPLDNTFYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA+G W L PVHQNRVGL+LD GIE +LR RH+Q  DA RA+LGL+  +Y VTD PL V
Sbjct  70    RFAQGDWGLNPVHQNRVGLILDRGIEPELRTRHIQAADATRATLGLTLTDYVVTDTPLQV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I +PDSLLRA  KL+  S   A+AVVARFP D D   +D+YR G G
Sbjct  130   ELRT-ADSGASWGTIGHPDSLLRAAHKLITHSKAEAIAVVARFPDDVDSLVLDNYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F+IPCAHAPAL P  +  ++ P++ +EE+GYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLIVREFRIPCAHAPALEPLPVDDTISPRAAAEELGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++ +         I A  VD++++P  ACGG   L+ +        II V +N T 
Sbjct  249   RAPQFVTQPHPY----SIWADQVDALVIPDTACGGSAMLSLSECNTR---IITVTDNTTA  301

Query  199   LNDTPERLGIEAVS  158
             LN TP+ LGIEA++
Sbjct  302   LNVTPQDLGIEAIA  315



>ref|WP_012308227.1| hypothetical protein [Synechococcus sp. PCC 7002]
 ref|YP_001735864.1| hypothetical protein SYNPCC7002_A2632 [Synechococcus sp. PCC 
7002]
 gb|ACB00609.1| conserved hypothetical protein [Synechococcus sp. PCC 7002]
Length=342

 Score =   312 bits (799),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 178/312 (57%), Positives = 222/312 (71%), Gaps = 7/312 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGA IGGYAGD +P+AR  + V D LITHPNVLN A L+WPM+N  YVEGY LD
Sbjct  2     LIIPTGIGAKIGGYAGDGIPIARLMAQVCDRLITHPNVLNGAQLFWPMANTFYVEGYGLD  61

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV QN+VGL+LD GIE +L+ RH+Q  +A RA+LGL   +Y VTD PL V
Sbjct  62    QFAAGNWGLRPVRQNKVGLLLDQGIEAELKTRHIQGAEACRATLGLPITDYVVTDAPLNV  121

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                V  + G S G I+N  SLLRA EKL+  + V A+AVVARFP D+D E +  YRQG G
Sbjct  122   TLKVS-ETGVSWGTIENVGSLLRAAEKLITQAKVEAIAVVARFPDDEDSELLAQYRQGSG  180

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+VK FQIPCAHAPALSP  +   + PK+ +EE+GYTFLPC+LAGL 
Sbjct  181   VDALAGAEAVISHLLVKKFQIPCAHAPALSPLPIEPELSPKAAAEELGYTFLPCILAGLS  240

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++  G    G+  I A  VDS+++P  ACGG   L+ A ++    LIIAV EN+T 
Sbjct  241   YAPQFVTTGDRQAGE--IWADQVDSLVIPASACGGSAVLSLAQTQT---LIIAVNENDTA  295

Query  199   LNDTPERLGIEA  164
             L+  PE +GI+A
Sbjct  296   LSIFPESVGIKA  307



>ref|WP_016861945.1| hypothetical protein [Fischerella muscicola]
Length=353

 Score =   312 bits (800),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 178/314 (57%), Positives = 220/314 (70%), Gaps = 6/314 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVA+  + V D LITHPNV+N A+LYW + N  YVEGY LD
Sbjct  8     LIVPTGIGAAIGGYAGDALPVAKTIAQVCDRLITHPNVMNGAILYWNLPNAFYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVHQNRVGL+LD GIE +LR+RHLQ  DAARA+LGLS  +Y VTD PL V
Sbjct  68    KFAAGCWGLRPVHQNRVGLLLDQGIEPELRLRHLQAADAARATLGLSLTDYVVTDAPLNV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E     + G S G I NPDSLLRA E L+  +   A+AVVARFP   D++   +YR G G
Sbjct  128   ELRTS-ESGASWGTIGNPDSLLRAAEILINKAGAEAIAVVARFPDYIDEQADQNYRHGKG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISHLVV+ F IPCAHAPA  PP L   + P+S +EE+GYTFLP VL GL 
Sbjct  187   VDPIAGAEAVISHLVVRQFHIPCAHAPAFLPPSLDPDLSPRSAAEELGYTFLPSVLVGLS  246

Query  379   TAPQYLIKGTE-ILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ++++  E I     I A+ VD+VI+P  ACG    L+ + ++    LI+ V EN T
Sbjct  247   RAPQFIVREIEQIFEPTDIWANQVDAVIMPATACGSSALLSLSQTQS---LIVTVRENHT  303

Query  202   VLNDTPERLGIEAV  161
             +L   P+ LGI++V
Sbjct  304   LLQVPPQPLGIKSV  317



>ref|WP_017293497.1| hypothetical protein [Geminocystis herdmanii]
Length=350

 Score =   312 bits (799),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 180/318 (57%), Positives = 227/318 (71%), Gaps = 13/318 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGA+IGGYAGDALPVAR+FS V D +ITHPNV+N A LYW   N+ YVEGYALD
Sbjct  10    LIIPTGIGASIGGYAGDALPVARSFSQVCDRVITHPNVMNGANLYWQCENIDYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W LE V QN++GL+LD GIE +LR RHLQV DA RA+LG++  +Y +TD  L V
Sbjct  70    KFASGEWGLESVRQNKIGLILDKGIETELRYRHLQVADAVRATLGINIQDYIITDRALNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLR+ E L++   VNA+AVVARFP D D + ++DYR G G
Sbjct  130   ELRT-ADSGASWGTIGNPDSLLRSAETLIREKKVNALAVVARFPDDTDSKALEDYRHGNG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D+LAG EAVISHL+V+ FQIPCAHAPALSP  L  ++  +S +EE+GYTFL CVL GL 
Sbjct  189   VDVLAGAEAVISHLLVREFQIPCAHAPALSPLPLDINISARSSAEELGYTFLSCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCIS--ASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENE  206
              APQ+  +      +N  S  A D++S+++P  ACGG   L+F+        IIAVE+NE
Sbjct  249   KAPQFTFQ------RNPYSLWAEDINSLVIPYSACGGSAVLSFSGLNTT---IIAVEDNE  299

Query  205   TVLNDTPERLGIEAVSTR  152
             TVLN  PE LGI+A+  +
Sbjct  300   TVLNIPPEVLGIKAIRVK  317



>ref|WP_017314371.1| hypothetical protein [Mastigocladopsis repens]
Length=362

 Score =   312 bits (799),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 175/313 (56%), Positives = 222/313 (71%), Gaps = 4/313 (1%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GAAIGGYAGDALPVA+A S V D LITHPNVLN A LYW + N  YVEGY LD
Sbjct  8     LIVPTGVGAAIGGYAGDALPVAKAASQVCDRLITHPNVLNGASLYWNLPNTFYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVHQNR+GL+ D GIE +LR+RHLQ  DAARA+LGLS  +Y ++D PL V
Sbjct  68    KFAAGCWGLRPVHQNRIGLLFDQGIEPELRLRHLQATDAARATLGLSITDYVISDAPLNV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLRA + L+K +   A+A+VARFP   D+E   +YRQG G
Sbjct  128   ELRTS-ASGASWGTIGNPDSLLRAAQVLIKRAGAEAIAIVARFPDTVDEEAEQNYRQGKG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISHL+V+ FQIPCAH+PA  PP L  ++ P+S +EE+GYTFL  VL GL 
Sbjct  187   VDPIAGAEAVISHLIVRTFQIPCAHSPAFCPPPLDPNLSPRSAAEELGYTFLSSVLVGLS  246

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++    E+     I A+ VD+VI+P  ACG    L+ + ++R +  II VEEN+T 
Sbjct  247   RAPQFIRASDELSQSGDIWANQVDAVIVPATACGSSALLSLSENRRCQ--IITVEENQTQ  304

Query  199   LNDTPERLGIEAV  161
             ++  P+ LGI++V
Sbjct  305   VDVRPQPLGIKSV  317



>ref|WP_015194845.1| hypothetical protein [Stanieria cyanosphaera]
 ref|YP_007134150.1| hypothetical protein Sta7437_3688 [Stanieria cyanosphaera PCC 
7437]
 gb|AFZ37184.1| hypothetical protein Sta7437_3688 [Stanieria cyanosphaera PCC 
7437]
Length=360

 Score =   311 bits (798),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 176/321 (55%), Positives = 221/321 (69%), Gaps = 13/321 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GAAIGGYAGDALPVARA + V D ++THPNVLN A LYW M N  YVEGY LD
Sbjct  9     LIVPTGVGAAIGGYAGDALPVARAMAQVCDRVLTHPNVLNGAQLYWSMDNTYYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA   W L+PVHQNR+GL+LD GIE +LR+RHLQ  DA RA+LGL+  +Y VTD PL V
Sbjct  69    RFAASNWGLQPVHQNRIGLLLDRGIETELRLRHLQAADATRATLGLNLTDYVVTDAPLEV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             +       G S G I NP SLLR  EKL++ +  NA+AVVARFP + +   +++YR G G
Sbjct  129   QLRTA-ASGASWGTIGNPASLLRGAEKLIRQAGANAIAVVARFPDEQESLALNNYRHGAG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ FQIP AHAPAL+P  L  ++ P++ +EE+GYTFLPCVL GL 
Sbjct  188   VDPLAGAEAVISHLLVRQFQIPAAHAPALNPLPLEPNLSPRAAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLIKGTEILGKN--------CISASDVDSVILPIDACGGDGALAFANSKRNRPLII  224
              APQ++        +          I A+ VD+VI+P  ACGG   L+F+ +      II
Sbjct  248   RAPQFVTPQKSTSARTSPALEVSATIWANQVDTVIVPASACGGSAILSFSGTSTQ---II  304

Query  223   AVEENETVLNDTPERLGIEAV  161
             AVEEN T +   PE LGI+A+
Sbjct  305   AVEENTTQMQVPPEPLGIKAI  325



>ref|WP_024544776.1| hypothetical protein [Synechococcus sp. NKBG15041c]
Length=357

 Score =   311 bits (796),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 176/312 (56%), Positives = 223/312 (71%), Gaps = 7/312 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGA IGGYAGD +P+AR  + V D LITHPNVLN A L+WPM+N  YVEGY LD
Sbjct  17    LIIPTGIGAKIGGYAGDGIPIARLMAQVCDRLITHPNVLNGAQLFWPMANTFYVEGYGLD  76

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV QN+VGL+LD GIE +L+ RH+Q  +A RA+LGL   +Y VTD PL V
Sbjct  77    QFAAGNWGLRPVRQNKVGLILDQGIEIELQTRHIQGAEACRATLGLPVTDYVVTDAPLNV  136

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                V  + G S G I+N  SLLRA EKL+  + V A+AV+ARFP D+D E +  YRQG G
Sbjct  137   TLNVS-ETGVSWGTIENVGSLLRAAEKLITQAKVQAIAVIARFPDDEDSELLAQYRQGSG  195

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+VK FQIPCAHAPALSP  +  ++ PK+ +EE+GYTFLPCVLAGL 
Sbjct  196   VDALAGAEAVISHLLVKQFQIPCAHAPALSPLPIEPALSPKAAAEELGYTFLPCVLAGLS  255

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ+++ G    G   I A  +DS+++P  ACGG   L+ A ++    L+IAV EN+T 
Sbjct  256   YAPQFVMAGDRQTG--TIWADQIDSLVIPASACGGSAVLSLAQTET---LVIAVNENDTA  310

Query  199   LNDTPERLGIEA  164
             L+  PE +GI+A
Sbjct  311   LSIFPESVGIKA  322



>ref|WP_019499684.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=344

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 176/316 (56%), Positives = 220/316 (70%), Gaps = 5/316 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +++PTGI AAIGGYAGDALPVARA ++V D LITHPNVLN A L+WPM NVLYVEGYA+D
Sbjct  10    LLIPTGINAAIGGYAGDALPVARAIAAVSDTLITHPNVLNGASLFWPMPNVLYVEGYAID  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             R A+G W L PVH NR+G++LD  IE DL +RH Q + AARA+LGL+  +  +TDLPL V
Sbjct  70    RVAQGEWGLRPVHGNRIGVILDRAIEPDLELRHRQAIAAARATLGLNISDIVITDLPLGV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             E     K G + G I  PDSLLRA  KL+  + V+A+AVVARFPDD D   + +YRQG G
Sbjct  130   E-IAQGKSGATWGTIAQPDSLLRAASKLICDAKVSAIAVVARFPDDPDSLALRNYRQGKG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISH +V+ F IPCAHAPAL P  L   + P+S +EE+GYTFLPCVLAGL 
Sbjct  189   VDALAGAEAVISHSIVREFAIPCAHAPALQPLPLDPDISPRSAAEELGYTFLPCVLAGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ +   ++I   + +S  D+D  I P  ACGG G L    S   +  +I +EEN T 
Sbjct  249   RAPQLIADRSQIRSGD-LSVDDIDVAIAPASACGGAGLLVLGRSSTTQ--LIFIEENTTA  305

Query  199   LNDTPERLGIEAVSTR  152
             LN +PE +G+  +  R
Sbjct  306   LNVSPEAMGLNGMRVR  321



>ref|WP_015158688.1| Protein of unknown function (DUF3326) [Chamaesiphon minutus]
 ref|YP_007096031.1| Protein of unknown function (DUF3326) [Chamaesiphon minutus PCC 
6605]
 gb|AFY92504.1| Protein of unknown function (DUF3326) [Chamaesiphon minutus PCC 
6605]
Length=351

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 176/316 (56%), Positives = 224/316 (71%), Gaps = 6/316 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAA+GG+AGDALP+ARA ++  D LITHPNV+N A LYW M N LYVEGYALD
Sbjct  9     LIVPTGIGAAMGGFAGDALPIARAVAASCDRLITHPNVMNGAQLYWSMPNALYVEGYALD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L+P+ +N++G+V D  I +DLR+RHLQ  DAARA+LGL  V+Y VTDLPL V
Sbjct  69    RFAAGAWGLQPLRRNKIGIVFDRSISDDLRVRHLQAADAARATLGLELVDYVVTDLPLGV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +       G S G I+ PDSLLRAV+K +  +   A+AV+ARFPDD     + DYR G+G
Sbjct  129   DLRT-AASGASWGTIEQPDSLLRAVDKSISVAGAEAIAVIARFPDDPGATILHDYRHGVG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ F++PCAHAPALSP  +   + P+S +EE+GYTFLPCVL GL 
Sbjct  188   VDPLAGAEAVISHLVVRTFKVPCAHAPALSPLPIDPEISPRSAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++   T       I   +VD+VI+P  ACGG G L FA S R +  II V EN+T 
Sbjct  248   RAPQFI--ATPTAPGAGIWHDEVDAVIIPESACGGSGLLNFATSSRAK--IITVAENQTR  303

Query  199   LNDTPERLGIEAVSTR  152
             +  TP+ + I+++  R
Sbjct  304   MAVTPKDVRIQSIGVR  319



>ref|WP_002802418.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI37032.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9701]
Length=352

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 179/313 (57%), Positives = 218/313 (70%), Gaps = 9/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD +PVARA + V D LITHPNVLN A LYWP++N  YVEGYALD
Sbjct  10    LIIPTGIGAAIGGYAGDGIPVARAIAQVCDRLITHPNVLNGAQLYWPLANTYYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVHQNR+GL+ D  IE DL  RHLQ  DA RA+LGL   +Y +TD PL V
Sbjct  70    RFARGDWGLSPVHQNRIGLLFDRAIEFDLLQRHLQAADAVRATLGLDLTDYVITDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +   +   G S G I NPDSLLR  EKL+K     A+A++ARFPDD D   + +YR G G
Sbjct  130   Q-LREAASGASWGTIGNPDSLLRGAEKLIKQGRAEAIAIIARFPDDPDSIALANYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIP AHAPALSP  L   + PK+ +EEIGYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLVVRQFQIPAAHAPALSPLPLDPQLSPKAAAEEIGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ L+K     G + I + +VD++I+P  ACG    L+F   K    ++IAV+EN T 
Sbjct  249   RAPQ-LVKQP---GPDAIWSREVDALIVPASACGSSTVLSFCQEKT---VLIAVQENSTR  301

Query  199   LNDTPERLGIEAV  161
             +   PE LG++A+
Sbjct  302   MKVAPEPLGVKAI  314



>ref|WP_039716645.1| hypothetical protein [Scytonema millei]
 gb|KIF19151.1| hypothetical protein QH73_39525 [Scytonema millei VB511283]
Length=354

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 178/314 (57%), Positives = 219/314 (70%), Gaps = 7/314 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDA+PVAR  +SV D LITHPNVLN A LYW + N  YVEGY LD
Sbjct  9     LIVPTGIGAAIGGYAGDAMPVARTLASVCDRLITHPNVLNGAQLYWSLPNAFYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVHQNRVGL+LD GIE DLR+RHLQ  DAARA+LGL+  +Y +TD PL V
Sbjct  69    KFAVGCWGLRPVHQNRVGLILDKGIESDLRLRHLQAADAARATLGLNLTDYVITDAPLNV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLRA E L+  +   A+AVVARFP D   E + +YR G G
Sbjct  129   ELRT-AASGASWGTIGNPDSLLRAAEVLISKAGAEAIAVVARFPDDVGSEALQNYRHGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EA+ISHL+VK FQIPCAH+PALS   L   + P+S +EE+GYTFLP VL GL 
Sbjct  188   VDPLAGAEAIISHLIVKTFQIPCAHSPALSSLPLDPDLSPRSAAEELGYTFLPSVLVGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ+++   + L +  I A+ V++VI+P  ACG    L+ + S+     II V EN+T 
Sbjct  248   RAPQFVVDKPQHLEE--IWANQVNAVIIPATACGSSAVLSLSQSQAQ---IITVAENQTT  302

Query  199   LNDTPERLGIEAVS  158
             +   P  LGI+A++
Sbjct  303   MQVPPAPLGIKAIA  316



>ref|WP_008191858.1| hypothetical protein [Moorea producens]
 gb|EGJ28375.1| hypothetical protein LYNGBM3L_74710 [Moorea producens 3L]
Length=365

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 180/326 (55%), Positives = 223/326 (68%), Gaps = 18/326 (6%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTG+GA+IGGYAGDALPVARA + V D LITHPNVLN A LYW + N  YVEGY LD
Sbjct  10    LIIPTGVGASIGGYAGDALPVARAIAQVCDRLITHPNVLNGAQLYWNLPNAFYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVHQNRVGL+LD GIE +LR+RHLQ  DA RA+LGL+  +Y VTD PL V
Sbjct  70    KFAAGSWGLRPVHQNRVGLLLDQGIEPELRLRHLQAADATRATLGLNLTDYVVTDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLRA + L++ +  +A+AVV RFP D D E + DYR G G
Sbjct  130   ELRT-AASGASWGTIGNPDSLLRAAQVLIEQAGADAIAVVVRFPDDFDSEALQDYRHGRG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EA+ISHL+V+ FQIPCAHAPAL P  +   + P+S +EE+GYTFLPCVL GL 
Sbjct  189   VDPLAGAEAIISHLIVRTFQIPCAHAPALMPLPIDPKLSPRSAAEELGYTFLPCVLVGLS  248

Query  379   TAPQYLIK------------GTEILGK-NCISASDVDSVILPIDACGGDGALAFANSKRN  239
              APQ+++                I  K   I A DVD++++P  ACGG   L+F+  +  
Sbjct  249   RAPQFVVNQKNSPSSLANPDSQTISSKPGDIWADDVDAIVIPATACGGSAMLSFSQLQTQ  308

Query  238   RPLIIAVEENETVLNDTPERLGIEAV  161
                IIAVEEN+T +   PE LGI+A+
Sbjct  309   ---IIAVEENQTTMEVPPEPLGIKAI  331



>ref|WP_016871549.1| hypothetical protein [Fischerella thermalis]
Length=353

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 175/314 (56%), Positives = 220/314 (70%), Gaps = 6/314 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVA+  + V D LITHPNV+N A LYW + N  YVEGY LD
Sbjct  8     LIVPTGIGAAIGGYAGDALPVAKTIAQVCDRLITHPNVMNGATLYWNLPNAFYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVHQNR+GL+LD GIE +LR+RHLQ  DAARA+LGLS  +Y VTD PL V
Sbjct  68    KFASGCWGLRPVHQNRIGLLLDQGIEPELRVRHLQAADAARATLGLSLTDYVVTDAPLNV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLR+ E L+  +   A+AVVARFP + D++   +YR G G
Sbjct  128   ELRTS-ASGVSWGTIGNPDSLLRSAEILINKAGAEAIAVVARFPDNIDEQADQNYRHGKG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISHL+V+ F IPCAH+PA  PP L   + P+S +EE+GYTFLP VL GL 
Sbjct  187   VDPIAGAEAVISHLLVRQFHIPCAHSPAFLPPSLDPDLSPRSAAEELGYTFLPSVLVGLS  246

Query  379   TAPQYLIKGTE-ILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ++++ TE I     I A+ +D+VI+P  ACG    L  + S+    LI+ V+EN T
Sbjct  247   RAPQFIVRETEQIPEPKDIWANQIDAVIVPASACGSSTLLNLSQSQS---LIVTVQENHT  303

Query  202   VLNDTPERLGIEAV  161
             +L   P+ LGI++V
Sbjct  304   LLQVPPQPLGIKSV  317



>ref|WP_009457281.1| hypothetical protein [Fischerella sp. JSC-11]
 gb|EHC12985.1| hypothetical protein FJSC11DRAFT_2602 [Fischerella sp. JSC-11]
Length=353

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 175/314 (56%), Positives = 220/314 (70%), Gaps = 6/314 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVA+  + V D LITHPNV+N A LYW + N  YVEGY LD
Sbjct  8     LIVPTGIGAAIGGYAGDALPVAKTIAQVCDRLITHPNVMNGATLYWNLPNAFYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVHQNR+GL+LD GIE +LR+RHLQ  DAARA+LGLS  +Y VTD PL V
Sbjct  68    KFASGCWGLRPVHQNRIGLLLDQGIEPELRVRHLQAADAARATLGLSLTDYVVTDAPLNV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLR+ E L+  +   A+AVVARFP + D++   +YR G G
Sbjct  128   ELRTS-ASGVSWGTIGNPDSLLRSAEILINKAGAEAIAVVARFPDNIDEQADQNYRHGKG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISHL+V+ F IPCAH+PA  PP L   + P+S +EE+GYTFLP VL GL 
Sbjct  187   VDPIAGAEAVISHLLVRQFHIPCAHSPAFLPPSLDPDLSPRSAAEELGYTFLPSVLVGLS  246

Query  379   TAPQYLIKGTE-ILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ++++ TE I     I A+ +D+VI+P  ACG    L  + S+    LI+ V+EN T
Sbjct  247   RAPQFIVRETEQIPEPKDIWANQIDAVIVPASACGSSTLLNLSQSQS---LIVTVQENHT  303

Query  202   VLNDTPERLGIEAV  161
             +L   P+ LGI++V
Sbjct  304   LLQVPPQPLGIKSV  317



>ref|WP_039740062.1| hypothetical protein [Hassallia byssoidea]
 gb|KIF37198.1| hypothetical protein PI95_10190 [Hassallia byssoidea VB512170]
Length=355

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 177/314 (56%), Positives = 219/314 (70%), Gaps = 6/314 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GA IGGYAGDALPVA+  + V D LITHPNVLN A LYW + N  YVEGY LD
Sbjct  9     LIVPTGVGAEIGGYAGDALPVAKVMAQVCDRLITHPNVLNGASLYWNLPNTFYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVHQNR+GL+LD GIE +LR+RHLQ  DAARA+LGLS  +Y ++D PL V
Sbjct  69    KFAAGCWGLRPVHQNRIGLLLDQGIEPELRLRHLQAADAARATLGLSLTDYVISDAPLEV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLRA E L+  +   A+AVVARFP + D++   +YR G G
Sbjct  129   E-LRSSASGASWGTIGNPDSLLRAAEVLINKAGAEAIAVVARFPDNIDEQVDQNYRHGKG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISHL+V+ FQIPCAH+PALSP  L   + P+S +EE+GYTFLPCVL GL 
Sbjct  188   VDPIAGAEAVISHLIVRTFQIPCAHSPALSPAPLDPDLSPRSAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLIKGTEILGKNC-ISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ+++  T  L +   I A+ VD+VI+P  ACGG   L+  N    R  II V EN+T
Sbjct  248   RAPQFILPQTHQLPEPTDIWANQVDAVIVPATACGGSTLLSLNN---RRCQIITVLENKT  304

Query  202   VLNDTPERLGIEAV  161
              +   PE LGI+ +
Sbjct  305   QMQVPPEPLGIKCI  318



>dbj|BAP16999.1| hypothetical protein ETSB_0104 [cyanobacterium endosymbiont of 
Epithemia turgida isolate EtSB Lake Yunoko]
Length=361

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 181/318 (57%), Positives = 219/318 (69%), Gaps = 9/318 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGA IGGYAGDALPVARA S V D LITHPNVLN A LYW + N  YVEGY LD
Sbjct  10    LIVPTGIGATIGGYAGDALPVARAISQVCDRLITHPNVLNGAQLYWNLPNTFYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L+PVHQNRVGL+LD G+E +L+ RHLQV DA RA+LGL   +Y +TD PL +
Sbjct  70    RFARGDWGLQPVHQNRVGLILDQGLEPELQTRHLQVADATRATLGLDITDYILTDTPLEI  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                +    G S G I NPDSLLRA E L+  + V A+AVV RFP + D   +D+YR G G
Sbjct  130   NLGI-ASSGTSWGTIGNPDSLLRAAETLITQAKVQAIAVVVRFPDELDSLALDNYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F IP AHAPAL P  L  ++ P++ +EE+GYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLIVRQFGIPAAHAPALMPLPLEPNLSPRAAAEELGYTFLPCVLVGLS  248

Query  379   TAPQYL----IKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEE  212
              APQ++    +     L  + I  + VD+VI+P  ACGG   L+F  S RN   II V E
Sbjct  249   RAPQFVYTEGVNLKSTLVDSVIWGNQVDAVIIPETACGGSAILSF--SHRNT-RIITVAE  305

Query  211   NETVLNDTPERLGIEAVS  158
             N+T L  TPE LGI+A+ 
Sbjct  306   NKTRLQVTPESLGIQALK  323



>ref|WP_015227354.1| hypothetical protein [Halothece sp. PCC 7418]
 ref|YP_007169696.1| hypothetical protein PCC7418_3367 [Halothece sp. PCC 7418]
 gb|AFZ45482.1| hypothetical protein PCC7418_3367 [Halothece sp. PCC 7418]
Length=350

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 175/316 (55%), Positives = 222/316 (70%), Gaps = 8/316 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGA+IGGYAGDALP+ARA + + D +ITHPNVLN A LYW + NV YVEGY LD
Sbjct  10    LIVPTGIGASIGGYAGDALPIARAIAQISDQVITHPNVLNGAQLYWSLPNVYYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA   W L PVHQNRVGL+LD GIE +L++RHLQ  +A + +LG++  EY VTD PL V
Sbjct  70    QFAANRWGLRPVHQNRVGLILDQGIEPELQLRHLQAAEAVKTTLGVNMGEYIVTDAPLDV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             +       G S G I  PDSLLRA E L+K   V+A+AVVARFP D D E +  YRQG G
Sbjct  130   QLQT-ADSGASWGTIGQPDSLLRAAEILIKQGKVSAIAVVARFPDDMDAEALTSYRQGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ FQIPCAHAPALSP     +V P++ +EE+GYTFLPCVL GL 
Sbjct  189   VDALAGAEAVISHLIVREFQIPCAHAPALSPLPADATVSPRAAAEELGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++      +  N   A  VD+V++P +A GG   L+++ S+     IIAVE+N+T 
Sbjct  249   RAPQFITHPQPSVDLN---ADAVDAVVIPANAAGGSAVLSWSQSQTP---IIAVEDNQTT  302

Query  199   LNDTPERLGIEAVSTR  152
             +  TPE LGI+ +  +
Sbjct  303   MEVTPESLGIKTIRVQ  318



>dbj|GAL94388.1| hypothetical protein N44_02968 [Microcystis aeruginosa NIES-44]
Length=352

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 179/313 (57%), Positives = 217/313 (69%), Gaps = 9/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD +PVARA + V D LITHPNVLN A LYWP++N  YVEGYALD
Sbjct  10    LIIPTGIGAAIGGYAGDGIPVARAIAQVCDRLITHPNVLNGAQLYWPLANTYYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVHQNR+GL+ D  IE DL  RHLQ  DA RA+LGL   +Y +TD PL V
Sbjct  70    RFARGDWGLSPVHQNRIGLLFDRAIEFDLLQRHLQAADAVRATLGLDLTDYVITDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +   +   G S G I NPDSLLR  EKL+      A+A+VARFPDD D   + +YR G G
Sbjct  130   Q-LREAASGASWGTIGNPDSLLRGAEKLINQGQAEAIAIVARFPDDPDSIALANYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIP AHAPALSP  L   + PK+ +EEIGYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLVVRQFQIPAAHAPALSPLPLDPQLSPKAAAEEIGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ L+K     G + I + +VD++I+P  ACG    L+F   K    ++IAV+EN T 
Sbjct  249   RAPQ-LVKQP---GPDAIWSREVDALIVPASACGSSTVLSFCQEKT---VLIAVQENSTR  301

Query  199   LNDTPERLGIEAV  161
             +   PE LG++A+
Sbjct  302   MKVAPEPLGVKAI  314



>ref|WP_006512525.1| Protein of unknown function (DUF3326) [Xenococcus sp. PCC 7305]
 gb|ELS00372.1| Protein of unknown function (DUF3326) [Xenococcus sp. PCC 7305]
Length=350

 Score =   307 bits (786),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 176/328 (54%), Positives = 222/328 (68%), Gaps = 7/328 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVARA + V D LITHPNVLN A LYWP  N+ YVEGY LD
Sbjct  9     LIVPTGIGAAIGGYAGDALPVARAMAQVCDRLITHPNVLNGAQLYWPRDNIYYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L+PV QN+VGL+LD+ IE +LR+RHLQV DA RA+LGL   +Y +TD PL V
Sbjct  69    KFAAGQWGLQPVRQNKVGLLLDSAIEPELRLRHLQVADATRATLGLELTDYVITDAPLDV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I N  SLLR  EKL+  +   A+A+VARFP D D   +D+YRQG G
Sbjct  129   ELRTS-SSGASWGTIGNAASLLRGAEKLITQAGAEAIAIVARFPDDMDAVQLDNYRQGTG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F+IP AHAPALSP  +  +V P++ +EE+GYTFLPCVL GL 
Sbjct  188   VDHLAGAEAVISHLIVRQFKIPAAHAPALSPIPVDPNVAPRAAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++         N I A  +D+V++P +ACGG   ++F++S      II V EN T 
Sbjct  248   RAPQFVTNRNN--SSNLIWADHIDAVVIPANACGGSAVMSFSDSPTT---IITVAENSTK  302

Query  199   LNDTPERLGIEAVSTRYLGNSFYLLYLC  116
             +   PE LG++ +       +  +L  C
Sbjct  303   IKVPPEPLGMKTIRVHSYLEALGVLAAC  330



>ref|WP_008196916.1| hypothetical protein [Microcystis sp. T1-4]
 emb|CCI30592.1| conserved hypothetical protein [Microcystis sp. T1-4]
Length=352

 Score =   306 bits (785),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 178/313 (57%), Positives = 217/313 (69%), Gaps = 9/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD +PVARA + V D LITHPNVLN A LYWP++N  YVEGYALD
Sbjct  10    LIIPTGIGAAIGGYAGDGIPVARAIAQVCDRLITHPNVLNGAQLYWPLANTYYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVHQNR+GL+ D  IE DL  RHLQ  DA RA+LGL   +Y VTD PL V
Sbjct  70    RFARGDWGLSPVHQNRIGLLFDRAIEFDLLQRHLQAADAVRATLGLDITDYLVTDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +   +   G S G I NPDSLLR  EKL+K     A+A+VARFPDD D   + +YR G G
Sbjct  130   Q-LREAASGASWGTIGNPDSLLRGAEKLIKQGRAEAIAIVARFPDDPDSIALANYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIP AHAPALSP  L   + PK+ +EEIGYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLVVRQFQIPAAHAPALSPLPLDPQLSPKAAAEEIGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ + + +     + I + +VD++I+P  ACG    L+F   K    ++IAV+EN T 
Sbjct  249   RAPQLVKQPS----PDAIWSREVDALIVPASACGSSTVLSFCQEKT---VLIAVQENSTR  301

Query  199   LNDTPERLGIEAV  161
             +   PE LG++A+
Sbjct  302   MKVAPEPLGVKAI  314



>ref|WP_036480121.1| hypothetical protein [Myxosarcina sp. GI1]
Length=352

 Score =   306 bits (785),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 179/316 (57%), Positives = 221/316 (70%), Gaps = 6/316 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GAAIGGYAGDALPVARA + + D LITHPNVLN A LY+P  N LYVEGY LD
Sbjct  10    LIVPTGVGAAIGGYAGDALPVARAIAQISDRLITHPNVLNGAQLYYPQGNTLYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PV QN+VGL+LD GIE +LR+RHLQ  DAARA+LGLS  +Y VTD PL V
Sbjct  70    RFAAGDWGLLPVRQNKVGLLLDCGIEPELRLRHLQAADAARATLGLSLSDYVVTDAPLKV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdddde-didDYRQGMG  560
             E       G S G I NPDSLLRA +KL+  +   A+AVVARFPDD+D  ++ +YR G G
Sbjct  130   ELRT-ASSGASWGTIGNPDSLLRAADKLITQAGAEAIAVVARFPDDEDSPELQNYRYGRG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ FQIP AHAPAL P  +   V P++ +EE+GYTFLPCVL GL 
Sbjct  189   VDCLAGAEAVISHLIVREFQIPAAHAPALMPLPVDPQVSPRAAAEELGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ+    T       I +  VD++I+P  ACGG   L+F+NS   +  II+V +N T 
Sbjct  249   RAPQFTDNRT--FNSQTIWSDIVDALIIPHTACGGSATLSFSNSPTTK--IISVSDNFTQ  304

Query  199   LNDTPERLGIEAVSTR  152
             +   PE LG++ +  +
Sbjct  305   MQTPPEPLGVKTIRVK  320



>ref|WP_015154383.1| hypothetical protein [Chroococcidiopsis thermalis]
 ref|YP_007091704.1| hypothetical protein Chro_2344 [Chroococcidiopsis thermalis PCC 
7203]
 gb|AFY87835.1| hypothetical protein Chro_2344 [Chroococcidiopsis thermalis PCC 
7203]
Length=371

 Score =   307 bits (786),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 178/329 (54%), Positives = 221/329 (67%), Gaps = 20/329 (6%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDA+PVAR  +SV D LITHPNVLN A LYW + N  YVEGY LD
Sbjct  9     LIVPTGIGAAIGGYAGDAMPVARTLASVCDRLITHPNVLNGAQLYWSLPNAFYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L P+HQNR+GL+LD GIE DLR+RHLQ  DAARA+LGL+  +Y +TD PL V
Sbjct  69    KFAAGCWGLRPIHQNRIGLILDKGIETDLRLRHLQAADAARATLGLNLTDYVITDAPLNV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLRA E L+  +   A+AVVARFP D   E + +YR G G
Sbjct  129   ELRT-ATSGASWGTIGNPDSLLRAAEVLISKAGAEAIAVVARFPDDIGSEALQNYRHGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EA+ISHL+VK FQIPCAH+PALSP  L   + P+S +EE+GYTFLP VL GL 
Sbjct  188   VDPLAGAEAIISHLIVKTFQIPCAHSPALSPLPLDPDLSPRSAAEELGYTFLPSVLVGLS  247

Query  379   TAPQYLIK--------GTEILGKNCIS-------ASDVDSVILPIDACGGDGALAFANSK  245
              APQ+++         GT +     I+       A +VD+V++P  ACG    L+ + S+
Sbjct  248   RAPQFVVNPHRVETLPGTSLQPPRHITSLHEDIWAKEVDAVVIPATACGSSAVLSLSQSQ  307

Query  244   RNRPLIIAVEENETVLNDTPERLGIEAVS  158
                  II V EN+T +   P  LGI+A++
Sbjct  308   AQ---IITVAENQTTMQVPPAPLGIKAIA  333



>dbj|BAM54996.1| hypothetical protein BEST7613_6065 [Bacillus subtilis BEST7613]
Length=348

 Score =   306 bits (783),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 179/313 (57%), Positives = 218/313 (70%), Gaps = 7/313 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTG+GAA+GGYAGDALP+ARA S V D LITHPNVLN A LY+P+ N LYVEGYALD
Sbjct  7     LIIPTGVGAALGGYAGDALPIARAISQVCDRLITHPNVLNGAQLYYPIPNALYVEGYALD  66

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA+G W L PV  N +GL+LD GIEEDLR RHLQV D ARA+LGL+  +Y VTD PL V
Sbjct  67    RFAQGDWGLTPVGNNAIGLILDQGIEEDLRWRHLQVADGARATLGLTLTDYVVTDEPLGV  126

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E  +    G S G I NP+SLLRA +KL+  +   A+AV+ARFP D   + + DYR G G
Sbjct  127   ELRLS-DSGTSWGTIANPESLLRAADKLLTQTQAQAIAVIARFPDDVGTQVLADYRHGHG  185

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ FQ+PCAHAPALSP  L   + P+S +EE+GYTFLPCVL GL 
Sbjct  186   VDPLAGAEAVISHLIVRQFQVPCAHAPALSPLPLDPDISPRSAAEELGYTFLPCVLMGLS  245

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP Y  +     G+   S  DV++V++P  ACGG   ++F+ S      IIAVE N T 
Sbjct  246   RAPHYQ-RFPNAQGQTLWS-RDVNAVVVPASACGGSALMSFSQSSAR---IIAVENNSTQ  300

Query  199   LNDTPERLGIEAV  161
             L    E LGI  V
Sbjct  301   LEVYGEDLGISVV  313



>ref|WP_016515684.1| hypothetical protein [Microcystis aeruginosa]
 gb|EPF21814.1| hypothetical protein MAESPC_02348 [Microcystis aeruginosa SPC777]
Length=352

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 177/313 (57%), Positives = 217/313 (69%), Gaps = 9/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD +PVA+A + V D LITHPNVLN A LYWP++N  YVEGYALD
Sbjct  10    LIIPTGIGAAIGGYAGDGIPVAKAIAQVCDRLITHPNVLNGAQLYWPLANTYYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVHQNR+GL+ D  IE DL  RHLQ  DA RA+LGL   +Y VTD PL V
Sbjct  70    RFARGDWGLSPVHQNRIGLLFDRAIEFDLLQRHLQAADAVRATLGLDLTDYLVTDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +   +   G S G I NPDSLLR  EKL+K     A+A+VARFPDD D   + +YR G G
Sbjct  130   Q-LREAASGASWGTIGNPDSLLRGAEKLIKQGRAEAIAIVARFPDDPDSIALANYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIP AHAPALSP  L   + PK+ +EEIGYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLVVRQFQIPAAHAPALSPLPLDPQLSPKAAAEEIGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ + + +     + I + +VD++I+P  ACG    L+F   K    ++IAV+EN T 
Sbjct  249   RAPQLVKQPS----PDAIWSREVDALIVPASACGSSTVLSFCQEKT---VLIAVQENSTR  301

Query  199   LNDTPERLGIEAV  161
             +   PE LG++A+
Sbjct  302   MKVAPEPLGVKAI  314



>ref|WP_017286664.1| hypothetical protein [Leptolyngbya boryana]
Length=359

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 180/332 (54%), Positives = 230/332 (69%), Gaps = 11/332 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDA+PVARA S V DCLITHPNVLN A LYW + N LYVEGY LD
Sbjct  10    LIVPTGIGAAIGGYAGDAMPVARAISEVADCLITHPNVLNGAQLYWNLPNALYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L P   NR+GL+LD  IE DL++RHLQV DAARA+LGL+ ++Y VTD PL V
Sbjct  70    QFAAGHWGLLPTTSNRIGLILDQAIEPDLKLRHLQVADAARATLGLNILDYVVTDQPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E     K G + G I++PDSLLRA EKL++ +  +A+AVVARFP D   E + +YR G G
Sbjct  130   ELRT-AKSGATWGTIEHPDSLLRAAEKLIQ-AGADAIAVVARFPDDTGSEALQNYRHGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D L+G EAVISHL+V+ F +PCAHAPALS   L   + P+S +EE+G+TFLPCVL GL 
Sbjct  188   VDPLSGAEAVISHLIVRTFHVPCAHAPALSALPLDPDLSPRSAAEELGHTFLPCVLVGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP++    TE    + I A  ++++++P  ACGG   L  + +   R  IIAV+EN+T 
Sbjct  248   RAPRF----TEFPKAHAIWADQMNALVIPASACGGSAILHLSQT---RTRIIAVQENQTK  300

Query  199   LNDTPERLGIEAVSTRYLGNSFYLLYLCDLRG  104
             LN + E LGI A   +    +  +L +CD  G
Sbjct  301   LNVSAEALGIRATIVKSYLEAIGIL-ICDRAG  331



>ref|WP_002785777.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI20575.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9807]
Length=352

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 179/313 (57%), Positives = 216/313 (69%), Gaps = 9/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD +PVARA + V D LITHPNVLN A LYWP+ N  YVEGYALD
Sbjct  10    LIIPTGIGAAIGGYAGDGIPVARAIAEVCDRLITHPNVLNGAQLYWPLDNTYYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVHQNR+GL+ D  IE DL  RHLQ  DA RA+LGL   +Y +TD PL V
Sbjct  70    RFARGDWGLSPVHQNRIGLLFDRAIEFDLLQRHLQAADAVRATLGLDLTDYLITDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +   +   G S G I NPDSLLR  EKL+      A+A+VARFPDD D   + +YR G G
Sbjct  130   Q-LREAASGASWGTIGNPDSLLRGAEKLINQGRAEAIAIVARFPDDPDSIALANYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIP AHAPALSP  L   + PK+ +EEIGYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLVVRQFQIPAAHAPALSPLPLDPQLSPKAAAEEIGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ L+K     G + I + +VD++I+P  ACG    L+F   K    ++IAV+EN T 
Sbjct  249   RAPQ-LVKQP---GPDAIWSREVDALIVPASACGSSTVLSFCQEKT---VLIAVQENSTR  301

Query  199   LNDTPERLGIEAV  161
             +   PE LG++A+
Sbjct  302   MKVAPEPLGVKAI  314



>ref|WP_015219502.1| hypothetical protein [Cyanobacterium aponinum]
 ref|YP_007161819.1| hypothetical protein Cyan10605_1670 [Cyanobacterium aponinum 
PCC 10605]
 gb|AFZ53775.1| hypothetical protein Cyan10605_1670 [Cyanobacterium aponinum 
PCC 10605]
Length=353

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 176/316 (56%), Positives = 223/316 (71%), Gaps = 13/316 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGA IGGYAGDALP+ARA +   D LITHPNV+N A LYW   N+ YVEGYALD
Sbjct  11    LIIPTGIGADIGGYAGDALPIARAIAQGCDRLITHPNVMNGANLYWSTDNIYYVEGYALD  70

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA   W L+PV QN +G++ D  IE +L  RH+Q +DA RA+LG+   EY +TD PL V
Sbjct  71    QFASAKWGLQPVRQNNIGIIFDQSIETELFYRHIQTIDAVRATLGIEINEYIITDEPLGV  130

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E  +    G S G I+NPDSLLRA EKL+K   VNA+AV+ARFP D+D + + +YR G G
Sbjct  131   ELRI-ADSGASWGTIKNPDSLLRAGEKLIKERKVNALAVIARFPDDNDSQALQNYRYGEG  189

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ FQIP AHAPALSP  L  ++ PK+ +EE+G+TFLPCVL GL 
Sbjct  190   VDALAGAEAVISHLLVREFQIPSAHAPALSPLPLDINISPKAAAEELGFTFLPCVLVGLS  249

Query  379   TAPQYLIKGTEILGKNCIS--ASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENE  206
              APQY       L K+  S  A DV+ +I+P +ACGG   L+F+       LIIAV+EN 
Sbjct  250   RAPQY------TLTKDNYSFWAEDVNCLIVPANACGGSATLSFSGLNT---LIIAVKENS  300

Query  205   TVLNDTPERLGIEAVS  158
             TVL+ TPE+LG+  V+
Sbjct  301   TVLDVTPEKLGLNVVT  316



>ref|WP_023074452.1| hypothetical protein [Leptolyngbya sp. Heron Island J]
 gb|ESA34833.1| hypothetical protein N836_15555 [Leptolyngbya sp. Heron Island 
J]
Length=363

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 175/301 (58%), Positives = 213/301 (71%), Gaps = 11/301 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GAAIGGYAGDALPVARA ++V D LITHPNVLN A LYWP+ N  YVEGY LD
Sbjct  14    MIVPTGVGAAIGGYAGDALPVARAIAAVTDRLITHPNVLNGAQLYWPLPNAYYVEGYGLD  73

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L+PVHQN +GLVLD  IE++LR RHLQ  DAARA+LGL+   Y  TD PL V
Sbjct  74    QFAAGHWQLQPVHQNTIGLVLDQAIEDELRWRHLQAADAARATLGLTIHGYVTTDAPLGV  133

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                +      + G ++ PDSLLRAV KL++ +   A+AV+ARFP D     + DYRQG G
Sbjct  134   R--LKQAQAATWGTLERPDSLLRAVAKLLQ-AGCTAIAVIARFPDDLGSAALTDYRQGTG  190

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQ+PCAHAPAL P  L  ++ P+S +EEIGYTFLPCVLAGL 
Sbjct  191   VDPLAGAEAVISHLVVREFQVPCAHAPALQPLPLDPTISPRSAAEEIGYTFLPCVLAGLS  250

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ+    T     + ISASDVD++I+P    GG   L+ + +K     IIAV++N T 
Sbjct  251   KAPQFSATAT----THSISASDVDALIMPASTLGGSAVLSLSGTKTQ---IIAVQDNTTA  303

Query  199   L  197
             L
Sbjct  304   L  304



>ref|WP_002771087.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI04382.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9443]
Length=352

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 179/313 (57%), Positives = 215/313 (69%), Gaps = 9/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD +PVARA + V D LITHPNVLN A LYWP+ N  YVEGYALD
Sbjct  10    LIIPTGIGAAIGGYAGDGIPVARAIAEVCDRLITHPNVLNGAQLYWPLDNTYYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVHQNR+GL+ D  IE DL  RHLQ  DA RA+LGL   +Y +TD PL V
Sbjct  70    RFARGDWGLSPVHQNRIGLLFDRAIEFDLLQRHLQAADAVRATLGLDLTDYLITDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +   +   G S G I NPDSLLR  EKL+      A+A+VARFPDD D   + +YR G G
Sbjct  130   Q-LREAASGASWGTIGNPDSLLRGAEKLINQGRAEAIAIVARFPDDPDSIALANYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIP AHAPALSP  L   + PK+ +EEIGYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLVVRQFQIPAAHAPALSPLPLDPQLSPKAAAEEIGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ L+K     G + I   +VD++I+P  ACG    L+F   K    ++IAV+EN T 
Sbjct  249   RAPQ-LVKQP---GPDAIWGREVDALIVPASACGSSTVLSFCQEKT---VLIAVQENSTR  301

Query  199   LNDTPERLGIEAV  161
             +   PE LG++A+
Sbjct  302   MKVAPEPLGVKAI  314



>ref|WP_027842366.1| hypothetical protein [Mastigocoleus testarum]
Length=354

 Score =   305 bits (780),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 174/314 (55%), Positives = 225/314 (72%), Gaps = 6/314 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GAAIGGYAGDA+PVA+A S V D LITHPNVLNAA +YW + N LYVEGY LD
Sbjct  8     LIVPTGVGAAIGGYAGDAIPVAKALSQVCDRLITHPNVLNAATMYWNLPNALYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVHQN++GL+LD GIE DLR+RHLQ  DAARA+LGLS  +Y +TD PL V
Sbjct  68    KFAAGSWGLRPVHQNKIGLLLDGGIEPDLRLRHLQASDAARATLGLSLTDYVITDAPLNV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdddd-edidDYRQGMG  560
             E    P  G S G I N DSLLRA + L+  +   A+AVVARFPD+ D E  ++YRQG G
Sbjct  128   ELRNSPS-GASWGTIGNLDSLLRAADILINKAGAEAIAVVARFPDEVDPETENNYRQGKG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISH +V+ F+IPCAH+PA  P  L +++ P+S +EE+GYTF+P V  GL 
Sbjct  187   VDPIAGAEAVISHSIVRTFKIPCAHSPAFLPAPLDSNLSPRSAAEELGYTFIPSVFVGLN  246

Query  379   TAPQYLIKGTEILGK-NCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ++++G +   +   I A+ +D+ I P++ACGG   L+     + R  II VEEN+T
Sbjct  247   RAPQFIVEGNDQHPQPGDIWANQIDAAIAPVNACGGSALLSL---NQQRCEIIVVEENQT  303

Query  202   VLNDTPERLGIEAV  161
              +   PE LGI++V
Sbjct  304   QIQVPPEPLGIKSV  317



>ref|WP_002782645.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI12401.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9806]
Length=352

 Score =   305 bits (780),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 177/313 (57%), Positives = 215/313 (69%), Gaps = 9/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD +PVARA + V D LITHPNVLN A LYWP+ N  YVEGYALD
Sbjct  10    LIIPTGIGAAIGGYAGDGIPVARATAQVCDRLITHPNVLNGAQLYWPLDNTYYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVHQNR+GL+ D  IE DL  RHLQ  DA RA+LGL   +Y +TD PL V
Sbjct  70    RFARGDWGLSPVHQNRIGLLFDRAIEFDLLQRHLQAADAVRATLGLDLTDYVITDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +   +   G S G I NPDSLLR  EKL+K     A+A+VARFPDD D   + +YR G G
Sbjct  130   Q-LREAASGASWGTIGNPDSLLRGAEKLIKQGRAEAIAIVARFPDDPDSIALANYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIP AHAPALSP  L   + PK+ +EEIGYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLVVRQFQIPAAHAPALSPLPLDPQLSPKAAAEEIGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ + + +     + I   +VD++I+P  ACG    L+F   K    ++IAV+EN T 
Sbjct  249   RAPQLVKQPS----PDAIWGREVDALIVPASACGSSTVLSFCQEKT---VLIAVQENSTR  301

Query  199   LNDTPERLGIEAV  161
             +   PE LG++A+
Sbjct  302   MKVDPEPLGVKAI  314



>ref|WP_006621874.1| MULTISPECIES: hypothetical protein [Arthrospira]
 gb|EDZ95461.1| conserved hypothetical protein [Arthrospira maxima CS-328]
 emb|CCE20335.1| conserved hypothetical protein [Arthrospira sp. PCC 8005]
 gb|EKD10061.1| hypothetical protein SPLC1_S100910 [Arthrospira platensis C1]
Length=352

 Score =   305 bits (780),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 179/316 (57%), Positives = 226/316 (72%), Gaps = 7/316 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTGIGA +GGYAGDALP+AR+ S V D LITHPNVLN A LYWP+ N LYVEGYALD
Sbjct  9     MIVPTGIGADLGGYAGDALPIARSLSGVCDRLITHPNVLNGAQLYWPIPNALYVEGYALD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             + A G W L+PVH NRVGL+LD G+E +L++RHLQ  D ARA+LG++  +Y +TD PL V
Sbjct  69    QMAAGCWGLQPVHSNRVGLLLDRGMEPELQLRHLQAADGARATLGINMTDYVITDAPLNV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E  + P  G S G I NPDSLLR  ++L+  +   A+AVVARFP D+    +  YRQG G
Sbjct  129   ELRIAPS-GASWGTIGNPDSLLRGAKQLIDKAGAEAIAVVARFPDDEGSVALSQYRQGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EA+ISHL+V+HF+IPCAHAPAL P  L   + P+S +EEIGYTFLPCVLAGL 
Sbjct  188   VDPLAGAEAIISHLIVRHFRIPCAHAPALLPLPLDPHLSPRSAAEEIGYTFLPCVLAGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQY+   + +   + I A+ VD+V++P  ACGG   L+FANS +   L+I V EN T 
Sbjct  248   RAPQYV--QSRLTAPDSIWANQVDAVVVPETACGGSAILSFANSAK---LMITVAENRTT  302

Query  199   LNDTPERLGIEAVSTR  152
             +   PE +GI+ V  +
Sbjct  303   MATPPEAIGIKTVPVK  318



>ref|WP_002734977.1| putative lipoprotein [Microcystis aeruginosa]
 gb|ELP57351.1| putative lipoprotein [Microcystis aeruginosa TAIHU98]
Length=352

 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 177/313 (57%), Positives = 215/313 (69%), Gaps = 9/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD +PVARA + V D LITHPNVLN A LYWP++N  YVEGYALD
Sbjct  10    LIIPTGIGAAIGGYAGDGIPVARAIAQVCDRLITHPNVLNGAQLYWPLANTYYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVHQNR+GL+ D  IE DL  RHLQ  DA RA+LGL   +Y VTD PL V
Sbjct  70    RFARGDWGLSPVHQNRIGLLFDRAIEFDLLQRHLQAADAVRATLGLDLTDYLVTDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +   +   G S G I NPDSLLR  EKL+      A+A+VARFPDD D   + +YR G G
Sbjct  130   Q-LREAASGASWGTIGNPDSLLRGAEKLINQGRAEAIAIVARFPDDPDSIALANYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIP AHAPALSP  L   + PK+ +EEIGYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLVVRQFQIPAAHAPALSPLPLDPQLSPKAAAEEIGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ + + +     + I + +VD++I+P  ACG     +F   K    ++IAVEEN T 
Sbjct  249   RAPQLVKQPS----PDAIWSREVDALIVPASACGSSTVFSFCQEKS---VLIAVEENSTR  301

Query  199   LNDTPERLGIEAV  161
             +   PE LG++A+
Sbjct  302   MKVAPEPLGVKAI  314



>ref|WP_002762816.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCH99464.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9717]
Length=352

 Score =   304 bits (779),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 176/313 (56%), Positives = 215/313 (69%), Gaps = 9/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD +PVARA + V D LITHPNVLN A LYWP+ N  YVEGYALD
Sbjct  10    LIIPTGIGAAIGGYAGDGIPVARAIAQVCDRLITHPNVLNGAQLYWPLDNTYYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVHQNR+GL+ D  IE DL  RHLQ  DA RA+LGL   +Y +TD PL V
Sbjct  70    RFARGDWGLSPVHQNRIGLLFDRAIEFDLLQRHLQAADAVRATLGLDLTDYLITDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +   +   G S G I NPDSLLR  EKL+      A+A+VARFPDD D   + +YR G G
Sbjct  130   Q-LREAASGASWGTIGNPDSLLRGAEKLINQGRAEAIAIVARFPDDPDSIALANYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIP AHAPALSP  L   + PK+ +EEIGYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLVVRQFQIPAAHAPALSPLPLDPQLSPKAAAEEIGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ + +     G + I + +VD++I+P  ACG    L+F   K    ++I+V+EN T 
Sbjct  249   RAPQLVKRP----GPDAIWSREVDALIVPASACGSSTVLSFCQEKT---VLISVQENSTR  301

Query  199   LNDTPERLGIEAV  161
             +   PE LG++A+
Sbjct  302   MKVAPEPLGVKAI  314



>ref|WP_029637806.1| hypothetical protein [[Scytonema hofmanni] UTEX B 1581]
Length=354

 Score =   304 bits (779),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 180/314 (57%), Positives = 219/314 (70%), Gaps = 6/314 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGA IGGYAGDALPVA   S V D LITHPNVLN A LY  + N  YVEGY LD
Sbjct  8     LIVPTGIGAEIGGYAGDALPVASCVSQVCDRLITHPNVLNGASLYRNLPNTFYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVHQNR+GL+LD GIE +LR+RHLQ  DAARA+LGLS  +Y +TD PL V
Sbjct  68    KFAAGCWGLRPVHQNRIGLLLDQGIEPELRLRHLQAADAARATLGLSLTDYVITDAPLEV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLRA E L+  +   A+AVVARFP + D E   +YR G G
Sbjct  128   E-LRSSASGASWGTIGNPDSLLRAAEVLINKAGAEAIAVVARFPDNIDQEADQNYRHGKG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISHL+V+ FQIPCAH+PALSP  +   + P+S +EE+GYTFLPCVL GL 
Sbjct  187   VDAIAGAEAVISHLIVRTFQIPCAHSPALSPVPIDPDLSPRSAAEELGYTFLPCVLVGLS  246

Query  379   TAPQYLIKGTEILGKNC-ISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ+++  T  L +   I A+ VD+VI+P  ACGG   L+  NS+R +  II V EN+T
Sbjct  247   QAPQFIVGETHQLSEPTDIWANQVDAVIVPATACGGSTLLSL-NSRRCQ--IITVLENKT  303

Query  202   VLNDTPERLGIEAV  161
              +   PE LGI+ +
Sbjct  304   QMQVPPEPLGIKCI  317



>gb|EMT07294.1| hypothetical protein F775_11719 [Aegilops tauschii]
Length=405

 Score =   305 bits (782),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 168/256 (66%), Positives = 203/256 (79%), Gaps = 2/256 (1%)
 Frame = -1

Query  913  FAEGLWALEP-VHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             A+  +AL   +   +VGLVLD+GIEE+LR+RHLQV DAARASLGL  VEY VTD PL +
Sbjct  89   LADAQYALRRGIRPRQVGLVLDSGIEEELRLRHLQVADAARASLGLPVVEYAVTDAPLEI  148

Query  736  EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
            + W DPKCG+STG + N DSLLRAV+ LV  + VNAVAVVARFPDDD ED D YR+G G+
Sbjct  149  KTWFDPKCGKSTGSVGNSDSLLRAVDALVNQAGVNAVAVVARFPDDDPEDSDCYREGKGV  208

Query  556  DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
            DLLAGVEA+ISHL+VK F+IP AHAPA+ P  LS SV P+S +EEIGYTFLPCVLAGL T
Sbjct  209  DLLAGVEAIISHLIVKEFKIPAAHAPAVLPLPLSPSVSPRSAAEEIGYTFLPCVLAGLST  268

Query  376  APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANS-KRNRPLIIAVEENETV  200
            APQY+ +    L   CI ASDVDSVILP DACGGDGALAF+ + ++N+PLII V+ENETV
Sbjct  269  APQYVTRRQGTLDSGCIVASDVDSVILPRDACGGDGALAFSRTARKNKPLIITVQENETV  328

Query  199  LNDTPERLGIEAVSTR  152
            L+DTP++  IEA++ +
Sbjct  329  LDDTPDKFNIEALNVQ  344


 Score = 67.4 bits (163),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  970  MLYWPMSNVLYVEGYALDRFAEGLWALEPVHQN  872
            MLYWP  N LYVEGYALDRFAEG WAL+PVHQ 
Sbjct  1    MLYWPTPNTLYVEGYALDRFAEGAWALQPVHQK  33



>dbj|BAG48274.1| hypothetical protein MAE_08375 [Microcystis aeruginosa NIES-843]
Length=352

 Score =   304 bits (778),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 177/313 (57%), Positives = 214/313 (68%), Gaps = 9/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD +PVARA + V D LITHPNVLN A LYWP+ N  YVEGYALD
Sbjct  10    LIIPTGIGAAIGGYAGDGIPVARAIAQVCDRLITHPNVLNGAQLYWPLDNTYYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVHQNR+GL+ D  IE DL  RHLQ  DA RA+LGL   +Y VTD PL V
Sbjct  70    RFARGDWGLSPVHQNRIGLLFDRAIEFDLLQRHLQAADAVRATLGLDLTDYLVTDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +   +   G S G I NPDSLLR  EKL+      A+A+VARFPDD D   + +YR G G
Sbjct  130   Q-LREAASGASWGTIGNPDSLLRGAEKLINQGRAEAIAIVARFPDDPDSIALANYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIP AHAPALSP  L   + PK+ +EEIGYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLVVRQFQIPAAHAPALSPLPLDPQLSPKAAAEEIGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ + + +     + I   +VD++I+P  ACG    L+F   K    ++IAV+EN T 
Sbjct  249   RAPQLVKQPS----PDAIWGREVDALIVPASACGSSTVLSFCQEKT---VLIAVQENSTR  301

Query  199   LNDTPERLGIEAV  161
             +   PE LG++A+
Sbjct  302   MKVAPEPLGVKAI  314



>ref|WP_002752635.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCH91414.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9432]
Length=352

 Score =   303 bits (777),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 175/313 (56%), Positives = 213/313 (68%), Gaps = 9/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD +PVARA + V D LITHPNVLN A LYWP+ N  YVEGYALD
Sbjct  10    LIIPTGIGAAIGGYAGDGIPVARAIAQVCDRLITHPNVLNGAQLYWPLDNTYYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVHQNR+GL+ D  IE DL  RHLQ  DA RA+LGL   +Y +TD PL V
Sbjct  70    RFARGDWGLSPVHQNRIGLLFDRAIEFDLLQRHLQAADAVRATLGLDLTDYLITDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +   +   G S G I NPDSLLR  EKL+      A+A+VARFPD  D   + +YR G G
Sbjct  130   Q-LREAASGASWGTIGNPDSLLRGAEKLINQGRAEAIAIVARFPDAPDSIALANYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIP AHAPALSP  L   + PK+ +EEIGYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLVVRQFQIPAAHAPALSPLPLDPQLSPKAAAEEIGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ + + +     + I + +VD++I+P  ACG    L+F   K    ++I VEEN T 
Sbjct  249   RAPQLVKQPS----PDAIWSREVDALIVPASACGSSTVLSFCQEKS---VLIVVEENSTR  301

Query  199   LNDTPERLGIEAV  161
             +   PE LG++A+
Sbjct  302   MKVAPEPLGVKAI  314



>ref|WP_002775622.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI06053.1| conserved hypothetical protein [Microcystis aeruginosa PCC 7941]
Length=352

 Score =   303 bits (777),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 176/313 (56%), Positives = 216/313 (69%), Gaps = 9/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD +PVA+A + V D LITHPNVLN A LYWP++N  YVEGYALD
Sbjct  10    LIIPTGIGAAIGGYAGDGIPVAKAIAQVCDRLITHPNVLNGAQLYWPLANTYYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVHQNR+GL+ D  IE DL  RHLQ  DA RA+LGL   +Y +TD PL V
Sbjct  70    RFARGDWGLSPVHQNRIGLLFDRAIEFDLLQRHLQAADAVRATLGLDLTDYVITDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +   +   G S G I NPDSLLR  EKL+K     A+A+VARFPDD D   + +YR G G
Sbjct  130   Q-LREAASGSSWGTIGNPDSLLRGAEKLIKQGWAEAIAIVARFPDDPDSIALANYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIP AHAPALSP  L   + PK+ +EEIGYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLVVRQFQIPAAHAPALSPLPLDPQLSPKAAAEEIGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ + + +     + I   +VD++I+P  ACG    L+F   K    ++IAV+EN T 
Sbjct  249   RAPQLVKQPS----PDAIWRREVDALIVPASACGSSTVLSFCQEKT---VLIAVQENSTR  301

Query  199   LNDTPERLGIEAV  161
             +   PE LG++A+
Sbjct  302   MKVAPEPLGVKAI  314



>ref|WP_010872915.1| hypothetical protein [Synechocystis sp. PCC 6803]
 ref|NP_441613.1| hypothetical protein slr1287 [Synechocystis sp. PCC 6803]
 ref|YP_005383480.1| hypothetical protein SYNGTI_1718 [Synechocystis sp. PCC 6803 
substr. GT-I]
 ref|YP_005386649.1| hypothetical protein SYNPCCP_1717 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 ref|YP_005409356.1| hypothetical protein SYNPCCN_1717 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 ref|YP_005651671.1| hypothetical protein SYNGTS_1718 [Synechocystis sp. PCC 6803]
 ref|YP_007451495.1| hypothetical protein MYO_117360 [Synechocystis sp. PCC 6803]
 dbj|BAA18293.1| slr1287 [Synechocystis sp. PCC 6803]
 dbj|BAK50466.1| hypothetical protein SYNGTS_1718 [Synechocystis sp. PCC 6803]
 dbj|BAL29465.1| hypothetical protein SYNGTI_1718 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL32634.1| hypothetical protein SYNPCCN_1717 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL35803.1| hypothetical protein SYNPCCP_1717 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 gb|AGF51981.1| hypothetical protein MYO_117360 [Synechocystis sp. PCC 6803]
Length=336

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 166/295 (56%), Positives = 201/295 (68%), Gaps = 7/295 (2%)
 Frame = -1

Query  1042  LPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALDRFAEGLWALEPVHQNRVG  863
             LP+ARA S V D LITHPNVLN A LY+P+ N LYVEGYALDRFA+G W L PV  N +G
Sbjct  13    LPIARAISQVCDRLITHPNVLNGAQLYYPIPNALYVEGYALDRFAQGDWGLTPVGNNAIG  72

Query  862   LVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMVEKWVDPKCGQSTGRIQNP  683
             L+LD GIEEDLR RHLQV D ARA+LGL+  +Y VTD PL VE  +    G S G I NP
Sbjct  73    LILDQGIEEDLRWRHLQVADGARATLGLTLTDYVVTDEPLGVELRLS-DSGTSWGTIANP  131

Query  682   DSLLRAVEKLVKGSDVNAVAVVARFPddd-dedidDYRQGMGIDLLAGVEAVISHLVVKH  506
             +SLLRA +KL+  +   A+AV+ARFPDD   + + DYR G G+D LAG EAVISHL+V+ 
Sbjct  132   ESLLRAADKLLTQTQAQAIAVIARFPDDVGTQVLADYRHGHGVDPLAGAEAVISHLIVRQ  191

Query  505   FQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGTAPQYLIKGTEILGKNCI  326
             FQ+PCAHAPALSP  L   + P+S +EE+GYTFLPCVL GL  AP Y  +     G+   
Sbjct  192   FQVPCAHAPALSPLPLDPDISPRSAAEELGYTFLPCVLMGLSRAPHYQ-RFPNAQGQTLW  250

Query  325   SASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVLNDTPERLGIEAV  161
             S  DV++V++P  ACGG   ++F+ S      IIAVE N T L    E LGI  V
Sbjct  251   S-RDVNAVVVPASACGGSALMSFSQSSAR---IIAVENNSTQLEVYGEDLGISVV  301



>ref|WP_019492864.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=353

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 173/318 (54%), Positives = 221/318 (69%), Gaps = 8/318 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGDALPV +  + VVD LITHPNV+N AMLYW + N LYVEGY LD
Sbjct  8     LIIPTGIGAAIGGYAGDALPVVKTLAQVVDKLITHPNVMNGAMLYWNIPNALYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVH N++GL+LD GIE DLR+R LQ VDAARA+LG++  +Y VTD PL V
Sbjct  68    RFAAGDWGLRPVHNNKIGLLLDQGIEPDLRLRQLQAVDAARATLGITVTDYVVTDAPLNV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E     + G S G I N DSLLRA + L+     +A+AVVARFP + D E   +YR G G
Sbjct  128   ELRTS-ESGASWGTIGNADSLLRAADTLINKVGASAIAVVARFPDEVDSEADRNYRLGKG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +DL+AG EAVISHL+V+ F++PCAHAPA  PP L  ++ P+S +EEIGYTFLP VL GL 
Sbjct  187   VDLIAGAEAVISHLIVREFEVPCAHAPAFLPPPLDINLSPRSAAEEIGYTFLPSVLVGLN  246

Query  379   TAPQYLIKGTE--ILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENE  206
              APQ+++K     +   N I A+ VD+VI+P  ACG    L+ +     + LI+ +EENE
Sbjct  247   KAPQFIVKDKHGYMNEPNDIWANQVDAVIVPATACGSSAILSLS----QKSLIVTIEENE  302

Query  205   TVLNDTPERLGIEAVSTR  152
             T      + LG++++  R
Sbjct  303   THSKVLSQPLGVKSLQVR  320



>ref|WP_012629812.1| hypothetical protein [Cyanothece sp. PCC 7425]
 ref|YP_002485127.1| hypothetical protein Cyan7425_4456 [Cyanothece sp. PCC 7425]
 gb|ACL46766.1| conserved hypothetical protein [Cyanothece sp. PCC 7425]
Length=348

 Score =   303 bits (776),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 179/319 (56%), Positives = 222/319 (70%), Gaps = 10/319 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGA IGGYAGDA+PVAR  + V D LITHPNVLN A LYW + NV YVEGY LD
Sbjct  10    LIIPTGIGAKIGGYAGDAIPVARTIAQVCDRLITHPNVLNGAQLYWSLPNVFYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVHQNRVGL+LD GIE DL++RHLQ  +A RA+LGL+ + Y +TD PL V
Sbjct  70    QFAAGNWGLRPVHQNRVGLILDRGIEPDLQLRHLQAAEACRATLGLNLIGYVLTDTPLEV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
              K      G + G IQ+PDSLL+A E L++ +   A+AVVARFPDD   E + +YR G G
Sbjct  130   -KLQTAASGATWGTIQHPDSLLQAAEHLIQ-AGAEAIAVVARFPDDCGSEALHNYRTGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F++PCAHAPAL+P  L   + P+S +EEIGYTFLP VL GL 
Sbjct  188   VDPLAGAEAVISHLIVRQFKLPCAHAPALTPLPLDPQISPRSAAEEIGYTFLPSVLVGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ+ +          I+  DVD+VI+P  ACGG G L F+ +      IIAV ENET 
Sbjct  248   RAPQFALAPHL---SGAITNRDVDAVIVPASACGGSGLLHFSQTGTQ---IIAVMENETT  301

Query  199   LNDTPERLGIEAVS-TRYL  146
             L  T E LGI+ ++ + YL
Sbjct  302   LQVTAEALGIKVMTVSSYL  320



>ref|WP_008313378.1| Protein of unknown function (DUF3326) [Leptolyngbya sp. PCC 6406]
Length=361

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 187/326 (57%), Positives = 221/326 (68%), Gaps = 21/326 (6%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVARA + V D LITHPNVLN A LYWP+   LYVEGY LD
Sbjct  9     LIVPTGIGAAIGGYAGDALPVARAMAQVADILITHPNVLNGAQLYWPLPQALYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVH NRVGL+LDA IE DLR RHLQ   AARA+LG++  +Y VTD PL V
Sbjct  69    RFAAGDWGLAPVHHNRVGLLLDAAIEPDLRGRHLQAAAAARATLGITLTDYGVTDAPLGV  128

Query  736   EKWVD-PKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdddde-didDYRQGM  563
                +D    G + G I NP +LLR  E+L++ +  NA+AVVARFPDD D   +  YRQG 
Sbjct  129   T--LDRAASGATWGTIANPGALLRGAERLLQ-AGANAIAVVARFPDDVDSPALHQYRQGQ  185

Query  562   GIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGL  383
             G+D LAG EAVISHLVV+ FQ+PCAHAPAL P     +V PK+ +EEIGYTFLPCVLAGL
Sbjct  186   GVDPLAGAEAVISHLVVRQFQVPCAHAPALLPLPFDATVAPKAAAEEIGYTFLPCVLAGL  245

Query  382   GTAPQYLIKGTEILG------------KNCISASDVDSVILPIDACGGDGALAFANSKRN  239
               APQ++ KG    G               + A  VD+V++P  ACGG   L  +     
Sbjct  246   SRAPQFVTKGDGTKGVTESGSREDPLLGGTLWAHQVDAVVVPATACGGSAVLTLS----R  301

Query  238   RPLIIAVEENETVLNDTPERLGIEAV  161
             R  IIAVEEN T L+ +PE LG+ A+
Sbjct  302   RVPIIAVEENRTALSVSPEALGLRAI  327



>ref|WP_016873218.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=353

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 176/315 (56%), Positives = 216/315 (69%), Gaps = 6/315 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             + +PTGIGAAIGGYAGDALPVARA + V D LITHPNVLN A LYW + N  YVEGY LD
Sbjct  8     LTIPTGIGAAIGGYAGDALPVARAIAQVCDRLITHPNVLNGASLYWNLPNTFYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FAEG W L PVHQNRVGLVLD GIE +LR+RHLQ  DAARA+LG+S  +Y +TD PL V
Sbjct  68    KFAEGCWGLRPVHQNRVGLVLDQGIEPELRLRHLQAADAARATLGISLTDYVITDAPLNV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I N DSLLRAVE L+  +   A+AVVARFP   D E   +YR G G
Sbjct  128   ELRT-AASGASWGTIGNSDSLLRAVEVLITKARAEAIAVVARFPDHLDQEAEQNYRHGKG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISHLVV+ F+IPCAHAPA   P L  ++ P+S +EE+GYTFLPCVL GL 
Sbjct  187   VDPIAGAEAVISHLVVRQFRIPCAHAPAFEAPPLDPNLSPRSAAEELGYTFLPCVLVGLS  246

Query  379   TAPQYLIKGT-EILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ++ + T ++     I A  VD+ I+P  ACG    L+     + R LI+ V EN+T
Sbjct  247   RAPQFMARQTYQVPQLEDIWADRVDAAIVPATACGSSALLSL---NQQRCLIVTVNENKT  303

Query  202   VLNDTPERLGIEAVS  158
              +    + LGI+++ 
Sbjct  304   QIQVPSQPLGIKSIQ  318



>ref|WP_015202946.1| hypothetical protein [Crinalium epipsammum]
 ref|YP_007142340.1| hypothetical protein Cri9333_1949 [Crinalium epipsammum PCC 9333]
 gb|AFZ12830.1| hypothetical protein Cri9333_1949 [Crinalium epipsammum PCC 9333]
Length=358

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 182/314 (58%), Positives = 222/314 (71%), Gaps = 5/314 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GA+IGGYAGDALPVARA ++  D LITHPNVLN A LYW + N  YVEGYALD
Sbjct  10    LIVPTGVGASIGGYAGDALPVARAIANCCDRLITHPNVLNGASLYWNLPNGFYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA   W L PV  NRVGL+LD GIE DLR+RHLQ  +AARA+LGL+  +Y VTD PL V
Sbjct  70    QFAANSWGLRPVRNNRVGLILDQGIEPDLRVRHLQAAEAARATLGLNLTDYVVTDQPLGV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             E  +    G S G IQNPDSLLRA + L+K    +A+AVVARFPDD   E + +YR G G
Sbjct  130   ELRI-ADSGASWGTIQNPDSLLRAADVLIKQEKADAIAVVARFPDDCSSEVLHNYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIPCAHAPAL P  L   + P+S +EE+GYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLVVRTFQIPCAHAPALLPLPLDPDISPRSAAEELGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++   ++      I A  VD+V++P  ACGG   L+F+        IIAVEEN+T 
Sbjct  249   RAPQFITNKSQQPRPEDIWADQVDAVVIPASACGGSAILSFSQLPVK---IIAVEENQTQ  305

Query  199   LNDTPERLGIEAVS  158
             +   PE+LGI+A+ 
Sbjct  306   MQVPPEKLGIKALQ  319



>ref|WP_002792374.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI21971.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9808]
Length=352

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 176/313 (56%), Positives = 214/313 (68%), Gaps = 9/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD +PVARA + V D LITHPNVLN A LYWP+ N  YVEGYALD
Sbjct  10    LIIPTGIGAAIGGYAGDGIPVARAIAQVCDRLITHPNVLNGAQLYWPLDNTHYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVHQNR+GL+ D  IE DL  RHLQ  DA RA+LGL   +Y +TD PL V
Sbjct  70    RFARGDWGLSPVHQNRIGLLFDRAIEFDLLQRHLQAADAVRATLGLDLTDYVITDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +   +   G S G I NPDSLLR  EKL+      A+A+VARFPDD D   + +YR G G
Sbjct  130   Q-LREAASGASWGTIGNPDSLLRGAEKLINRGRAEAIAIVARFPDDPDSIALANYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIP AHAPALSP  L   + PK+ +EEIGYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLVVRQFQIPAAHAPALSPLPLDPQLSPKAAAEEIGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ + + +     + I + +VD++I+P  ACG     +F   K    ++IAVEEN T 
Sbjct  249   RAPQLVKQPS----PDAIWSREVDALIVPASACGSSTVFSFCQEKS---VLIAVEENSTR  301

Query  199   LNDTPERLGIEAV  161
             +   PE LG++A+
Sbjct  302   MKVDPEPLGVKAI  314



>ref|WP_011612448.1| hypothetical protein [Trichodesmium erythraeum]
 ref|YP_722563.1| hypothetical protein Tery_2924 [Trichodesmium erythraeum IMS101]
 gb|ABG52090.1| conserved hypothetical protein [Trichodesmium erythraeum IMS101]
Length=358

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 176/313 (56%), Positives = 223/313 (71%), Gaps = 5/313 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGA+IGGYAGD LPVARA +   D LITHPNVLN A LYW + N LYVEGYA+D
Sbjct  14    LIIPTGIGASIGGYAGDGLPVARAIAQTCDLLITHPNVLNGAQLYWSLPNALYVEGYAID  73

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA+G + L+PVHQNRVGL+LD  IE +L++RHLQ  DA RA+LGL+  +Y VTDLPL V
Sbjct  74    KFAQGWYGLQPVHQNRVGLILDQAIEPELQLRHLQAADATRATLGLNLTDYIVTDLPLGV  133

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             +     + G S G I NPDSLLRA   L+      A+AVVARFP D+    + +YR G G
Sbjct  134   Q-LRKSESGASWGTIANPDSLLRAAYTLIHKGKAEAIAVVARFPDDEGSTALQEYRYGQG  192

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+VK FQIPCAHAPAL P  L  ++ P+S +EE+GYTFLPCVL GL 
Sbjct  193   VDPLAGAEAVISHLIVKTFQIPCAHAPALLPLPLDPNLSPRSAAEEMGYTFLPCVLVGLS  252

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ +     +   N I A  VD+V++P  ACGG   ++F+ +K     IIAV+EN+T 
Sbjct  253   RAPQLVTFRDGLALPNSIWAEQVDAVVVPATACGGSAVISFSQTKAQ---IIAVKENKTY  309

Query  199   LNDTPERLGIEAV  161
             +  +PE+LGI+A+
Sbjct  310   MQVSPEKLGIKAL  322



>ref|WP_004163183.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI21379.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9809]
Length=352

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 176/313 (56%), Positives = 214/313 (68%), Gaps = 9/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD +PVA+A + V D LITHPNVLN A LYWP+ N  YVEGYALD
Sbjct  10    LIIPTGIGAAIGGYAGDGIPVAKAIAQVCDRLITHPNVLNGAQLYWPLDNTYYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVHQNR+GL+ D  IE DL  RHLQ  DA RA+LGL   +Y VTD PL V
Sbjct  70    RFARGDWGLSPVHQNRIGLLFDRAIEFDLLQRHLQAADAVRATLGLDLTDYLVTDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +   +   G S G I NPDSLLR  EKL+      A+A+VARFPDD D   + +YR G G
Sbjct  130   Q-LREAASGASWGTIGNPDSLLRGAEKLINQGRAEAIAIVARFPDDPDSIALANYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIP AHAPALSP  L   + PK+ +EEIGYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLVVRQFQIPAAHAPALSPLPLDPQLSPKAAAEEIGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ + + +     + I   +VD++I+P  ACG    L+F   K    ++IAV+EN T 
Sbjct  249   RAPQLVKQPS----PDAIWGREVDALIVPASACGSSTVLSFCQEKT---VLIAVQENSTR  301

Query  199   LNDTPERLGIEAV  161
             +   PE LG++A+
Sbjct  302   MKVAPEPLGVKAI  314



>ref|WP_017659713.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=349

 Score =   302 bits (773),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 172/312 (55%), Positives = 210/312 (67%), Gaps = 6/312 (2%)
 Frame = -1

Query  1093  IVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALDR  914
             +VPTGIGA IGGYAGDA+PVARA + V D LITHPNVLN A LYW   NV YVEGY LD+
Sbjct  10    LVPTGIGAEIGGYAGDAIPVARAIAQVCDRLITHPNVLNGAQLYWSQPNVSYVEGYGLDQ  69

Query  913   FAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMVE  734
             FA G W L PVHQNRVGL+LD  IE DLR+RHLQ  DA RA+LGL   +Y VTD PL V 
Sbjct  70    FAAGRWGLRPVHQNRVGLILDKAIEPDLRLRHLQAADATRATLGLDLTDYVVTDEPLGVS  129

Query  733   KWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGID  554
                  + G S G + NPDSLLRA E+ +  +   A+A+VARFPD+  +  D YR G G+D
Sbjct  130   LRTS-EAGASWGTLDNPDSLLRAAERSIDRAGAEAIAIVARFPDESGDAFDRYRSGQGVD  188

Query  553   LLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGTA  374
              +AG EAVISHLVV+ FQIP AHAPALSP     SV P++ +EE+GYTFLPCVL GL  A
Sbjct  189   PIAGAEAVISHLVVRQFQIPAAHAPALSPLPADPSVSPRAAAEELGYTFLPCVLVGLSRA  248

Query  373   PQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVLN  194
             PQ+    T   G   + + D+D++++P  ACGG   L   N  +    I+AV  N+T + 
Sbjct  249   PQFADASTGEEG--IVRSRDIDAIVVPETACGGSAIL---NLSQTAARIVAVRNNQTQMR  303

Query  193   DTPERLGIEAVS  158
               P  LGI A++
Sbjct  304   VPPAALGIRAIT  315



>gb|EDX87671.1| hypothetical protein S7335_5381 [Synechococcus sp. PCC 7335]
Length=362

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 175/319 (55%), Positives = 221/319 (69%), Gaps = 13/319 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAA+GGYAGDALP+AR  +SV D LITHPNVLN A LYWPM N  YVEGY LD
Sbjct  9     LIIPTGIGAAMGGYAGDALPIARTVASVTDRLITHPNVLNGAQLYWPMDNAYYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV+QN +GLV+D G+E++LR RHLQ  DA RA+LGL    + VTD PL V
Sbjct  69    QFAAGRWRLRPVYQNPIGLVIDKGVEDELRSRHLQAADATRATLGLDVRSHIVTDRPLGV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                   + G S G + NP SLLRAVE+L+  + V A+AVVARFP DD  + +  YR+G G
Sbjct  129   -TLKTTESGASWGTLTNPGSLLRAVERLITEAKVRAIAVVARFPDDDGSDVLKAYRKGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ F++PCAHAPALSP  L   + P+S +EEIGYTFL CVL GL 
Sbjct  188   VDPLAGAEAVISHLVVRTFKLPCAHAPALSPLPLGPQISPRSAAEEIGYTFLSCVLVGLS  247

Query  379   TAPQYLIKGTEILGKNC-----ISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVE  215
              APQ+L   TE++G        I +++VD+VI+P  A GG   ++ A S      +I V 
Sbjct  248   RAPQFL---TEVVGSQANTTGDICSTEVDTVIVPATALGGSAVMSLAQSAAQ---VIVVG  301

Query  214   ENETVLNDTPERLGIEAVS  158
             EN+T ++   E LGI A++
Sbjct  302   ENKTTMSVRAEDLGIRAIA  320



>ref|WP_038016502.1| hypothetical protein [Synechococcus sp. PCC 7335]
Length=364

 Score =   302 bits (774),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 175/319 (55%), Positives = 221/319 (69%), Gaps = 13/319 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAA+GGYAGDALP+AR  +SV D LITHPNVLN A LYWPM N  YVEGY LD
Sbjct  11    LIIPTGIGAAMGGYAGDALPIARTVASVTDRLITHPNVLNGAQLYWPMDNAYYVEGYGLD  70

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV+QN +GLV+D G+E++LR RHLQ  DA RA+LGL    + VTD PL V
Sbjct  71    QFAAGRWRLRPVYQNPIGLVIDKGVEDELRSRHLQAADATRATLGLDVRSHIVTDRPLGV  130

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                   + G S G + NP SLLRAVE+L+  + V A+AVVARFP DD  + +  YR+G G
Sbjct  131   -TLKTTESGASWGTLTNPGSLLRAVERLITEAKVRAIAVVARFPDDDGSDVLKAYRKGQG  189

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ F++PCAHAPALSP  L   + P+S +EEIGYTFL CVL GL 
Sbjct  190   VDPLAGAEAVISHLVVRTFKLPCAHAPALSPLPLGPQISPRSAAEEIGYTFLSCVLVGLS  249

Query  379   TAPQYLIKGTEILGKNC-----ISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVE  215
              APQ+L   TE++G        I +++VD+VI+P  A GG   ++ A S      +I V 
Sbjct  250   RAPQFL---TEVVGSQANTTGDICSTEVDTVIVPATALGGSAVMSLAQSAAQ---VIVVG  303

Query  214   ENETVLNDTPERLGIEAVS  158
             EN+T ++   E LGI A++
Sbjct  304   ENKTTMSVRAEDLGIRAIA  322



>ref|WP_024968968.1| hypothetical protein [Microcystis aeruginosa]
Length=352

 Score =   301 bits (772),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 176/313 (56%), Positives = 214/313 (68%), Gaps = 9/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD +PVARA + V D LITHPNVLN A LYW + N  YVEGYALD
Sbjct  10    LIIPTGIGAAIGGYAGDGIPVARAIAQVCDRLITHPNVLNGAQLYWSLDNTYYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVHQNR+GL+ D  IE DL  RHLQ  DA RA+LGL   +Y +TD PL V
Sbjct  70    RFARGDWGLSPVHQNRIGLLFDRAIEFDLLQRHLQAADAVRATLGLDLTDYLITDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +   +   G S G I NPDSLLR  EKL+      A+A+VARFPDD D   + +YR G G
Sbjct  130   Q-LREAASGASWGTIGNPDSLLRGAEKLINQGRAEAIAIVARFPDDPDSIALANYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIP AHAPALSP  L   + PK+ +EEIGYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLVVRQFQIPAAHAPALSPLPLDPQLSPKAAAEEIGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ + + +     + I + +VD++I+P  ACG    L+F   K    ++IAVEEN T 
Sbjct  249   RAPQLVKQPS----PDAIWSREVDALIVPASACGSSTVLSFCQEKT---VLIAVEENSTR  301

Query  199   LNDTPERLGIEAV  161
             +   PE LG++A+
Sbjct  302   MKVAPEPLGVKAI  314



>ref|WP_017720725.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=361

 Score =   301 bits (772),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 183/313 (58%), Positives = 223/313 (71%), Gaps = 5/313 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVARA + + D LITHPNVLN A LYWP+ N LYVEG+ LD
Sbjct  10    LIVPTGIGAAIGGYAGDALPVARAMAQIADRLITHPNVLNGAQLYWPLPNALYVEGFGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA+G W L PVHQNRVGL+LD GIE DLR+RHLQ  DAARA+LG+S  +  VTD PL V
Sbjct  70    KFAKGCWGLRPVHQNRVGLILDCGIEPDLRLRHLQAADAARATLGISLTDCAVTDAPLEV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             E       G S G I NP SLLRA E LV+ +   A+AVVARFPDD D E +  YR G G
Sbjct  130   ELRTS-DAGASWGTIGNPGSLLRAAEVLVRQAGAEALAVVARFPDDPDSEALQRYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+   IPCAHAPALSP  L  ++ P+S +EE+G+TFLPCVLAGL 
Sbjct  189   VDPLAGAEAVISHLVVRTLAIPCAHAPALSPLPLDANLSPRSAAEELGHTFLPCVLAGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++   +EI     + A  VD+V++P  A GG   L+F+       L IAV EN+T 
Sbjct  249   RAPQFITTKSEICQPADVWAEQVDAVVVPAAAFGGSAVLSFSQMPV---LAIAVSENQTT  305

Query  199   LNDTPERLGIEAV  161
             +   PE++G++A+
Sbjct  306   MQVPPEKVGVKAI  318



>ref|WP_015221805.1| hypothetical protein [Cyanobacterium stanieri]
 ref|YP_007164136.1| hypothetical protein Cyast_0508 [Cyanobacterium stanieri PCC 
7202]
 gb|AFZ46487.1| hypothetical protein Cyast_0508 [Cyanobacterium stanieri PCC 
7202]
Length=349

 Score =   301 bits (770),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 173/316 (55%), Positives = 225/316 (71%), Gaps = 10/316 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GA+IGGYAGDALPVARA   V D LITHPNV+N A LYW   N+ YVEGYALD
Sbjct  11    LIVPTGVGASIGGYAGDALPVARAMGQVCDRLITHPNVMNGASLYWSAPNIDYVEGYALD  70

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L+ VHQN++GL+LD  IE +LR RHLQ +DA RA++G++  +Y +TD PL V
Sbjct  71    KFAGGEWGLKSVHQNKIGLILDQAIEPELRHRHLQAMDALRATVGINARDYIITDAPLNV  130

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E  +  + G S G I NPDSLLRA +KLV    +NA+AVVARFP D D + + DYR G G
Sbjct  131   ELRI-AESGASWGTIGNPDSLLRAGKKLVD-QGINALAVVARFPDDTDSQALTDYRHGSG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ FQIPCAHAPALSP  L  ++ P++ +EE+G+TFLPCVL GL 
Sbjct  189   VDALAGAEAVISHLLVREFQIPCAHAPALSPLPLDVNISPRAAAEELGHTFLPCVLVGLN  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ+ ++         + A D+D++++P  ACGG   L+FA+S      II VE+NET+
Sbjct  249   KAPQFSLEKD----NRSLWAEDIDALVIPHHACGGSATLSFAHSHTK---IIVVEDNETI  301

Query  199   LNDTPERLGIEAVSTR  152
             +    E LGI+ +  +
Sbjct  302   IKVPAEPLGIKTIRVK  317



>ref|WP_002749344.1| putative lipoprotein [Microcystis aeruginosa]
 emb|CAO87853.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS44862.1| putative lipoprotein [Microcystis aeruginosa DIANCHI905]
Length=352

 Score =   301 bits (770),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 175/313 (56%), Positives = 214/313 (68%), Gaps = 9/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGD +PVA+A + V D LITHPNVLN A LYWP+ N  YVEGYALD
Sbjct  10    LIIPTGIGAAIGGYAGDGIPVAKAIAQVCDRLITHPNVLNGAQLYWPLVNTYYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVHQNR+GL+ D  IE DL  RHLQ  DA RA+LGL   +Y +TD PL V
Sbjct  70    RFARGDWGLSPVHQNRIGLLFDRAIEFDLLQRHLQAADAVRATLGLDLTDYLITDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +   +   G S G I NPDSLLR  EKL+      A+A+VARFPDD D   + +YR G G
Sbjct  130   Q-LREAASGASWGTIGNPDSLLRGAEKLINQGRAEAIAIVARFPDDPDSIALANYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIP AHAPALSP  L   + PK+ +EEIGYTFLPCVL GL 
Sbjct  189   VDPLAGAEAVISHLVVRQFQIPAAHAPALSPLPLDPQLSPKAAAEEIGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ + + +     + I   +VD++I+P  ACG    L+F   K    ++IAV+EN T 
Sbjct  249   RAPQLVKQPS----PDAIWGREVDALIVPASACGSSTVLSFCQEKT---VLIAVQENSTR  301

Query  199   LNDTPERLGIEAV  161
             +   PE LG++A+
Sbjct  302   MKVAPEPLGVKAI  314



>ref|WP_036021466.1| hypothetical protein, partial [Leptolyngbya sp. PCC 7375]
Length=350

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 177/301 (59%), Positives = 211/301 (70%), Gaps = 11/301 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GAAIGGYAGDALPVARA ++V D LITHPNVLN A LYWP+ N  YVEGY LD
Sbjct  14    MIVPTGVGAAIGGYAGDALPVARAIATVTDRLITHPNVLNGAQLYWPLPNAYYVEGYGLD  73

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L+PVHQN +GLVLD GIE+DLR RHLQ  DAARA+LGL    Y  TD  L V
Sbjct  74    QFAAGRWHLQPVHQNTIGLVLDQGIEDDLRWRHLQAADAARATLGLKIHGYVTTDASLGV  133

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                +      + G ++ PDSLLRAVE L++ S   A+AV+ARFP D D + + DYRQG G
Sbjct  134   R--LKQAAAATWGTLERPDSLLRAVEHLLQ-SGCTAIAVIARFPDDMDSDALTDYRQGHG  190

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQ+PCAHAPAL P  L  S+ P+S +EEIGYTFLPCVLAGL 
Sbjct  191   VDPLAGAEAVISHLVVREFQVPCAHAPALQPLPLDPSISPRSAAEEIGYTFLPCVLAGLS  250

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ+    T     + ISA DVD +I+P    GG   L+ + +      IIAV++N T 
Sbjct  251   KAPQFSTLAT----AHSISAPDVDVLIVPASTLGGSATLSLSGTATQ---IIAVKDNPTT  303

Query  199   L  197
             L
Sbjct  304   L  304



>ref|WP_015143380.1| hypothetical protein [Pleurocapsa minor]
 ref|YP_007080632.1| hypothetical protein Ple7327_1714 [Pleurocapsa sp. PCC 7327]
 gb|AFY77075.1| Protein of unknown function (DUF3326) [Pleurocapsa sp. PCC 7327]
Length=360

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 175/315 (56%), Positives = 215/315 (68%), Gaps = 7/315 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGA+IGGYAGDALPVARA +   D LITHPNVLN A LYW + N LYVEGY LD
Sbjct  9     LIVPTGIGASIGGYAGDALPVARAIAQTCDRLITHPNVLNGAQLYWSLPNTLYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA   W L+PV QNR+GL+LD  IE +LR+RHLQV DAARA+LGL   +Y +TD PL V
Sbjct  69    KFACLEWGLQPVRQNRIGLILDRAIESELRLRHLQVADAARATLGLDLTDYVITDAPLEV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             E       G S G I NP SLLRA + L+  +  +A+A+VARFPDD     + +YR G G
Sbjct  129   ELRT-AVSGASWGTIGNPGSLLRAAQTLIHQARADAIAIVARFPDDPGSLALQNYRSGSG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIP AHAPAL P  L  ++ P++ +EE+GYTFLP VL GL 
Sbjct  188   VDPLAGAEAVISHLVVRQFQIPAAHAPALMPLPLDPNLSPRAAAEELGYTFLPSVLVGLS  247

Query  379   TAPQYLIKGTEILG--KNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENE  206
              APQ++ K           I A +VD+ ++P  ACGG   L+ +  K +   II VEEN 
Sbjct  248   RAPQFVTKERNSFSFPPETIWADEVDAAVIPATACGGSAILSLSGQKAS---IIGVEENR  304

Query  205   TVLNDTPERLGIEAV  161
             T +  TPE LGIEA+
Sbjct  305   TQMQVTPESLGIEAI  319



>ref|WP_009630743.1| Protein of unknown function (DUF3326) [Synechocystis sp. PCC 
7509]
Length=347

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 177/313 (57%), Positives = 217/313 (69%), Gaps = 12/313 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGDALPVARA +SV D LITHPNVLN A LYW M NVLYVEGY LD
Sbjct  9     LIIPTGIGAAIGGYAGDALPVARAIASVCDRLITHPNVLNGAQLYWSMPNVLYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA   W L PV QNR+GL+LD GIE +L++R LQ  +AARA+LGLS  +Y +TD PL V
Sbjct  69    KFAASAWGLHPVRQNRIGLILDKGIEPELQVRQLQAAEAARATLGLSLTDYVITDTPLNV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I+NPDSLLRA +KL+     NA+AVVARFP D D   ++ YR G G
Sbjct  129   ELRTS-ASGASWGTIENPDSLLRAAQKLID-IGANAIAVVARFPDDIDSTALEQYRHGQG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+VK F+IPCAHAPAL P  +  ++ P+S +EE+GYTFLP VL GL 
Sbjct  187   VDPLAGAEAVISHLIVKTFKIPCAHAPALLPLPIDPNISPRSAAEELGYTFLPSVLVGLS  246

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP++     +I  K      +VD+VI+P  ACGG   L+ +NS      II V +N T 
Sbjct  247   RAPRFTSDRRDIWAK------EVDAVIVPATACGGSAILSLSNSTAQ---IITVSDNHTK  297

Query  199   LNDTPERLGIEAV  161
             +   P  LGI+A+
Sbjct  298   MLVPPAPLGIKAI  310



>ref|WP_006618621.1| hypothetical protein [Arthrospira platensis]
 ref|YP_005072618.1| hypothetical protein [Arthrospira platensis NIES-39]
 dbj|BAI94080.1| hypothetical protein [Arthrospira platensis NIES-39]
 gb|KDR54895.1| hypothetical protein APPUASWS_025545 [Arthrospira platensis str. 
Paraca]
Length=352

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 177/316 (56%), Positives = 222/316 (70%), Gaps = 7/316 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GA +GGYAGDALP+AR+ S V D LITHPNVLN A LYW + N LYVEGYALD
Sbjct  9     MIVPTGVGADLGGYAGDALPIARSLSGVCDTLITHPNVLNGAQLYWSIPNALYVEGYALD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             + A G W L+PVH NRVGL+LD G+E +L++RHLQ  D ARA+LG++  +Y +TD PL V
Sbjct  69    QMAAGCWGLQPVHSNRVGLLLDRGMEPELQLRHLQAADGARATLGINMTDYVITDAPLNV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E  + P  G S G I NPDSLLR  +KL++ +   A+AVVARFP D     +  YRQG G
Sbjct  129   ELRIAPS-GASWGTIGNPDSLLRGAQKLIEQAGAEAIAVVARFPDDQGSVALTQYRQGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EA+ISHL+V+HF+IPCAHAPAL P  L   + P+S +EEIGYTFLPCVLAGL 
Sbjct  188   VDPLAGAEAIISHLIVRHFRIPCAHAPALLPLPLDPHLSPRSAAEEIGYTFLPCVLAGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQY+   + +   + I A  VD+V++P  ACGG   L+FAN+      II V EN T 
Sbjct  248   RAPQYV--QSPLTAPDSIWAHQVDAVVVPETACGGSAILSFANTPTR---IITVAENGTT  302

Query  199   LNDTPERLGIEAVSTR  152
             +   PE +GI+ V  +
Sbjct  303   MATPPEAIGIKTVPVK  318



>ref|WP_015172389.1| hypothetical protein [Geitlerinema sp. PCC 7407]
 ref|YP_007109876.1| hypothetical protein GEI7407_2349 [Geitlerinema sp. PCC 7407]
 gb|AFY66824.1| hypothetical protein GEI7407_2349 [Geitlerinema sp. PCC 7407]
Length=358

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 179/314 (57%), Positives = 221/314 (70%), Gaps = 6/314 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             ++VPTGIGAAIGGYAGDALP ARA + VVDCLITHPNVLN A LYWP+ N LYVEGY LD
Sbjct  15    LLVPTGIGAAIGGYAGDALPTARAIAQVVDCLITHPNVLNGAQLYWPIPNALYVEGYGLD  74

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA+G W+L P HQNRVGL+LD  IE +LR+RHLQ  DAARA+LGL+  +Y VTD PL V
Sbjct  75    QFAQGHWSLRPTHQNRVGLLLDQAIEPELRLRHLQAADAARATLGLTLTDYVVTDAPLGV  134

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                   + G + G I+NP SLLRA E L++ +   A+AVVARFP D   E +  YR G G
Sbjct  135   -MLRTAESGATWGTIENPGSLLRAAETLIQKAGAEAIAVVARFPDDTGSEALQAYRHGQG  193

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ F IPCAHAPAL P  L   + P+S +EE+GYTFLPCVL GL 
Sbjct  194   VDPLAGAEAVISHLVVRRFGIPCAHAPALLPLPLDPELSPRSAAEEVGYTFLPCVLVGLS  253

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ+  +G        ++A  VD++I+P  A GG   L+ A ++     IIAV EN T 
Sbjct  254   RAPQF-GRGMGDRRPTDLTADQVDALIVPATAFGGSAVLSLAQTQTQ---IIAVRENATR  309

Query  199   LNDTPERLGIEAVS  158
             +  +PE+LGI A++
Sbjct  310   MAVSPEQLGIRAIA  323



>ref|WP_019508954.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=356

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 220/315 (70%), Gaps = 8/315 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GAAIGGYAGDALPVARA + + D LITHPNVLN A LYWP+ N  YVEGY LD
Sbjct  8     LIVPTGVGAAIGGYAGDALPVARAIAHMGDRLITHPNVLNGAQLYWPLDNTYYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA   W L PV QN+VGL+LD GIE +LR+RH+Q  DA RA+LGL+  +Y +TD PL V
Sbjct  68    RFAANQWGLRPVRQNKVGLLLDRGIEPELRLRHIQAADATRATLGLNLTDYVITDAPLAV  127

Query  736   E-KWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdddde-didDYRQGM  563
             E +  D   G S G I NP SLLRA EKL+  +   A+AVVARFPDD+D  ++ +YR G 
Sbjct  128   ELRTAD--SGASWGTIGNPGSLLRAAEKLISQAGAEAIAVVARFPDDEDSPELQNYRHGE  185

Query  562   GIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGL  383
             G+D LAG EAVISHL+V++FQIP AHAPAL P  + + + P++ +EE+GYTFLPCV+ GL
Sbjct  186   GVDHLAGAEAVISHLIVRNFQIPAAHAPALKPLAVDSDISPRAAAEELGYTFLPCVIVGL  245

Query  382   GTAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
               APQ++ +    +    + A  V+  I+P  ACGG G L+ +NS      IIAV  N T
Sbjct  246   SRAPQFITETKSSI-PEVMWADSVNVAIVPYSACGGSGILSLSNSSTQ---IIAVTNNST  301

Query  202   VLNDTPERLGIEAVS  158
              +   PE LGI+ ++
Sbjct  302   EIYVPPEPLGIKVIT  316



>gb|EKV03311.1| Protein of unknown function (DUF3326) [Leptolyngbya sp. PCC 7375]
Length=368

 Score =   300 bits (768),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 177/301 (59%), Positives = 211/301 (70%), Gaps = 11/301 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTG+GAAIGGYAGDALPVARA ++V D LITHPNVLN A LYWP+ N  YVEGY LD
Sbjct  14    MIVPTGVGAAIGGYAGDALPVARAIATVTDRLITHPNVLNGAQLYWPLPNAYYVEGYGLD  73

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L+PVHQN +GLVLD GIE+DLR RHLQ  DAARA+LGL    Y  TD  L V
Sbjct  74    QFAAGRWHLQPVHQNTIGLVLDQGIEDDLRWRHLQAADAARATLGLKIHGYVTTDASLGV  133

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                +      + G ++ PDSLLRAVE L++ S   A+AV+ARFP D D + + DYRQG G
Sbjct  134   R--LKQAAAATWGTLERPDSLLRAVEHLLQ-SGCTAIAVIARFPDDMDSDALTDYRQGHG  190

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQ+PCAHAPAL P  L  S+ P+S +EEIGYTFLPCVLAGL 
Sbjct  191   VDPLAGAEAVISHLVVREFQVPCAHAPALQPLPLDPSISPRSAAEEIGYTFLPCVLAGLS  250

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ+    T     + ISA DVD +I+P    GG   L+ + +      IIAV++N T 
Sbjct  251   KAPQFSTLAT----AHSISAPDVDVLIVPASTLGGSATLSLSGTATQ---IIAVKDNPTT  303

Query  199   L  197
             L
Sbjct  304   L  304



>ref|WP_038530386.1| hypothetical protein [Synechocystis sp. PCC 6714]
 gb|AIE73907.1| hypothetical protein D082_13790 [Synechocystis sp. PCC 6714]
Length=348

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 172/313 (55%), Positives = 217/313 (69%), Gaps = 7/313 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTG+GAAIGGYAGDALP+ARA S V D LITHPNVLN A LY+P++N LYVEGYALD
Sbjct  7     LIIPTGVGAAIGGYAGDALPIARAISQVCDRLITHPNVLNGAQLYYPIANALYVEGYALD  66

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA+G W L PV  N +GL+ D GIE+DL  RHLQV D ARA+LGL+  +Y +TD PL V
Sbjct  67    RFAQGDWGLTPVGNNAIGLIFDQGIEDDLLWRHLQVADGARATLGLTLTDYVITDEPLGV  126

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddd-dedidDYRQGMG  560
             E  +      S G I NP+SLLRA +KL+  +   A+AV+ARFPDD   + + DYR G G
Sbjct  127   ELRLS-DSSTSWGTIANPESLLRAADKLLTQTKAQAIAVIARFPDDVGSQILTDYRHGHG  185

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D L+G EAVISHL+V+ FQ+PCAHAPALSP  L   + P+S +EE+GYTFLPCVL GL 
Sbjct  186   VDPLSGAEAVISHLIVRQFQVPCAHAPALSPLPLDPDISPRSAAEELGYTFLPCVLMGLS  245

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP Y  +         +   DV+++++P  ACGG   ++F+++      IIAVE N T 
Sbjct  246   RAPHY--QRFPNSNSQTLWNRDVNALVVPASACGGSALMSFSDTSAR---IIAVENNSTQ  300

Query  199   LNDTPERLGIEAV  161
             L   PE LGI  V
Sbjct  301   LEVYPEDLGISVV  313



>ref|WP_035372229.1| hypothetical protein [Dolichospermum circinale]
Length=340

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 174/312 (56%), Positives = 219/312 (70%), Gaps = 8/312 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGDALPVAR  S V D LITHPNV+N A LYW + N  YVEGY LD
Sbjct  9     LIIPTGIGAAIGGYAGDALPVARIISQVCDRLITHPNVMNGASLYWNIPNAFYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV  NRVGL+LD GIE +L +RHLQV DAARA+LGL    + +TD PL V
Sbjct  69    KFAAGEWGLRPVRSNRVGLLLDQGIEPELMLRHLQVADAARATLGLDITNHVITDAPLNV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E    P  G S G I NPDSLLRA EKL+      A+AVV RFP D D+  + +YRQG G
Sbjct  129   ELRTSP-TGTSWGTIGNPDSLLRAAEKLIIQEKAQAIAVVTRFPDDMDETALQNYRQGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F+IPCAHAPALSP   +T++ P++ +EE+GYTFLPCVL GL 
Sbjct  188   VDPLAGAEAVISHLLVRTFKIPCAHAPALSPAPTATNLSPRAAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLI--KGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENE  206
              APQ++I  +  + L  + + A+ VD++I+P  +CGG   L+ + S+     II V EN+
Sbjct  248   NAPQFIINTESYQPLSTD-LWANQVDALIIPDTSCGGSALLSLSQSQCQ---IITVRENK  303

Query  205   TVLNDTPERLGI  170
             T+L  +  +L I
Sbjct  304   TLLQVSAHKLKI  315



>ref|WP_009625382.1| hypothetical protein [Pseudanabaena biceps]
 gb|ELS34473.1| hypothetical protein Pse7429DRAFT_0468 [Pseudanabaena biceps 
PCC 7429]
Length=343

 Score =   296 bits (759),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 180/322 (56%), Positives = 221/322 (69%), Gaps = 14/322 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             ++VPTGI AAIGGYAGDALPVARA +S+ D +ITHPNVLN A LYW M NVLY EGYALD
Sbjct  10    LLVPTGINAAIGGYAGDALPVARAIASIADHVITHPNVLNGASLYWSMPNVLYTEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             R A G W L PV  NR+G++LD G+E DL +RH QV+ AA+A+LGL+  +  VTD  L V
Sbjct  70    RMARGDWGLRPVRANRIGVILDRGMESDLELRHRQVIAAAQATLGLNITDVIVTDCDLGV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             E       G + G I N DSLLRA +KL+K S V A+AVVARFPDD D E + +YRQG G
Sbjct  130   E-LRSGDSGATWGTIANLDSLLRAADKLIKVSQVQAIAVVARFPDDPDSEALQNYRQGKG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISH +V+ F IPCAHAPAL P  L  SV P++ +EE+GYTFLPCVL GL 
Sbjct  189   VDALAGAEAVISHAIVREFAIPCAHAPALQPLPLDASVAPRAAAEELGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPL----IIAVEE  212
              AP+ +I+    L    I+A D+ +++ P  ACGG G LA        PL     I V+E
Sbjct  249   RAPK-IIRDRTWLKPEDITADDISAIVTPYRACGGAGLLAL------NPLPHVQTIFVKE  301

Query  211   NETVLNDTPERLGIEAVS-TRY  149
             N T LN TPE LG++ ++ T Y
Sbjct  302   NHTALNVTPEMLGLKGITVTNY  323



>ref|WP_035994181.1| hypothetical protein, partial [Leptolyngbya sp. KIOST-1]
Length=353

 Score =   296 bits (759),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 190/316 (60%), Positives = 222/316 (70%), Gaps = 13/316 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             ++VPTGIGAA+GGYAGDALPVARA +SVVD LITHPNV+N A LYWP+ N  YVEGY LD
Sbjct  15    LVVPTGIGAAVGGYAGDALPVARAIASVVDTLITHPNVMNGAQLYWPLPNACYVEGYGLD  74

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVH+NR+GLVLDA IEEDLR RHLQ  DAARA+LGL   +Y VTD  L V
Sbjct  75    QFAAGRWGLAPVHRNRIGLVLDAAIEEDLRWRHLQAADAARATLGLDLTDYVVTDAALGV  134

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPd-dddedidDYRQGMG  560
             E     + G + G IQ PDSLLRA E+ +  +   A+AVVARFP+  D E + DYRQG G
Sbjct  135   E-LRRAESGATWGTIQRPDSLLRAAEQAIA-AGAEAIAVVARFPEDIDTEALQDYRQGQG  192

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+  ++PCAHAPALSP  L  SV PKS +EEIGYTFLPCVLAGL 
Sbjct  193   VDPLAGAEAVISHLVVRTLKVPCAHAPALSPLPLDPSVAPKSAAEEIGYTFLPCVLAGLS  252

Query  379   TAPQYLI---KGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEEN  209
              APQ++     G   LG   + A  VD++++P  ACGG   L+       R L IAVE N
Sbjct  253   RAPQFVPGPGAGRSSLG---LWADRVDAIVVPASACGGSALLSLG----RRALAIAVEAN  305

Query  208   ETVLNDTPERLGIEAV  161
              T L   PE LGI AV
Sbjct  306   TTALAVGPEALGIPAV  321



>ref|WP_010994960.1| hypothetical protein [Nostoc sp. PCC 7120]
 ref|NP_484829.1| hypothetical protein alr0786 [Nostoc sp. PCC 7120]
 dbj|BAB72743.1| alr0786 [Nostoc sp. PCC 7120]
Length=344

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 171/317 (54%), Positives = 217/317 (68%), Gaps = 6/317 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GAAIGGYAGDALPVAR  + V D LITHPNVLN A LYW + N  YVEGY LD
Sbjct  9     LIVPTGVGAAIGGYAGDALPVARLIAQVCDRLITHPNVLNGASLYWNIPNSFYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV  N++GL+LD GIE DLR+RHLQ  DAARA+LGL+  ++ +TD PL V
Sbjct  69    KFAAGCWGLRPVRNNKIGLLLDQGIEPDLRLRHLQAADAARATLGLTITDHVITDAPLNV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E    P  G S G I NPDSLLRA E L+  S   A+A+VARFP D D+    +YR G G
Sbjct  129   ELRTAPS-GASWGTIGNPDSLLRAAEILINKSGAEAIAIVARFPDDMDEVAAQNYRHGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISHLVV++FQIPCAH+PAL+P      + P+S +EE+GYTFLP VL GL 
Sbjct  188   VDPIAGAEAVISHLVVRNFQIPCAHSPALAPEPPYPDLSPRSAAEELGYTFLPSVLVGLS  247

Query  379   TAPQYLI-KGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ+++ K +       I A  VD++I+P  ACG    L+ +  +     II VEEN+T
Sbjct  248   RAPQFILEKESSQSHLEDIWAEQVDAIIMPATACGSSALLSLSQKQCQ---IITVEENQT  304

Query  202   VLNDTPERLGIEAVSTR  152
              +  T + LGI+++  +
Sbjct  305   QIQVTAQALGIKSIQVK  321



>ref|WP_012408583.1| hypothetical protein [Nostoc punctiforme]
 ref|YP_001865511.1| hypothetical protein Npun_R1915 [Nostoc punctiforme PCC 73102]
 gb|ACC80568.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
Length=354

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 177/316 (56%), Positives = 217/316 (69%), Gaps = 10/316 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GAAIGGYAGDALPVA+  + V D LITHPNVLN A LYW + N  YVEGY LD
Sbjct  8     LIVPTGVGAAIGGYAGDALPVAKVIAQVCDRLITHPNVLNGASLYWNLPNAFYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV  N+VGL+LD  IE +LR+RH+Q  DA RA+LGL+  +Y +TD PL V
Sbjct  68    KFASGCWGLRPVRNNKVGLLLDQAIEPELRLRHIQAADAVRATLGLALTDYVITDAPLNV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLRA E L+K +   A+AVVARFP D D E +  YR G G
Sbjct  128   ELRTT-ASGASWGTIGNPDSLLRAAEILIKKAGAEAIAVVARFPDDMDSEAVQKYRHGEG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPAL--SPPQLSTSVCPKSVSEEIGYTFLPCVLAG  386
             +D LAG EAVISHL+V+ FQIPCAH+PAL   PPQ   S  P+S +EE+GYTFLPCVL G
Sbjct  187   VDPLAGAEAVISHLLVRTFQIPCAHSPALLSEPPQPDLS--PRSAAEELGYTFLPCVLVG  244

Query  385   LGTAPQYLI-KGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEEN  209
             L  APQ++I KG     K  I A +VD+ I P +ACG    L+ +   + R  II VEEN
Sbjct  245   LSRAPQFIIDKGAIASEKGDIWADEVDAAIAPANACGSSALLSLS---QRRCQIITVEEN  301

Query  208   ETVLNDTPERLGIEAV  161
             +T++   P+ LGI+ +
Sbjct  302   KTLIKVPPQPLGIKVI  317



>ref|WP_006529474.1| Protein of unknown function (DUF3326) [Gloeocapsa sp. PCC 73106]
 gb|ELR97713.1| Protein of unknown function (DUF3326) [Gloeocapsa sp. PCC 73106]
Length=358

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 173/312 (55%), Positives = 214/312 (69%), Gaps = 6/312 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             ++VPTGIGA+IGGYAGDALP+ARA + + D LITHPNVLN A LYW   N+ YVEGYALD
Sbjct  10    LLVPTGIGASIGGYAGDALPIARAIAGLGDRLITHPNVLNGAQLYWSQPNIYYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA   W L PV QN +GL+LD G+E +LR+RHLQ  DA RA+LGL   EY +TD PL V
Sbjct  70    QFALKRWGLRPVKQNSIGLILDQGMELELRLRHLQAADALRATLGLEIKEYILTDAPLGV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdddde-didDYRQGMG  560
             E    P  G S G I NP SLLRA  KL+  + V+A+AVVARFPD+ D   + +YRQG G
Sbjct  130   ELRSAP-SGASWGTISNPGSLLRAAAKLIDQAKVDAIAVVARFPDEIDSPLLANYRQGSG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISHL+V+ F +P AHAPAL P  +   + PK+ +EE+GYTFLPCVL GL 
Sbjct  189   VDPIAGAEAVISHLIVRTFAVPAAHAPALKPLPIEPQLSPKAAAEELGYTFLPCVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP+ +I   +    + I A  VD+VI+P DACG    L F+  +     IIAV EN T 
Sbjct  249   QAPR-IITNQQRYTPDSIWAEQVDAVIVPADACGSSAILGFSQLQTK---IIAVAENRTS  304

Query  199   LNDTPERLGIEA  164
             +   PE LGIEA
Sbjct  305   MKVYPESLGIEA  316



>ref|WP_038084800.1| hypothetical protein [Tolypothrix bouteillei]
 gb|KIE09167.1| hypothetical protein DA73_0232680 [Tolypothrix bouteillei VB521301]
Length=368

 Score =   295 bits (755),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 168/326 (52%), Positives = 221/326 (68%), Gaps = 17/326 (5%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GA+IGGYAGDALPVA+A + V D LITHPNVLN A LYW + N LYVEGY LD
Sbjct  8     LIVPTGVGASIGGYAGDALPVAKAVAGVCDRLITHPNVLNGANLYWNLPNALYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV++NR+GL+LD GIE +L++RHLQ  DAARA+LGLS  +Y +TD PL V
Sbjct  68    KFAAGEWGLRPVYRNRIGLILDQGIEPELQLRHLQAADAARATLGLSLTDYVITDAPLKV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             +       G S G I NPDSLLRA   L++ +   A+AVVARFP + D+E    YRQG G
Sbjct  128   QLQTS-ASGASWGTIGNPDSLLRAASVLIEKAGAEAIAVVARFPDNIDEEIEQKYRQGQG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISHL+V+ FQIPCAH+PA  PP L  ++ P+S +EE+GYTFL  VL GL 
Sbjct  187   VDPIAGAEAVISHLIVRTFQIPCAHSPAFLPPPLDANLSPRSAAEELGYTFLTSVLVGLS  246

Query  379   TAPQYLIKGTEILGKNCISAS-------------DVDSVILPIDACGGDGALAFANSKRN  239
              APQ+L+  +  L ++    S              VD+ I+P  ACG    L+ + ++R 
Sbjct  247   RAPQFLVAESHQLSESETKISPKIGAKTGDIWVNQVDAAIVPATACGSSALLSLSRTQRC  306

Query  238   RPLIIAVEENETVLNDTPERLGIEAV  161
             +  I+ V EN T L  +P+ LG++++
Sbjct  307   Q--IVTVAENHTQLQVSPQPLGLKSI  330



>gb|EMS50023.1| hypothetical protein TRIUR3_20384 [Triticum urartu]
Length=228

 Score =   290 bits (742),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 164/271 (61%), Positives = 189/271 (70%), Gaps = 48/271 (18%)
 Frame = -1

Query  970  MLYWPMSNVLYVEGYALDRFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARA  791
            MLYWPM N LYVEGYALDRFAEG WAL+PVHQN+VGLVLD+GIEE+LR+RHLQV DAARA
Sbjct  1    MLYWPMPNTLYVEGYALDRFAEGAWALQPVHQNKVGLVLDSGIEEELRLRHLQVADAARA  60

Query  790  SLGLSFVEYTVTDLPLMVEKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVAR  611
            SLGL  VEYTVTD PL ++ W DPKCG+STG + N DSLLRAV+ LV  + VNAVAVVAR
Sbjct  61   SLGLPVVEYTVTDAPLEIKTWFDPKCGKSTGSVGNSDSLLRAVDTLVNHAGVNAVAVVAR  120

Query  610  FPddddedidDYRQGMGIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSV  431
            FPDDD ED D YR+G                                             
Sbjct  121  FPDDDPEDSDCYREG---------------------------------------------  135

Query  430  SEEIGYTFLPCVLAGLGTAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFAN  251
              +IGYTFLPCVLAGL TAPQY+ +    L   CI ASDVDSVILP DACGGDGALAF+ 
Sbjct  136  --KIGYTFLPCVLAGLSTAPQYVTRRQGTLDSGCIVASDVDSVILPRDACGGDGALAFSR  193

Query  250  S-KRNRPLIIAVEENETVLNDTPERLGIEAV  161
            + ++N+PLII V+ENETVL+DTP++ GIEA+
Sbjct  194  TARKNKPLIITVQENETVLDDTPDKFGIEAI  224



>ref|WP_037220213.1| hypothetical protein [Richelia intracellularis]
Length=358

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 171/322 (53%), Positives = 216/322 (67%), Gaps = 11/322 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGA+IGGYAGDA+PVAR  S V + LITHPNVLN A LYW + N  YVEGY LD
Sbjct  8     LIIPTGIGASIGGYAGDAIPVARILSQVCERLITHPNVLNGACLYWNIPNTFYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RF  G W L PVHQN++GL+LD GIE +LR+R LQ  DAAR +LGLS  +Y +TD PL V
Sbjct  68    RFTAGDWGLHPVHQNKIGLLLDQGIEPELRLRQLQAADAARGTLGLSLTDYVITDAPLDV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E     + G S G I NPDSLLR  E L+  +   A+AVVARFP D D+E   +YR G G
Sbjct  128   ELRTS-QSGASWGTIGNPDSLLRGAEVLINKAGAEAIAVVARFPDDSDNEADQNYRLGQG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISHLVV+ FQIPCAHAPA  PP L  ++ P++ +EE+GYTFLP V+ GL 
Sbjct  187   VDSIAGAEAVISHLVVRQFQIPCAHAPAFYPPPLEANLSPRAAAEELGYTFLPSVMVGLS  246

Query  379   TAPQYLIK------GTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAV  218
              APQ++ +       T + G   + A  V++VI+P +ACG    L   N    R  +I V
Sbjct  247   RAPQFITRKFVDKTDTMLDGDASVWAEQVNAVIVPANACGSSTLL---NLSEKRCQVITV  303

Query  217   EENETVLNDTPERLGIEAVSTR  152
             EEN+T +    + LGIE++  R
Sbjct  304   EENQTHIQVPHQPLGIESIQVR  325



>emb|CDN13340.1| FIG01149963: hypothetical protein [Richelia intracellularis]
Length=365

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 171/322 (53%), Positives = 216/322 (67%), Gaps = 11/322 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGA+IGGYAGDA+PVAR  S V + LITHPNVLN A LYW + N  YVEGY LD
Sbjct  15    LIIPTGIGASIGGYAGDAIPVARILSQVCERLITHPNVLNGACLYWNIPNTFYVEGYGLD  74

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RF  G W L PVHQN++GL+LD GIE +LR+R LQ  DAAR +LGLS  +Y +TD PL V
Sbjct  75    RFTAGDWGLHPVHQNKIGLLLDQGIEPELRLRQLQAADAARGTLGLSLTDYVITDAPLDV  134

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E     + G S G I NPDSLLR  E L+  +   A+AVVARFP D D+E   +YR G G
Sbjct  135   ELRTS-QSGASWGTIGNPDSLLRGAEVLINKAGAEAIAVVARFPDDSDNEADQNYRLGQG  193

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISHLVV+ FQIPCAHAPA  PP L  ++ P++ +EE+GYTFLP V+ GL 
Sbjct  194   VDSIAGAEAVISHLVVRQFQIPCAHAPAFYPPPLEANLSPRAAAEELGYTFLPSVMVGLS  253

Query  379   TAPQYLIK------GTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAV  218
              APQ++ +       T + G   + A  V++VI+P +ACG    L   N    R  +I V
Sbjct  254   RAPQFITRKFVDKTDTMLDGDASVWAEQVNAVIVPANACGSSTLL---NLSEKRCQVITV  310

Query  217   EENETVLNDTPERLGIEAVSTR  152
             EEN+T +    + LGIE++  R
Sbjct  311   EENQTHIQVPHQPLGIESIQVR  332



>ref|WP_012953577.1| hypothetical protein [Candidatus Atelocyanobacterium thalassa]
 ref|YP_003421270.1| hypothetical protein UCYN_01630 [Candidatus Atelocyanobacterium 
thalassa]
 gb|ADB94912.1| hypothetical protein UCYN_01630 [Candidatus Atelocyanobacterium 
thalassa isolate ALOHA]
Length=351

 Score =   294 bits (752),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 170/314 (54%), Positives = 220/314 (70%), Gaps = 9/314 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGA+IGGYAGDALP+ARA + + D LITHPNVLN A LYWP SN+LYVEGY LD
Sbjct  10    LIVPTGIGASIGGYAGDALPLARAMAKICDYLITHPNVLNGAQLYWPSSNILYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
              F+ G W L+PV  NRVGL+LD GIE DL +RH+Q  +AARA+LGL   +Y VTD  L V
Sbjct  70    NFSCGNWGLDPVLSNRVGLILDQGIESDLMLRHIQAANAARATLGLKLTDYIVTDASLGV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E  +    G S G I NP SLLRA EKL+      A+AVV+RFP + D   +++YR G G
Sbjct  130   ELRIT-NSGTSWGTISNPGSLLRAAEKLINIDRAEAIAVVSRFPDEIDKTLLNNYRSGSG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG E+VISHL+V  F IP AHAPAL+P  L +++ P+S +EE+GYTFL  VL GL 
Sbjct  189   VDPIAGAESVISHLIVSQFCIPAAHAPALNPLPLDSTISPRSAAEELGYTFLSSVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++ K       + I A DVD++++P  ACGG   L+   ++RN  ++IAV ENET 
Sbjct  249   RAPQFVTKQN----FHSIWADDVDALVVPATACGGSSVLSL--NQRNS-VLIAVAENETA  301

Query  199   LNDTPERLGIEAVS  158
             +N  PE L ++A++
Sbjct  302   INVLPESLKLKAIT  315



>ref|XP_002994394.1| hypothetical protein SELMODRAFT_432315 [Selaginella moellendorffii]
 gb|EFJ04545.1| hypothetical protein SELMODRAFT_432315 [Selaginella moellendorffii]
Length=465

 Score =   297 bits (761),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 182/312 (58%), Positives = 214/312 (69%), Gaps = 52/312 (17%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG GA IGGYAGDALPVARA +S+VDCLITHPNVLN AMLYWPMSN LYVEGYALD
Sbjct  46    LIVPTGTGACIGGYAGDALPVARALASIVDCLITHPNVLNGAMLYWPMSNALYVEGYALD  105

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PVH+N+VGLVLDAGIE+DLR                              
Sbjct  106   RFAAGAWGLSPVHRNKVGLVLDAGIEQDLR------------------------------  135

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
                                  LR ++KLV+ + ++AVAVVARFPDDD E + DYRQG G+
Sbjct  136   ---------------------LRHLQKLVRDAAIDAVAVVARFPDDDVEVLKDYRQGQGV  174

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D LAGVEAVIS +VV  F IPCAHAPAL+P    +SV P+S +EEIGYTFLP VLAGL  
Sbjct  175   DALAGVEAVISKMVVSEFHIPCAHAPALAPLPFDSSVSPRSAAEEIGYTFLPSVLAGLSK  234

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQY+ + ++    + I A DVD+V++P++ACGGDG  AF+   R +PLIIAVEEN TVL
Sbjct  235   APQYVSRDSDHR-PHRIWAEDVDAVLVPVNACGGDGVRAFSKKARQKPLIIAVEENVTVL  293

Query  196   NDTPERLGIEAV  161
             NDTPE+L IEAV
Sbjct  294   NDTPEKLQIEAV  305



>ref|WP_018399932.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=348

 Score =   293 bits (750),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 169/314 (54%), Positives = 220/314 (70%), Gaps = 12/314 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGA+IGGYAGDA+PV RA + V D LITHPNVLN A LYW    + YVEGYALD
Sbjct  10    LIVPTGIGASIGGYAGDAMPVVRAMAQVCDRLITHPNVLNGAQLYWNAPPIHYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA GLW L+PVHQNR+GL+LDA IE +LR+RH+Q  +AA+ +LGL+  +Y VTD P+ V
Sbjct  70    QFAAGLWGLQPVHQNRIGLLLDAAIEPELRLRHIQAAEAAKTTLGLNLTDYVVTDAPVGV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddd--dedidDYRQGM  563
             E       G S G IQN  +LLRA E L+  +  +A+AVVARFPD++  D  + DYR G+
Sbjct  130   ELRTA-ASGASWGTIQNEGTLLRAAETLIYKAQADAIAVVARFPDEEPDDPSLQDYRHGV  188

Query  562   GIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGL  383
             G+D +AG EAVISHL+V+ FQIPCAHAPALSP  +   V P++ +EE+GYTFLPCVL GL
Sbjct  189   GVDAIAGAEAVISHLIVRQFQIPCAHAPALSPLPVDAEVSPRAAAEELGYTFLPCVLMGL  248

Query  382   GTAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
               AP++L   +       I A  VD++I+P +ACGG   L+ + S+     +I V +N T
Sbjct  249   SRAPRFLTTPS----PQGIWADSVDAIIVPANACGGSATLSLSQSQ-----VITVADNHT  299

Query  202   VLNDTPERLGIEAV  161
              +  T   LGI+A+
Sbjct  300   QMQVTAAPLGIKAL  313



>ref|WP_022609137.1| protein of unknown function (DUF3326) [Rubidibacter lacunae]
 gb|ERN40030.1| protein of unknown function (DUF3326) [Rubidibacter lacunae KORDI 
51-2]
Length=357

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 179/316 (57%), Positives = 214/316 (68%), Gaps = 13/316 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             ++VPTGIGAAIGGYAGDALPVARA + V DCLITHPNVLN A LYWP+ N LYVEGY LD
Sbjct  15    LLVPTGIGAAIGGYAGDALPVARAIAQVADCLITHPNVLNGAQLYWPLPNALYVEGYGLD  74

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PV  NR+GL+LDA IE DLR+RHLQ  DAARA+LGL   EY +TD PL V
Sbjct  75    RFAAGDWVLRPVTSNRIGLLLDAAIESDLRLRHLQAADAARATLGLDLTEYVITDAPLAV  134

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdddde-didDYRQGMG  560
             E       G S G + N DSLLRA E LVK +   A+AVVARFPDD D   + DYR+G G
Sbjct  135   ELRT-ATSGVSWGTLGNLDSLLRAAETLVKQAGATAIAVVARFPDDADSPALQDYRRGTG  193

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISH +V+  Q+PCAHAPAL P      + P++ +EE+GYTFLPCVLAGL 
Sbjct  194   VDALAGAEAVISHAIVRTLQVPCAHAPALKPLPPDPDLSPRAAAEELGYTFLPCVLAGLA  253

Query  379   TAPQY-LIKGTEI--LGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEEN  209
              AP +  + G     L ++CI     D+++ P  ACGG   L+ + ++      IAV  N
Sbjct  254   RAPHFAALTGCRPGDLTRDCI-----DAIVTPATACGGSTLLSLSQTRTR---AIAVAAN  305

Query  208   ETVLNDTPERLGIEAV  161
              T L   PE LGI+A 
Sbjct  306   TTQLAVAPEPLGIKAT  321



>ref|WP_013192930.1| hypothetical protein [Trichormus azollae]
 ref|YP_003723043.1| hypothetical protein Aazo_4722 ['Nostoc azollae' 0708]
 gb|ADI65920.1| conserved hypothetical protein ['Nostoc azollae' 0708]
Length=345

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 176/314 (56%), Positives = 213/314 (68%), Gaps = 6/314 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGDALPVAR  S V D LITHPNVLN A LYW + N  YVEGY LD
Sbjct  9     LIIPTGIGAAIGGYAGDALPVARVISQVCDHLITHPNVLNGASLYWNIPNASYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVH NRVGL+LD GIE +L +RHLQ  DAARA+LGL+   + +TD PL V
Sbjct  69    QFAAGCWGLRPVHSNRVGLLLDQGIEPELMLRHLQASDAARATLGLNITNHVITDSPLDV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E  +    G S G I NPDSLLRA E L+K     A+AVV RFP   D+E   +YR G G
Sbjct  129   ELSIS-ASGASWGTIGNPDSLLRAAEILIKKEKAEALAVVTRFPDKIDEEAAQNYRHGKG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ FQIPCAHAPAL+P      + P S +EE+GYTFLPCV  GL 
Sbjct  188   VDPLAGAEAVISHLLVRTFQIPCAHAPALAPASPDPDLSPCSAAEELGYTFLPCVFVGLS  247

Query  379   TAPQYLIKGTEILGKNC-ISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ++ K   I      I A  VD+VI+P +ACGG+   A  N  +N+  II V EN+T
Sbjct  248   RAPQFITKREVINSLQADIWADQVDAVIVPANACGGN---ALLNLSQNQCQIITVAENKT  304

Query  202   VLNDTPERLGIEAV  161
             ++      LGI+++
Sbjct  305   LIQVPAPALGIKSI  318



>ref|WP_015130268.1| hypothetical protein [Calothrix sp. PCC 7507]
 ref|YP_007067299.1| hypothetical protein Cal7507_4083 [Calothrix sp. PCC 7507]
 gb|AFY34465.1| hypothetical protein Cal7507_4083 [Calothrix sp. PCC 7507]
Length=354

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 174/314 (55%), Positives = 217/314 (69%), Gaps = 6/314 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVAR  + V D LITHPNVLN A LYW + N  YVEGY LD
Sbjct  9     LIVPTGIGAAIGGYAGDALPVARTIAQVCDRLITHPNVLNGASLYWNLPNAFYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV  N++GL+LD GIE +LR+RHLQ  DAARA+LGL+  +Y +TD PL V
Sbjct  69    KFAAGCWGLRPVRTNKIGLLLDQGIEPELRLRHLQAADAARATLGLNLTDYVITDAPLNV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLRA E L+  +   A+AVVARFP D D+  + +YR G G
Sbjct  129   ELRTS-ISGASWGTIGNPDSLLRAAEILINKAGAEAIAVVARFPDDIDEVAVQNYRHGKG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ FQIPCAH+PAL+       + P+S +EE+GYTFLP VL GL 
Sbjct  188   VDPLAGAEAVISHLIVRTFQIPCAHSPALASAPPDPDLSPRSAAEELGYTFLPSVLVGLS  247

Query  379   TAPQYLI-KGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ++I KG     ++ I A  +D+ I+P  ACG    L+  N KR +  II VEEN+T
Sbjct  248   RAPQFIIEKGLVASLQDDIWADQIDAAIVPATACGSSALLSL-NQKRCQ--IITVEENKT  304

Query  202   VLNDTPERLGIEAV  161
              +   P+ LGI+++
Sbjct  305   QIKVPPQPLGIKSI  318



>gb|AHJ27893.1| hypothetical protein NSP_15590 [Nodularia spumigena CCY9414]
Length=359

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 173/314 (55%), Positives = 215/314 (68%), Gaps = 6/314 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTG+GAAIGGYAGDALPVA+  S V D LITHPNVLN A LYW + N LYVEGY LD
Sbjct  14    LIIPTGVGAAIGGYAGDALPVAKVISQVCDRLITHPNVLNGASLYWNLPNTLYVEGYGLD  73

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV  N++GL+LD GIE +L++RHLQ  DAARA+LGL+  +Y VTD PL V
Sbjct  74    KFASGCWGLRPVRNNKIGLLLDQGIEPELQLRHLQAADAARATLGLTLTDYVVTDAPLNV  133

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLRA E L+  +   A+AVVARFP + D+  + +YRQG G
Sbjct  134   ELRTS-ASGASWGTIGNPDSLLRAAEILINKAGAEAIAVVARFPDNMDEAAVQNYRQGQG  192

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F+IPCAHAPAL+      ++ P+S +EE+GYTFLPCVL GL 
Sbjct  193   VDPLAGAEAVISHLIVRTFKIPCAHAPALASAPPEPNLSPRSAAEELGYTFLPCVLVGLS  252

Query  379   TAPQYLIKGTEILG-KNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ++I    +    + I A  VD  I P +AC G  AL   N KR +  II V EN+T
Sbjct  253   RAPQFIINKESMTAFADDIWADQVDCAIAPANAC-GSSALISLNQKRCQ--IITVAENKT  309

Query  202   VLNDTPERLGIEAV  161
             ++      LGI A+
Sbjct  310   LIQVPAPALGITAL  323



>ref|WP_006197949.1| hypothetical protein [Nodularia spumigena]
 gb|EAW43889.1| hypothetical protein N9414_09486 [Nodularia spumigena CCY9414]
Length=354

 Score =   292 bits (747),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 173/314 (55%), Positives = 215/314 (68%), Gaps = 6/314 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTG+GAAIGGYAGDALPVA+  S V D LITHPNVLN A LYW + N LYVEGY LD
Sbjct  9     LIIPTGVGAAIGGYAGDALPVAKVISQVCDRLITHPNVLNGASLYWNLPNTLYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV  N++GL+LD GIE +L++RHLQ  DAARA+LGL+  +Y VTD PL V
Sbjct  69    KFASGCWGLRPVRNNKIGLLLDQGIEPELQLRHLQAADAARATLGLTLTDYVVTDAPLNV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLRA E L+  +   A+AVVARFP + D+  + +YRQG G
Sbjct  129   ELRTS-ASGASWGTIGNPDSLLRAAEILINKAGAEAIAVVARFPDNMDEAAVQNYRQGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F+IPCAHAPAL+      ++ P+S +EE+GYTFLPCVL GL 
Sbjct  188   VDPLAGAEAVISHLIVRTFKIPCAHAPALASAPPEPNLSPRSAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLIKGTEILG-KNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ++I    +    + I A  VD  I P +AC G  AL   N KR +  II V EN+T
Sbjct  248   RAPQFIINKESMTAFADDIWADQVDCAIAPANAC-GSSALISLNQKRCQ--IITVAENKT  304

Query  202   VLNDTPERLGIEAV  161
             ++      LGI A+
Sbjct  305   LIQVPAPALGITAL  318



>ref|WP_017749379.1| hypothetical protein [Scytonema hofmanni]
Length=362

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 176/321 (55%), Positives = 224/321 (70%), Gaps = 11/321 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGA+IGGYAGDALPVA+A + V D LITHPNVLN A LYW + N LYVEGY LD
Sbjct  8     LIVPTGIGASIGGYAGDALPVAKAVARVCDRLITHPNVLNGANLYWNLPNALYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV+QNR+GL+LD GIE +L++RHLQ  DAARA+LGLS  +Y +TD  L V
Sbjct  68    KFAAGEWGLRPVYQNRIGLILDQGIEPELQLRHLQAADAARATLGLSLTDYVITDAHLEV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             +  +    G S G I NPDSLLRA E L++ +   A+AVVARFP + D+E    YRQG G
Sbjct  128   QLQIS-ASGASWGTIGNPDSLLRAAEILIEKAGAEAIAVVARFPDNIDEEIEQKYRQGQG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             ID +AG EAVISHL+V+ FQIPCAH+PA  PP L  ++ P+S +EE+GYTFL  VL GL 
Sbjct  187   IDPIAGAEAVISHLIVRTFQIPCAHSPAFLPPPLDPNLSPRSAAEELGYTFLTSVLVGLS  246

Query  379   TAPQYLIKGTEIL--GKNCISASD-----VDSVILPIDACGGDGALAFANSKRNRPLIIA  221
              APQ+LI G+  L   K  I   D     VD+ I+P  ACG    L+ + S+R +  I+ 
Sbjct  247   RAPQFLIGGSHQLTESKTKIKTGDIWVNQVDAAIVPATACGSSALLSLSRSRRCQ--IVT  304

Query  220   VEENETVLNDTPERLGIEAVS  158
             VE+N+T +   P+ LGI+++ 
Sbjct  305   VEDNQTQIQVPPQPLGIKSIQ  325



>ref|WP_015140985.1| hypothetical protein [Nostoc sp. PCC 7524]
 ref|YP_007078172.1| hypothetical protein Nos7524_4847 [Nostoc sp. PCC 7524]
 gb|AFY50575.1| Protein of unknown function (DUF3326) [Nostoc sp. PCC 7524]
Length=355

 Score =   292 bits (747),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 172/316 (54%), Positives = 218/316 (69%), Gaps = 10/316 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GA+IGGYAGDA+PVAR  + V D LITHPNVLN A LYW + N  YVEGY LD
Sbjct  9     LIVPTGVGASIGGYAGDAIPVARLIAQVCDRLITHPNVLNGASLYWNIPNAFYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV  N++GL+LD GIE +LR+RHLQ  DAARA+LGL+  +Y  TD PL V
Sbjct  69    KFAAGCWGLRPVRNNKIGLLLDQGIEPELRLRHLQAADAARATLGLTLTDYVTTDAPLKV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLR  E L+K +   A+AVVARFP + D+E + +YR G G
Sbjct  129   E-LRSASSGASWGTIGNPDSLLRGAETLIKQAGAEAIAVVARFPDNMDEEAVQNYRLGKG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALS--PPQLSTSVCPKSVSEEIGYTFLPCVLAG  386
             +D +AG EAVISHL+V++FQIPCAHAPAL+  PP+L+ S  P+S +EE+GYTFLP VL G
Sbjct  188   VDPIAGAEAVISHLIVRNFQIPCAHAPALAAEPPELNLS--PRSAAEELGYTFLPSVLVG  245

Query  385   LGTAPQYLI-KGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEEN  209
             L  APQ+++ KG        I A  VD++I+P  ACG    L+ +        II VEEN
Sbjct  246   LSRAPQFILEKGLTASLAADIWAEQVDAIIMPATACGSSALLSLSQKPCQ---IITVEEN  302

Query  208   ETVLNDTPERLGIEAV  161
              T +   P+ LGI+++
Sbjct  303   HTQIKVPPQPLGIKSI  318



>ref|WP_015148776.1| hypothetical protein [Oscillatoria acuminata]
 ref|YP_007086054.1| hypothetical protein Oscil6304_2516 [Oscillatoria acuminata PCC 
6304]
 gb|AFY82134.1| Protein of unknown function (DUF3326) [Oscillatoria acuminata 
PCC 6304]
Length=354

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 180/313 (58%), Positives = 220/313 (70%), Gaps = 5/313 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GAAIGGYAGDALPVARA + V D LITHPNVLN A LYWP+SN  YVEGYALD
Sbjct  10    LIVPTGVGAAIGGYAGDALPVARAIAQVCDRLITHPNVLNGAQLYWPISNAFYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
              FA+G W L+PVHQNR+GL+LD  IE +LRIRHLQ  DA RA+LGL+  EY +TD PL V
Sbjct  70    CFAKGDWGLQPVHQNRIGLILDCAIEPELRIRHLQAADATRATLGLNLTEYVITDAPLKV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLRA E+L+K +   AVAVVARFP D + E + +YR G G
Sbjct  130   ELRTS-AAGASWGTIGNPDSLLRAAERLIKDAKAEAVAVVARFPDDIESEALHNYRHGTG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F+IPCAHAPAL P  L   + P+S +EEIGYTFLPCVLAGL 
Sbjct  189   VDPLAGAEAVISHLIVRTFKIPCAHAPALLPLPLDPDISPRSAAEEIGYTFLPCVLAGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++   +     + I    VD++++P  A GG   L+ ++       IIAV EN+T 
Sbjct  249   RAPQFISTKSPHCQPSDIWVEQVDALVIPATAAGGSAVLSLSHQSAQ---IIAVRENQTQ  305

Query  199   LNDTPERLGIEAV  161
             +   P  LG+ A+
Sbjct  306   MQVPPGSLGVPAI  318



>ref|WP_015186570.1| hypothetical protein [Gloeocapsa sp. PCC 7428]
 ref|YP_007125853.1| hypothetical protein Glo7428_0076 [Gloeocapsa sp. PCC 7428]
 gb|AFZ28693.1| hypothetical protein Glo7428_0076 [Gloeocapsa sp. PCC 7428]
Length=354

 Score =   291 bits (746),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 179/313 (57%), Positives = 216/313 (69%), Gaps = 6/313 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDA+PVARA +SV D LITHPNVLN A LYW + NV YVEGY LD
Sbjct  10    LIVPTGIGAAIGGYAGDAMPVARAIASVADRLITHPNVLNGAQLYWSLPNVFYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV QNR+GL+LD GIE DL++R LQ  DA RA+LGL+  +Y VTD  + V
Sbjct  70    QFASGSWGLRPVRQNRIGLILDQGIEPDLQLRQLQAADATRATLGLNLSDYVVTDAAIGV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdddde-didDYRQGMG  560
             E       G S G IQNP +LLRA E L+  + V+A+AVVARFPDD D   +  YR G G
Sbjct  130   ELRTS-NSGVSWGTIQNPGTLLRAAETLINKARVDAIAVVARFPDDMDSPALQQYRHGQG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQ+PCAHAPAL P  L   + P+S +EEIGYTFLP VL GL 
Sbjct  189   VDPLAGAEAVISHLVVREFQVPCAHAPALLPLPLDPDISPRSAAEEIGYTFLPSVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ+ +   +    + I A+ VD++I+P  ACGG   L+F+        II V+EN T 
Sbjct  249   RAPQF-VTNQQQSSPHDIWANQVDALIIPATACGGSTVLSFSQDSVQ---IITVQENHTK  304

Query  199   LNDTPERLGIEAV  161
             L   PE LGI+ V
Sbjct  305   LYVPPEPLGIKVV  317



>ref|WP_015081184.1| hypothetical protein [Anabaena sp. 90]
 ref|YP_006997855.1| hypothetical protein ANA_C13372 [Anabaena sp. 90]
 gb|AFW96042.1| hypothetical protein ANA_C13372 [Anabaena sp. 90]
Length=349

 Score =   291 bits (745),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 172/315 (55%), Positives = 216/315 (69%), Gaps = 8/315 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGDALPVAR  S V D LITHPNV+N A LYW + N  YVEGY LD
Sbjct  12    LIIPTGIGAAIGGYAGDALPVARVISQVCDRLITHPNVMNGASLYWNIPNAFYVEGYGLD  71

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV  NRVGL+LD  IE +L +RHLQV DAARA+LGL+   + +TD PL V
Sbjct  72    KFAAGEWGLRPVRSNRVGLLLDQAIEPELMLRHLQVADAARATLGLNITNHVITDAPLNV  131

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPd-dddedidDYRQGMG  560
             E       G S G I NPDSLLRA EKL+      A+AVVARFP+  D+  + +YRQG G
Sbjct  132   ELRTS-SSGASWGTIGNPDSLLRAAEKLIIAEKAEAIAVVARFPEDMDETAVQNYRQGQG  190

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F+IPCAHAPALSP   S ++ P++ +EE+GYTFLPCVL GL 
Sbjct  191   VDPLAGAEAVISHLLVRTFKIPCAHAPALSPAPASPNLSPRAAAEELGYTFLPCVLVGLS  250

Query  379   TAPQYLI--KGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENE  206
              APQ++I  K    L  + I A+ VD++I+P  ACG    L+ ++ +     II V EN+
Sbjct  251   NAPQFIINTKNYNSLSTD-IWANQVDALIIPATACGNSALLSVSHKQCQ---IITVAENK  306

Query  205   TVLNDTPERLGIEAV  161
             T++      L I+ +
Sbjct  307   TLIQVPASMLKIQTL  321



>ref|WP_008232449.1| hypothetical protein [Richelia intracellularis]
 emb|CCH66685.1| hypothetical protein RINTHH_5300 [Richelia intracellularis HH01]
Length=357

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 215/321 (67%), Gaps = 10/321 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+P+GIGA+IGGYAGDA+PVAR  S V + LITHPNVLN A LYW   N LYVEGY LD
Sbjct  8     LIIPSGIGASIGGYAGDAIPVARVLSQVCERLITHPNVLNGACLYWNFPNTLYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +F  G W L PVHQN++GL+LD GIE +L++R LQ  DAAR +LGLS  +Y +TD PL +
Sbjct  68    KFTAGDWGLYPVHQNKIGLLLDQGIESELQLRQLQAADAARGTLGLSLTDYVITDAPLNI  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E  +  + G S G I NPDSLLR  E L+K +   A+AVV RFP + D E   +YR G G
Sbjct  128   ELRIS-ESGISWGTIGNPDSLLRGAEVLIKKAGATAIAVVTRFPDEIDSEVDKNYRLGQG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             ID +AG EAVISHLVV+HFQIPCAHAP   P  L  +V P++ +EE+G+TFLP VL GL 
Sbjct  187   IDPIAGAEAVISHLVVRHFQIPCAHAPTFLPLPLERNVSPRTAAEELGHTFLPSVLVGLS  246

Query  379   TAPQYLIKGT-----EILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVE  215
              APQ++ + +      I+    I A  ++SV+LP  ACG    L   N  + +  II VE
Sbjct  247   HAPQFITRKSLNKTGTIVDHLSIWAEQINSVVLPASACGNSTLL---NLSQKQCQIITVE  303

Query  214   ENETVLNDTPERLGIEAVSTR  152
             EN+T +   P+ +GIE +  R
Sbjct  304   ENQTKIQVYPQLIGIEPIQVR  324



>ref|WP_011243486.1| hypothetical protein [Synechococcus elongatus]
 ref|YP_171884.1| hypothetical protein syc1174_c [Synechococcus elongatus PCC 6301]
 ref|YP_399358.1| hypothetical protein Synpcc7942_0339 [Synechococcus elongatus 
PCC 7942]
 sp|P08452.2|Y1174_SYNP6 RecName: Full=Uncharacterized lipoprotein syc1174_c; Flags: Precursor 
[Synechococcus elongatus PCC 6301]
 dbj|BAD79364.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gb|ABB56371.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
 gb|AJD56579.1| hypothetical protein M744_01315 [Synechococcus sp. UTEX 2973]
Length=359

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 218/310 (70%), Gaps = 8/310 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIG A+GGYAGDALP+ARA +SV D LITHPNV+N A LYWP+ NV YVEGYALD
Sbjct  10    LIVPTGIGCAVGGYAGDALPLARAIASVSDRLITHPNVMNGASLYWPLPNVAYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L+PVH NR+GL+LDA IE +LRIRH QV +AA+A+LGLS     +TD PL V
Sbjct  70    RFAAGDWQLQPVHCNRIGLLLDAAIEPELRIRHQQVAEAAQATLGLSVTAAVITDAPLGV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
                     G + G I  PDSLLRA ++L+K +   A+AV+ARFPDD     + DYRQG G
Sbjct  130   -TLRQADSGSTWGTIDRPDSLLRAADQLLK-AGCEAIAVIARFPDDPGAIALQDYRQGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ FQ+PCAHAPAL P  L  S+ P+S +EE+G+TFLPCVLAGL 
Sbjct  188   VDPLAGAEAVISHLIVREFQVPCAHAPALQPLPLDASISPRSAAEELGHTFLPCVLAGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP+Y    TE + ++ I    VD VI P  A GG G L +A   R  P I+AV EN + 
Sbjct  248   RAPRYR-SATESIAES-IRPESVDVVIAPETAIGGPGILHWA--ARGIP-ILAVAENRST  302

Query  199   LNDTPERLGI  170
             L+  P  LG+
Sbjct  303   LDLRPVDLGV  312



>ref|WP_011317440.1| hypothetical protein [Anabaena variabilis]
 ref|YP_321085.1| hypothetical protein Ava_0566 [Anabaena variabilis ATCC 29413]
 gb|ABA20190.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
Length=344

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 168/318 (53%), Positives = 217/318 (68%), Gaps = 8/318 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALP+AR  + V D LITHPNV+N A LYW + N  YVEGY LD
Sbjct  9     LIVPTGIGAAIGGYAGDALPIARLIAQVCDRLITHPNVINGASLYWNIPNSFYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV  N++GL+LD GIE DLR+RHLQ  DAARA+LGL+  ++ +TD PL V
Sbjct  69    KFASGYWGLRPVRNNKIGLLLDQGIEPDLRLRHLQAADAARATLGLTITDHVITDAPLNV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E    P  G S G I NPDSLLRA E L+  +   A+A+VARFP D ++E   +YR G G
Sbjct  129   ELRTAPS-GASWGTIGNPDSLLRAAEILINKNGAEAIAIVARFPDDMNEEAAQNYRHGKG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISHLVV++F IPCAH+PAL+P      + P+S +EE+GYTFLP VL GL 
Sbjct  188   VDPIAGAEAVISHLVVRNFHIPCAHSPALAPEPPYPGLSPRSAAEELGYTFLPSVLVGLS  247

Query  379   TAPQYLIKGTEILGKNC--ISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENE  206
              APQ+++K  E+   +   I A  VD++I+P  ACG    L+ +  +     II VEEN+
Sbjct  248   RAPQFILK-KELSQSHLEDIWAEQVDAIIMPATACGSSALLSLSQKQCQ---IITVEENQ  303

Query  205   TVLNDTPERLGIEAVSTR  152
             T +    + LGI++   +
Sbjct  304   TQIQVPAQALGIKSTQVK  321



>ref|WP_035156368.1| hypothetical protein [Calothrix sp. 336/3]
 gb|KFB85273.1| hypothetical protein IJ00_22215 [Calothrix sp. 336/3]
Length=342

 Score =   289 bits (739),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 174/315 (55%), Positives = 218/315 (69%), Gaps = 7/315 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVA+A S V D LITHPNV+N A LYW + N  YVEGY LD
Sbjct  8     LIVPTGIGAAIGGYAGDALPVAKAVSQVCDRLITHPNVMNGASLYWNLPNTFYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVH N++GL+LD  IE +LR+RHLQV DAARA+LGLS + + +TD  L V
Sbjct  68    QFAAGNWGLRPVHYNKLGLILDQAIEPELRLRHLQVADAARATLGLSIINHVITDAALNV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdddd-edidDYRQGMG  560
             E  V    G S G I NPDSLLRA E L+      A+AVVARFPD+ +     +YRQG G
Sbjct  128   ELRVS-DSGASWGSIGNPDSLLRAAEVLIH-QGAEAIAVVARFPDEINPILAANYRQGKG  185

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISHL+V+ F+IPCAHAPA++P      + P+S +EEIGYTFLPCVL GL 
Sbjct  186   VDPIAGAEAVISHLIVRQFRIPCAHAPAIAPSPPEIDLAPRSAAEEIGYTFLPCVLVGLS  245

Query  379   TAPQYLIK-GTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
             +APQ++++   E      I A+ VD+VI+P DACG    L+ ++ K     II V+EN T
Sbjct  246   SAPQFILRENHEFPQPGDIWANQVDAVIIPADACGSSALLSLSSQKCQ---IITVKENST  302

Query  202   VLNDTPERLGIEAVS  158
              +      LGI+A+ 
Sbjct  303   KIQVPAAPLGIKAIQ  317



>gb|KFF41084.1| Protein of unknown function (DUF3326) [Candidatus Atelocyanobacterium 
thalassa isolate SIO64986]
Length=351

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 167/314 (53%), Positives = 215/314 (68%), Gaps = 9/314 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGA+IGGYAGDALP+ARA + V D LITHPNVLN A LYWP SN+LYVEGY LD
Sbjct  10    LIVPTGIGASIGGYAGDALPLARAMAKVCDYLITHPNVLNGAQLYWPSSNILYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
              FA G W L PV  N+VGL+LD GIE +L  RH+Q  +AAR +LGL   +Y +TD PL V
Sbjct  70    NFACGDWGLNPVLSNKVGLILDQGIESELMSRHIQAANAARGTLGLRLTDYMITDAPLGV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E  +    G S G I NP SLLRA EKL+  +   A+A+V+RFP   D+  I +YR G G
Sbjct  130   ETRI-ANSGTSWGTINNPGSLLRAAEKLIDKNGAEAIAIVSRFPDTIDETLISNYRSGNG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG E++ISHL+V  F IP AHAPAL P  L  +V P+S +EE+GYTFL  VL GL 
Sbjct  189   VDPIAGAESIISHLIVSQFCIPAAHAPALHPLPLDDTVSPRSAAEELGYTFLSSVLVGLS  248

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ++ K       + I A D+D++++P  ACGG    +F  S+R+  LIIAV EN+T 
Sbjct  249   RAPQFITKQR----FHSIWADDIDALVVPATACGGSSVFSF--SQRDS-LIIAVTENKTT  301

Query  199   LNDTPERLGIEAVS  158
             ++   E LG++ ++
Sbjct  302   IDVPSESLGLKTIT  315



>ref|WP_016949734.1| hypothetical protein [Anabaena sp. PCC 7108]
Length=350

 Score =   289 bits (739),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 172/315 (55%), Positives = 217/315 (69%), Gaps = 8/315 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGDALPVAR  S V D LITHPNVLN A LYW + N LYVEGY LD
Sbjct  9     LIIPTGIGAAIGGYAGDALPVARLISQVCDRLITHPNVLNGASLYWNLPNTLYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA   W L PVH NRVGL+LD  IE +L +RHLQ  DAARA+LGL+   + VTD PL V
Sbjct  69    KFASQCWGLRPVHSNRVGLLLDQAIEPELMLRHLQAADAARATLGLTITNHVVTDAPLNV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPd-dddedidDYRQGMG  560
             E       G S G I NPDSLLRA E L+K    +A+AVVARFP+  D++ + +YR G G
Sbjct  129   ELRTS-ASGASWGTIGNPDSLLRAAEILIKKEGADAIAVVARFPEDIDEKAVQNYRHGKG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ FQIPCAHAPALS       + P+S +EE+GYTFLPCVL GL 
Sbjct  188   VDPLAGAEAVISHLLVRTFQIPCAHAPALSTAPPDPDLSPRSAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLIKGTEILGK--NCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENE  206
              APQ++IK  E++      I A  V+++I+P +ACG    L+ ++ +     II V EN+
Sbjct  248   RAPQFIIK-KEVINSLPEDIWADQVNAIIVPANACGSSALLSLSHKQCQ---IITVAENK  303

Query  205   TVLNDTPERLGIEAV  161
             T++  +   L I+++
Sbjct  304   TLIEVSAPALAIKSI  318



>ref|WP_015208251.1| Protein of unknown function (DUF3326) [Cylindrospermum stagnale]
 ref|YP_007147678.1| Protein of unknown function (DUF3326) [Cylindrospermum stagnale 
PCC 7417]
 gb|AFZ24998.1| Protein of unknown function (DUF3326) [Cylindrospermum stagnale 
PCC 7417]
Length=348

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 173/317 (55%), Positives = 220/317 (69%), Gaps = 13/317 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDA+PVA+  + V D LITHPNVLN A LYW + N  YVEGY LD
Sbjct  10    LIVPTGIGAAIGGYAGDAIPVAKVLAQVCDRLITHPNVLNGASLYWNLPNTFYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVH N++GL+LD GIE +LR+RHLQ  DAARA+LGL+  ++ +TD PL V
Sbjct  70    KFAAGCWGLRPVHSNKIGLLLDRGIEPELRLRHLQAADAARATLGLTITDHVITDAPLNV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E  + P  G S G I NPDSLLRA EKL+K    NA+AVVARFP + D E   +YR G G
Sbjct  130   ELRISPS-GTSWGTIGNPDSLLRAAEKLIK-MGANAIAVVARFPDNLDQEAEQNYRHGKG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIPCAH+PAL        + P+S +EE+GYTFLP VL GL 
Sbjct  188   VDPLAGAEAVISHLVVRTFQIPCAHSPALGTAPPDPDLSPRSAAEELGYTFLPSVLVGLS  247

Query  379   TAPQYLIKGTEILG--KNCISASDVDSVILPIDACGGDGALAFANSKRNRPL--IIAVEE  212
              APQ++++  E+    +  I A+ VD++I+P  ACG    L+      N+ L  II V E
Sbjct  248   RAPQFIVE-RELSNSLQEDIWANQVDAIIIPATACGSSALLSL-----NQRLCQIITVAE  301

Query  211   NETVLNDTPERLGIEAV  161
             N+T++  +   LGI+++
Sbjct  302   NKTLIQVSSPALGIKSI  318



>ref|WP_011056519.1| hypothetical protein [Thermosynechococcus elongatus]
 ref|NP_681461.1| hypothetical protein tlr0672 [Thermosynechococcus elongatus BP-1]
 dbj|BAC08223.1| tlr0672 [Thermosynechococcus elongatus BP-1]
Length=337

 Score =   288 bits (737),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 176/313 (56%), Positives = 212/313 (68%), Gaps = 10/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGDA+PV RA + V D LITHPNVLN AMLYWP+ NV YVEGYALD
Sbjct  6     LIIPTGIGAAIGGYAGDAIPVVRALAQVCDRLITHPNVLNGAMLYWPLPNVWYVEGYALD  65

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
              FA G W L P   NRVGL+LDA +E DL++RH Q   A  A+LGL+  E  +TD PL V
Sbjct  66    EFAVGHWGLLPPRPNRVGLLLDAAMEADLQLRHRQAAAACSATLGLTITEPVITDEPLGV  125

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +       G + G + NP SLLR+ EKL++G+   A+A+V RFPDD   E +  YR G G
Sbjct  126   QLQTA-ASGTTWGTVANPASLLRSAEKLIQGAQAEAIAIVTRFPDDPGTEALHHYRSGQG  184

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+HFQIP AHAPAL P  L  SV P++++EEIGYTFLP VL GL 
Sbjct  185   VDPLAGAEAVISHLVVQHFQIPAAHAPALQPLPLEESVHPRALAEEIGYTFLPSVLVGLS  244

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP+Y     + L +      DVD+VI+P  A GG G LAFA+  +  P II V  N T 
Sbjct  245   RAPRYSFSAPQALWRQ-----DVDAVIVPATALGGRGILAFAH--QGIP-IITVANNTTT  296

Query  199   LNDTPERLGIEAV  161
             LN T   LGIE +
Sbjct  297   LNVTGADLGIETI  309



>ref|WP_015200523.1| hypothetical protein [Calothrix parietina]
 ref|YP_007139884.1| hypothetical protein Cal6303_5022 [Calothrix sp. PCC 6303]
 gb|AFZ03912.1| hypothetical protein Cal6303_5022 [Calothrix sp. PCC 6303]
Length=355

 Score =   288 bits (738),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 173/316 (55%), Positives = 226/316 (72%), Gaps = 10/316 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGA+IGGYAGDALPVA+  + VVD LITHPNV+N A+LYW + N  YVEGY LD
Sbjct  8     LIIPTGIGASIGGYAGDALPVAKTIAQVVDRLITHPNVMNGAILYWNIPNSFYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV+QNRVGL+LD GIE DLR+R++Q  DAARA+LGLS  +Y +TD PL V
Sbjct  68    KFAAGEWGLRPVYQNRVGLILDQGIEPDLRLRNIQAADAARATLGLSLTDYVITDAPLNV  127

Query  736   E-KWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGM  563
             E +  D   G S G I NPDSLLRA + L+     NAVAVVARFP + D E   +YR G 
Sbjct  128   EIRTAD--SGASWGTIGNPDSLLRAADVLINEVGANAVAVVARFPDEVDGEADYNYRLGK  185

Query  562   GIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGL  383
             G+D +AG EAVISHL+V+ FQ+PCAHAPA  PP L  ++ P+S +EE+GYTFLP VL GL
Sbjct  186   GVDPIAGAEAVISHLIVRKFQVPCAHAPAFLPPDLEPNLSPRSAAEELGYTFLPSVLVGL  245

Query  382   GTAPQYLIKGTEILG--KNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEEN  209
               APQ+++K  EI G     I  + VD+VI+P +ACGG   ++ +   + + L+++V EN
Sbjct  246   SRAPQFIVK-REIAGALAGDIWVNQVDAVIVPANACGGSALMSLS---QQQCLVVSVAEN  301

Query  208   ETVLNDTPERLGIEAV  161
             +T +    E +GI+++
Sbjct  302   QTQMRVISETIGIKSI  317



>ref|WP_029315190.1| hypothetical protein [Acaryochloris sp. CCMEE 5410]
Length=354

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 169/326 (52%), Positives = 218/326 (67%), Gaps = 10/326 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +++PTGIGAAIGGYAGDA+PV R  S V D +ITHPNVLN A LYWP+ N  YVEGY LD
Sbjct  12    LLIPTGIGAAIGGYAGDAIPVIRTLSVVCDRIITHPNVLNGAQLYWPIPNAWYVEGYGLD  71

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVHQNR+G+VLD  IE +LR+RHLQ +DAARA+LG+S  +  VTD PL V
Sbjct  72    QFAAGRWGLRPVHQNRIGVVLDQAIEPELRLRHLQAIDAARATLGISITDVCVTDTPLGV  131

Query  736   E-KWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGM  563
               K  D   G + G +  PDSLLRAVE L+     +A+A+VARFP D D + +  YRQG 
Sbjct  132   TLKTAD--SGATWGTLDQPDSLLRAVEHLLNDRATSAIALVARFPDDLDSDMLQAYRQGQ  189

Query  562   GIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGL  383
             G+D LAG EAVISHLVV+ FQIPCAHAPALSP  L   + P++ +EE+GYTFLP VL GL
Sbjct  190   GVDALAGAEAVISHLVVQQFQIPCAHAPALSPLPLDPHLNPRAAAEELGYTFLPSVLVGL  249

Query  382   GTAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
               APQ++    +      +    VD+V++P  ACG    L+   +  +   II V +N T
Sbjct  250   SRAPQFIQDSAQ---PTDLWQDQVDAVVVPASACGSGAILSLNATPAH---IITVMDNTT  303

Query  202   VLNDTPERLGIEAVSTRYLGNSFYLL  125
              ++ T + LGIE++  +    +  +L
Sbjct  304   TMHATAQSLGIESIPVQSYAEAVGVL  329



>ref|WP_015175653.1| hypothetical protein [Oscillatoria nigro-viridis]
 ref|YP_007114756.1| hypothetical protein Osc7112_1855 [Oscillatoria nigro-viridis 
PCC 7112]
 gb|AFZ06340.1| hypothetical protein Osc7112_1855 [Oscillatoria nigro-viridis 
PCC 7112]
Length=419

 Score =   289 bits (740),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 159/260 (61%), Positives = 202/260 (78%), Gaps = 6/260 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GA+IGG+AGDALPVARA + + D LITHPNVLN A LYWP+ N LYVEGYALD
Sbjct  10    LIVPTGVGASIGGFAGDALPVARAIAQISDTLITHPNVLNGAQLYWPIPNALYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L+PVHQNR+GL+LD+ IE DL++RHLQ  DAARA+LGL+  +  +TD PL V
Sbjct  70    KFAAGCWGLQPVHQNRIGLILDSAIEPDLQLRHLQAADAARATLGLNITDCVLTDRPLQV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E  +  + G S G I NPDSLLRA EKL++ + V A+AVVARFP D+    +++YR+G G
Sbjct  130   ELRIS-ESGASWGTIGNPDSLLRAAEKLIEQARVEAIAVVARFPDDEGSLALENYRRGKG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EA+ISHL+V+ F+IPCAHAPALS   L   + P+S +EEIGYTFLPCVLAGLG
Sbjct  189   VDPLAGAEALISHLIVRTFKIPCAHAPALSALPLDPHLSPRSAAEEIGYTFLPCVLAGLG  248

Query  379   TAPQYLIKGTEILGK-NCIS  323
              APQ++   T  +G+ +C+S
Sbjct  249   KAPQFV---TPTVGQASCLS  265



>ref|WP_016867217.1| hypothetical protein [Fischerella muscicola]
Length=353

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 222/315 (70%), Gaps = 6/315 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVA+  + V D LITHPNV+N A LYW + N  YVEGY LD
Sbjct  8     LIVPTGIGAAIGGYAGDALPVAKTIAQVCDRLITHPNVMNGATLYWNLPNAFYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVHQNR+GL+LD GIE +LR+RHLQ  DAARA+LGLS  +Y ++D  L V
Sbjct  68    KFASGCWGLRPVHQNRIGLLLDQGIEPELRVRHLQAADAARATLGLSLTDYVISDTHLNV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLRA E L+  +   A+AVVARFP + D++   +YR G G
Sbjct  128   ELRTS-ASGVSWGTIGNPDSLLRAAEVLINKAGAEAIAVVARFPDNIDEQADQNYRHGKG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AG EAVISHLVV+ F IPCAH+PA  PP L   + P+S +EE+GYTFLP VL GL 
Sbjct  187   VDPIAGAEAVISHLVVRQFHIPCAHSPAFLPPPLDPDLSPRSAAEELGYTFLPSVLVGLS  246

Query  379   TAPQYLIKGTE-ILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ++++ TE IL    I A+ +D+VI+P  AC   G+ A  +  +++ LI+ V+EN T
Sbjct  247   RAPQFIVRETEQILEPTDIWANQIDAVIVPATAC---GSSALLSLSQSQSLIVTVQENHT  303

Query  202   VLNDTPERLGIEAVS  158
             ++   P+ LGI++V 
Sbjct  304   LIQVPPQPLGIKSVQ  318



>ref|WP_027401381.1| hypothetical protein [Aphanizomenon flos-aquae]
Length=353

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 167/303 (55%), Positives = 211/303 (70%), Gaps = 8/303 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGDALPVAR  S V D LITHPNV+N A LYW + N  YVEGY LD
Sbjct  9     LIIPTGIGAAIGGYAGDALPVARVISQVCDRLITHPNVMNGASLYWNIPNGFYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV  NRVGL+LD GIE +L +RHLQV DAARA+LGL+   + +TD PL V
Sbjct  69    KFAAGEWGLRPVRSNRVGLLLDQGIEPELMLRHLQVADAARATLGLNITNHVITDAPLNV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E    P  G S G I NPDSLLRA EKL+      A+AVVARFP + D+  + +Y QG G
Sbjct  129   ELRTSPS-GASWGTIGNPDSLLRAAEKLIIEEKAEAIAVVARFPDNMDETAVKNYHQGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AGVEAVISHL+V+ F+IPCAHAPAL+      ++ P++ +EE+GYTFLPCVL GL 
Sbjct  188   VDPIAGVEAVISHLLVRTFKIPCAHAPALASTPPEANLSPRAAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLI--KGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENE  206
              APQ++I  +    L  + I A  VD++I+P  ACG   +L+ +  +     II V EN+
Sbjct  248   NAPQFIINTENHNFLSTD-IWADQVDALIIPATACGSSASLSLSQKQCQ---IITVAENK  303

Query  205   TVL  197
             T++
Sbjct  304   TLM  306



>ref|WP_026734663.1| hypothetical protein [Fischerella sp. PCC 9605]
Length=353

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 169/315 (54%), Positives = 217/315 (69%), Gaps = 6/315 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVA+A + V D LITHPNVLN A+LYW + N  YVEGY LD
Sbjct  8     LIVPTGIGAAIGGYAGDALPVAKAIAQVCDRLITHPNVLNGAILYWNLPNAFYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVHQNR+GL+LD GIE +LR+R LQ  DAARA+LGLS  +Y +TD PL V
Sbjct  68    KFAAGCWGLRPVHQNRIGLILDQGIEPELRLRQLQAADAARATLGLSLTDYVITDAPLNV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLRA + L+      A+AV+ARFP D D++   +YR G G
Sbjct  128   ELRTT-ASGTSWGTIGNPDSLLRAADVLINKVGAEAIAVIARFPDDIDEQADQNYRHGKG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D + G EAVISHLVV+ FQ+PCAH+PA  PP     + P+S +EE+GYTFLP VL GL 
Sbjct  187   VDPIGGAEAVISHLVVRQFQVPCAHSPAFLPPSPDPDLSPRSAAEELGYTFLPSVLVGLS  246

Query  379   TAPQYLI-KGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ+++ +  E+     I ++ VD+ I+P  ACG    L+ +   + R LI+ V EN+T
Sbjct  247   RAPQFIVGESHEMPEPIDIWSNQVDAAIVPATACGSSALLSLS---QKRCLIVTVNENQT  303

Query  202   VLNDTPERLGIEAVS  158
              +   P+ LGI+++ 
Sbjct  304   QVQVPPQPLGIKSIQ  318



>ref|WP_028082450.1| hypothetical protein [Dolichospermum circinale]
Length=344

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 170/312 (54%), Positives = 212/312 (68%), Gaps = 8/312 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGDALPVAR  S V D LITHPNV+N A LYW + N  YVEGY LD
Sbjct  9     LIIPTGIGAAIGGYAGDALPVARIISQVCDRLITHPNVMNGASLYWNIPNAFYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV  NRVGL+LD GIE +L  RHLQV DAARA+LGL    + +TD  L V
Sbjct  69    KFAAGEWGLRPVRSNRVGLLLDQGIEPELMRRHLQVADAARATLGLDITNHVITDADLNV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPd-dddedidDYRQGMG  560
             E  +    G S G I NPDSLLRA EKL+      A+AVV RFP+  D+  + +YRQG G
Sbjct  129   ELRIS-SSGTSWGTIGNPDSLLRAAEKLIIQEKAQAIAVVTRFPEDMDETALQNYRQGEG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F+IPCAHAPALSP    +++ P++ +EE+GYTFLPCVL GL 
Sbjct  188   VDPLAGAEAVISHLLVRTFKIPCAHAPALSPAPTVSNLSPRAAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLIKGTEILG--KNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENE  206
              APQ++I  TE        + A  +D++I+P  +CGG   L+ + S+     II V EN+
Sbjct  248   NAPQFIIN-TESYKPLSTDLWADQIDALIIPDTSCGGSALLSLSKSQCQ---IITVTENK  303

Query  205   TVLNDTPERLGI  170
             T+L  +   L I
Sbjct  304   TLLQVSAPMLKI  315



>ref|WP_011429974.1| hypothetical protein [Synechococcus sp. JA-3-3Ab]
 ref|YP_474554.1| hypothetical protein CYA_1103 [Synechococcus sp. JA-3-3Ab]
 gb|ABC99291.1| conserved hypothetical protein [Synechococcus sp. JA-3-3Ab]
Length=371

 Score =   284 bits (727),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 173/309 (56%), Positives = 212/309 (69%), Gaps = 6/309 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             ++VPTGIGA +GG+AGDALPVARA ++ VDCLITHPNVLN A L+WPM NVLYVEGY LD
Sbjct  38    LLVPTGIGARVGGFAGDALPVARALAAAVDCLITHPNVLNGATLFWPMGNVLYVEGYGLD  97

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RF  G W L PV QNRVG+VLDAGI EDLR RHLQV+ AA+A+LGL      +T  PL V
Sbjct  98    RFCAGEWFLRPVRQNRVGVVLDAGIPEDLRQRHLQVLQAAQATLGLDIGPLRLTPRPLGV  157

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
                  P  G S G +++P++LL A  +L+  +   A+AVVARFP  DD D   Y QG G+
Sbjct  158   AVSFSP-AGASQGSLEDPEALLEAARELLC-AGAEALAVVARFP--DDLDFSRYEQGQGV  213

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D LAG EA++SHLVV+   IPCAHAPA  P      V P++ +EE+G+TFLP VLAGL  
Sbjct  214   DPLAGAEAILSHLVVRELGIPCAHAPAFYPDPDPKPVHPRAAAEEVGFTFLPSVLAGLSY  273

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQ++ +G      + ++A  VDSVI P  A GG G L  A+  R  PL IAVEEN TV+
Sbjct  274   APQFVKRGDPPQPGD-LTAEQVDSVIAPATAFGGPGLLYLASRPRP-PLFIAVEENATVM  331

Query  196   NDTPERLGI  170
                P +LGI
Sbjct  332   QVHPRQLGI  340



>ref|WP_012163142.1| hypothetical protein [Acaryochloris marina]
 ref|YP_001517008.1| hypothetical protein AM1_2690 [Acaryochloris marina MBIC11017]
 gb|ABW27692.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
Length=319

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/302 (51%), Positives = 198/302 (66%), Gaps = 10/302 (3%)
 Frame = -1

Query  1024  FSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALDRFAEGLWALEPVHQNRVGLVLDAG  845
              S V D +ITHPNVLN A LYWP+ N  YVEGY LD+FA G W L PVHQN +G+VLD  
Sbjct  1     MSMVCDRIITHPNVLNGAQLYWPIPNAWYVEGYGLDQFAAGQWGLRPVHQNHIGVVLDQA  60

Query  844   IEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMVE-KWVDPKCGQSTGRIQNPDSLLR  668
             IE +LR+RHLQ +DAARA+LG+S  +  VTD PL V  K  D   G + G +  PDSLLR
Sbjct  61    IEPELRLRHLQAIDAARATLGISITDVYVTDTPLGVTLKTAD--SGATWGTLDQPDSLLR  118

Query  667   AVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMGIDLLAGVEAVISHLVVKHFQIPC  491
             AVE L+    ++A+AVVARFP D D + +  YRQG G+D LAG EAVISHLVV+ FQIPC
Sbjct  119   AVEHLINDRSISAIAVVARFPDDLDSDMLQAYRQGQGVDALAGAEAVISHLVVQQFQIPC  178

Query  490   AHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGTAPQYLIKGTEILGKNCISASDV  311
             AHAPALSP  L   + P++ +EE+GYTFLP VL GL  APQ+ I+G+       +    V
Sbjct  179   AHAPALSPLPLDPHLNPRAAAEELGYTFLPSVLVGLSRAPQF-IQGSA--QPTDLWQDQV  235

Query  310   DSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVLNDTPERLGIEAVSTRYLGNSFY  131
             D+V++P  ACG    L+   +  +   II V +N T ++ T + LGIE++  +    +  
Sbjct  236   DAVVVPASACGSGAILSLNATPAH---IITVMDNTTTMHATAQSLGIESIPVQSYAEAVG  292

Query  130   LL  125
             +L
Sbjct  293   IL  294



>ref|WP_026101359.1| hypothetical protein [cyanobacterium PCC 7702]
Length=356

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 170/315 (54%), Positives = 212/315 (67%), Gaps = 5/315 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVARA + V D LITHPNVLN A LYW + N LYVEGY LD
Sbjct  8     LIVPTGIGAAIGGYAGDALPVARAIAQVCDRLITHPNVLNGASLYWNLPNTLYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVHQNRVGL+LD GIE +LR R LQ  DAARA+LGLS  EY +TD PL V
Sbjct  68    KFAAGAWGLRPVHQNRVGLILDRGIEPELRWRQLQAADAARATLGLSLTEYVITDTPLNV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLRA + LV  +   A+AVVARFP + D +   +YR G G
Sbjct  128   ELRTSVS-GSSWGTIGNPDSLLRAAQVLVTKAKAEAIAVVARFPDEIDAQAEQNYRCGKG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLST-SVCPKSVSEEIGYTFLPCVLAGL  383
             +D +AG EAVISHLVV+ F +PCAHAPA         ++ P+  +EE+GYTFLP VL GL
Sbjct  187   VDPIAGAEAVISHLVVREFHLPCAHAPAFKATLAEDGNLSPRCAAEELGYTFLPSVLVGL  246

Query  382   GTAPQYLI-KGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENE  206
               APQ+++ +  ++  +  I   +VD  I+P +ACG    L+ +  K+    I+AV+EN 
Sbjct  247   SRAPQFVVGQARQVSSEQDIWVDEVDVAIVPANACGSSALLSLSQ-KQGCCAIVAVKENY  305

Query  205   TVLNDTPERLGIEAV  161
             T +      LGI+++
Sbjct  306   TRIQVPACSLGIKSI  320



>ref|WP_015167604.1| hypothetical protein [Synechococcus sp. PCC 7502]
 ref|YP_007105080.1| hypothetical protein Syn7502_00813 [Synechococcus sp. PCC 7502]
 gb|AFY72945.1| Protein of unknown function (DUF3326) [Synechococcus sp. PCC 
7502]
Length=348

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 169/318 (53%), Positives = 213/318 (67%), Gaps = 8/318 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGI AAIGGYAGDALPVARA ++V D +ITHPNVLN A L++PM NVLYVEGY LD
Sbjct  9     LIIPTGIKAAIGGYAGDALPVARAIAAVADTVITHPNVLNGASLFYPMPNVLYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             + A G W L+PVH NR+G++LD GIE +L +RH Q + AA+A+LGL+  +  +TD  L V
Sbjct  69    QVALGNWGLQPVHSNRIGVILDRGIEPELELRHRQAIAAAQATLGLTITDTVITDQNLGV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E  +  K G + G I +PDSLLRA + LV    V A+AV+ RFP D D   + +YRQG G
Sbjct  129   ELQIG-KSGATWGTIAHPDSLLRAADYLVNVCKVQAIAVITRFPDDTDSLALQNYRQGRG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F IP AHAPALSP  L  SV  ++ +EE+GYTFLPCVL GL 
Sbjct  188   VDALAGAEAVISHLLVREFAIPTAHAPALSPLPLDPSVSARAAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYL-IKGTEILGKN---CISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEE  212
              APQ++  KG   L  N    I+ + +D +I P  ACGG   LA    K N    I V E
Sbjct  248   KAPQFITTKGNTDLVINLTKAIARNHIDVIITPESACGGTAILAL--QKLNHIHYIFVRE  305

Query  211   NETVLNDTPERLGIEAVS  158
             N T L   P+ LG+   +
Sbjct  306   NTTALQVYPQMLGLTGTT  323



>ref|WP_015124467.1| hypothetical protein [Synechococcus sp. PCC 6312]
 ref|YP_007061467.1| hypothetical protein Syn6312_1778 [Synechococcus sp. PCC 6312]
 gb|AFY60924.1| Protein of unknown function (DUF3326) [Synechococcus sp. PCC 
6312]
Length=354

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 169/332 (51%), Positives = 212/332 (64%), Gaps = 19/332 (6%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAA+GGYAGDA+PV RA   V D +ITHPNVLN A LYW M NV YVEGY LD
Sbjct  9     LIIPTGIGAAMGGYAGDAIPVVRALGQVCDQIITHPNVLNGAQLYWSMPNVAYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L+    NR+GL+ D  I  DLR+RHLQ  +A RA+LGL   +Y VTD PL V
Sbjct  69    QFAAGAWGLQRGQTNRIGLLFDQAIAPDLRLRHLQAAEACRATLGLRLTDYVVTDQPLGV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G + G +++PDSLLRA  KL++     A+A++ RFP   D + + DYRQG G
Sbjct  129   ELRTS-ASGATWGTLRHPDSLLRAAAKLIE--TAQAIAIITRFPDQIDAQALSDYRQGQG  185

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHLVV+ FQIP AHAPAL P  L  SV P++ +EEIGYTFLP VL GL 
Sbjct  186   VDPLAGAEAVISHLVVREFQIPAAHAPALMPLPLDASVSPQAAAEEIGYTFLPSVLVGLS  245

Query  379   TAPQYLI-------KGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIA  221
              APQ++        +   ++ + C     VD VI P  ACGG G LAF  +      II 
Sbjct  246   QAPQFVSLDSQVSHQAAGVMDRRC-----VDVVISPAGACGGSGLLAFNQTGTQ---IIT  297

Query  220   VEENETVLNDTPERLGIEAVSTRYLGNSFYLL  125
             V +N T LN T   LGI+A++ +    +  +L
Sbjct  298   VADNSTTLNVTAAGLGIKALAVQSYAEAIGVL  329



>ref|WP_039200324.1| hypothetical protein [Aphanizomenon flos-aquae]
 gb|KHG42646.1| hypothetical protein OA07_03830 [Aphanizomenon flos-aquae 2012/KM/D3]
Length=353

 Score =   281 bits (718),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 170/305 (56%), Positives = 210/305 (69%), Gaps = 12/305 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGDALPVAR  S V D LITHPNV+N A LYW + N  YVEGY LD
Sbjct  9     LIIPTGIGAAIGGYAGDALPVARVISQVCDRLITHPNVMNGASLYWNIPNGFYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV  NRV L+LD GIE +L +RHLQV DAARA+LGL+   + +TD PL V
Sbjct  69    KFAAGEWGLRPVRSNRVSLLLDQGIEPELMLRHLQVADAARATLGLNITNHVITDAPLNV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E    P  G S G I NPDSLLRA EKL+      A+AVVARFP D D+  I +Y QG G
Sbjct  129   ELRTSPS-GASWGTIGNPDSLLRAAEKLIIEEKAEAIAVVARFPDDMDETAIKNYHQGQG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D +AGVEAVISHL+V+ F+IPCAHAPAL+      ++ P + +EE+GYTFLPCVL GL 
Sbjct  188   VDPIAGVEAVISHLLVRTFKIPCAHAPALASTPPDANLSPPAAAEELGYTFLPCVLVGLS  247

Query  379   TAPQYLIKGTEILGKNCIS----ASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEE  212
              APQ++I  TE    N +S    A+ VD++I+P  ACG    L+ +  +     II V E
Sbjct  248   NAPQFIIN-TE--NHNSLSTDIWANQVDALIIPATACGSSALLSLSQKQCQ---IITVAE  301

Query  211   NETVL  197
             N+T++
Sbjct  302   NKTLM  306



>ref|WP_015216277.1| hypothetical protein [Anabaena cylindrica]
 ref|YP_007158570.1| hypothetical protein Anacy_4296 [Anabaena cylindrica PCC 7122]
 gb|AFZ59660.1| hypothetical protein Anacy_4296 [Anabaena cylindrica PCC 7122]
Length=346

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 176/315 (56%), Positives = 220/315 (70%), Gaps = 8/315 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGDALPVA+  S V D LITHPNV+N A LYW +SN LYVEGY LD
Sbjct  9     LIIPTGIGAAIGGYAGDALPVAKVISQVCDRLITHPNVMNGASLYWNISNALYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVH+NRVGL+LD  IE +L +RHLQ  DAARA+LGL+   + +TD PL V
Sbjct  69    KFAAGEWGLRPVHRNRVGLLLDQSIEPELMLRHLQAADAARATLGLTIANHVITDAPLNV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLRA E L+K   V+A+AVVARFP + D+E   +YR G G
Sbjct  129   ELRAS-ASGASWGTIGNPDSLLRAAEILIKKERVDAIAVVARFPDNIDEEAAQNYRHGHG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ FQIPCAHAPAL+      ++ P+S +EE+GYTFLPCVL GL 
Sbjct  188   VDPLAGAEAVISHLLVRTFQIPCAHAPALAAALPDPNLSPRSAAEELGYTFLPCVLIGLS  247

Query  379   TAPQYLIKGTEILGK--NCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENE  206
              APQ+++K  EI+      I A  VD+VI+P +ACGG   L+ +  +     II V EN+
Sbjct  248   CAPQFILK-REIINSLPADIWADQVDAVIVPANACGGSALLSLSQKQCQ---IITVAENK  303

Query  205   TVLNDTPERLGIEAV  161
             T++      LGI ++
Sbjct  304   TLIQVPAPVLGINSI  318



>ref|WP_017710888.1| hypothetical protein [Prochlorothrix hollandica]
Length=356

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 184/329 (56%), Positives = 227/329 (69%), Gaps = 10/329 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIG A+GGYAGDALPVARA + VVD LITHPNVLN A LYWP++N LYVEGY LD
Sbjct  9     LIIPTGIGCAVGGYAGDALPVARALAGVVDRLITHPNVLNGAQLYWPLANALYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W LEPV QNRVGL+LDAGIE DLR+RHLQ   AAR +LGLS  +Y VTD PL V
Sbjct  69    RFAAGQWGLEPVTQNRVGLLLDAGIEPDLRLRHLQAAAAARTTLGLSLTDYVVTDRPLTV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddd--dedidDYRQGM  563
              +    + G S G I+  DSLLRA EKLV  +   A+AVV RFPD+     ++  YRQG 
Sbjct  129   -RLSRGESGASWGTIEPLDSLLRAAEKLVTQAQAQAIAVVVRFPDEAPDSPELVQYRQGQ  187

Query  562   GIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGL  383
             G+D +AG EA+ISH + +  QIPCAHAPAL+   L   + P+S +EE+G+TFLPCVL GL
Sbjct  188   GVDPIAGAEAIISHFLGRSLQIPCAHAPALAALPLDPQLSPRSAAEELGHTFLPCVLVGL  247

Query  382   GTAPQYLIKG---TEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEE  212
               APQY +        L  +C++ +DVD V++P  ACGG   L +A+  +   LI+AVE+
Sbjct  248   SRAPQYRVLSPVPPAPLPASCLTTADVDVVVVPASACGGSALLHWASQGK---LILAVED  304

Query  211   NETVLNDTPERLGIEAVSTR-YLGNSFYL  128
             N T L   PE LGI AV  R YL +  Y+
Sbjct  305   NTTALAVPPEALGIPAVRVRSYLESVGYV  333



>ref|WP_024124060.1| protein of unknown function DUF3326 [Thermosynechococcus sp. 
NK55a]
 ref|YP_008899156.1| protein of unknown function DUF3326 [Thermosynechococcus sp. 
NK55a]
 gb|AHB87643.1| protein of unknown function DUF3326 [Thermosynechococcus sp. 
NK55a]
Length=337

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 170/313 (54%), Positives = 209/313 (67%), Gaps = 10/313 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGAAIGGYAGDA+PV RA + V D LITHPNVLN AMLYWP+ NV YVEGYALD
Sbjct  6     LIIPTGIGAAIGGYAGDAIPVVRALAQVCDRLITHPNVLNGAMLYWPLPNVWYVEGYALD  65

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
              FA G W L P   NR+GL+LDA IE +L++RH Q   A  A+LGL+  E  +TD PL V
Sbjct  66    EFAAGHWGLLPPRANRIGLLLDAAIEPELQLRHRQAAAACSATLGLTLTEPVITDEPLGV  125

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
             +       G + G + NP SLLR+ E L++ +   A+A+V RFPDD   E +  YR G G
Sbjct  126   QLQTA-ASGATWGTVANPASLLRSAETLIQVAKAEAIAIVTRFPDDPGTEALHHYRSGQG  184

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+HFQIP AHAPAL P  L  SV P++++EEIGYTFLP VL GL 
Sbjct  185   VDPLAGAEAVISHLIVQHFQIPAAHAPALEPLPLEESVHPRALAEEIGYTFLPSVLVGLS  244

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP+Y +     L +      DVD+VI+P  A GG G LA A+  +  P I+ V  N T 
Sbjct  245   RAPRYSLSDPHALWRQ-----DVDAVIVPATALGGRGILALAH--QGIP-ILTVANNTTT  296

Query  199   LNDTPERLGIEAV  161
             LN T   LGIE +
Sbjct  297   LNVTGADLGIETI  309



>ref|WP_015163572.1| hypothetical protein [Pseudanabaena sp. PCC 7367]
 ref|YP_007101026.1| hypothetical protein Pse7367_0284 [Pseudanabaena sp. PCC 7367]
 gb|AFY68598.1| hypothetical protein Pse7367_0284 [Pseudanabaena sp. PCC 7367]
Length=355

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 174/313 (56%), Positives = 213/313 (68%), Gaps = 4/313 (1%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVARA ++V D LITHPNVLN A LYWP++NV YVEG+ALD
Sbjct  12    LIVPTGIGAAIGGYAGDALPVARALAAVADNLITHPNVLNGASLYWPLANVWYVEGFALD  71

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             + A G W L P H NR+G+VLD  IE DL +RH QV+DAA+A+LG+       TD  L +
Sbjct  72    QVAIGNWGLRPRHFNRLGVVLDRAIEPDLALRHRQVIDAAKATLGIDISGVITTDQDLGI  131

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E     + G S G I NPD+LLRA E L+K     A+AVVARFP D  +E +  YRQG G
Sbjct  132   E-LRQGESGISWGTIANPDALLRAAELLIKQFRAEAIAVVARFPDDMQNEMLQQYRQGQG  190

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+ +  Q+PCAHAPAL P  L  +VC +S +EE+GYTFLPCVLAGL 
Sbjct  191   VDALAGAEAVISHLISRELQLPCAHAPALLPLPLDPTVCARSAAEELGYTFLPCVLAGLS  250

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              APQ +I  T       + A D+D  I P DACG    LA A +  ++P +I V EN TV
Sbjct  251   RAPQ-IITRTNHAATGDLWAEDIDVAIAPYDACGSPALLALAMAT-HQPRLIFVRENSTV  308

Query  199   LNDTPERLGIEAV  161
             L   PE L ++ +
Sbjct  309   LQVPPESLALKGI  321



>ref|WP_017654438.1| hypothetical protein [Microchaete sp. PCC 7126]
Length=362

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 165/315 (52%), Positives = 212/315 (67%), Gaps = 6/315 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGAAIGGYAGDALPVA+  + V D LITHPNVLN A LYW + N  YVEGY LD
Sbjct  10    LIVPTGIGAAIGGYAGDALPVAKVIAEVCDRLITHPNVLNGASLYWNLPNAFYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PVH N++GL+LD GIE +LR+RHLQ  DAARA+LGL+  +Y +TD PL V
Sbjct  70    KFAAGCWGLRPVHSNKIGLLLDQGIEPELRLRHLQAADAARATLGLTLTDYVITDAPLGV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPd-dddedidDYRQGMG  560
             E  +    G S G I NPDSLLRA E L++ +   A+AVVARFP+  D++ + +YR G G
Sbjct  130   ELRMS-STGASWGTIGNPDSLLRAAEVLIQQAGAEAIAVVARFPEDMDEQAVQNYRHGKG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+ F IPCAH+PAL+       + P+S +EE+GYTFLP VL GL 
Sbjct  189   VDPLAGAEAVISHLIVRTFHIPCAHSPALAAAPPDPDLSPRSAAEELGYTFLPSVLVGLS  248

Query  379   TAPQYLIKGTEILGK-NCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ++I+   +  +   I    VD+ I P  ACG    L+   ++     II V EN T
Sbjct  249   RAPQFIIEKGLVASRLEDIWVDQVDAAIAPATACGSSALLSLNQTQCQ---IITVTENRT  305

Query  202   VLNDTPERLGIEAVS  158
              +      LGI++++
Sbjct  306   QIQVPAHSLGIKSIN  320



>ref|WP_015113228.1| hypothetical protein [Nostoc sp. PCC 7107]
 ref|YP_007050163.1| hypothetical protein Nos7107_2404 [Nostoc sp. PCC 7107]
 gb|AFY43013.1| hypothetical protein Nos7107_2404 [Nostoc sp. PCC 7107]
Length=349

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 162/314 (52%), Positives = 215/314 (68%), Gaps = 6/314 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GAAIGGYAGDA+PVAR  + V D LITHPNVLN A LYW + N  YVEG+ LD
Sbjct  8     LIVPTGVGAAIGGYAGDAIPVARTLAQVCDRLITHPNVLNGASLYWNIPNAFYVEGFGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L+PV  N++GL+LD  IE DL++RHLQ  DAARA+LGL+  +Y +TD PL V
Sbjct  68    KFASGCWGLQPVRNNKIGLLLDQSIEPDLQLRHLQAADAARATLGLTITDYVITDAPLNV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E       G S G I NPDSLLRA E L+      A+AVVARFP D D++ + +Y QG G
Sbjct  128   ELRTS-ASGASWGTIGNPDSLLRAAEILINKMGAEAIAVVARFPDDMDEDAVQNYHQGKG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V++FQIPCAH+PAL+       + P+S +EE+GYTFLP VL GL 
Sbjct  187   VDPLAGAEAVISHLLVRNFQIPCAHSPALASTSPYPDLSPRSAAEELGYTFLPSVLVGLS  246

Query  379   TAPQYLIKGTEILGKNC-ISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
              APQ++++          I A  +D+ I+P +AC   G+ A  +  ++R  II V++N+T
Sbjct  247   RAPQFIVEKQLFTSHPADIWADQIDAAIVPANAC---GSSALLSLSQSRCPIITVKDNQT  303

Query  202   VLNDTPERLGIEAV  161
              +    + LGI+++
Sbjct  304   QIQVPAQPLGIKSI  317



>ref|WP_009344242.1| hypothetical protein [Raphidiopsis brookii]
 gb|EFA72135.1| conserved hypothetical protein [Raphidiopsis brookii D9]
Length=342

 Score =   273 bits (698),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 164/318 (52%), Positives = 207/318 (65%), Gaps = 6/318 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGA IGGYAGDA+P+AR  S V D LITHPNVLN A LYW +SN  YVEGY LD
Sbjct  9     LIIPTGIGATIGGYAGDAIPLARVMSQVCDRLITHPNVLNGASLYWNISNSYYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV  N++G++LD  IE DL +RHLQ VD ARA+LGL+ V+  VTD  L V
Sbjct  69    KFASGEWGLRPVRSNKIGVILDKAIEPDLMLRHLQTVDGARATLGLNIVDSIVTDTSLGV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             E  V    G S G I NPDSLLRA  KLV    V A+A+V RFP D  E  + YRQG G+
Sbjct  129   EIGVS-ASGISWGTISNPDSLLRAAAKLVTTEKVEAIAIVGRFP-DSMEGEEKYRQGKGV  186

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D +AG EAVISHL+V++F+IPCAHAPAL+       + P + +EEIGYT++P VL GL  
Sbjct  187   DPVAGAEAVISHLLVRNFKIPCAHAPALATSLPELDLSPLAAAEEIGYTYMPSVLVGLSR  246

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQ++           I   ++D+VI P  ACG    ++ +  +     I+ V  NET++
Sbjct  247   APQFITSEKNKSLPGDIWVEEIDAVISPAGACGSSLLMSLSQKQCQ---IVTVTGNETLI  303

Query  196   NDTPERLGIEAVS-TRYL  146
             N     LGI+A+  T YL
Sbjct  304   NVPAASLGIKAIQVTSYL  321



>ref|WP_006275911.1| hypothetical protein [Cylindrospermopsis raciborskii]
 gb|EFA71119.1| conserved hypothetical protein [Cylindrospermopsis raciborskii 
CS-505]
Length=342

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 167/320 (52%), Positives = 208/320 (65%), Gaps = 10/320 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIGA IGGYAGDA+P+AR  S V D LITHPNVLN A LYW +SN  YVEGY LD
Sbjct  9     LIIPTGIGATIGGYAGDAIPLARVMSQVCDRLITHPNVLNGASLYWNISNSYYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G W L PV  NR+G++LD  IE DL +RHLQ VD ARA+LGL+ V+  VTD  L V
Sbjct  69    KFASGEWGLRPVRSNRIGVILDKAIEPDLMLRHLQTVDGARATLGLNIVDSIVTDTSLGV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             E  +    G S G I NPDSLLRA  KLV    V A+AVV RFP D  E  + YRQG G+
Sbjct  129   EIGIS-TSGISWGTISNPDSLLRAAAKLVTTEKVEAIAVVGRFP-DTMEGEEKYRQGKGV  186

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPAL--SPPQLSTSVCPKSVSEEIGYTFLPCVLAGL  383
             D +AG EAVISHL+V+ F+IPCAHAPAL  SPP+L  S  P + +EEIGYT++P VL GL
Sbjct  187   DPIAGAEAVISHLLVRTFKIPCAHAPALATSPPELDLS--PLAAAEEIGYTYMPSVLVGL  244

Query  382   GTAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
               APQ++           I   ++D+VI P  ACG    ++ +  +     I+ V  NET
Sbjct  245   SRAPQFITSEKNKSLPGDIWVEEIDAVISPAGACGSSLLMSLSQIQCQ---IVTVTGNET  301

Query  202   VLNDTPERLGIEAVS-TRYL  146
             ++      LGI++   + YL
Sbjct  302   LITVPAASLGIKSTQVSSYL  321



>ref|WP_011433038.1| hypothetical protein [Synechococcus sp. JA-2-3B'a(2-13)]
 ref|YP_477653.1| hypothetical protein CYB_1423 [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD02390.1| conserved hypothetical protein [Synechococcus sp. JA-2-3B'a(2-13)]
Length=392

 Score =   267 bits (682),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 172/340 (51%), Positives = 214/340 (63%), Gaps = 28/340 (8%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +++PTGIGA IGG+AGDALPVAR  ++  + +ITHPNVLN A L+WPM NVLYVEGY LD
Sbjct  9     LLIPTGIGARIGGFAGDALPVARTLAAAAERVITHPNVLNGASLFWPMGNVLYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +F  G+W L PV QN VG+VLDAGI  DL+ RHLQV+ AA+A+LGL+   + +T  PL V
Sbjct  69    QFCAGVWNLRPVRQNCVGVVLDAGIPPDLQQRHLQVMQAAQATLGLNIGPWRLTRQPLGV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
                  P  G S G +  PD+LL   ++LV+     A+AVVARFP  DD D   Y QG G+
Sbjct  129   SVSFSPS-GASQGSLARPDALLETAQELVR-LGAEAIAVVARFP--DDLDFSQYEQGRGV  184

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D LAGVEA+ISHLVV+  +IPCAHAPA  P      V P++ +EE+G+TFLP VL GL  
Sbjct  185   DPLAGVEALISHLVVRELRIPCAHAPAFYPETFPKPVHPRAAAEEVGFTFLPSVLVGLSY  244

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANS------KRNR-------  236
             APQ+ +K  +      ++A  VDSVI P  A GG G L  A+        R R       
Sbjct  245   APQF-VKSGDPAQPGDLTAEQVDSVIAPATAFGGPGLLHLASRYGSAMLSRPRHNAPPLT  303

Query  235   ---------PLIIAVEENETVLNDTPERLGIEAVS-TRYL  146
                      PL IAVEEN TV+   P +LGI  VS T YL
Sbjct  304   RTDGVLTRPPLFIAVEENTTVMQVHPRQLGIPHVSVTSYL  343



>ref|XP_005707042.1| hypothetical protein Gasu_21940 [Galdieria sulphuraria]
 gb|EME30522.1| hypothetical protein Gasu_21940 [Galdieria sulphuraria]
Length=400

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 153/304 (50%), Positives = 202/304 (66%), Gaps = 4/304 (1%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +++PTG GA IGGYAGD LP ARAF+SVVD LI HPNVLN A++YWPM NVLYVEG+ +D
Sbjct  58    LVIPTGTGARIGGYAGDGLPTARAFASVVDRLIAHPNVLNGALMYWPMDNVLYVEGFGMD  117

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +F  G W L PV  NRVGLVLD+GIEE+L  RHLQ  DAARA+LG++  +Y +T+  L V
Sbjct  118   QFFSGKWGLRPVRWNRVGLVLDSGIEEELLYRHLQCADAARATLGIAVTDYALTEKALHV  177

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             E ++    G S+GRI+  + L+RA  KL++  + +A+A+V RFPDDDDE +  YR G G+
Sbjct  178   ETFITDD-GTSSGRIEGLELLVRASRKLIEERNCDAIALVTRFPDDDDELLHSYRHGYGV  236

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D++ G EA+IS  V +  Q+PCAHAPALSP  L  ++ PKS +EE+GYTFL  VL GL  
Sbjct  237   DIVGGAEALISRHVAQECQVPCAHAPALSPLPLDKTIHPKSAAEELGYTFLTSVLVGLSR  296

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             AP Y+    +   ++ I    +D+V+LP          A      +R  +  VEEN T  
Sbjct  297   APHYITSRQDSHAED-IWVDSLDAVVLPFGV--HQNTCAVEQLYHSRTALFYVEENSTEK  353

Query  196   NDTP  185
              D P
Sbjct  354   KDIP  357



>ref|WP_011140560.1| hypothetical protein [Gloeobacter violaceus]
 ref|NP_923503.1| hypothetical protein gll0557 [Gloeobacter violaceus PCC 7421]
 dbj|BAC88498.1| gll0557 [Gloeobacter violaceus PCC 7421]
Length=342

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 162/327 (50%), Positives = 221/327 (68%), Gaps = 9/327 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             ++VPTG+GAA+GG+AGDA+PVAR  + V DCLITHPNVLN A+L +P++N LYVEGY LD
Sbjct  8     LLVPTGVGAAVGGFAGDAIPVARLLAGVADCLITHPNVLNGALLSYPLTNALYVEGYGLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RF +G W L PVH+NRVG+VLDAG+      +HL  ++AAR +LG+  + +  T+ PL V
Sbjct  68    RFCKGEWRLRPVHRNRVGVVLDAGLSASQHQQHLHALEAARYTLGVDILGHCTTEGPLGV  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             E       G + G +++P  LL A ++L   +   A+AVV+R P   + D   YR G G+
Sbjct  128   E-ICGGAVGTAWGTLRHPQRLLAAAQRLAT-AGAEAIAVVSRCP---ESDDTAYRAGRGV  182

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D + GVEAVISHLVV+H Q+P AHAPA     L   V P+  +E +G TFLPCVLAGL  
Sbjct  183   DPVGGVEAVISHLVVRHLQLPAAHAPAFDYDPLPGPVHPRVAAEVLGPTFLPCVLAGLAR  242

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             AP++ + G  +L ++ ++A+ VD V+ P+D CGG G LA  +S  NRP+++AVEEN T L
Sbjct  243   APRF-VSGPGVLPQD-LAAAAVDVVVSPVDCCGGAGLLALMDST-NRPVLLAVEENTTRL  299

Query  196   NDTPERLGIEAVSTR-YLGNSFYLLYL  119
             N TPERLG++    R YL    +L+ L
Sbjct  300   NVTPERLGLKVRRVRSYLEACGWLVAL  326



>emb|CBN76959.1| conserved unknown protein [Ectocarpus siliculosus]
Length=410

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 163/327 (50%), Positives = 216/327 (66%), Gaps = 7/327 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             ++VPTGIGAAIGGYAGDALPVARA SSVVD L+THPNV+N AML WP + + YVEGYALD
Sbjct  20    LVVPTGIGAAIGGYAGDALPVARAVSSVVDTLVTHPNVMNGAMLSWPQAGIQYVEGYALD  79

Query  916   RFAEGLWALEPVHQ--NRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPL  743
              F  G W L PV +  +R+GLVLD  IE+DL++RH+Q  +AARA+LG++  EY VT+ P 
Sbjct  80    EFCAGRWGLLPVTKGGHRIGLVLDCAIEDDLQLRHVQAANAARATLGINVAEYCVTEKPA  139

Query  742   MVEKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedi-dDYRQG  566
              V   +    G S G ++  DSL+ A  +LV+ +   A+AVVARFPDD+DE+    YR+G
Sbjct  140   GVTLEMTTG-GASWGTVKGLDSLVDAGRRLVEEAGCTAIAVVARFPDDEDEEALQAYREG  198

Query  565   MGIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAG  386
              G+D + G EA+ISH++ +  ++PCAHAPAL P  +  SV P++ +EE+GYTFLPCVL+ 
Sbjct  199   QGVDAVGGAEAIISHVMSQKLKVPCAHAPALPPIDVDESVSPRACAEELGYTFLPCVLSN  258

Query  385   LGTAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENE  206
             L  AP  +           + A  VD+V+ P  A GG G L+ A       L+IAVE+N 
Sbjct  259   LHRAPSIITSREHPRAGEALWADAVDAVVAPASAFGGAGVLSLAEQATT--LLIAVEDNA  316

Query  205   TVLNDTPER-LGIEAVSTRYLGNSFYL  128
             TV+       LG  +VS R +  S YL
Sbjct  317   TVMKAGARALLGSSSVSDRCVTVSSYL  343



>ref|XP_005713541.1| unnamed protein product [Chondrus crispus]
 emb|CDF33722.1| unnamed protein product [Chondrus crispus]
Length=445

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 159/317 (50%), Positives = 210/317 (66%), Gaps = 10/317 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             + VPTGIGA+IGGYAGDALPV R  S++VD +ITHPNVLN A++YWP+ N LYVEG+ALD
Sbjct  93    LTVPTGIGASIGGYAGDALPVVRLISTIVDTVITHPNVLNGALMYWPLPNALYVEGFALD  152

Query  916   RFAEGLWAL--EPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPL  743
             +FA G +AL       NR+GLVLDA +  D  +RH Q  +AARA+LGL   +Y +TDLPL
Sbjct  153   QFAAGNYALYHSTNRSNRIGLVLDAAMHPDAILRHKQAAEAARATLGLQVTDYVITDLPL  212

Query  742   MVEKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdddd-edidDYRQG  566
              V K     CG S G+I NP+SLL A  +L+      A+AVV +FP+D+D   +  YR G
Sbjct  213   HV-KIESSDCGPSWGQISNPESLLAASARLI-ARGCQAIAVVTKFPEDEDPIQLAKYRAG  270

Query  565   MGIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAG  386
               +D +AG EAVISHLV +   +PCAHAPALSP  + +SV PK+ +EE+GYTFL CVL G
Sbjct  271   AAVDAIAGAEAVISHLVTRELHVPCAHAPALSPLNVDSSVSPKAAAEELGYTFLSCVLVG  330

Query  385   LGTAPQYLIKGTEILG---KNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVE  215
             L  AP+ +           K+ I A  VDS+++P  A GG   +  A++K    L+IAV 
Sbjct  331   LSKAPKLIPTARSDAQPDFKDIIFAEQVDSIVVPASAFGGSALMNLASAK--DALVIAVG  388

Query  214   ENETVLNDTPERLGIEA  164
             EN T ++ +   +GIE+
Sbjct  389   ENRTAISVSSRCVGIES  405



>ref|WP_036901027.1| hypothetical protein [Prochlorococcus sp. MIT 0601]
 gb|KGG13475.1| hypothetical protein EV05_0129 [Prochlorococcus sp. MIT 0601]
Length=355

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 165/319 (52%), Positives = 209/319 (66%), Gaps = 12/319 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +++PTGIG +IGGYAGDA+P AR  +S   CLITHPNV+N A LYW    + YVEGYA+D
Sbjct  5     LLIPTGIGCSIGGYAGDAIPYARLLASASGCLITHPNVMNGATLYWSDRRIQYVEGYAID  64

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G   L PV + ++GL+LD GIE+DLR RHLQVVDA + SLG+      +TD PL +
Sbjct  65    RFATGEVLLNPVRKQKLGLILDKGIEKDLRERHLQVVDACKTSLGIDIGPILITDNPLGI  124

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                     G S G I+NPDSLLRA +KL K     A+AVV RFP D D ED++ YR+G G
Sbjct  125   -SLTQGTSGSSWGGIENPDSLLRAGDKL-KSQGATAIAVVTRFPDDLDSEDLEAYRKGKG  182

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EA+ISHL+VKH  +PCAHAPAL+   L   V P+S +EE+G+TFLPCVL GL 
Sbjct  183   VDPLAGAEAIISHLLVKHLNLPCAHAPALNALPLENFVDPRSAAEELGHTFLPCVLVGLS  242

Query  379   TAPQYL-IKGTE----ILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVE  215
              AP  + I  T+     LG++ IS   V +VI P  A GG   LA    +RN PLI+   
Sbjct  243   RAPSLVEIDRTQGIDSCLGRDLISIDHVGAVIAPDGALGGAAVLACI--ERNIPLIVV--  298

Query  214   ENETVLNDTPERLGIEAVS  158
              N  VLN T   LG++ ++
Sbjct  299   SNRGVLNVTASSLGLDTLN  317



>ref|WP_011365126.1| hypothetical protein [Synechococcus sp. CC9605]
 ref|YP_382477.1| hypothetical protein Syncc9605_2183 [Synechococcus sp. CC9605]
 gb|ABB35922.1| conserved hypothetical protein [Synechococcus sp. CC9605]
Length=345

 Score =   254 bits (650),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 165/312 (53%), Positives = 206/312 (66%), Gaps = 14/312 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             M+VPTGIG  IGGYAGDALP AR  ++   CLITHPNV+N A LYW  S VLYVEGY LD
Sbjct  5     MLVPTGIGCDIGGYAGDALPSARLLAAASGCLITHPNVMNGASLYWRDSRVLYVEGYGLD  64

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G WAL PV + R+GL+LDAGI  +L  R +QVV+  RASLGL       TD PL V
Sbjct  65    RFAVGEWALRPVRKQRIGLLLDAGINPELAQRQIQVVEGCRASLGLEIGPVITTDAPLEV  124

Query  736   --EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQG  566
               E+      G S GR+  PD+LLRA ++L K +   A+AVVARFP+D + E++  YRQG
Sbjct  125   TLERGAS---GASWGRLGCPDALLRAGDRL-KQAGATAIAVVARFPEDPESEELAAYRQG  180

Query  565   MGIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAG  386
              G+D LAG EAVISHL+VKH QIPCAHAPAL P  L   + P++  EE+GYTFL CVL G
Sbjct  181   SGVDALAGAEAVISHLLVKHLQIPCAHAPALDPLPLDPQLDPRAAGEELGYTFLACVLVG  240

Query  385   LGTAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENE  206
             L  AP  L+ G    G   + AS + +V++P  A GG+  LA    +RN P++     N 
Sbjct  241   LSRAPD-LVSGDRQCGD--VDASQLGAVVVPEGALGGEAVLACV--ERNLPVVCVA--NP  293

Query  205   TVLNDTPERLGI  170
             +VL+ T + LG+
Sbjct  294   SVLSVTADALGL  305



>ref|WP_011620217.1| hypothetical protein [Synechococcus sp. CC9311]
 ref|YP_731505.1| hypothetical protein sync_2308 [Synechococcus sp. CC9311]
 gb|ABI45517.1| Uncharacterized membrane protein [Synechococcus sp. CC9311]
Length=352

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 160/310 (52%), Positives = 203/310 (65%), Gaps = 9/310 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             M++PTGIG AIGGYAGDALP AR  ++   CLITHPNV+N A LYW    + YVEGY LD
Sbjct  9     MLIPTGIGCAIGGYAGDALPSARLLAAASGCLITHPNVMNGASLYWKDPRIHYVEGYGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G WAL  V Q R+GL+LDAGIE +LR RHLQV D  RA+LG+       +D+PL V
Sbjct  69    RFATGDWALRSVRQQRIGLLLDAGIEPELRQRHLQVADGCRATLGIEIGPVVTSDVPLGV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                +  + G S G ++ PDSLLRA E+L K +  +A+AVVARFP D   E +D YR G G
Sbjct  129   HLGLG-QSGASWGTLERPDSLLRAGERL-KANGASAIAVVARFPDDQGSEALDAYRHGSG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+H QIPCAHAPALSP  L   + P++ +EE+GYTFL CVL GL 
Sbjct  187   VDALAGAEAVISHLLVRHLQIPCAHAPALSPLSLDLQLDPRAAAEELGYTFLACVLVGLS  246

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP  + +       + + A D+  +++P  A GG+  LA    +R  P+I  V  N +V
Sbjct  247   QAPALIQRAAA--NPSDLVADDLGVLVVPEGALGGEAVLACL--ERRVPVISVV--NPSV  300

Query  199   LNDTPERLGI  170
             L  T   LG+
Sbjct  301   LEVTSTALGV  310



>ref|WP_006171972.1| hypothetical protein [Synechococcus sp. WH 5701]
 gb|EAQ76168.1| hypothetical protein WH5701_15216 [Synechococcus sp. WH 5701]
Length=382

 Score =   253 bits (647),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 148/285 (52%), Positives = 188/285 (66%), Gaps = 10/285 (4%)
 Frame = -1

Query  1006  CLITHPNVLNAAMLYWPMSNVLYVEGYALDRFAEGLWALEPVHQNRVGLVLDAGIEEDLR  827
             CLITHPN LNAA LYW    + YVEG+AL+RFA G  AL PV   RVGL+LDAGIE++LR
Sbjct  39    CLITHPNALNAAALYWSDPRIHYVEGWALNRFAAGDLALAPVASQRVGLLLDAGIEQELR  98

Query  826   IRHLQVVDAARASLGLSFVEYTVTDLPLMVEKWVDPKCGQSTGRIQNPDSLLRAVEKLVK  647
             +RHLQV +A RASLGLS      TD+PL V   + P  G S+GRI  PD+L+RA E+L +
Sbjct  99    LRHLQVAEACRASLGLSIGPVLSTDVPLEVSLSLGPS-GVSSGRIGRPDALIRAGERL-R  156

Query  646   GSDVNAVAVVARFP-ddddedidDYRQGMGIDLLAGVEAVISHLVVKHFQIPCAHAPALS  470
              +   A+AVVARFP D   E +  YRQG G+D LAG EAVISHL+ +   +PCAHAPAL+
Sbjct  157   QAGATAIAVVARFPDDPGSEALASYRQGSGVDALAGAEAVISHLLSRQLGLPCAHAPALA  216

Query  469   PPQLSTSVCPKSVSEEIGYTFLPCVLAGLGTAPQYL----IKGTEILGKNCISASDVDSV  302
             P  L   + P + +EE+G+TFLPCVL GL  AP  +    + G E LG+  I  S + +V
Sbjct  217   PLSLDPRLDPLAAAEELGHTFLPCVLVGLSRAPDLIPLRPVSGPEPLGEAVIHPSRIGAV  276

Query  301   ILPIDACGGDGALAFANSKRNRPLIIAVEENETVLNDTPERLGIE  167
             + P  A GG+  LA A  +R  PL IAVE N ++L  +  RLG+ 
Sbjct  277   VAPAGALGGEAVLACA--ERGIPL-IAVEGNPSLLEVSAGRLGLS  318



>ref|WP_006854316.1| hypothetical protein [Synechococcus sp. WH 8016]
 gb|EHA60395.1| hypothetical protein Syn8016DRAFT_2182 [Synechococcus sp. WH 
8016]
Length=342

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 160/310 (52%), Positives = 196/310 (63%), Gaps = 9/310 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             M+VPTGIG AIGGYAGDALP AR  +S   CLITHPNV+N A LYW    + YVEGY LD
Sbjct  1     MVVPTGIGCAIGGYAGDALPSARLLASASGCLITHPNVMNGASLYWKDPRISYVEGYGLD  60

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G WAL PV Q R+GL+LDAGIE +LR RHLQV D  RA+LG+       +D+PL V
Sbjct  61    RFAVGDWALRPVRQQRIGLLLDAGIEPELRQRHLQVADGCRATLGIEIGPVVSSDVPLGV  120

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                +  + G S G ++ PDSLLRA E+L +     A+AVVARFP D   E +  YR G G
Sbjct  121   HMGLG-QSGASWGTLERPDSLLRAGERL-RAHGATAIAVVARFPDDQGSEALQAYRHGSG  178

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+H QIPCAHAPALS   L   + P++  EE+GYTFL CVL GL 
Sbjct  179   VDALAGAEAVISHLLVRHLQIPCAHAPALSALPLDEQLDPRAAGEELGYTFLACVLVGLS  238

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP  L +         + A D+  ++ P  A GG+  LA    +R  P+I     N +V
Sbjct  239   QAPDLLQRAAA--HSQDLVADDLGVLVAPEGALGGEAVLACL--ERRVPVISVA--NPSV  292

Query  199   LNDTPERLGI  170
             L  T   LG+
Sbjct  293   LQVTSTALGL  302



>ref|WP_028952763.1| hypothetical protein [Synechococcus sp. CC9616]
Length=351

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 158/310 (51%), Positives = 205/310 (66%), Gaps = 9/310 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             M+VPTGIG  IGGYAGDA+P AR  +S   CLITHPNV+N A LYW  + + YVEGYALD
Sbjct  10    MVVPTGIGCEIGGYAGDAIPSARLLASASGCLITHPNVMNGASLYWLDNRIHYVEGYALD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PV + R+GL+LDAGIE DL +RH Q+++A RASLGL       +D PL V
Sbjct  70    RFAAGDWQLRPVRRQRLGLLLDAGIEADLTLRHRQLMEACRASLGLDIGPVITSDAPLEV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                     G S GR+  PD+LLRA E L K +  +A+AVVARFP + D   +  YRQG G
Sbjct  130   TLETG-GSGASWGRLGRPDALLRAGECL-KRAGASAIAVVARFPDEVDTAALAAYRQGSG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+H Q+PCAHAPAL+P  L   V P++V+EE+G+TFL CVL GL 
Sbjct  188   VDGLAGAEAVISHLLVRHLQLPCAHAPALAPLPLDPQVDPRAVAEELGHTFLACVLVGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP  ++ G+     + + A  + +V++P  A GG+  LA    +R  P+I    EN +V
Sbjct  248   RAPDLVVDGS--CRPDDLMADQLGAVVVPQGALGGEAVLACL--ERQVPVITV--ENRSV  301

Query  199   LNDTPERLGI  170
             L+ T + L +
Sbjct  302   LSVTSDALAM  311



>gb|AHF64590.1| hypothetical protein Syncc8109_2264 [Synechococcus sp. WH 8109]
Length=350

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 159/310 (51%), Positives = 201/310 (65%), Gaps = 10/310 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             M+VPTGIG  IGGYAGDALP AR  ++   CLITHPNV+N A LYW  S VLYVEGY LD
Sbjct  10    MLVPTGIGCDIGGYAGDALPSARLLAAASGCLITHPNVMNGASLYWSDSRVLYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G WAL PV + R+GL+LDAGIE +L  R +QV +  RASLGL       TD PL V
Sbjct  70    RFAVGDWALRPVRRQRIGLLLDAGIEPELAQRQIQVAEGCRASLGLEIGPVITTDAPLEV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPd-dddedidDYRQGMG  560
                     G S GR+  PD+LLRA E+L K +   A++VVARFP+    E++  YRQG G
Sbjct  130   TLECG-ASGASWGRLGCPDALLRAGERL-KQAGATAISVVARFPEDSKSEELAAYRQGSG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+H QIPCAHAPAL P  L   + P++  EE+GYTFL CVL GL 
Sbjct  188   VDALAGAEAVISHLLVQHLQIPCAHAPALDPLPLDPQLDPRAAGEELGYTFLACVLVGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP  L+      G   + A+ + +V++P  A GG+  LA    +RN P++     N +V
Sbjct  248   RAPD-LVSAPRQPGD--LDAAQLGAVVVPEGALGGEAVLACV--ERNLPVVCVA--NPSV  300

Query  199   LNDTPERLGI  170
             L+ T + +G+
Sbjct  301   LSVTADAIGL  310



>gb|AII46051.1| hypothetical protein KR49_06245 [Synechococcus sp. KORDI-49]
Length=354

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 164/319 (51%), Positives = 206/319 (65%), Gaps = 14/319 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             M+VPTGIG AIGGYAGDALP AR  ++   CLITHPNVLN A LYW    + YVEGY LD
Sbjct  10    MLVPTGIGCAIGGYAGDALPSARLLAAASGCLITHPNVLNGASLYWSDPRIHYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PV + R+GL+LDAGIE +L  R +QV +A RA+LGL       TD+PL V
Sbjct  70    RFAAGEWLLRPVRRQRIGLLLDAGIEPELAQRQIQVAEACRATLGLDIGPVLSTDVPLGV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
                     G S G ++ PD+LLRA E+L + +   A+AVVARFP+D    ++  YRQG G
Sbjct  130   H-LEQGASGASWGSLERPDALLRAGERL-RDAGATAIAVVARFPEDPQSAELAAYRQGSG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+H QIPCAHAPAL P  L   + P++ +EE+GYTFL CVL GL 
Sbjct  188   VDALAGAEAVISHLLVRHLQIPCAHAPALGPLPLDPHLDPRAAAEELGYTFLACVLVGLS  247

Query  379   TAPQYLIKGTEILGKNC-----ISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVE  215
              AP  L+         C     ++A  + +V++P  A GG+  LA     RN P +IAV 
Sbjct  248   RAPD-LVTDRLTAAAGCRQADQVAADQLGAVVVPEGALGGEALLAAV--ARNVP-VIAV-  302

Query  214   ENETVLNDTPERLGI-EAV  161
              N +VL  TP+ LG+ EAV
Sbjct  303   ANPSVLAVTPQALGLAEAV  321



>ref|XP_010658567.1| PREDICTED: uncharacterized protein LOC100854116 isoform X1 [Vitis 
vinifera]
Length=163

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 138/188 (73%), Gaps = 25/188 (13%)
 Frame = -1

Query  970  MLYWPMSNVLYVEGYALDRFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARA  791
            MLYWP+ NVLYV GYALDRFAEGLWAL+PVHQNRVGLVLDA IE +LR+RHLQV DA RA
Sbjct  1    MLYWPVPNVLYVVGYALDRFAEGLWALQPVHQNRVGLVLDAAIEGELRLRHLQVADATRA  60

Query  790  SLGLSFVEYTVTDLPLMVEKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVAR  611
            SLGL  +EY VTD PL+VEKWVDPK GQSTGRI++PDSL RAV+ LV  +          
Sbjct  61   SLGLPVLEYIVTDTPLLVEKWVDPKSGQSTGRIKHPDSLPRAVQTLVNRTK---------  111

Query  610  FPddddedidDYRQGMGIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSV  431
                            GID LAGVEAVISHLVVK FQIPCAHAPALSP  LS S+CPKS 
Sbjct  112  ----------------GIDDLAGVEAVISHLVVKEFQIPCAHAPALSPFPLSLSLCPKSA  155

Query  430  SEEIGYTF  407
            ++E+   F
Sbjct  156  AKEVSNIF  163



>ref|WP_009790490.1| hypothetical protein [Synechococcus sp. BL107]
 gb|EAU72461.1| hypothetical protein BL107_16675 [Synechococcus sp. BL107]
Length=351

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 152/312 (49%), Positives = 199/312 (64%), Gaps = 9/312 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             M+VPTGIG  IGGYAGDALP AR  ++   CLITHPNV+N A LYW    + YVEGY LD
Sbjct  10    MVVPTGIGCEIGGYAGDALPSARLLAAASGCLITHPNVMNGAALYWSDPRIQYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G WAL PV + R+GL+LDAGIE +L  R +QV +A  ASLGL       +D PL V
Sbjct  70    RFAVGDWALRPVRRQRIGLLLDAGIEAELAQRQIQVAEACHASLGLDIGPVLRSDQPLGV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPd-dddedidDYRQGMG  560
                     G S G +++PD+LLRA E+L + +   A+AVVARFP+    + +  YRQG G
Sbjct  130   -SLARGASGASWGNLEHPDALLRAGERL-RDAGATAIAVVARFPEDLGSKALTSYRQGSG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+H Q+PCAHAPAL+P  L   + P++  EE+GYTFL CVL GL 
Sbjct  188   VDALAGAEAVISHLLVRHLQMPCAHAPALAPLPLDPQLDPRAAGEELGYTFLACVLVGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP  +     + G   + AS + + ++P  A GG+  LA    +R  P+I     N ++
Sbjct  248   RAPDLIDTSAALTGD--VQASQIGAAVVPEGALGGEALLACV--ERGIPVISVA--NPSL  301

Query  199   LNDTPERLGIEA  164
             L+ TP  LG+ +
Sbjct  302   LSVTPAVLGLSS  313



>ref|WP_007101644.1| hypothetical protein [Synechococcus sp. RS9917]
 gb|EAQ68451.1| hypothetical protein RS9917_08385 [Synechococcus sp. RS9917]
Length=354

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 141/282 (50%), Positives = 184/282 (65%), Gaps = 10/282 (4%)
 Frame = -1

Query  1006  CLITHPNVLNAAMLYWPMSNVLYVEGYALDRFAEGLWALEPVHQNRVGLVLDAGIEEDLR  827
             CL+THPNV+N A LYW    + YVEGYALDRFA G WAL+PV Q R+GL+LDAGIE +LR
Sbjct  40    CLVTHPNVMNGAALYWSDRRIHYVEGYALDRFAAGDWALQPVRQQRIGLLLDAGIEPELR  99

Query  826   IRHLQVVDAARASLGLSFVEYTVTDLPLMVEKWVDPKCGQSTGRIQNPDSLLRAVEKLVK  647
              RHLQV D  RA+LGL       TD PL V   +  + G S G +++PD+LLRA E+L K
Sbjct  100   QRHLQVADGCRATLGLEIGPVLSTDQPLGVHLELG-ESGVSWGTLEHPDALLRAGERL-K  157

Query  646   GSDVNAVAVVARFPdd-ddedidDYRQGMGIDLLAGVEAVISHLVVKHFQIPCAHAPALS  470
              +   A+AVVARFP+D + + +  YR G G+D LAG EAVISH +V+H QIPCAHAPALS
Sbjct  158   DAGATAIAVVARFPEDPESDALVAYRHGSGVDALAGAEAVISHALVRHLQIPCAHAPALS  217

Query  469   PPQLSTSVCPKSVSEEIGYTFLPCVLAGLGTAPQYLIKGTEILGKNC--ISASDVDSVIL  296
             P  L   + P++  EE+GYTFL CVL GL  AP  ++  T + G     + A+D+ +V++
Sbjct  218   PLPLDPQLDPRAAGEELGYTFLACVLVGLSRAPDLVVP-TGLAGARSLRLQAADLGAVVV  276

Query  295   PIDACGGDGALAFANSKRNRPLIIAVEENETVLNDTPERLGI  170
             P  A GG+  LA    +R  P+I     N ++L  T   LG+
Sbjct  277   PDGALGGEAVLACV--ERGIPVITVA--NASLLQVTAAALGL  314



>ref|WP_017324593.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=343

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 157/312 (50%), Positives = 202/312 (65%), Gaps = 6/312 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             ++VPTGIGAA+GG+AGDALPVAR+ ++ VD LI HPNVLN A L+WP++N LYVEG  +D
Sbjct  10    LLVPTGIGAAVGGFAGDALPVARSLAAAVDRLIAHPNVLNGASLFWPIANALYVEGLGID  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             R   G W L PV QNRVG+V DA IE DL  RH   + AARA+LGL+ V    T  PL V
Sbjct  70    RACAGEWNLRPVRQNRVGMVFDAAIEPDLLQRHHHAIQAARATLGLNIVVGVTTAEPLGV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMGI  557
             +    P  G S G +  P +LL   ++ ++     A+A+VARFP  DD D  DY +G+G+
Sbjct  130   QITEAPS-GASCGTLARPRALLDGAQRALQ-MGAEAIAIVARFP--DDLDFTDYSRGIGV  185

Query  556   DLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGT  377
             D LAGVEA++SHLVV+ F  PCAHAPAL      T+V P++ +EEIG+TFLP VLAGL  
Sbjct  186   DPLAGVEAILSHLVVREFGCPCAHAPALRLEDPPTAVHPRAAAEEIGFTFLPSVLAGLSY  245

Query  376   APQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVL  197
             APQ+ +   E+     ISA  +D  I P  A G    L  A  +R  PL +AV EN +V+
Sbjct  246   APQF-VPSAELPQLGDISAGAIDVAIAPATAFGSPALLHLAARERP-PLFVAVSENTSVM  303

Query  196   NDTPERLGIEAV  161
                P+ LGI A+
Sbjct  304   EVLPQDLGIAAI  315



>ref|WP_038553214.1| hypothetical protein [Synechococcus sp. KORDI-52]
 gb|AII48532.1| hypothetical protein KR52_05155 [Synechococcus sp. KORDI-52]
Length=350

 Score =   246 bits (627),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 160/312 (51%), Positives = 202/312 (65%), Gaps = 14/312 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             M+VPTGIG  IGGYAGDALP AR  ++   CLITHPNV+N A LYW  S V YVEGY LD
Sbjct  10    MLVPTGIGCDIGGYAGDALPSARLLAAASGCLITHPNVMNGASLYWSDSRVHYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G WAL PV + R+GL+LDAGIE +L  R +QV +  RASLGL       TD PL V
Sbjct  70    RFAMGEWALRPVRRQRIGLLLDAGIEPELAHRQIQVAEGCRASLGLDIGPVISTDAPLEV  129

Query  736   --EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQG  566
               E+      G S GR+  PD+LLRA E+L K +   A+AVVARFP+D + E++  YRQG
Sbjct  130   TLERGAS---GASWGRLGCPDALLRAGERL-KQAGATAIAVVARFPEDPESEELAAYRQG  185

Query  565   MGIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAG  386
              G+D LAG EAV+SHL+VKH Q PCAHAPAL P  L   +  ++  EE+GYTFL CV+ G
Sbjct  186   SGVDALAGAEAVVSHLLVKHLQTPCAHAPALDPLPLDPQLDSRAAGEELGYTFLACVMVG  245

Query  385   LGTAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENE  206
             L  AP  L+ G    G   + A  + +V++P  A GG+  LA    +RN P++     N 
Sbjct  246   LSRAPD-LVSGDRQPGD--VDAEQLGAVVVPEGALGGEAVLACV--ERNLPVVCVA--NP  298

Query  205   TVLNDTPERLGI  170
             +VL+ T + LG+
Sbjct  299   SVLSVTADALGL  310



>ref|WP_011359310.1| hypothetical protein [Synechococcus sp. CC9902]
 ref|YP_376505.1| hypothetical protein Syncc9902_0493 [Synechococcus sp. CC9902]
 gb|ABB25461.1| conserved hypothetical protein [Synechococcus sp. CC9902]
Length=351

 Score =   245 bits (626),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 157/312 (50%), Positives = 203/312 (65%), Gaps = 9/312 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             M+VPTGIG  IGGYAGDALP AR  ++   CLITHPNV+N A LYW    + YVEGY LD
Sbjct  10    MVVPTGIGCEIGGYAGDALPSARLLAAASGCLITHPNVMNGAALYWSDPRIHYVEGYGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G WAL PV + R+GL+LDAGIE +L  R +QV +A RA+LGL       +D  L V
Sbjct  70    RFAAGDWALRPVRRQRIGLLLDAGIEAELAQRQIQVAEACRATLGLDIGPVLRSDQSLGV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
                  P  G S G ++ PD+LLRA E+L + +   A+AVVARFP+D   + +  YRQG G
Sbjct  130   SLDRGPS-GASWGSLERPDALLRAGERL-RDAGATAIAVVARFPEDPGSDALTSYRQGSG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+  QIPCAHAPAL+P  L   + P++ +EE+GYTFL CVL GL 
Sbjct  188   VDALAGAEAVISHLLVRQLQIPCAHAPALAPLPLDPHLDPRAAAEELGYTFLACVLVGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP  LI  T  L  + + AS + + ++P  A GG+  LA    +R  P+I     N ++
Sbjct  248   RAPD-LIDTTAALTGD-VHASQIGAAVVPEGALGGEAVLACV--ERGIPVISVA--NPSL  301

Query  199   LNDTPERLGIEA  164
             L+ TPE LG+ +
Sbjct  302   LSVTPEVLGLSS  313



>ref|WP_007098839.1| hypothetical protein [Synechococcus sp. RS9916]
 gb|EAU74740.1| hypothetical protein RS9916_34572 [Synechococcus sp. RS9916]
Length=359

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 154/322 (48%), Positives = 204/322 (63%), Gaps = 8/322 (2%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
              +VPTGIG  +GG+AGDALP AR  ++   CLITHPNV+N A LYW    + YVEGYALD
Sbjct  15    FLVPTGIGCDVGGFAGDALPSARLLAAASGCLITHPNVMNGASLYWSDPRIHYVEGYALD  74

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PV + R+GL+LDAGIE +LR RHLQV D  RASLGL       TD PL V
Sbjct  75    RFAVGDWMLRPVRRQRIGLLLDAGIEPELRQRHLQVADGCRASLGLEIGPVVTTDAPLGV  134

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
                +    G S G ++ PD+LLRA E+L K +   A+AVVARFP+D D E ++ YR G G
Sbjct  135   HLELG-DSGISWGTLERPDALLRAGERL-KAAGATAIAVVARFPEDPDSEALEAYRHGSG  192

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+H Q+PCAHAPAL+P  L   + P++  EE+GYTFL CVL GL 
Sbjct  193   VDALAGAEAVISHLLVRHLQLPCAHAPALAPLPLDPQLDPRAAGEELGYTFLSCVLVGLS  252

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP  L++   +   + +    + +V++P  A G +  LA    +R+ P+I     N ++
Sbjct  253   RAPD-LLRADALQSSHLLHPDQLGAVVVPDGALGSEALLACM--ERSVPVITVA--NPSL  307

Query  199   LNDTPERLGIEAVSTRYLGNSF  134
             L  T + L ++        +S+
Sbjct  308   LQVTAQALDLDRTCPLLAASSY  329



>ref|WP_006043310.1| hypothetical protein [Synechococcus sp. WH 7805]
 gb|EAR19755.1| hypothetical protein WH7805_12583 [Synechococcus sp. WH 7805]
Length=352

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 160/311 (51%), Positives = 202/311 (65%), Gaps = 9/311 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MIVPTGIG  IGGYAGDALP AR  ++   CL+THPNV+N A LYW    +LYVEG+ LD
Sbjct  9     MIVPTGIGCEIGGYAGDALPAARVLAAACGCLVTHPNVMNGAALYWSDDRILYVEGWGLD  68

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G  AL    + RVGL+LDA IE  LR RHLQV DA RA+LGL       TD+ L V
Sbjct  69    RFAAGELALRGGRRQRVGLLLDAAIEPSLRDRHLQVADACRATLGLDVGPVITTDVALGV  128

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                   + G S G ++ PD+LLRA EKL  G   +A+AVVARFP D   E +  YR G G
Sbjct  129   -TLRQGESGVSWGSLERPDALLRAGEKLRDGG-ASAIAVVARFPDDSGSEALQAYRHGSG  186

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D+LAG EAVISHL+V+H QIPCAHAPAL+P  L   + P++ +EE+ +TFLPCVL GL 
Sbjct  187   VDVLAGAEAVISHLLVRHLQIPCAHAPALAPLPLDPQLDPRAAAEELAHTFLPCVLVGLS  246

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP  +   +   G   + AS + +V++P  A GG+  LA    +RN P +IAV  N +V
Sbjct  247   RAPDLIQPASAEPGD--LLASRLGAVVVPEGALGGEAVLACL--ERNVP-VIAV-TNPSV  300

Query  199   LNDTPERLGIE  167
             L  + + LG+E
Sbjct  301   LQVSSQSLGLE  311



>ref|WP_023172333.1| hypothetical protein [Gloeobacter kilaueensis]
 ref|YP_008710973.1| hypothetical protein GKIL_1020 [Gloeobacter kilaueensis JS1]
 gb|AGY57266.1| hypothetical protein GKIL_1020 [Gloeobacter kilaueensis JS1]
Length=348

 Score =   243 bits (620),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 153/328 (47%), Positives = 215/328 (66%), Gaps = 11/328 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             ++VPTG+GAAIGGYAGDA+PVAR  + V D L+THPNVLN A+L WP+ N LYVEGYALD
Sbjct  8     LLVPTGVGAAIGGYAGDAIPVARLLAGVADRLVTHPNVLNGALLSWPLPNALYVEGYALD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             R+  G WAL PVH+NRVG++LDA + +  R++HLQ ++AAR +LG+  + +  ++  L +
Sbjct  68    RWCRGEWALRPVHRNRVGVLLDAALSDSQRLQHLQAIEAARFTLGVDILGHCTSEGALGI  127

Query  736   EKWVDP-KCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPddddedidDYRQGMG  560
                V P   G + G I +PD LLRA E+LV  +  +A+A+V+R P   + D   Y  G G
Sbjct  128   --LVHPGSTGTAWGTIAHPDRLLRAAERLVA-AGADAIAIVSRCP---EVDDSAYLGGRG  181

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D + GVEA++SHLVV+H   P AHAPA         V P+  +E +G TFLPCVLAGL 
Sbjct  182   VDPIGGVEALVSHLVVRHLGRPAAHAPAFDYAAEPQPVHPRVAAEALGPTFLPCVLAGLS  241

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
             TAP+Y+    +    + +  + VD+++ P+   GG G LA   ++   P+++AVEEN   
Sbjct  242   TAPRYVR--ADAAHPSDLLPTQVDAIVAPVGCSGGPGLLAL-MAQTTPPVLLAVEENLCR  298

Query  199   LNDTPERLGIEAVSTR-YLGNSFYLLYL  119
             L+ TPERLG++A   R YL    +L+ L
Sbjct  299   LDVTPERLGLKARRVRSYLEACGWLVAL  326



>ref|WP_011130831.1| hypothetical protein [Prochlorococcus marinus]
 ref|NP_895290.1| hypothetical protein PMT1463 [Prochlorococcus marinus str. MIT 
9313]
 emb|CAE21638.1| conserved hypothetical protein [Prochlorococcus marinus str. 
MIT 9313]
Length=375

 Score =   243 bits (619),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 158/319 (50%), Positives = 200/319 (63%), Gaps = 10/319 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             ++VPTGIG  IGGYAGDALP AR  ++   CLITHPNV+N A LYW    + YVEGY+LD
Sbjct  21    LVVPTGIGCEIGGYAGDALPSARLLAAASGCLITHPNVINGAALYWSDPRIQYVEGYSLD  80

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G   L PV Q R+GL+LDAGIE +LR R  QV +  RASLGL+      TD+PL V
Sbjct  81    RFAAGELGLRPVRQQRIGLLLDAGIEPELRQRQWQVAEGCRASLGLNLGPVVTTDVPLEV  140

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
              +  +   G S G +  PD+LLRA E+L + +  +A+AVVARFP+D   E +  YRQG G
Sbjct  141   -RLREGSSGASWGELGQPDALLRAGEQL-RDAGASAIAVVARFPEDPQSEALRAYRQGSG  198

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+   +PCAHAPALSP      + P++  EE+GYTFL CVL GL 
Sbjct  199   VDALAGAEAVISHLLVRELGLPCAHAPALSPLPCDPLLDPRAAGEELGYTFLACVLVGLS  258

Query  379   TAPQYL---IKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEEN  209
              AP  +   I+     G   + A  + +V+ P  A GG+  LA    +R  PLI     N
Sbjct  259   RAPDLVPLTIEEALPAGAELLHAEQLGAVVAPEGALGGEAVLACL--ERGVPLITVT--N  314

Query  208   ETVLNDTPERLGIEAVSTR  152
              +VL  TPE LGI +   R
Sbjct  315   PSVLKVTPEALGITSGVQR  333



>ref|WP_011825162.1| hypothetical protein [Prochlorococcus marinus]
 ref|YP_001016504.1| hypothetical protein P9303_04871 [Prochlorococcus marinus str. 
MIT 9303]
 gb|ABM77239.1| conserved hypothetical protein [Prochlorococcus marinus str. 
MIT 9303]
Length=375

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 198/319 (62%), Gaps = 10/319 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             ++VPTGIG  IGGYAGDALP AR  ++   CLITHPNV+N A LYW    + YVEGY+LD
Sbjct  21    LVVPTGIGCEIGGYAGDALPSARLLAAASGCLITHPNVINGAALYWSDPRIQYVEGYSLD  80

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G   L PV Q R+GL+LDAGIE +LR R  QV +  RASLGL+      TD+PL V
Sbjct  81    RFAAGELGLRPVRQQRIGLLLDAGIEPELRQRQWQVAEGCRASLGLNLGPVVTTDVPLEV  140

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPd-dddedidDYRQGMG  560
              +  +   G S G +  PD+LLRA E+L + +  +A+AVVARFP+    E +  YRQG G
Sbjct  141   -RLCEGSSGASWGELGQPDALLRAGEQL-RDAGASAIAVVARFPEDPQSEALRAYRQGSG  198

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+   +PCAHAPALSP      + P++  EE+GYTFL CVL GL 
Sbjct  199   VDALAGAEAVISHLLVRELGLPCAHAPALSPLPCDPLLDPRAAGEELGYTFLACVLVGLS  258

Query  379   TAPQYLIKGTE---ILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEEN  209
              AP  +   TE     G   + A  + +V+ P  A GG+  LA    +R  PLI     N
Sbjct  259   RAPDLVPLTTEDPLPAGAELLHAEQLGAVVAPEGALGGEAVLACL--ERGVPLITVT--N  314

Query  208   ETVLNDTPERLGIEAVSTR  152
              +VL  TPE L I +   R
Sbjct  315   PSVLKVTPEALAITSGVQR  333



>ref|WP_036905544.1| hypothetical protein [Prochlorococcus marinus]
 gb|KGG20963.1| hypothetical protein EV03_0900 [Prochlorococcus marinus str. 
PAC1]
Length=370

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 155/331 (47%), Positives = 205/331 (62%), Gaps = 16/331 (5%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIG  +GGYAGDA+P AR  +S   CLITHPNV+N   LYWP + + YVEGY+L+
Sbjct  11    LIIPTGIGCNVGGYAGDAIPAARLLASASGCLITHPNVMNGGSLYWPDNCIQYVEGYSLN  70

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
              FA G   L+PV Q +VGL+LDAG+E DL+ RHLQV D   ASLGL      +T+  L +
Sbjct  71    LFASGEVFLKPVRQQKVGLLLDAGLESDLKKRHLQVADGCVASLGLDIGPVMITEKALQI  130

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                     G S G I+ PD LLRA +KL K +   A+AVV RFP + D+ +   YRQG G
Sbjct  131   -NLKKGMSGSSWGNIEEPDVLLRAADKL-KQAGATAIAVVTRFPDESDELETKLYRQGHG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D++AGVEAVISH +VKH  IPCAHAP LSP  +   + P++  EEIGYTFL  VL GL 
Sbjct  189   VDIIAGVEAVISHFLVKHLLIPCAHAPGLSPLPIDYDLDPRTSGEEIGYTFLQSVLVGLS  248

Query  379   TAPQYLIKGTEILGK--------NCISASDVDSVILPIDACGGDGALAFANSKRNRPLII  224
              AP  LI  +EI  K          +S  D+ +V++P  A GG+  L+    +R  PLII
Sbjct  249   RAPD-LIYKSEIKAKENTLFQVNTLLSNRDLGAVVVPQGALGGEAVLSCI--ERFIPLII  305

Query  223   AVEENETVLNDTPERLGIEAVSTRYLGNSFY  131
                 N+ VLN +  ++ ++++S     N  Y
Sbjct  306   V--SNQGVLNVSSTKMRLDSLSGNRDKNILY  334



>ref|WP_038546488.1| hypothetical protein [Synechococcus sp. KORDI-100]
 gb|AII44368.1| hypothetical protein KR100_13525 [Synechococcus sp. KORDI-100]
Length=351

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 197/310 (64%), Gaps = 9/310 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             M+VPTGIG  IGGYAGDA+P AR  +S   CLITHPNV+N A LYW    + YVEG+ LD
Sbjct  10    MVVPTGIGCEIGGYAGDAIPSARLLASASGCLITHPNVMNGASLYWVDPRIHYVEGFGLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L PV + R+GL+LDAGIE +L  R +QV +  RASLGL       +D PL V
Sbjct  70    RFASGDWHLRPVRRQRIGLLLDAGIEAELAQRQIQVAEGCRASLGLDIGPVITSDAPLEV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                   + G S G +  PD+LLRA E L K +   A+AVVARFP D D E +  YRQG G
Sbjct  130   -SLERGESGVSWGCLGRPDALLRAGESL-KQAGATAIAVVARFPDDVDSEQLAAYRQGSG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+H QIPCAHAPAL+P  L   + P++  EE+GYTFL CVL GL 
Sbjct  188   VDALAGAEAVISHLLVRHLQIPCAHAPALAPLPLDPQLDPRAAGEELGYTFLACVLVGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP  +  G    G   ++A  + ++++P  A GG+  LA    +R  PLI    +N +V
Sbjct  248   RAPGLVSTGACRPGD--LTADQIGAIVVPQGALGGEAVLACL--ERQVPLITV--DNPSV  301

Query  199   LNDTPERLGI  170
             L+ T + L +
Sbjct  302   LSVTSDALAL  311



>ref|WP_011295324.1| hypothetical protein [Prochlorococcus marinus]
 ref|YP_292171.1| hypothetical protein PMN2A_0978 [Prochlorococcus marinus str. 
NATL2A]
 gb|AAZ58468.1| uncharacterized membrane protein [Prochlorococcus marinus str. 
NATL2A]
Length=370

 Score =   237 bits (605),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 151/330 (46%), Positives = 203/330 (62%), Gaps = 14/330 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIG  +GGYAGDA+P AR  +S   CLITHPNV+N   LYWP + + YVEGY+L+
Sbjct  11    LIIPTGIGCNVGGYAGDAIPAARLLASASGCLITHPNVMNGGSLYWPDNCIQYVEGYSLN  70

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
              FA G   L+PV Q +VGL+LDAG+E DL+ RHLQV D   ASLGL       T+  + +
Sbjct  71    LFASGEVFLKPVRQQKVGLLLDAGLESDLKKRHLQVADGCVASLGLDIGPVMTTEKAIQI  130

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                     G S G I+ PD LLRA EKL K +   A+AVV RFP + D+ +   YRQG G
Sbjct  131   -NLKKGMSGSSWGNIEEPDVLLRAAEKL-KQAGATAIAVVTRFPDESDELETKLYRQGHG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D++AGVEAVISH +VKH  IPCAHAP L+P  +   + P++  EEIGYTFL  VL GL 
Sbjct  189   VDIIAGVEAVISHFLVKHLLIPCAHAPGLAPLPIDYDLDPRTSGEEIGYTFLQSVLVGLS  248

Query  379   TAPQYLIKGTEILGKNC-------ISASDVDSVILPIDACGGDGALAFANSKRNRPLIIA  221
              AP  + K    + +N        +S  D+ +V++P  A GG+  L+    +R  PLII 
Sbjct  249   RAPDLIYKSEMKVKENTLFQVNTFLSNRDLGAVVVPQGALGGEAVLSCI--ERFIPLIIV  306

Query  220   VEENETVLNDTPERLGIEAVSTRYLGNSFY  131
                N+ VLN +  ++ ++++S     N  Y
Sbjct  307   --SNQGVLNVSSTKMRLDSLSGNRDKNILY  334



>ref|WP_038654090.1| hypothetical protein [Prochlorococcus sp. MIT 0801]
 gb|AIQ97990.1| hypothetical protein EW15_1898 [Prochlorococcus sp. MIT 0801]
Length=370

 Score =   235 bits (600),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 200/330 (61%), Gaps = 14/330 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             MI+P GIG  +GGYAGDA+P AR  +S  DCLITHPNVLN   LYW  + + YVEGY+L+
Sbjct  11    MIIPAGIGCNVGGYAGDAIPAARLLASASDCLITHPNVLNGGSLYWSDTCIHYVEGYSLN  70

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
              FA G   L+PV Q +VGL+LDAG+E DL+ RHLQV D   ASLGL       T+  + +
Sbjct  71    LFAAGEVFLKPVRQQKVGLLLDAGLESDLKKRHLQVADGCVASLGLDIGPVITTERAVRI  130

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                     G S G I+ PD LLR  EKL K +   A+AV+ RFP D ++ +   YRQG G
Sbjct  131   -NLKKGLSGSSWGNIEEPDVLLRGAEKL-KKAGATAIAVITRFPDDSEELETKLYRQGKG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D++AGVEAVISHL+VKH  IPCAHAP L P  +   + P++  EEIGYTFL  VL GL 
Sbjct  189   VDIIAGVEAVISHLLVKHLLIPCAHAPGLPPLPIDYDLDPRTSGEEIGYTFLQSVLVGLS  248

Query  379   TAPQYLIK-------GTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIA  221
              AP  + K        T +  K  +S  D+ +V++P  A GG+  L+    +R  PLII 
Sbjct  249   RAPDLICKSSMKTKENTFLQLKTLLSNRDLGAVVVPQGALGGEAVLSCI--ERFIPLIIV  306

Query  220   VEENETVLNDTPERLGIEAVSTRYLGNSFY  131
                N+ VLN    ++ +++VS     N  Y
Sbjct  307   --SNQGVLNVNSTKMRLDSVSGDKHKNILY  334



>ref|WP_011127370.1| hypothetical protein [Synechococcus sp. WH 8102]
 ref|NP_896594.1| hypothetical protein SYNW0499 [Synechococcus sp. WH 8102]
 emb|CAE07014.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
Length=348

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 157/311 (50%), Positives = 201/311 (65%), Gaps = 12/311 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             M+VPTGIG  IGG+AGDALP AR  ++   CLITHPNV+N A LYW    + YVEGY+LD
Sbjct  10    MLVPTGIGCQIGGFAGDALPSARLLAAASGCLITHPNVMNGAALYWRDPRIHYVEGYSLD  69

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G W L+PV + R+GL+LDAGIE +L  RHLQV +  RA+LGL       TD PL V
Sbjct  70    RFAVGEWDLQPVRRQRIGLLLDAGIEAELAQRHLQVAEGCRATLGLEIGPVVTTDQPLEV  129

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
              +      G S GR+  PD+LLRA E+L K +   A+AVVARFP+D   E++ +YR G G
Sbjct  130   -QLEQGSSGSSWGRLGRPDALLRAGERL-KQAGATAIAVVARFPEDPASEELAEYRAGSG  187

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+H QIPCAHAPAL+P  L   + P++  EE+GYTFL CVL GL 
Sbjct  188   VDALAGAEAVISHLLVRHLQIPCAHAPALAPLALDPQLDPRAAGEELGYTFLACVLVGLS  247

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP  L       G+  + A+ + +V+ P    GG+  LA    +R  PLI     N +V
Sbjct  248   QAPDLLPA-----GEGALQAAQLGAVVAPEGGLGGEAVLACL--ERGVPLITVT--NPSV  298

Query  199   LNDTPERLGIE  167
             L  + E LG++
Sbjct  299   LTVSAEALGLD  309



>gb|KGG10860.1| hypothetical protein EV04_1822 [Prochlorococcus marinus str. 
LG]
Length=356

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 148/319 (46%), Positives = 201/319 (63%), Gaps = 12/319 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             M++P+GIG  +GGYAGDA+P AR  ++   CLITHPNV+N A LYW   ++ YVEG+++D
Sbjct  1     MLIPSGIGCQVGGYAGDAIPFARLLAASSGCLITHPNVMNGASLYWHDESIQYVEGFSVD  60

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             +FA G   L PV   R+G++LDAG+  +LR RHL V+DA RA+LGL       TD PL +
Sbjct  61    QFACGDIVLRPVRNQRIGVLLDAGLGSELRKRHLDVIDACRATLGLDIGPVETTDSPLKI  120

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                +    G S G++  P  LLRA E+L K     A+AVV RFP D D E++  YRQG G
Sbjct  121   TLEIS-SSGASWGKLSTPTPLLRAGERL-KKEGATAIAVVTRFPDDLDSEELGAYRQGHG  178

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D++AG EAVISHL+V+H  +PCAHAPALSP  ++  + P++  EE+GYTFLPCVL GL 
Sbjct  179   VDVIAGAEAVISHLLVRHLCLPCAHAPALSPLPIAEDLDPRAAGEELGYTFLPCVLVGLS  238

Query  379   TAPQYLIKGT-----EILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVE  215
              AP  + + T      +   N IS  D+ +V+ PI A GG+  L     ++  PLI    
Sbjct  239   HAPDLIPRDTLKTLSNLTKPNFISIEDLGAVVAPIGALGGEAVLGCI--EKGIPLIAV--  294

Query  214   ENETVLNDTPERLGIEAVS  158
              N  VL    + LG++A S
Sbjct  295   SNPGVLKVDLDSLGLKADS  313



>ref|WP_011824388.1| hypothetical protein [Prochlorococcus marinus]
 ref|YP_001015666.1| hypothetical protein NATL1_18461 [Prochlorococcus marinus str. 
NATL1A]
 gb|ABM76402.1| conserved hypothetical protein [Prochlorococcus marinus str. 
NATL1A]
Length=370

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 150/330 (45%), Positives = 201/330 (61%), Gaps = 14/330 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +I+PTGIG  +GGYAGDA+P AR  +S   CLITHPNV+N   LYWP + + YVEGY+L+
Sbjct  11    LIIPTGIGCNVGGYAGDAIPAARLLASASGCLITHPNVMNGGSLYWPDNCIQYVEGYSLN  70

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
              FA G   L+PV Q +VGL+LDAG+E DL+ RHLQV D   ASLGL       T+  + +
Sbjct  71    LFASGEVFLKPVRQQKVGLLLDAGLESDLKKRHLQVADGCIASLGLDIGPVMTTEKAIQI  130

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                     G S G I+ PD LLRA EKL K +   A+AVV RFP + D+ +   YRQG G
Sbjct  131   -NLKKGLSGSSWGNIEEPDVLLRAAEKL-KQAGATAIAVVTRFPDESDELETKLYRQGHG  188

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D++AGVEAVISH +VK   IPCAHAP L+P  +   + P++  EEIGYTFL  VL GL 
Sbjct  189   VDIIAGVEAVISHFLVKKLLIPCAHAPGLAPLPIDYDLDPRTSGEEIGYTFLQSVLVGLS  248

Query  379   TAPQYLIKGTEILGKNC-------ISASDVDSVILPIDACGGDGALAFANSKRNRPLIIA  221
              AP  + K      +N        +S  D+ +V++P  A GG+  L+    +R  PLII 
Sbjct  249   RAPDLIYKSEMKAKENTMFQVNTLLSNRDLGAVVVPQGALGGEAVLSCI--ERFIPLIIV  306

Query  220   VEENETVLNDTPERLGIEAVSTRYLGNSFY  131
                N+ VLN +  ++ ++++S     N  Y
Sbjct  307   --SNQGVLNVSSTKMRLDSLSGNRDKNILY  334



>ref|WP_036911410.1| MULTISPECIES: hypothetical protein [Prochlorococcus]
 gb|KGG28696.1| hypothetical protein EV12_0591 [Prochlorococcus sp. MIT 0701]
Length=355

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 159/319 (50%), Positives = 197/319 (62%), Gaps = 10/319 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             M+VPTGIG  IGGYAGDALP AR  ++   CLITHPNV+N A LYW    + YVEGY+LD
Sbjct  1     MVVPTGIGCEIGGYAGDALPSARLLAAASGCLITHPNVINGATLYWSDPRIQYVEGYSLD  60

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G   L PV Q R+GL+LDAGIE +LR R  QV +  RASLGL+      TD+PL V
Sbjct  61    RFAAGELGLRPVRQQRIGLLLDAGIEPELRQRQWQVAEGCRASLGLNLGPVVTTDVPLEV  120

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
              +      G S G +  PD+LLRA E L + +  +A+AVVARFP+D   E +  YRQG G
Sbjct  121   -RLCQGSSGASWGELGQPDALLRAGEHL-RDAGASAIAVVARFPEDPQSEALRAYRQGSG  178

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+   +PCAHAPAL P      + P++  EE+GYTFL CVL GL 
Sbjct  179   VDALAGAEAVISHLLVRELCLPCAHAPALPPLPCDPLLDPRAAGEELGYTFLACVLVGLS  238

Query  379   TAPQYLIKGTEI---LGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEEN  209
              AP  +   TE     G   + A  + +V+ P  A GG+  LA    +R  PLI     N
Sbjct  239   RAPDLVPLTTEEALPAGAELLHAEQLGAVVAPEGALGGEAVLACL--ERGVPLITVA--N  294

Query  208   ETVLNDTPERLGIEAVSTR  152
              +VL  TPE LGI +   R
Sbjct  295   PSVLKVTPEALGITSGVQR  313



>ref|WP_019480249.1| hypothetical protein [Prochlorococcus sp. W11]
Length=349

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 139/302 (46%), Positives = 201/302 (67%), Gaps = 8/302 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +++PTGIG  IGG+AG+ALPVA+  +S   CL+THPNV+N   L      + YVEGY+LD
Sbjct  8     LVIPTGIGCQIGGFAGEALPVAKLLASASGCLVTHPNVMNGGTLAEKDERIFYVEGYSLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA     L+ V+Q ++G++ D  IE ++ +RHLQV DA  A+LG++   Y +T+ P+ +
Sbjct  68    RFARAEIGLKKVNQQKIGIIFDKNIENEILLRHLQVADACIATLGINIASYVITEEPVGI  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                 D   G S+G + NP++L++A + L+    + A+A+V RFP + D ED++ YR+G G
Sbjct  128   -VLSDELSGFSSGYVSNPETLIKAGKSLIN-QGITAIAIVTRFPDEIDFEDLNLYREGKG  185

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             ID++AGVEAVISHL+ K+ +IPCAHAPAL+P  L  ++ P++ +EEIGYTFLP VL GL 
Sbjct  186   IDVIAGVEAVISHLISKYLKIPCAHAPALTPIDLKPNLDPRAAAEEIGYTFLPSVLIGLS  245

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
             TAP  LI       K  +S  +++S+++P  A GG+  LA      N   IIAV +NE V
Sbjct  246   TAPD-LIDLPNFNSKVTVSPYEIESIVVPSGALGGEAVLACMERNLN---IIAV-KNEGV  300

Query  199   LN  194
             LN
Sbjct  301   LN  302



>ref|WP_036892609.1| MULTISPECIES: hypothetical protein [Prochlorococcus]
Length=365

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/301 (45%), Positives = 185/301 (61%), Gaps = 12/301 (4%)
 Frame = -1

Query  1042  LPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALDRFAEGLWALEPVHQNRVG  863
             +P AR  ++   CLITHPNV+N A LYW   ++ YVEG+++D+FA G   L PV   R+G
Sbjct  28    IPFARLLAASSGCLITHPNVMNGASLYWHDESIQYVEGFSVDQFACGDIVLRPVRNQRIG  87

Query  862   LVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMVEKWVDPKCGQSTGRIQNP  683
             ++LDAG+  +LR RHL V+DA RA+LGL       TD PL +   +    G S G++  P
Sbjct  88    VLLDAGLGSELRKRHLDVIDACRATLGLDIGPVETTDSPLKITLEIS-SSGASWGKLSTP  146

Query  682   DSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMGIDLLAGVEAVISHLVVKH  506
               LLRA E+L K     A+AVV RFP D D E++  YRQG G+D++AG EAVISHL+V+H
Sbjct  147   TPLLRAGERL-KKEGATAIAVVTRFPDDLDSEELGAYRQGHGVDVIAGAEAVISHLLVRH  205

Query  505   FQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGTAPQYLIKGT-----EIL  341
               +PCAHAPALSP  ++  + P++  EE+GYTFLPCVL GL  AP  + + T      + 
Sbjct  206   LCLPCAHAPALSPLPIAEDLDPRAAGEELGYTFLPCVLVGLSHAPDLIPRDTLKTLSNLT  265

Query  340   GKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVLNDTPERLGIEAV  161
               N IS  D+ +V+ PI A GG+  L     ++  PLI     N  VL    + LG++A 
Sbjct  266   KPNFISIEDLGAVVAPIGALGGEAVLGCI--EKGIPLIAV--SNPGVLKVDLDSLGLKAD  321

Query  160   S  158
             S
Sbjct  322   S  322



>ref|WP_011125751.1| hypothetical protein [Prochlorococcus marinus]
 ref|NP_875992.1| Uncharacterized membrane protein [Prochlorococcus marinus subsp. 
marinus str. CCMP1375]
 gb|AAQ00645.1| Uncharacterized membrane protein [Prochlorococcus marinus subsp. 
marinus str. CCMP1375]
 gb|KGG20440.1| hypothetical protein EV08_1024 [Prochlorococcus marinus str. 
SS2]
 gb|KGG24109.1| hypothetical protein EV09_0714 [Prochlorococcus marinus str. 
SS35]
 gb|KGG31634.1| hypothetical protein EV10_1729 [Prochlorococcus marinus str. 
SS51]
 gb|KGG34700.1| hypothetical protein EV11_1831 [Prochlorococcus sp. SS52]
Length=366

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/301 (45%), Positives = 185/301 (61%), Gaps = 12/301 (4%)
 Frame = -1

Query  1042  LPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALDRFAEGLWALEPVHQNRVG  863
             +P AR  ++   CLITHPNV+N A LYW   ++ YVEG+++D+FA G   L PV   R+G
Sbjct  29    IPFARLLAASSGCLITHPNVMNGASLYWHDESIQYVEGFSVDQFACGDIVLRPVRNQRIG  88

Query  862   LVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMVEKWVDPKCGQSTGRIQNP  683
             ++LDAG+  +LR RHL V+DA RA+LGL       TD PL +   +    G S G++  P
Sbjct  89    VLLDAGLGSELRKRHLDVIDACRATLGLDIGPVETTDSPLKITLEIS-SSGASWGKLSTP  147

Query  682   DSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMGIDLLAGVEAVISHLVVKH  506
               LLRA E+L K     A+AVV RFP D D E++  YRQG G+D++AG EAVISHL+V+H
Sbjct  148   TPLLRAGERL-KKEGATAIAVVTRFPDDLDSEELGAYRQGHGVDVIAGAEAVISHLLVRH  206

Query  505   FQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLGTAPQYLIKGT-----EIL  341
               +PCAHAPALSP  ++  + P++  EE+GYTFLPCVL GL  AP  + + T      + 
Sbjct  207   LCLPCAHAPALSPLPIAEDLDPRAAGEELGYTFLPCVLVGLSHAPDLIPRDTLKTLSNLT  266

Query  340   GKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETVLNDTPERLGIEAV  161
               N IS  D+ +V+ PI A GG+  L     ++  PLI     N  VL    + LG++A 
Sbjct  267   KPNFISIEDLGAVVAPIGALGGEAVLGCI--EKGIPLIAV--SNPGVLKVDLDSLGLKAD  322

Query  160   S  158
             S
Sbjct  323   S  323



>ref|WP_036899511.1| hypothetical protein [Prochlorococcus marinus]
Length=349

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 138/302 (46%), Positives = 202/302 (67%), Gaps = 8/302 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +++PTGIG  IGG+AGDALPVA+  +S   CL+THPNV+N   L      + YVEGY+LD
Sbjct  8     LVIPTGIGCEIGGFAGDALPVAKLLASASGCLVTHPNVMNGGTLSEKDERIFYVEGYSLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA     L+ V+Q ++G++ D  IE ++ +RHLQV DA  A+LG+    Y +TD P+ +
Sbjct  68    RFARAEIGLKKVNQQKIGIIFDKNIENEILLRHLQVADACIATLGIDIASYVITDEPVGI  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                 D   G S+G ++NP++L++A + L+    + A+A+V RFP + D E+++ YR+G G
Sbjct  128   -VISDELSGLSSGYVRNPETLIKAGKSLIN-QGITAIAIVTRFPDEIDFENVNLYREGKG  185

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             ID++AGVEAVISHL+ K+ ++PCAHAPAL+P  L  ++ P++ +EEIGYTFLP VL GL 
Sbjct  186   IDVIAGVEAVISHLISKYLKVPCAHAPALAPIDLKVNLDPRAAAEEIGYTFLPSVLIGLS  245

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
             TAP  LI   ++  K  +   +++S+++P  A GG+  LA      N   IIAV +NE V
Sbjct  246   TAPD-LIDLPDLDNKITLCPHEIESIVVPSGALGGEAVLACMERDLN---IIAV-KNEGV  300

Query  199   LN  194
             LN
Sbjct  301   LN  302



>gb|KGG28390.1| hypothetical protein EV13_1632 [Prochlorococcus sp. MIT 0702]
 gb|KGG36340.1| hypothetical protein EV14_0434 [Prochlorococcus sp. MIT 0703]
Length=375

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 159/319 (50%), Positives = 197/319 (62%), Gaps = 10/319 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             M+VPTGIG  IGGYAGDALP AR  ++   CLITHPNV+N A LYW    + YVEGY+LD
Sbjct  21    MVVPTGIGCEIGGYAGDALPSARLLAAASGCLITHPNVINGATLYWSDPRIQYVEGYSLD  80

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA G   L PV Q R+GL+LDAGIE +LR R  QV +  RASLGL+      TD+PL V
Sbjct  81    RFAAGELGLRPVRQQRIGLLLDAGIEPELRQRQWQVAEGCRASLGLNLGPVVTTDVPLEV  140

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
              +      G S G +  PD+LLRA E L + +  +A+AVVARFP+D   E +  YRQG G
Sbjct  141   -RLCQGSSGASWGELGQPDALLRAGEHL-RDAGASAIAVVARFPEDPQSEALRAYRQGSG  198

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISHL+V+   +PCAHAPAL P      + P++  EE+GYTFL CVL GL 
Sbjct  199   VDALAGAEAVISHLLVRELCLPCAHAPALPPLPCDPLLDPRAAGEELGYTFLACVLVGLS  258

Query  379   TAPQYLIKGTE---ILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEEN  209
              AP  +   TE     G   + A  + +V+ P  A GG+  LA    +R  PLI     N
Sbjct  259   RAPDLVPLTTEEALPAGAELLHAEQLGAVVAPEGALGGEAVLACL--ERGVPLITVA--N  314

Query  208   ETVLNDTPERLGIEAVSTR  152
              +VL  TPE LGI +   R
Sbjct  315   PSVLKVTPEALGITSGVQR  333



>ref|XP_005794327.1| hypothetical protein EMIHUDRAFT_308248 [Emiliania huxleyi CCMP1516]
 gb|EOD41898.1| hypothetical protein EMIHUDRAFT_308248 [Emiliania huxleyi CCMP1516]
Length=395

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 208/325 (64%), Gaps = 13/325 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTG+GAAIGGYAGDA+PVARA ++V D ++THPNVLN A +YW      YVEG+ALD
Sbjct  32    LIVPTGVGAAIGGYAGDAMPVARALTAVADTVVTHPNVLNGAQMYWSHDAFQYVEGFALD  91

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
              FA G W L P    +VGL+LDA IE +LR+RHLQ  DAARA+LGL    +  TD PL V
Sbjct  92    EFAAGRWGLRPASAQKVGLLLDAAIEPELRLRHLQAADAARATLGLCVAAHATTDAPLGV  151

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
             E  + P  G S      PD+LL A  +L   +   A+AVVARFP D+D+E +  YR G G
Sbjct  152   ELQMSPS-GAS-----RPDALLAAARRLQA-AGCTAIAVVARFPDDEDEEMLAAYRAGDG  204

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D + G EA+ISHL+ K  ++PCAHAPAL    L   + P++ +EE+G+TFLPCVLA L 
Sbjct  205   VDAIGGAEAIISHLITKELRLPCAHAPALPALGLEPGLAPRACAEELGHTFLPCVLANLA  264

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP  L+ G+E      +  S +D++++P DACGG   LA A S     L++ VEEN   
Sbjct  265   RAPS-LLDGSERPLPGDLRDS-LDALVVPADACGGAAVLALAASDT---LVVGVEENTCA  319

Query  199   LNDTPERLGIEAVSTRYLGNSFYLL  125
             +  +PERLG   V  R    +  LL
Sbjct  320   MAVSPERLGGGVVRVRSYMEAIGLL  344



>gb|EWM25222.1| Protein of unknown function DUF3326 [Nannochloropsis gaditana]
Length=821

 Score =   240 bits (612),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 149/326 (46%), Positives = 198/326 (61%), Gaps = 20/326 (6%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +IVPTGIGA+IGGYAGDALPVA   +SVVD LITHPNV+N A LY P  N+LY EG+ALD
Sbjct  84    LIVPTGIGASIGGYAGDALPVAHGLASVVDTLITHPNVMNGASLYAPRPNILYTEGFALD  143

Query  916   RFAEGLWALEPV----HQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDL  749
              FA G W L P       +++G+VLD G+EE++R+RHLQVV+ ARA+LG+      VT+ 
Sbjct  144   EFAGGRWGLRPFLPYQGSHKIGVVLDVGMEEEMRLRHLQVVEGARATLGIDVGAVAVTEE  203

Query  748   PLMVEKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdddd--edidDY  575
             P+ V   + P  G S G++  P++L++A  +LV+     A+AVVARFP++++    +  Y
Sbjct  204   PMEVGLGLMPG-GGSWGKVGKPNTLMKAARRLVEEEGCTALAVVARFPEEEEDEAALQAY  262

Query  574   RQGMGIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCV  395
             R+G G+D + G EAVISHLV     +PCAHAP L P      + PK+  EE+GYTFLPCV
Sbjct  263   REGHGVDCVGGAEAVISHLVTAELGVPCAHAPGLPPLAADAGISPKACGEELGYTFLPCV  322

Query  394   LAGLGTAP----------QYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSK  245
             LA L  AP                        +   DV +V+ P  A GG   L     +
Sbjct  323   LANLQRAPVLVSPHLEGRNRGRNRGREGDGRTLWREDVSAVVAPASAVGGPAVLGLLGGE  382

Query  244   R---NRPLIIAVEENETVLNDTPERL  176
             R      L++AVEENET++   PE L
Sbjct  383   RASGQATLLVAVEENETLMRVWPEDL  408



>ref|WP_011820928.1| hypothetical protein [Prochlorococcus marinus]
 ref|YP_001011940.1| hypothetical protein P9515_16261 [Prochlorococcus marinus str. 
MIT 9515]
 gb|ABM72833.1| conserved hypothetical protein [Prochlorococcus marinus str. 
MIT 9515]
Length=355

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 200/303 (66%), Gaps = 10/303 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
              I+PTGIG  IGG+AGD+LP A+  +S   CLITHPNV+N   L     ++ YVEGY+LD
Sbjct  8     FIIPTGIGCEIGGFAGDSLPAAKLLASASGCLITHPNVMNGGSLAEKHKDIFYVEGYSLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA+G   L+ V Q ++G++ D+ IE ++ IRHLQV DA  A+LG+    Y +T  PL +
Sbjct  68    RFAKGEIGLKSVKQQKIGIIFDSSIEHEILIRHLQVADACVATLGIDVDSYVLTKKPLGI  127

Query  736   EKWVDPKC-GQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGM  563
                +D +  G S G I+NPD+L+ A E L+    + A+A+VA+FP D D  + + YR+G 
Sbjct  128   S--IDSESQGISEGLIENPDTLIEAGEMLIN-KGMTAIAIVAKFPDDLDLVETNSYREGK  184

Query  562   GIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGL  383
             G+D +AGVEAVISHL+ K  ++PCAHAPALSP +L+ ++ P++ SEEIGYTFLP VL GL
Sbjct  185   GVDPIAGVEAVISHLISKFLKVPCAHAPALSPIELNENLDPRAASEEIGYTFLPSVLIGL  244

Query  382   GTAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENET  203
               AP  LI+ ++      +  S V+S+++P  + GG+  LA      N   IIAV +N+ 
Sbjct  245   SKAPD-LIELSDKSDSITLHPSHVESIVIPSGSLGGEAVLAGMERGLN---IIAV-KNQN  299

Query  202   VLN  194
             ++N
Sbjct  300   IIN  302



>ref|WP_011133076.1| hypothetical protein [Prochlorococcus marinus]
 ref|NP_893564.1| hypothetical protein PMM1447 [Prochlorococcus marinus subsp. 
pastoris str. CCMP1986]
 emb|CAE19906.1| conserved hypothetical protein [Prochlorococcus marinus subsp. 
pastoris str. CCMP1986]
 gb|KGF86698.1| hypothetical protein PROCH_1000 [Prochlorococcus marinus str. 
EQPAC1]
Length=352

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 138/304 (45%), Positives = 202/304 (66%), Gaps = 12/304 (4%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
              I+PTGIG  IGG+AGDALP A+  +S   CLITHPNV+N   L     ++ YVEGY+LD
Sbjct  8     FIIPTGIGCEIGGFAGDALPAAKLLASASGCLITHPNVMNGGSLSEQNKDIFYVEGYSLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPL--  743
             RFA+G   L+ V Q ++G++ D+ IE ++ +RHLQ  DA  A+LG+    Y +T  PL  
Sbjct  68    RFAKGEIGLKSVKQQKIGIIFDSSIEHEILMRHLQAADACVATLGIDVDSYVLTKEPLGI  127

Query  742   MVEKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQG  566
             ++E  +    G S G I+NPD+L+ A E+L++   + A+A+VA+FP + D  + + YR+G
Sbjct  128   VIESELQ---GISEGLIENPDTLIEAGERLIE-KGITAIAIVAKFPDNTDLIETNSYREG  183

Query  565   MGIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAG  386
              G+D +AGVEAVISHL+ K+ ++PCAHAPALSP +L+ ++ P++ SEEIGYTFLP VL G
Sbjct  184   KGVDPIAGVEAVISHLISKYLKVPCAHAPALSPIELNENLDPRAASEEIGYTFLPSVLIG  243

Query  385   LGTAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENE  206
             L  AP  LI+  +      +  S ++S+++P  A GG+G LA      N   +I+V +N+
Sbjct  244   LSNAPD-LIELNDNNENITLHPSHIESIVVPSGALGGEGVLACIERGLN---VISV-KNK  298

Query  205   TVLN  194
              +LN
Sbjct  299   NILN  302



>ref|WP_019475351.1| hypothetical protein [Prochlorococcus sp. W2]
Length=349

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 138/302 (46%), Positives = 201/302 (67%), Gaps = 8/302 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +++PTGIG  IGG+AGDALP+A+  +S   CL+THPNV+N   L      + YVEGY+LD
Sbjct  8     LVIPTGIGCEIGGFAGDALPIAKLLASASGCLVTHPNVMNGGTLAEKDERIFYVEGYSLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA     L  V+Q ++G++ D  IE  L +RHLQV DA  A+LG++   Y +T+ P+ +
Sbjct  68    RFARAEIGLRKVNQQKIGIIFDKNIENQLLLRHLQVADACIATLGINIDSYVITEEPVGI  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdddd-edidDYRQGMG  560
                 D   G S+G ++NP++L++A + L+    + A+A+V RFPD+ D +D++ YR+G G
Sbjct  128   -VISDELSGLSSGYVRNPETLIKAGKSLIN-QGITAIAIVTRFPDEIDCDDVNLYREGKG  185

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             ID++AGVEA+ISHL+ K+ ++PCAHAPALSP  L  ++ P++ +EEIGYTFLP VL GL 
Sbjct  186   IDVIAGVEAIISHLISKYLKVPCAHAPALSPIDLKVNLDPRAAAEEIGYTFLPSVLIGLS  245

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
             TAP  LI   +   K  +   +++S+++P  A GG+  LA      N   IIAV +NE V
Sbjct  246   TAPD-LIDLPDFNSKITVCPHEIESIVVPSGALGGEAVLACMERNLN---IIAV-KNEGV  300

Query  199   LN  194
             LN
Sbjct  301   LN  302



>ref|WP_010315328.1| hypothetical protein [Synechococcus sp. CB0205]
Length=348

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 159/316 (50%), Positives = 201/316 (64%), Gaps = 9/316 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             M+VPTGIG  +GGYAGDA+P AR  ++   CLITHPNV+N A LYW    + YVEG +LD
Sbjct  12    MVVPTGIGCEVGGYAGDAVPAARLLAAASGCLITHPNVMNGASLYWSDPRIHYVEGSSLD  71

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA    AL+PV   R+GL+LDAGIEEDLR+RHLQV D  RASLGLS      T  P+ V
Sbjct  72    RFAAAELALQPVRSQRIGLLLDAGIEEDLRLRHLQVADGCRASLGLSLGPVETTTAPIGV  131

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGMG  560
                   + G S G++  PD LL A E+L + +   A+AV+ARFPDD D E +  YRQG G
Sbjct  132   -TLSQGESGASWGQLARPDVLLEAGERL-RDAGATAIAVIARFPDDPDSEALTAYRQGGG  189

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             +D LAG EAVISH + +   +PCAHAPALSP ++   + P++  EE+GYTFLPCVL GL 
Sbjct  190   VDALAGAEAVISHWLSRQLNLPCAHAPALSPLEIDPQLDPRAAGEELGYTFLPCVLVGLS  249

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
              AP   +   +      I A  + +V+ P  A GG   LA A  +R  P +IAV EN  V
Sbjct  250   RAPA--LWPADQAPAESIRAEQIGAVVAPAGALGGAAVLACA--ERGIP-VIAV-ENPCV  303

Query  199   LNDTPERLGIEAVSTR  152
             L+ T E LGIE +  +
Sbjct  304   LSVTAEALGIEVLRAK  319



>ref|WP_019476279.1| hypothetical protein [Prochlorococcus sp. W4]
Length=349

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 202/302 (67%), Gaps = 8/302 (3%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
             +++PTGIG  IGG+AGDALPVA+  +S   CL+THPNV+N   L      + YVEGY+LD
Sbjct  8     LVIPTGIGCEIGGFAGDALPVAKLLASASGCLVTHPNVMNGGTLSEKDERIFYVEGYSLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA     L+ V+Q ++G++ D  IE ++  RHLQV DA  A+LG++   Y +T+ P+ +
Sbjct  68    RFARAEIGLKKVNQQKIGIIFDKNIENEMLCRHLQVADACIATLGINIASYVITEEPVGI  127

Query  736   EKWVDPKCGQSTGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFP-ddddedidDYRQGMG  560
                 D + G S+G ++NP++L++A + L+    + A+A+V RF  + D ED++ YR+G G
Sbjct  128   -VISDEQSGLSSGYVRNPETLIKAGKSLIN-QGITAIAIVTRFSDEIDFEDVNLYREGKG  185

Query  559   IDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGLG  380
             ID++AGVEAVISHL+ K+ ++PCAHAPAL+P  L  ++ P++ +EEIGYTFLP VL GL 
Sbjct  186   IDVIAGVEAVISHLISKYLKVPCAHAPALTPIDLKVNLDPRAAAEEIGYTFLPSVLIGLS  245

Query  379   TAPQYLIKGTEILGKNCISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEENETV  200
             TAP  L+   +   K  +S  +++S+++P  A GG+  LA      N   IIAV +NE V
Sbjct  246   TAPD-LVDLPDSSTKIAVSPHEIESIVVPSGALGGEAVLACMERNLN---IIAV-KNEGV  300

Query  199   LN  194
             LN
Sbjct  301   LN  302



>emb|CBI26920.3| unnamed protein product [Vitis vinifera]
Length=174

 Score =   220 bits (561),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -1

Query  1042  LPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALDRFAEGLWALEPVHQNRVG  863
             +PVARA +SVVDCLI+HPNVLNAAML WP+ NVLYV GYALDRFAEGLWAL+ VHQNRVG
Sbjct  14    IPVARALASVVDCLISHPNVLNAAMLCWPVPNVLYVVGYALDRFAEGLWALQLVHQNRVG  73

Query  862   LVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMVEKWVDPKCGQSTGRIQNP  683
             LVLDA IE +LR+ HLQV DA RASLGL  +EY VTD PL+VEKWVDPK GQSTGR+++P
Sbjct  74    LVLDAAIEGELRLCHLQVADATRASLGLPVLEYIVTDTPLLVEKWVDPKSGQSTGRVKHP  133

Query  682   DSLLRAVEKLVKGSDVNAVAVVARF  608
             DSL RAV+ LV  + VNAVAVV  F
Sbjct  134   DSLPRAVQTLVNRTKVNAVAVVGCF  158



>ref|WP_025980005.1| hypothetical protein [Prochlorococcus sp. scB243_498B23]
Length=352

 Score =   226 bits (576),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 205/310 (66%), Gaps = 16/310 (5%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
              IVPTGIG  +GG+AGDALP A+  +S   CLITHPNV+N   L     N+ YVEGY+LD
Sbjct  8     FIVPTGIGCEVGGFAGDALPTAKLLASASGCLITHPNVMNGGTLSEKDKNIFYVEGYSLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA+G  AL+ V Q R+G++ D+ IE+++ +RHLQV DA  ++LG++   Y +T  PL +
Sbjct  68    RFAKGEIALKRVKQQRIGIIFDSAIEKEILVRHLQVADACVSTLGINVHSYVITKKPLNI  127

Query  736   EKWVDPKCGQ-STGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGM  563
                +D    + S GRI+NP++L+ A + L++   V A+A+VA+FPD+ D  + + YR+G 
Sbjct  128   --VIDSDSSKISGGRIENPNALIDAGKCLIE-KGVTAIAIVAKFPDEPDSLETNIYREGK  184

Query  562   GIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGL  383
             G+D +AGVEAVISHL+ K  ++PCAHAPAL+P +L+ ++ P++ +EEIGYTFLP VL GL
Sbjct  185   GVDPIAGVEAVISHLISKFLKVPCAHAPALNPIELNENLDPRAAAEEIGYTFLPSVLIGL  244

Query  382   GTAPQYLIKGTEILGKN---CISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEE  212
               AP  +    E+  KN    +    ++S+++P  A GG+  LA      N   II+V +
Sbjct  245   SNAPDIV----ELPAKNESISLHPDQIESIVVPNGALGGEAVLAGIEKGLN---IISV-K  296

Query  211   NETVLNDTPE  182
             N+ +L  T E
Sbjct  297   NQNILKVTSE  306



>ref|WP_011933905.1| hypothetical protein [Synechococcus sp. WH 7803]
 ref|YP_001225735.1| hypothetical protein SynWH7803_2012 [Synechococcus sp. WH 7803]
 emb|CAK24438.1| Conserved hypothetical protein [Synechococcus sp. WH 7803]
Length=354

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 137/281 (49%), Positives = 181/281 (64%), Gaps = 9/281 (3%)
 Frame = -1

Query  1006  CLITHPNVLNAAMLYWPMSNVLYVEGYALDRFAEGLWALEPVHQNRVGLVLDAGIEEDLR  827
             CL+THPNV+N A LYW    + YVEG+ LDRFA G  AL    + R+GL+LDA IE  LR
Sbjct  39    CLVTHPNVMNGAALYWSDERIFYVEGWGLDRFAAGELALRGGRRQRIGLLLDAAIEPCLR  98

Query  826   IRHLQVVDAARASLGLSFVEYTVTDLPLMVEKWVDPKCGQSTGRIQNPDSLLRAVEKLVK  647
              RHLQV DA RA+LGL       TD+ L V      + G S G +++PD+LLRA E L +
Sbjct  99    DRHLQVADACRATLGLEIGPVVTTDVALGV-TLRQGESGVSWGSLEHPDALLRAGETL-R  156

Query  646   GSDVNAVAVVARFPdd-ddedidDYRQGMGIDLLAGVEAVISHLVVKHFQIPCAHAPALS  470
              +  +A+AVVARFPDD   E ++ YR G G+D LAG EAVISHL+V+H QIPCAHAPAL+
Sbjct  157   DAGASAIAVVARFPDDCGSEALEAYRHGSGVDGLAGAEAVISHLLVRHLQIPCAHAPALA  216

Query  469   PPQLSTSVCPKSVSEEIGYTFLPCVLAGLGTAPQYLIKGTEILGKNCISASDVDSVILPI  290
             P  L   + P++ +EE+ +TFLPCVL GL  AP  +   T   G   + AS + ++++P 
Sbjct  217   PLPLDPQLDPRAAAEELAHTFLPCVLVGLSRAPDLIQSATAQPGD--LLASGLRALVVPE  274

Query  289   DACGGDGALAFANSKRNRPLIIAVEENETVLNDTPERLGIE  167
              A GG+  LA    +RN P +IAV  N +VL  + + LG+E
Sbjct  275   GALGGEAVLACL--ERNVP-VIAV-SNPSVLQVSSQSLGLE  311



>ref|WP_025975988.1| hypothetical protein [Prochlorococcus sp. scB243_495N3]
Length=352

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 204/310 (66%), Gaps = 16/310 (5%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
              IVPTGIG  +GG+AGDALP A+  +S   CLITHPNV+N   L     N+ YVEGY+LD
Sbjct  8     FIVPTGIGCEVGGFAGDALPTAKLLASASGCLITHPNVMNGGTLSEKDKNIFYVEGYSLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             RFA+G  AL+ V Q R+G++ D+ IE+++ +RHLQV DA  ++LG++   Y +T  PL +
Sbjct  68    RFAKGEIALKRVKQQRIGIIFDSAIEKEILVRHLQVADACVSTLGINVHSYVITKKPLNI  127

Query  736   EKWVDPKCGQ-STGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGM  563
                +D    + S GRI+NP++L+ A + L++   V A+A+VA+FPD+ D  + + YR+G 
Sbjct  128   --VIDSDSSKISGGRIENPNALIDAGKCLIE-KGVTAIAIVAKFPDEPDSLETNIYREGK  184

Query  562   GIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGL  383
             G+D +AGVEAVISHL+ K  ++PCAHAPAL+P +L+ ++ P++ +EEIGYTFLP VL GL
Sbjct  185   GVDPIAGVEAVISHLISKFLKVPCAHAPALNPIELNENLDPRAAAEEIGYTFLPSVLIGL  244

Query  382   GTAPQYLIKGTEILGKN---CISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEE  212
               AP  +    E+  KN    +    ++S+++P  A GG+  LA      N   II+V +
Sbjct  245   SNAPDIV----ELPAKNESISLHPDQIESIVVPNGALGGEAVLAGIEKGLN---IISV-K  296

Query  211   NETVLNDTPE  182
             N+  L  T E
Sbjct  297   NQNTLKVTSE  306



>ref|WP_025923519.1| hypothetical protein [Prochlorococcus sp. scB243_495D8]
Length=352

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 139/304 (46%), Positives = 200/304 (66%), Gaps = 15/304 (5%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
              IVPTGIG  +GG+AGDALP A+  +S   CLITHPNV+N A L     N+ YVEGY+LD
Sbjct  8     FIVPTGIGCEVGGFAGDALPTAKLLASASGCLITHPNVMNGATLSEKDKNIFYVEGYSLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             R A+G  AL+ V Q ++G++ D+ IE+D+ +RHLQV DA  ++LG++   Y +T  PL +
Sbjct  68    RLAKGEIALKRVKQQKIGIIFDSAIEKDILVRHLQVADACVSTLGINVHSYVITKKPLNI  127

Query  736   EKWVDPKCGQ-STGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdd-ddedidDYRQGM  563
                +D    + S G I+NPD+L+ A + L++   V A+A+VA+FPDD D  + + YR+G 
Sbjct  128   --VIDSDSSKISGGTIKNPDTLIDAGKCLIE-KGVTAIAIVAKFPDDPDSLETNIYREGK  184

Query  562   GIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGL  383
             G+D +AGVEAVISHL+ K  ++PCAHAPAL+P +L+ ++ P++ +EEIGYTFLP VL GL
Sbjct  185   GVDPIAGVEAVISHLISKFLKVPCAHAPALNPIELNENLDPRAAAEEIGYTFLPSVLIGL  244

Query  382   GTAPQYLIKGTEILGKN---CISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEE  212
               AP  +    E+  KN    +    +DS+++P  A GG+  LA      N   II+V+ 
Sbjct  245   SNAPDIV----ELPSKNESISLHPDQIDSIVVPNGALGGEAVLAGIEKGLN---IISVQN  297

Query  211   NETV  200
               T+
Sbjct  298   QNTL  301



>ref|WP_035829530.1| hypothetical protein [Cyanobium sp. CACIAM 14]
 gb|KEF43063.1| hypothetical protein ER33_02330 [Cyanobium sp. CACIAM 14]
Length=351

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 138/280 (49%), Positives = 177/280 (63%), Gaps = 8/280 (3%)
 Frame = -1

Query  1006  CLITHPNVLNAAMLYWPMSNVLYVEGYALDRFAEGLWALEPVHQNRVGLVLDAGIEEDLR  827
             CLITHPNV+NAA LYW    + YVEG+ALDRFA G  AL PV   RVG++LDAGIE +L 
Sbjct  41    CLITHPNVMNAAALYWSDRRIHYVEGWALDRFAAGALALAPVPFQRVGVLLDAGIEPELA  100

Query  826   IRHLQVVDAARASLGLSFVEYTVTDLPLMVEKWVDPKCGQSTGRIQNPDSLLRAVEKLVK  647
             +RH QVV+A RASLGL       +D+PL V   +    G S G +  PD LLR  E+LV 
Sbjct  101   LRHRQVVEACRASLGLPLGPVLSSDVPLEVSLSLG-PSGSSWGCLGRPDELLRVGERLVA  159

Query  646   GSDVNAVAVVARFP-ddddedidDYRQGMGIDLLAGVEAVISHLVVKHFQIPCAHAPALS  470
              +   A+AVVARFP D +   +  YR G G+D LAG EAVISHL+ +H  IPCAHAPAL+
Sbjct  160   -AGATAIAVVARFPDDPEAAALAAYRHGGGVDALAGAEAVISHLLSRHLGIPCAHAPALA  218

Query  469   PPQLSTSVCPKSVSEEIGYTFLPCVLAGLGTAPQYLIKGTEILGKNCISASDVDSVILPI  290
             P      + P++ +EE+G+TFLPCVL GL  AP   ++     G+  + A  + +V+ P 
Sbjct  219   PLPPDQDLDPRAAAEELGHTFLPCVLVGLSRAPD--LRPEPAAGEGLLHADQLGAVVAPA  276

Query  289   DACGGDGALAFANSKRNRPLIIAVEENETVLNDTPERLGI  170
              A GG+  LA A  +R  PL IAVE N  +L  + E LG+
Sbjct  277   GALGGEAVLACA--ERGVPL-IAVEGNPCLLQVSGEALGL  313



>gb|ABE11100.1| conserved hypothetical protein [uncultured Prochlorococcus marinus 
clone HF10-11D6]
Length=352

 Score =   224 bits (571),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 142/310 (46%), Positives = 203/310 (65%), Gaps = 16/310 (5%)
 Frame = -1

Query  1096  MIVPTgigaaiggyagdALPVARAFSSVVDCLITHPNVLNAAMLYWPMSNVLYVEGYALD  917
              IVPTGIG  +GG+AGDALP A+  +S   CLITHPNV+N   L     N+ YVEGY+LD
Sbjct  8     FIVPTGIGCEVGGFAGDALPTAKLLASASGCLITHPNVMNGGTLSEKDKNIFYVEGYSLD  67

Query  916   RFAEGLWALEPVHQNRVGLVLDAGIEEDLRIRHLQVVDAARASLGLSFVEYTVTDLPLMV  737
             R A+G  AL+ V Q +VG++ D+ IE+++ +RHLQV DA  ++LG++   Y +T  PL +
Sbjct  68    RLAKGEIALKRVKQQKVGIIFDSAIEKEILVRHLQVADACVSTLGINVHSYMITKKPLNI  127

Query  736   EKWVDPKCGQ-STGRIQNPDSLLRAVEKLVKGSDVNAVAVVARFPdddde-didDYRQGM  563
                +D    + S G I+NPD+L+ A + L++   V A+A+VA+FPDD D  + + YR+G 
Sbjct  128   --VIDSDSSKVSGGTIENPDTLIDAGKCLIE-KGVTAIAIVAKFPDDSDSLETNIYREGR  184

Query  562   GIDLLAGVEAVISHLVVKHFQIPCAHAPALSPPQLSTSVCPKSVSEEIGYTFLPCVLAGL  383
             G+D ++GVEAVISHLV K  ++PCAHAPAL+P +L+ ++ P++ SEEIGYTFLP VL GL
Sbjct  185   GVDPISGVEAVISHLVSKFLKVPCAHAPALNPIELNENLDPRAASEEIGYTFLPSVLIGL  244

Query  382   GTAPQYLIKGTEILGKN---CISASDVDSVILPIDACGGDGALAFANSKRNRPLIIAVEE  212
               AP  +    E+  KN    +    ++S+++P  A GG+  LA      N   II+V +
Sbjct  245   SNAPDIV----ELPAKNESISLHPDQIESIVVPNGALGGEAVLAGIEKGLN---IISV-K  296

Query  211   NETVLNDTPE  182
             N+  LN T E
Sbjct  297   NQNTLNVTNE  306



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2593405246560