BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24932_g2_i2 len=1053 path=[2621:0-254 9822:255-327 2949:328-353
2975:354-505 3127:506-520 3142:521-665 3287:666-689 10446:690-690
3312:691-783 3405:784-819 787:820-824 792:825-865 10470:866-869
837:870-873 841:874-890 10490:891-897 865:898-926 10520:927-928
896:929-939 907:940-953 921:954-1000 10545:1001-1003 10548:1004-1005
973:1006-1037 1005:1038-1043 1011:1044-1052]

Length=1053
                                                                      Score     E

ref|XP_006378523.1|  sulfotransferase family protein                    289   1e-91   
ref|XP_011009569.1|  PREDICTED: cytosolic sulfotransferase 5-like       286   1e-90   
ref|XP_011009587.1|  PREDICTED: cytosolic sulfotransferase 12-like      283   2e-89   
ref|XP_002267209.1|  PREDICTED: cytosolic sulfotransferase 12           282   6e-89   Vitis vinifera
ref|XP_002512030.1|  Flavonol 4'-sulfotransferase, putative             282   1e-88   Ricinus communis
ref|XP_006348649.1|  PREDICTED: cytosolic sulfotransferase 12-like      281   2e-88   
emb|CDP00476.1|  unnamed protein product                                279   1e-87   
ref|XP_003628738.1|  Flavonol sulfotransferase-like protein             278   2e-87   
ref|XP_009598362.1|  PREDICTED: cytosolic sulfotransferase 12-like      277   8e-87   
gb|KDP41358.1|  hypothetical protein JCGZ_15765                         275   2e-86   
gb|KDO70277.1|  hypothetical protein CISIN_1g019700mg                   276   3e-86   
ref|XP_006484253.1|  PREDICTED: cytosolic sulfotransferase 12-like      275   3e-86   
ref|XP_009620813.1|  PREDICTED: cytosolic sulfotransferase 12-lik...    276   4e-86   
ref|XP_009620812.1|  PREDICTED: cytosolic sulfotransferase 12-lik...    276   5e-86   
ref|XP_006437857.1|  hypothetical protein CICLE_v10031848mg             276   9e-86   
ref|XP_006348794.1|  PREDICTED: cytosolic sulfotransferase 12-like      273   2e-85   
ref|XP_009616636.1|  PREDICTED: cytosolic sulfotransferase 12-like      273   2e-85   
ref|XP_006388018.1|  hypothetical protein POPTR_0396s00220g             270   1e-84   
ref|XP_011070903.1|  PREDICTED: cytosolic sulfotransferase 12-like      271   2e-84   
gb|KEH33293.1|  P-loop nucleoside triphosphate hydrolase superfam...    270   3e-84   
ref|XP_007045763.1|  Flavonol 4'-sulfotransferase, putative             272   3e-84   
gb|KEH16899.1|  P-loop nucleoside triphosphate hydrolase superfam...    270   6e-84   
ref|XP_010023658.1|  PREDICTED: cytosolic sulfotransferase 12-like      269   9e-84   
ref|XP_007045765.1|  P-loop containing nucleoside triphosphate hy...    269   1e-83   
ref|XP_010052979.1|  PREDICTED: cytosolic sulfotransferase 12-like      268   1e-83   
ref|XP_004239453.1|  PREDICTED: cytosolic sulfotransferase 12-like      268   2e-83   
ref|XP_009767933.1|  PREDICTED: cytosolic sulfotransferase 12           268   3e-83   
ref|XP_010046610.1|  PREDICTED: cytosolic sulfotransferase 12-like      265   2e-82   
ref|XP_008352940.1|  PREDICTED: cytosolic sulfotransferase 12-like      264   9e-82   
ref|XP_006348796.1|  PREDICTED: cytosolic sulfotransferase 12-like      263   2e-81   
ref|XP_006348647.1|  PREDICTED: cytosolic sulfotransferase 12-like      263   3e-81   
ref|XP_004297202.1|  PREDICTED: cytosolic sulfotransferase 12-like      262   5e-81   
ref|XP_010681134.1|  PREDICTED: cytosolic sulfotransferase 12-like      260   3e-80   
ref|XP_011102095.1|  PREDICTED: cytosolic sulfotransferase 12-like      259   4e-80   
ref|XP_011102114.1|  PREDICTED: cytosolic sulfotransferase 12-like      259   6e-80   
ref|XP_004239020.1|  PREDICTED: cytosolic sulfotransferase 12-like      258   2e-79   
ref|XP_004247253.1|  PREDICTED: cytosolic sulfotransferase 12-like      258   2e-79   
emb|CDP14958.1|  unnamed protein product                                256   5e-79   
ref|XP_004298345.1|  PREDICTED: cytosolic sulfotransferase 5-like       256   5e-79   
ref|XP_010044374.1|  PREDICTED: cytosolic sulfotransferase 5-like       256   7e-79   
ref|XP_010050823.1|  PREDICTED: cytosolic sulfotransferase 13-like      256   8e-79   
ref|XP_010050705.1|  PREDICTED: cytosolic sulfotransferase 12-like      255   1e-78   
ref|XP_004297203.1|  PREDICTED: cytosolic sulfotransferase 12-like      256   1e-78   
ref|XP_010260931.1|  PREDICTED: cytosolic sulfotransferase 5-like       256   2e-78   
ref|XP_008339764.1|  PREDICTED: cytosolic sulfotransferase 12-like      255   2e-78   
ref|XP_006348797.1|  PREDICTED: cytosolic sulfotransferase 12-like      255   2e-78   
ref|XP_010091629.1|  Flavonol sulfotransferase-like protein             255   3e-78   
ref|XP_003628737.1|  Flavonol sulfotransferase-like protein             253   7e-78   
ref|XP_006348798.1|  PREDICTED: cytosolic sulfotransferase 12-like      253   1e-77   
emb|CDP00475.1|  unnamed protein product                                253   2e-77   
ref|XP_008339761.1|  PREDICTED: cytosolic sulfotransferase 5-like       253   2e-77   
ref|XP_006339394.1|  PREDICTED: cytosolic sulfotransferase 12-like      252   2e-77   
ref|XP_006339391.1|  PREDICTED: cytosolic sulfotransferase 12-like      251   5e-77   
ref|XP_007010821.1|  Sulfotransferase 2A                                252   7e-77   
ref|XP_010048649.1|  PREDICTED: cytosolic sulfotransferase 5-like       251   7e-77   
ref|XP_009129071.1|  PREDICTED: cytosolic sulfotransferase 12-lik...    251   9e-77   
ref|XP_010051322.1|  PREDICTED: cytosolic sulfotransferase 12-like      250   1e-76   
ref|XP_010514146.1|  PREDICTED: cytosolic sulfotransferase 12-like      250   1e-76   
gb|KCW80596.1|  hypothetical protein EUGRSUZ_C01959                     249   2e-76   
ref|XP_009129073.1|  PREDICTED: cytosolic sulfotransferase 12-lik...    250   2e-76   
emb|CDP16517.1|  unnamed protein product                                250   2e-76   
ref|XP_010051374.1|  PREDICTED: cytosolic sulfotransferase 5-like       249   2e-76   
ref|XP_010051309.1|  PREDICTED: cytosolic sulfotransferase 12-like      249   3e-76   
emb|CDP07173.1|  unnamed protein product                                249   3e-76   
ref|XP_003599784.1|  Flavonol sulfotransferase-like protein             251   3e-76   
emb|CDP19484.1|  unnamed protein product                                249   5e-76   
ref|XP_002265137.1|  PREDICTED: cytosolic sulfotransferase 15           248   1e-75   Vitis vinifera
ref|XP_003530555.2|  PREDICTED: cytosolic sulfotransferase 5-like       248   2e-75   
ref|XP_010050715.1|  PREDICTED: cytosolic sulfotransferase 13-like      247   3e-75   
ref|XP_010039273.1|  PREDICTED: cytosolic sulfotransferase 5-like       247   3e-75   
ref|XP_002268667.1|  PREDICTED: flavonol 3-sulfotransferase             246   5e-75   Vitis vinifera
ref|XP_002314916.2|  hypothetical protein POPTR_0010s14820g             246   6e-75   Populus trichocarpa [western balsam poplar]
ref|XP_010048648.1|  PREDICTED: cytosolic sulfotransferase 13-like      246   6e-75   
ref|XP_009590910.1|  PREDICTED: cytosolic sulfotransferase 15-like      246   8e-75   
ref|XP_002265863.1|  PREDICTED: cytosolic sulfotransferase 15           246   8e-75   Vitis vinifera
gb|KDP40565.1|  hypothetical protein JCGZ_24564                         246   9e-75   
ref|XP_004239455.1|  PREDICTED: cytosolic sulfotransferase 12-like      245   1e-74   
ref|XP_004240284.1|  PREDICTED: cytosolic sulfotransferase 12-like      244   2e-74   
ref|XP_002538120.1|  Flavonol 4'-sulfotransferase, putative             244   4e-74   Ricinus communis
gb|AAC63113.1|  steroid sulfotransferase 3                              244   4e-74   Brassica napus [oilseed rape]
ref|XP_008240107.1|  PREDICTED: flavonol sulfotransferase-like          244   6e-74   
ref|XP_010534326.1|  PREDICTED: cytosolic sulfotransferase 15-like      244   8e-74   
ref|XP_009114137.1|  PREDICTED: cytosolic sulfotransferase 12           243   8e-74   
ref|XP_002304810.1|  sulfotransferase family protein                    243   9e-74   Populus trichocarpa [western balsam poplar]
ref|XP_010048646.1|  PREDICTED: cytosolic sulfotransferase 5-like       243   1e-73   
gb|EYU26929.1|  hypothetical protein MIMGU_mgv1a009329mg                243   1e-73   
ref|XP_010425175.1|  PREDICTED: cytosolic sulfotransferase 12-like      243   1e-73   
ref|XP_004253506.1|  PREDICTED: cytosolic sulfotransferase 12-like      242   3e-73   
emb|CDP14620.1|  unnamed protein product                                244   3e-73   
ref|XP_007156373.1|  hypothetical protein PHAVU_003G280800g             242   3e-73   
ref|XP_008347825.1|  PREDICTED: cytosolic sulfotransferase 15-like      241   5e-73   
ref|XP_010518598.1|  PREDICTED: cytosolic sulfotransferase 12           241   5e-73   
ref|XP_010670538.1|  PREDICTED: cytosolic sulfotransferase 15-like      241   6e-73   
ref|XP_010523117.1|  PREDICTED: cytosolic sulfotransferase 12-like      241   6e-73   
ref|XP_010050960.1|  PREDICTED: cytosolic sulfotransferase 5-like       241   6e-73   
ref|XP_010677191.1|  PREDICTED: flavonol sulfotransferase-like          241   7e-73   
ref|XP_002272968.2|  PREDICTED: cytosolic sulfotransferase 13-like      241   1e-72   Vitis vinifera
ref|XP_009779416.1|  PREDICTED: cytosolic sulfotransferase 15           241   1e-72   
ref|XP_008393378.1|  PREDICTED: cytosolic sulfotransferase 13-like      239   2e-72   
ref|XP_007045764.1|  P-loop containing nucleoside triphosphate hy...    238   2e-72   
ref|XP_008231647.1|  PREDICTED: cytosolic sulfotransferase 15-like      239   2e-72   
ref|XP_004308399.1|  PREDICTED: cytosolic sulfotransferase 15-like      240   2e-72   
gb|KDP44529.1|  hypothetical protein JCGZ_16362                         238   2e-72   
ref|XP_007028479.1|  Sulfotransferase 2A, putative                      241   2e-72   
ref|XP_004250849.1|  PREDICTED: cytosolic sulfotransferase 12-like      239   2e-72   
gb|KCW80972.1|  hypothetical protein EUGRSUZ_C02337                     241   3e-72   
ref|XP_010523501.1|  PREDICTED: cytosolic sulfotransferase 12-like      239   3e-72   
ref|XP_009370647.1|  PREDICTED: cytosolic sulfotransferase 15-like      239   4e-72   
ref|XP_007208898.1|  hypothetical protein PRUPE_ppa026895mg             238   4e-72   
gb|KFK38089.1|  hypothetical protein AALP_AA3G068100                    238   9e-72   
ref|XP_009129074.1|  PREDICTED: cytosolic sulfotransferase 12-like      238   9e-72   
ref|XP_010425174.1|  PREDICTED: cytosolic sulfotransferase 12-like      238   1e-71   
ref|XP_010534168.1|  PREDICTED: cytosolic sulfotransferase 12-like      238   1e-71   
ref|XP_006395675.1|  hypothetical protein EUTSA_v10004585mg             237   1e-71   
ref|XP_011020444.1|  PREDICTED: cytosolic sulfotransferase 15-like      238   2e-71   
gb|KDO44381.1|  hypothetical protein CISIN_1g019118mg                   238   2e-71   
emb|CDY55733.1|  BnaAnng13870D                                          244   2e-71   
ref|XP_002264512.1|  PREDICTED: flavonol sulfotransferase-like          237   2e-71   Vitis vinifera
ref|XP_006591672.1|  PREDICTED: cytosolic sulfotransferase 15-like      237   2e-71   
ref|XP_006465789.1|  PREDICTED: cytosolic sulfotransferase 15-like      237   3e-71   
gb|AAR14296.1|  steroid sulfotransferase 4                              236   3e-71   Brassica napus [oilseed rape]
ref|XP_006418637.1|  hypothetical protein EUTSA_v10002851mg             236   4e-71   
ref|XP_010031022.1|  PREDICTED: cytosolic sulfotransferase 15-like      236   5e-71   
gb|KHN26485.1|  Flavonol sulfotransferase-like                          236   6e-71   
ref|XP_006432398.1|  hypothetical protein CICLE_v10003688mg             236   7e-71   
ref|XP_010502398.1|  PREDICTED: cytosolic sulfotransferase 12-like      235   7e-71   
ref|XP_010044375.1|  PREDICTED: cytosolic sulfotransferase 5-like       236   8e-71   
ref|XP_006385980.1|  hypothetical protein POPTR_0003s19280g             236   8e-71   
ref|XP_010095979.1|  Flavonol sulfotransferase-like protein             235   8e-71   
ref|XP_007225044.1|  hypothetical protein PRUPE_ppa019825mg             233   9e-71   
gb|AAC63111.1|  steroid sulfotransferase 1                              235   1e-70   Brassica napus [oilseed rape]
ref|XP_002876896.1|  hypothetical protein ARALYDRAFT_484285             235   1e-70   
ref|XP_006395674.1|  hypothetical protein EUTSA_v10005340mg             235   1e-70   
ref|XP_002876897.1|  sulfotransferase family protein                    235   1e-70   
gb|KDP44527.1|  hypothetical protein JCGZ_16360                         234   1e-70   
gb|KCW81180.1|  hypothetical protein EUGRSUZ_C02547                     234   2e-70   
ref|XP_010677194.1|  PREDICTED: flavonol sulfotransferase-like          234   2e-70   
ref|XP_004291155.1|  PREDICTED: cytosolic sulfotransferase 15-lik...    234   2e-70   
emb|CDY58630.1|  BnaC09g52480D                                          243   2e-70   
emb|CDY04166.1|  BnaA09g19440D                                          234   2e-70   
ref|XP_010087683.1|  Flavonol sulfotransferase-like protein             234   2e-70   
gb|KHN21542.1|  Flavonol sulfotransferase-like                          233   3e-70   
gb|KHN37710.1|  Flavonol sulfotransferase-like                          234   3e-70   
ref|XP_003542799.1|  PREDICTED: cytosolic sulfotransferase 15-like      234   3e-70   
ref|XP_004292840.1|  PREDICTED: cytosolic sulfotransferase 15-like      234   4e-70   
ref|XP_010051030.1|  PREDICTED: cytosolic sulfotransferase 12-like      236   4e-70   
ref|XP_007022041.1|  Sulfotransferase 2A, putative                      233   5e-70   
ref|XP_010520091.1|  PREDICTED: cytosolic sulfotransferase 15-like      234   6e-70   
ref|XP_002264929.1|  PREDICTED: flavonol sulfotransferase-like          234   6e-70   Vitis vinifera
ref|XP_009339576.1|  PREDICTED: cytosolic sulfotransferase 5-like       233   6e-70   
ref|XP_009130975.1|  PREDICTED: cytosolic sulfotransferase 15-like      234   6e-70   
ref|XP_010514147.1|  PREDICTED: cytosolic sulfotransferase 13-like      233   7e-70   
ref|XP_004306829.1|  PREDICTED: cytosolic sulfotransferase 15-like      233   8e-70   
ref|XP_010051056.1|  PREDICTED: cytosolic sulfotransferase 12-like      237   9e-70   
ref|XP_002514611.1|  Flavonol 3-sulfotransferase, putative              233   1e-69   Ricinus communis
ref|NP_190093.1|  sulfotransferase 5                                    232   1e-69   Arabidopsis thaliana [mouse-ear cress]
emb|CDY54154.1|  BnaA09g53490D                                          232   1e-69   
ref|XP_009114139.1|  PREDICTED: cytosolic sulfotransferase 12-like      232   1e-69   
ref|XP_006292772.1|  hypothetical protein CARUB_v10019022mg             232   2e-69   
gb|AFK43741.1|  unknown                                                 232   2e-69   
ref|XP_002264574.2|  PREDICTED: cytosolic sulfotransferase 15-like      232   2e-69   Vitis vinifera
ref|NP_178472.1|  cytosolic sulfotransferase 13                         231   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114140.1|  PREDICTED: cytosolic sulfotransferase 12-like      231   3e-69   
ref|XP_006292654.1|  hypothetical protein CARUB_v10018897mg             231   5e-69   
ref|XP_011070292.1|  PREDICTED: cytosolic sulfotransferase 15-like      231   5e-69   
gb|AFK33848.1|  unknown                                                 231   5e-69   
ref|XP_007029974.1|  Sulfotransferase 2A, putative                      231   7e-69   
emb|CDY58879.1|  BnaA03g55570D                                          231   9e-69   
ref|XP_009125671.1|  PREDICTED: cytosolic sulfotransferase 15-like      231   1e-68   
ref|XP_010430710.1|  PREDICTED: cytosolic sulfotransferase 13           229   1e-68   
ref|XP_009122389.1|  PREDICTED: cytosolic sulfotransferase 15-like      231   1e-68   
emb|CDY05012.1|  BnaAnng01940D                                          231   1e-68   
ref|NP_178471.1|  sulphotransferase 12                                  229   2e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CAA86850.1|  Flavonol sulfotransferase                              228   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002303947.1|  hypothetical protein POPTR_0003s19270g             229   2e-68   Populus trichocarpa [western balsam poplar]
ref|XP_010663822.1|  PREDICTED: uncharacterized protein LOC100261498    237   4e-68   
ref|XP_006292192.1|  hypothetical protein CARUB_v10018398mg             228   4e-68   
gb|KCW80592.1|  hypothetical protein EUGRSUZ_C01953                     227   5e-68   
ref|XP_006292601.1|  hypothetical protein CARUB_v10018842mg             228   6e-68   
ref|XP_003627983.1|  Flavonol sulfotransferase-like protein             228   7e-68   
emb|CDP11652.1|  unnamed protein product                                228   7e-68   
ref|XP_007022042.1|  Sulfotransferase 2A, putative                      231   1e-67   
ref|XP_002303948.2|  hypothetical protein POPTR_0003s19260g             227   1e-67   Populus trichocarpa [western balsam poplar]
ref|XP_007218724.1|  hypothetical protein PRUPE_ppa009048mg             227   1e-67   
gb|EYU28890.1|  hypothetical protein MIMGU_mgv1a009426mg                228   1e-67   
ref|XP_004514095.1|  PREDICTED: cytosolic sulfotransferase 15-like      227   1e-67   
gb|ADX97329.1|  sulfotransferase-like protein                           227   1e-67   
ref|XP_006399179.1|  hypothetical protein EUTSA_v10015302mg             228   2e-67   
emb|CDX81030.1|  BnaC03g02840D                                          228   2e-67   
ref|XP_008777577.1|  PREDICTED: cytosolic sulfotransferase 12-like      227   2e-67   
ref|XP_010665242.1|  PREDICTED: cytosolic sulfotransferase 15-like      226   4e-67   
gb|KEH21570.1|  P-loop nucleoside triphosphate hydrolase superfam...    226   4e-67   
ref|XP_011020447.1|  PREDICTED: cytosolic sulfotransferase 15-like      226   4e-67   
ref|XP_010672210.1|  PREDICTED: cytosolic sulfotransferase 13-like      226   4e-67   
ref|XP_009789859.1|  PREDICTED: flavonol sulfotransferase-like          226   5e-67   
ref|XP_007034897.1|  Flavonol 3-sulfotransferase, putative              226   6e-67   
ref|XP_007133673.1|  hypothetical protein PHAVU_011G199400g             225   6e-67   
emb|CDX99017.1|  BnaC09g48180D                                          226   8e-67   
ref|XP_007133678.1|  hypothetical protein PHAVU_011G199900g             224   1e-66   
ref|XP_007022038.1|  Sulfotransferase 2A                                225   1e-66   
ref|XP_011081805.1|  PREDICTED: cytosolic sulfotransferase 15-like      224   1e-66   
gb|EYU29209.1|  hypothetical protein MIMGU_mgv1a022523mg                224   1e-66   
gb|KCW81757.1|  hypothetical protein EUGRSUZ_C03121                     223   1e-66   
ref|XP_007133555.1|  hypothetical protein PHAVU_011G188800g             224   1e-66   
ref|XP_009621634.1|  PREDICTED: flavonol sulfotransferase-like          225   2e-66   
ref|XP_006347852.1|  PREDICTED: cytosolic sulfotransferase 15-like      224   2e-66   
ref|XP_010496748.1|  PREDICTED: cytosolic sulfotransferase 5-like       224   2e-66   
ref|XP_010936424.1|  PREDICTED: flavonol 3-sulfotransferase-like        224   2e-66   
ref|XP_011070306.1|  PREDICTED: cytosolic sulfotransferase 15-like      224   3e-66   
ref|XP_004514767.1|  PREDICTED: cytosolic sulfotransferase 15-lik...    224   3e-66   
ref|XP_004499637.1|  PREDICTED: cytosolic sulfotransferase 15-like      224   3e-66   
gb|EYU29210.1|  hypothetical protein MIMGU_mgv1a010218mg                223   3e-66   
ref|XP_010491300.1|  PREDICTED: cytosolic sulfotransferase 15-like      224   3e-66   
ref|XP_010271910.1|  PREDICTED: cytosolic sulfotransferase 15-like      224   4e-66   
ref|XP_006385979.1|  hypothetical protein POPTR_0003s19250g             223   4e-66   
ref|XP_010452648.1|  PREDICTED: cytosolic sulfotransferase 15           224   5e-66   
ref|XP_003542798.1|  PREDICTED: cytosolic sulfotransferase 15-like      223   5e-66   
ref|XP_010554271.1|  PREDICTED: cytosolic sulfotransferase 11-like      223   5e-66   
emb|CDY60367.1|  BnaA09g54440D                                          223   6e-66   
ref|XP_002265783.1|  PREDICTED: cytosolic sulfotransferase 15           223   6e-66   Vitis vinifera
ref|XP_007133664.1|  hypothetical protein PHAVU_011G198600g             223   6e-66   
ref|XP_006440813.1|  hypothetical protein CICLE_v10020894mg             223   7e-66   
gb|KDO65656.1|  hypothetical protein CISIN_1g041950mg                   222   8e-66   
gb|KFK25092.1|  hypothetical protein AALP_AA8G065200                    223   1e-65   
emb|CDY14059.1|  BnaC02g01760D                                          223   1e-65   
gb|AAC63112.1|  steroid sulfotransferase 2                              222   1e-65   Brassica napus [oilseed rape]
ref|XP_008777578.1|  PREDICTED: flavonol 4'-sulfotransferase-like       223   2e-65   
gb|KCW80590.1|  hypothetical protein EUGRSUZ_C01951                     221   2e-65   
ref|XP_011020446.1|  PREDICTED: cytosolic sulfotransferase 15-like      222   2e-65   
ref|XP_007133677.1|  hypothetical protein PHAVU_011G199800g             221   2e-65   
ref|XP_002873289.1|  sulfotransferase family protein                    222   2e-65   
ref|XP_010936423.1|  PREDICTED: flavonol sulfotransferase-like          222   2e-65   
gb|KHN37661.1|  Flavonol sulfotransferase-like                          221   3e-65   
ref|XP_003542828.1|  PREDICTED: cytosolic sulfotransferase 15-like      221   4e-65   
ref|NP_190094.1|  cytosolic sulfotransferase 6                          221   4e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004307199.1|  PREDICTED: cytosolic sulfotransferase 15-like      221   4e-65   
ref|XP_008807420.1|  PREDICTED: flavonol sulfotransferase-like          221   4e-65   
gb|AES68675.2|  sulfotransferase                                        221   5e-65   
ref|XP_003598424.1|  Sulfotransferase                                   220   5e-65   
ref|XP_006385956.1|  hypothetical protein POPTR_0003s18770g             220   6e-65   
ref|XP_010523511.1|  PREDICTED: cytosolic sulfotransferase 5-like       220   7e-65   
ref|XP_007133669.1|  hypothetical protein PHAVU_011G199100g             220   7e-65   
ref|XP_006385961.1|  hypothetical protein POPTR_0003s18820g             220   7e-65   
ref|NP_568177.1|  sulfotransferase 2A                                   221   7e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008777575.1|  PREDICTED: flavonol sulfotransferase-like          221   8e-65   
ref|XP_011070271.1|  PREDICTED: cytosolic sulfotransferase 5-like       223   8e-65   
ref|XP_003627955.1|  Flavonol sulfotransferase-like protein             222   8e-65   
dbj|BAB11159.1|  steroid sulfotransferase-like protein                  221   9e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002519139.1|  Flavonol 4'-sulfotransferase, putative             220   1e-64   Ricinus communis
ref|XP_006289894.1|  hypothetical protein CARUB_v10003509mg             220   1e-64   
ref|XP_009762002.1|  PREDICTED: flavonol sulfotransferase-like          220   1e-64   
ref|XP_004514768.1|  PREDICTED: cytosolic sulfotransferase 15-lik...    219   1e-64   
ref|XP_002525538.1|  Flavonol 4'-sulfotransferase, putative             219   2e-64   Ricinus communis
gb|KCW81101.1|  hypothetical protein EUGRSUZ_C02479                     218   2e-64   
ref|XP_010423267.1|  PREDICTED: cytosolic sulfotransferase 15-like      221   2e-64   
ref|XP_006440811.1|  hypothetical protein CICLE_v10023927mg             220   2e-64   
ref|XP_010048481.1|  PREDICTED: cytosolic sulfotransferase 12-like      218   3e-64   
ref|XP_007037642.1|  Flavonol 4'-sulfotransferase, putative             219   3e-64   
ref|XP_008785639.1|  PREDICTED: flavonol sulfotransferase-like          219   3e-64   
gb|AAL06879.1|  AT5g07010/MOJ9_18                                       219   4e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008777579.1|  PREDICTED: flavonol 4'-sulfotransferase-like       218   4e-64   
gb|KEH21569.1|  P-loop nucleoside triphosphate hydrolase superfam...    219   4e-64   
ref|XP_007022039.1|  Sulfotransferase 2A, putative                      223   5e-64   
ref|XP_010916164.1|  PREDICTED: cytosolic sulfotransferase 12-like      218   5e-64   
ref|XP_009615435.1|  PREDICTED: flavonol 3-sulfotransferase-like        219   7e-64   
ref|XP_007133559.1|  hypothetical protein PHAVU_011G189100g             217   7e-64   
ref|XP_007133667.1|  hypothetical protein PHAVU_011G198900g             217   7e-64   
ref|XP_009764805.1|  PREDICTED: flavonol 3-sulfotransferase-like        218   8e-64   
ref|XP_010672209.1|  PREDICTED: cytosolic sulfotransferase 15-like      218   8e-64   
ref|XP_011070341.1|  PREDICTED: cytosolic sulfotransferase 15-like      217   9e-64   
ref|XP_011020519.1|  PREDICTED: cytosolic sulfotransferase 15-like      217   9e-64   
ref|XP_006477735.1|  PREDICTED: cytosolic sulfotransferase 16-like      218   1e-63   
ref|XP_011003416.1|  PREDICTED: cytosolic sulfotransferase 8-like       218   1e-63   
ref|XP_010672206.1|  PREDICTED: cytosolic sulfotransferase 13-lik...    217   1e-63   
gb|KDO65654.1|  hypothetical protein CISIN_1g018736mg                   218   1e-63   
ref|XP_010906702.1|  PREDICTED: flavonol 3-sulfotransferase-like        218   1e-63   
ref|XP_010272754.1|  PREDICTED: flavonol sulfotransferase-like          217   1e-63   
ref|XP_002529982.1|  Flavonol 4'-sulfotransferase, putative             217   1e-63   Ricinus communis
ref|XP_010672207.1|  PREDICTED: cytosolic sulfotransferase 13-lik...    217   1e-63   
dbj|BAB11158.1|  steroid sulfotransferase-like protein                  217   2e-63   
ref|XP_011081693.1|  PREDICTED: cytosolic sulfotransferase 15-like      216   2e-63   
ref|XP_003627950.1|  Flavonol sulfotransferase-like protein             217   2e-63   
ref|XP_008785781.1|  PREDICTED: cytosolic sulfotransferase 7-like       217   2e-63   
ref|NP_196317.2|  sulfotransferase 2B                                   217   2e-63   
ref|XP_010672201.1|  PREDICTED: cytosolic sulfotransferase 13-lik...    216   2e-63   
ref|XP_007029964.1|  Sulfotransferase 2A, putative                      218   2e-63   
emb|CDX96514.1|  BnaA07g31250D                                          217   2e-63   
ref|XP_006304738.1|  hypothetical protein CARUB_v10012097mg             216   2e-63   
emb|CDP16991.1|  unnamed protein product                                217   2e-63   
ref|XP_010051057.1|  PREDICTED: cytosolic sulfotransferase 12-like      221   3e-63   
ref|XP_003541597.1|  PREDICTED: cytosolic sulfotransferase 15-like      216   3e-63   
ref|XP_004490050.1|  PREDICTED: cytosolic sulfotransferase 15-like      216   3e-63   
ref|XP_011070365.1|  PREDICTED: cytosolic sulfotransferase 15-like      215   4e-63   
ref|XP_010668070.1|  PREDICTED: cytosolic sulfotransferase 5-like       216   4e-63   
ref|XP_007133670.1|  hypothetical protein PHAVU_011G199200g             215   5e-63   
gb|KCW80599.1|  hypothetical protein EUGRSUZ_C01964                     214   6e-63   
gb|KCW50290.1|  hypothetical protein EUGRSUZ_J00075                     215   6e-63   
ref|XP_008811045.1|  PREDICTED: flavonol 3-sulfotransferase-like        215   6e-63   
gb|AFX73362.1|  desulfoglucosinolate sulfotransferase                   215   7e-63   
emb|CDX95244.1|  BnaC09g16260D                                          215   7e-63   
ref|NP_173294.1|  sulfotransferase 17                                   215   7e-63   
ref|XP_010476383.1|  PREDICTED: cytosolic sulfotransferase 1-like       214   8e-63   
ref|XP_009142142.1|  PREDICTED: cytosolic sulfotransferase 3            214   8e-63   
ref|XP_009789857.1|  PREDICTED: flavonol sulfotransferase-like          215   9e-63   
ref|XP_010459484.1|  PREDICTED: cytosolic sulfotransferase 17           215   9e-63   
ref|XP_010939222.1|  PREDICTED: cytosolic sulfotransferase 12-like      216   9e-63   
gb|EYU36903.1|  hypothetical protein MIMGU_mgv1a024755mg                214   1e-62   
gb|EMT06790.1|  Sulfotransferase 17                                     215   1e-62   
ref|XP_002318367.2|  hypothetical protein POPTR_0012s01280g             214   2e-62   
ref|XP_007133665.1|  hypothetical protein PHAVU_011G198700g             214   2e-62   
ref|XP_010545823.1|  PREDICTED: cytosolic sulfotransferase 5-like       214   2e-62   
ref|XP_006392096.1|  hypothetical protein EUTSA_v10023824mg             214   2e-62   
ref|XP_002305642.2|  hypothetical protein POPTR_0004s03150g             215   2e-62   
ref|XP_008790317.1|  PREDICTED: flavonol 4'-sulfotransferase-like       214   2e-62   
ref|XP_008778400.1|  PREDICTED: flavonol sulfotransferase-like          214   2e-62   
ref|XP_010272734.1|  PREDICTED: cytosolic sulfotransferase 8-like       214   2e-62   
gb|AFK46619.1|  unknown                                                 212   3e-62   
ref|XP_004973902.1|  PREDICTED: cytosolic sulfotransferase 5-like       213   3e-62   
ref|XP_011047829.1|  PREDICTED: flavonol sulfotransferase-like          213   3e-62   
dbj|BAJ86730.1|  predicted protein                                      214   4e-62   
ref|XP_008243884.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic su...    212   4e-62   
gb|ABK95273.1|  unknown                                                 213   4e-62   
ref|XP_011006876.1|  PREDICTED: flavonol 3-sulfotransferase-like        213   4e-62   
sp|P52837.1|F4ST_FLACH  RecName: Full=Flavonol 4'-sulfotransferas...    212   5e-62   
ref|XP_009106067.1|  PREDICTED: cytosolic sulfotransferase 16           213   5e-62   
gb|AAK17133.1|AF325065_1  putative steroid sulfotransferase             213   5e-62   
ref|XP_010523510.1|  PREDICTED: cytosolic sulfotransferase 11-like      213   5e-62   
ref|XP_006388004.1|  hypothetical protein POPTR_0412s00210g             213   5e-62   
gb|ACR10265.1|  sulfotransferase 5a                                     213   5e-62   
gb|EYU31478.1|  hypothetical protein MIMGU_mgv1a009607mg                213   5e-62   
emb|CDX96515.1|  BnaA07g31260D                                          213   6e-62   
ref|XP_010672352.1|  PREDICTED: cytosolic sulfotransferase 8-like       213   6e-62   
ref|XP_011020518.1|  PREDICTED: cytosolic sulfotransferase 15-like      212   7e-62   
ref|XP_011001965.1|  PREDICTED: flavonol sulfotransferase-like          212   7e-62   
emb|CDX73052.1|  BnaC06g35000D                                          212   9e-62   
emb|CDY49688.1|  BnaA02g27270D                                          212   1e-61   
ref|XP_006416590.1|  hypothetical protein EUTSA_v10008073mg             212   1e-61   
ref|NP_565305.1|  cytosolic sulfotransferase 11                         212   1e-61   
gb|EYU29211.1|  hypothetical protein MIMGU_mgv1a010290mg                211   1e-61   
ref|XP_010523502.1|  PREDICTED: cytosolic sulfotransferase 11           211   1e-61   
emb|CDX73045.1|  BnaC06g34930D                                          212   1e-61   
emb|CDY19226.1|  BnaC05g14270D                                          211   2e-61   
ref|XP_004236073.1|  PREDICTED: flavonol 3-sulfotransferase-like        211   2e-61   
ref|XP_006442535.1|  hypothetical protein CICLE_v10024230mg             211   2e-61   
gb|ADB85371.1|  putative flavonol 3-sulfotransferase                    211   2e-61   
gb|KDP31403.1|  hypothetical protein JCGZ_11779                         211   2e-61   
ref|XP_010939220.1|  PREDICTED: cytosolic sulfotransferase 8-like...    212   2e-61   
ref|XP_002276423.2|  PREDICTED: cytosolic sulfotransferase 8-like       211   2e-61   
ref|XP_010911932.1|  PREDICTED: cytosolic sulfotransferase 7-like       211   2e-61   
ref|XP_010521619.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic su...    211   2e-61   
ref|XP_002876895.1|  hypothetical protein ARALYDRAFT_484284             211   3e-61   
ref|XP_010031026.1|  PREDICTED: cytosolic sulfotransferase 15-like      211   3e-61   
emb|CDY67730.1|  BnaCnng56120D                                          209   3e-61   
emb|CDY42346.1|  BnaA09g15810D                                          211   4e-61   
gb|KFK36076.1|  hypothetical protein AALP_AA4G074200                    210   4e-61   
ref|XP_002887526.1|  predicted protein                                  211   4e-61   
ref|XP_009113421.1|  PREDICTED: cytosolic sulfotransferase 11-like      210   4e-61   
ref|XP_010095980.1|  Flavonol sulfotransferase-like protein             210   5e-61   
gb|KFK33526.1|  hypothetical protein AALP_AA5G024400                    210   5e-61   
gb|ACD87064.1|  desulfo-glucosinolate sulfotransferase                  210   6e-61   
emb|CDP04183.1|  unnamed protein product                                210   6e-61   
ref|XP_010450178.1|  PREDICTED: cytosolic sulfotransferase 1-like       209   7e-61   
emb|CDX96512.1|  BnaA07g31230D                                          210   8e-61   
ref|XP_002514612.1|  Flavonol 4'-sulfotransferase, putative             210   8e-61   
gb|KCW81182.1|  hypothetical protein EUGRSUZ_C02549                     208   8e-61   
emb|CDX89350.1|  BnaA01g15430D                                          209   8e-61   
ref|XP_006291483.1|  hypothetical protein CARUB_v10017618mg             209   9e-61   
ref|XP_006442533.1|  hypothetical protein CICLE_v10021050mg             209   1e-60   
emb|CBI24935.3|  unnamed protein product                                209   1e-60   
ref|XP_010495506.1|  PREDICTED: cytosolic sulfotransferase 1-like       209   1e-60   
ref|XP_006385954.1|  hypothetical protein POPTR_0003s18750g             208   1e-60   
ref|XP_009106068.1|  PREDICTED: cytosolic sulfotransferase 18-like      209   2e-60   
emb|CDY45712.1|  BnaC02g35140D                                          209   2e-60   
ref|XP_002533884.1|  Flavonol 3-sulfotransferase, putative              209   2e-60   
gb|EYU36904.1|  hypothetical protein MIMGU_mgv1a009066mg                209   2e-60   
ref|XP_008785638.1|  PREDICTED: cytosolic sulfotransferase 8-like       209   2e-60   
emb|CDX73049.1|  BnaC06g34970D                                          209   2e-60   
emb|CDX73051.1|  BnaC06g34990D                                          209   2e-60   
ref|XP_003627666.1|  Steroid sulfotransferase-like protein              210   2e-60   
ref|XP_006391844.1|  hypothetical protein EUTSA_v10024068mg             208   2e-60   
ref|XP_011034726.1|  PREDICTED: cytosolic sulfotransferase 15-like      208   3e-60   
ref|XP_002527846.1|  Flavonol 3-sulfotransferase, putative              208   3e-60   
ref|XP_010458821.1|  PREDICTED: cytosolic sulfotransferase 1-like       208   3e-60   
ref|XP_009106065.1|  PREDICTED: cytosolic sulfotransferase 18           208   3e-60   
gb|EYU24756.1|  hypothetical protein MIMGU_mgv1a010113mg                208   3e-60   
ref|XP_008781218.1|  PREDICTED: cytosolic sulfotransferase 12-like      207   3e-60   
ref|XP_008779205.1|  PREDICTED: flavonol sulfotransferase-like          208   3e-60   
emb|CAN83405.1|  hypothetical protein VITISV_022677                     212   4e-60   
ref|XP_009124814.1|  PREDICTED: cytosolic sulfotransferase 3-like       207   4e-60   
ref|XP_010477038.1|  PREDICTED: cytosolic sulfotransferase 17-lik...    208   4e-60   
ref|XP_002276618.3|  PREDICTED: cytosolic sulfotransferase 12-like      213   5e-60   
gb|AET02142.2|  sulfotransferase                                        210   5e-60   
emb|CDY26750.1|  BnaA06g12720D                                          207   5e-60   
ref|XP_010670590.1|  PREDICTED: cytosolic sulfotransferase 5-like       207   6e-60   
ref|XP_010501514.1|  PREDICTED: cytosolic sulfotransferase 17-like      209   8e-60   
gb|EMT21913.1|  Sulfotransferase 16                                     207   9e-60   
ref|XP_010425370.1|  PREDICTED: cytosolic sulfotransferase 18-like      207   9e-60   
ref|XP_003627957.1|  Sulfotransferase                                   207   1e-59   
ref|XP_002890287.1|  sulfotransferase family protein                    207   1e-59   
ref|XP_008240109.1|  PREDICTED: LOW QUALITY PROTEIN: flavonol sul...    206   1e-59   
ref|XP_004972363.1|  PREDICTED: cytosolic sulfotransferase 18-like      206   1e-59   
gb|AEZ00077.1|  desulfoglucosinolate sulfotransferase                   207   1e-59   
ref|XP_006359081.1|  PREDICTED: cytosolic sulfotransferase 12-like      206   1e-59   
ref|XP_010502574.1|  PREDICTED: cytosolic sulfotransferase 18-like      207   1e-59   
ref|NP_177549.1|  desulfo-glucosinolate sulfotransferase 18             207   2e-59   
gb|AAM65627.1|  putative flavonol sulfotransferase                      207   2e-59   
gb|KCW80975.1|  hypothetical protein EUGRSUZ_C02340                     205   2e-59   
ref|XP_004972362.1|  PREDICTED: cytosolic sulfotransferase 18-like      206   2e-59   
gb|AEZ00073.1|  desulfoglucosinolate sulfotransferase                   207   2e-59   
gb|ACR10273.1|  sulfotransferase 5c                                     206   2e-59   
ref|NP_174139.1|  sulfotransferase 7                                    206   2e-59   
ref|XP_002890004.1|  sulfotransferase family protein                    206   2e-59   
ref|XP_009148006.1|  PREDICTED: cytosolic sulfotransferase 11-like      206   2e-59   
emb|CDY42798.1|  BnaC01g22680D                                          206   2e-59   
ref|XP_003575593.1|  PREDICTED: cytosolic sulfotransferase 5-like       206   2e-59   
gb|EYU27151.1|  hypothetical protein MIMGU_mgv1a010018mg                206   2e-59   
ref|XP_010041349.1|  PREDICTED: cytosolic sulfotransferase 15-like      205   3e-59   
ref|XP_008785019.1|  PREDICTED: flavonol 4'-sulfotransferase-like       206   3e-59   
gb|EYU38464.1|  hypothetical protein MIMGU_mgv1a010211mg                205   3e-59   
gb|KCW80603.1|  hypothetical protein EUGRSUZ_C01969                     204   3e-59   
ref|XP_010478184.1|  PREDICTED: cytosolic sulfotransferase 7-like       205   3e-59   
ref|XP_002524372.1|  Flavonol 4'-sulfotransferase, putative             207   4e-59   
ref|NP_172799.1|  sulfotransferase 4B                                   205   4e-59   
ref|XP_011083739.1|  PREDICTED: cytosolic sulfotransferase 15-like      205   4e-59   
gb|EYU27103.1|  hypothetical protein MIMGU_mgv1a022913mg                205   4e-59   
ref|XP_006857151.1|  hypothetical protein AMTR_s00065p00162460          204   4e-59   
ref|XP_002514613.1|  Flavonol 4'-sulfotransferase, putative             205   5e-59   
gb|EMT15415.1|  Sulfotransferase 17                                     205   5e-59   
gb|ACH41745.1|  ST5a                                                    205   5e-59   
emb|CDX94351.1|  BnaC01g18330D                                          204   6e-59   
ref|XP_006377321.1|  hypothetical protein POPTR_0011s04870g             205   6e-59   
gb|ACB73191.1|  desulfo-glucosinolate sulfotransferase                  205   6e-59   
ref|XP_006301074.1|  hypothetical protein CARUB_v10021467mg             205   7e-59   
gb|ACH41750.1|  ST5a                                                    204   8e-59   
ref|XP_006408668.1|  hypothetical protein EUTSA_v10002041mg             204   9e-59   
ref|XP_010670555.1|  PREDICTED: cytosolic sulfotransferase 5-like       204   9e-59   
ref|XP_006385960.1|  hypothetical protein POPTR_0003s18810g             204   9e-59   
ref|XP_006302485.1|  hypothetical protein CARUB_v10020580mg             204   1e-58   
ref|XP_006390467.1|  hypothetical protein EUTSA_v10018813mg             204   1e-58   
ref|XP_010416243.1|  PREDICTED: cytosolic sulfotransferase 18           204   1e-58   
gb|EMT03994.1|  Sulfotransferase 17                                     207   1e-58   
ref|XP_002524377.1|  Flavonol 3-sulfotransferase, putative              204   1e-58   
ref|XP_010939140.1|  PREDICTED: flavonol 3-sulfotransferase-like        204   1e-58   
sp|P52836.2|F3ST_FLACH  RecName: Full=Flavonol 3-sulfotransferase...    203   1e-58   
emb|CDY22189.1|  BnaC01g39120D                                          204   1e-58   
ref|XP_010428377.1|  PREDICTED: cytosolic sulfotransferase 18-like      204   1e-58   
ref|XP_008779204.1|  PREDICTED: cytosolic sulfotransferase 12-like      202   1e-58   
ref|XP_010440548.1|  PREDICTED: cytosolic sulfotransferase 1-like       203   2e-58   
gb|EMT24568.1|  Flavonol 4'-sulfotransferase                            204   2e-58   
ref|XP_006390466.1|  hypothetical protein EUTSA_v10018795mg             204   2e-58   
gb|ACH41747.1|  ST5a                                                    204   2e-58   
ref|XP_002297700.2|  hypothetical protein POPTR_0001s07380g             203   2e-58   
ref|XP_009336546.1|  PREDICTED: flavonol sulfotransferase-like          205   2e-58   
ref|XP_007010840.1|  Sulfotransferase 2A, putative                      202   2e-58   
ref|XP_009123345.1|  PREDICTED: cytosolic sulfotransferase 11-like      204   2e-58   
gb|ADW54463.1|  sulfotransferase                                        203   2e-58   
ref|XP_007133686.1|  hypothetical protein PHAVU_011G200600g             202   3e-58   
gb|AAM62638.1|  steroid sulfotransferase, putative                      203   3e-58   
gb|AEZ00072.1|  desulfoglucosinolate sulfotransferase                   203   3e-58   
ref|XP_007133771.1|  hypothetical protein PHAVU_011G207500g             202   3e-58   
ref|XP_010478181.1|  PREDICTED: cytosolic sulfotransferase 7-like       202   4e-58   
ref|XP_002524373.1|  Flavonol 3-sulfotransferase, putative              203   4e-58   
ref|XP_010499316.1|  PREDICTED: cytosolic sulfotransferase 7-like       202   4e-58   
ref|XP_010532214.1|  PREDICTED: cytosolic sulfotransferase 18-like      203   4e-58   
sp|P52835.1|F3ST_FLABI  RecName: Full=Flavonol 3-sulfotransferase...    202   4e-58   
ref|XP_009128026.1|  PREDICTED: cytosolic sulfotransferase 16           204   4e-58   
ref|XP_007133675.1|  hypothetical protein PHAVU_011G199600g             202   4e-58   
gb|EYU30501.1|  hypothetical protein MIMGU_mgv1a026637mg                202   4e-58   
sp|P52838.1|FSTL_FLABI  RecName: Full=Flavonol sulfotransferase-like    201   6e-58   
ref|XP_009149333.1|  PREDICTED: cytosolic sulfotransferase 17           202   7e-58   
ref|XP_010499321.1|  PREDICTED: cytosolic sulfotransferase 7-like       202   7e-58   
ref|XP_006302516.1|  hypothetical protein CARUB_v10020613mg             202   7e-58   
ref|XP_009123352.1|  PREDICTED: cytosolic sulfotransferase 11-like      202   7e-58   
ref|XP_009130910.1|  PREDICTED: cytosolic sulfotransferase 1-like       201   8e-58   
ref|XP_010435235.1|  PREDICTED: cytosolic sulfotransferase 1-like       201   9e-58   
ref|XP_007210773.1|  hypothetical protein PRUPE_ppa019757mg             202   1e-57   
ref|XP_006300900.1|  hypothetical protein CARUB_v10021268mg             202   1e-57   
ref|XP_006304016.1|  hypothetical protein CARUB_v10009741mg             201   1e-57   
ref|XP_006399077.1|  hypothetical protein EUTSA_v10014078mg             201   1e-57   
ref|XP_009397578.1|  PREDICTED: cytosolic sulfotransferase 8-like       201   1e-57   
gb|KFK43386.1|  hypothetical protein AALP_AA1G119300                    201   1e-57   
ref|XP_006377316.1|  hypothetical protein POPTR_0011s04810g             201   1e-57   
ref|XP_006399078.1|  hypothetical protein EUTSA_v10014092mg             201   2e-57   
ref|XP_004971359.1|  PREDICTED: cytosolic sulfotransferase 18-like      200   2e-57   
ref|XP_002888964.1|  sulfotransferase family protein                    201   2e-57   
ref|XP_008785086.1|  PREDICTED: flavonol 3-sulfotransferase-like        201   2e-57   
dbj|BAK00292.1|  predicted protein                                      201   2e-57   
gb|EYU27148.1|  hypothetical protein MIMGU_mgv1a010017mg                200   2e-57   
gb|KFK44012.1|  hypothetical protein AALP_AA1G203200                    201   2e-57   
ref|XP_011006878.1|  PREDICTED: flavonol sulfotransferase-like          201   2e-57   
gb|KFK43385.1|  hypothetical protein AALP_AA1G119200                    201   2e-57   
ref|XP_010428378.1|  PREDICTED: cytosolic sulfotransferase 16 iso...    201   2e-57   
ref|NP_001047758.2|  Os02g0684100                                       201   2e-57   
ref|XP_006291422.1|  hypothetical protein CARUB_v10017560mg             201   3e-57   
ref|XP_008240108.1|  PREDICTED: flavonol 4'-sulfotransferase-like       201   3e-57   
ref|XP_002446820.1|  hypothetical protein SORBIDRAFT_06g023150          201   3e-57   
ref|XP_010473277.1|  PREDICTED: cytosolic sulfotransferase 18-like      201   3e-57   
ref|XP_009397577.1|  PREDICTED: flavonol 4'-sulfotransferase-like       200   3e-57   
emb|CDY42747.1|  BnaA03g47920D                                          199   3e-57   
ref|XP_011011419.1|  PREDICTED: flavonol sulfotransferase-like          200   3e-57   



>ref|XP_006378523.1| sulfotransferase family protein [Populus trichocarpa]
 gb|ERP56320.1| sulfotransferase family protein [Populus trichocarpa]
Length=316

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 156/291 (54%), Positives = 206/291 (71%), Gaps = 6/291 (2%)
 Frame = +1

Query  181   QENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDII  360
             QEN   +E ++ I  +S+P E+GW+  H++ Y+GFW  +  L G L CQKHFQAQ  DI 
Sbjct  2     QENETSQEFKDLI--ASMPTEKGWMAKHLHRYQGFWHSTRQLQGVLVCQKHFQAQDGDIF  59

Query  361   VCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPM  540
             + T PK G+TWLKA++F+L  R  FP ++Q HPLLT +P  L+  +E  Y  + + DF  
Sbjct  60    LVTTPKSGSTWLKAVMFSLVNRVSFPDTKQ-HPLLTNNPHALVPFLEMEYIGKENLDF-T  117

Query  541   NGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIP  720
             N    R+ STHLPL  LP+SV +S CKL+ +CRN KDT VS+WHF NKLR   +   A  
Sbjct  118   NFTFPRLFSTHLPLLSLPRSVEDSDCKLVYLCRNPKDTFVSFWHFTNKLRP--IDWSATS  175

Query  721   FPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLG  900
               ETFD++CRG S++GPFWDHVLGYWKESLE P++V F+KYEE+K EP ++LRR++ FLG
Sbjct  176   LEETFDKFCRGVSLYGPFWDHVLGYWKESLERPQRVFFMKYEEMKNEPRIQLRRLSEFLG  235

Query  901   CPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             CPFS EEE  GV+  I  LCSFE+LSNLEVNK GK +  + + V+FR+G+V
Sbjct  236   CPFSLEEENSGVLDEILELCSFENLSNLEVNKIGKLHSGQEHQVFFRRGEV  286



>ref|XP_011009569.1| PREDICTED: cytosolic sulfotransferase 5-like [Populus euphratica]
 ref|XP_011009576.1| PREDICTED: cytosolic sulfotransferase 5-like [Populus euphratica]
Length=329

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 161/306 (53%), Positives = 209/306 (68%), Gaps = 12/306 (4%)
 Frame = +1

Query  142   PNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALR  321
             P  S SLP   + QEN   +E ++ I+S  LP E+GW+  H++ Y+GFW  +  L G L 
Sbjct  4     PEQSLSLP--GYLQENETSQEFKDLIVS--LPTEKGWMAKHLHQYQGFWHTTRQLQGVLA  59

Query  322   CQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNME  501
             CQKHFQAQ  DI + T PK G+TWLKA++FAL  R  FP ++Q HPLLT +P  L+  +E
Sbjct  60    CQKHFQAQDGDIFLVTTPKSGSTWLKAVMFALVNRVSFPDTKQ-HPLLTNNPHALMPFLE  118

Query  502   FSYSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMN  681
               Y  + + DF  N    R+ STHLPL  LP+SV +S CKL+ +CRN KD  VS WHF N
Sbjct  119   MEYIGKETLDF-TNFTFPRLFSTHLPLLSLPRSVEDSDCKLVYLCRNPKDIFVSLWHFTN  177

Query  682   KLRAELLGLEAIP--FPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeik  855
             KLR     ++ +P    ETFD++CRG S++GPFWDHVLGYWKESLE PR+V FLKYEE+K
Sbjct  178   KLRP----IDWVPSSLEETFDKFCRGVSLYGPFWDHVLGYWKESLERPRRVFFLKYEEMK  233

Query  856   eepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVY  1035
              EP ++LRR++ FLGCPFS EEE  GV+  I  LCSFE+LSNLEVN  G+ +    +  +
Sbjct  234   NEPRIQLRRLSEFLGCPFSLEEENSGVLDEILELCSFENLSNLEVNNIGRLHSGEEHQAF  293

Query  1036  FRKGKV  1053
             FR+G+V
Sbjct  294   FRRGEV  299



>ref|XP_011009587.1| PREDICTED: cytosolic sulfotransferase 12-like [Populus euphratica]
Length=329

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 159/306 (52%), Positives = 210/306 (69%), Gaps = 8/306 (3%)
 Frame = +1

Query  136   SDPNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGA  315
             S P  S SLP   + QEN   +E ++ I+S  LP E+GW+  H++ Y+GFW  +  L G 
Sbjct  2     SSPKQSLSLP--GYLQENETSQEFKDLIVS--LPTEKGWMAKHLHQYQGFWHTTRQLTGV  57

Query  316   LRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRN  495
             L CQKHFQAQ  DI + T PK G+TWLKA++F+L  R  FP ++Q HPLLT +P  L+  
Sbjct  58    LACQKHFQAQDGDIFLVTNPKSGSTWLKAVMFSLVNRVSFPDTKQ-HPLLTNNPHALMPF  116

Query  496   MEFSYSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHF  675
             +E  Y  + + DF  +    R+ STHLPL  LP+SV +S CKL+ +CRN KDT VS WHF
Sbjct  117   LEMEYVGKENLDF-TSFTFPRLFSTHLPLLSLPRSVEDSDCKLVYLCRNPKDTFVSLWHF  175

Query  676   MNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeik  855
              NKLR    G  +    ETFD++CRG  ++GPFWDHVLGYWKESLE P++V FLKYEE+K
Sbjct  176   TNKLRPIDWG--STSLEETFDKFCRGVCLYGPFWDHVLGYWKESLERPQRVFFLKYEEMK  233

Query  856   eepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVY  1035
              EP ++LRR++ FLGCPF+ EEE  GV+  I  LCSFE+LSNLEVNK G+ +  + +  +
Sbjct  234   NEPRMQLRRLSEFLGCPFTLEEENSGVLDEILELCSFENLSNLEVNKIGRLHSGQEHQAF  293

Query  1036  FRKGKV  1053
             FR+G+V
Sbjct  294   FRRGEV  299



>ref|XP_002267209.1| PREDICTED: cytosolic sulfotransferase 12 [Vitis vinifera]
Length=333

 Score =   282 bits (722),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 157/299 (53%), Positives = 204/299 (68%), Gaps = 7/299 (2%)
 Frame = +1

Query  160   LPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQ  339
             LP  ++ QE+   +E R+ +  SSLPRE+GW+  H++ Y+GFW  S  L G + CQ+HFQ
Sbjct  8     LPLPEYLQEDEVTQEHRDLL--SSLPREKGWVTSHLFQYQGFWHTSRHLKGVVACQQHFQ  65

Query  340   AQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSR  516
             A  +DI++ T PK GTTWLKA+ FAL  R +FP ++  HPLLT +P EL+  +E   Y+ 
Sbjct  66    AHDTDILLVTTPKSGTTWLKAMAFALLKRVRFPDTRH-HPLLTNNPHELVPFLEIKLYAE  124

Query  517   EISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAE  696
                PD   +    R+ STHLP   LP+SV  S CKL+ +CRN +DT VS+W F NKLR E
Sbjct  125   SKVPDL-TSFTAPRLFSTHLPFTSLPESVNTSGCKLVYLCRNPRDTFVSFWQFTNKLRLE  183

Query  697   LLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveL  876
              +G    P  E FD++C G S+ GPFWDHVLGYWKESLE P K+LFLKYEE+K +P V+L
Sbjct  184   NMGTN--PLEEVFDKFCWGVSLSGPFWDHVLGYWKESLEKPEKILFLKYEEMKAQPHVQL  241

Query  877   RRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             RR+A FLGCPF  EEE   VV  I +LCSFE+LSNLEVNK GK      ++ +FR+G+V
Sbjct  242   RRLAEFLGCPFCPEEETRCVVDEILQLCSFENLSNLEVNKNGKLSSGEEHSAFFRRGEV  300



>ref|XP_002512030.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
 gb|EEF50699.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
Length=354

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/293 (52%), Positives = 199/293 (68%), Gaps = 5/293 (2%)
 Frame = +1

Query  175   FFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSD  354
             + QE    +E R+ I+S  LP E+GW+  +++ Y+GFW  +  L G + CQ HFQAQ SD
Sbjct  37    YLQEKDLSQECRDLIVS--LPAEKGWVANYLHQYQGFWHTTRQLKGVIACQNHFQAQESD  94

Query  355   IIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDF  534
             I + T PK GTTWLKA++FAL  RK F  ++Q HPLLT +P  L+  +E  Y     PDF
Sbjct  95    IFLVTTPKSGTTWLKAIMFALVNRKHFSDTKQQHPLLTNNPHVLVPFLEHQYIDTQLPDF  154

Query  535   PMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEA  714
               +    R+ STHLP   LPKSV +  CKL+ +CRN KDT VS WHF NKLR +  G  +
Sbjct  155   -TSFTSPRLFSTHLPFASLPKSVEDWGCKLVYLCRNPKDTFVSLWHFTNKLRPKEKGENS  213

Query  715   IPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGF  894
             +   ETFD++CRG S++GPFWDHVLGYWK+SLE P +VLFLKYE+ KEEP+  L +++ F
Sbjct  214   LE--ETFDKFCRGVSLYGPFWDHVLGYWKQSLEKPERVLFLKYEDFKEEPKGHLMKLSEF  271

Query  895   LGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             L CPFS+EEE  G +  I  LCSF+ LSNLEVNKTGK      N+ +FR+G+V
Sbjct  272   LNCPFSQEEESSGAMDEILNLCSFDYLSNLEVNKTGKLPSGEENSAFFRRGQV  324



>ref|XP_006348649.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=335

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 155/307 (50%), Positives = 208/307 (68%), Gaps = 7/307 (2%)
 Frame = +1

Query  136   SDPNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGA  315
             S   TS  +P  K+ QE+    E ++ +++  LP+E GWL  H+YNY+GFW+   F+ G 
Sbjct  2     SKSQTSPQIP-PKYLQEDEISDECKKLLLT--LPKERGWLASHIYNYQGFWVAPRFIQGV  58

Query  316   LRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRN  495
             + CQ+ FQAQ SDII+ T PK GTTWLK+L+F L  R ++PV +Q HPLL  +P +LI  
Sbjct  59    IACQQQFQAQDSDIILVTTPKSGTTWLKSLLFVLVNRMKYPVFEQNHPLLVKNPHDLIPF  118

Query  496   MEFS-YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWH  672
             +E   Y   + P+F  +    R+LSTH+P   LPKSV +SK KL+ +CRN KDT +S WH
Sbjct  119   LEIKLYVDGLVPNF-ASFTSPRLLSTHMPFASLPKSVQDSKTKLVYLCRNPKDTFISLWH  177

Query  673   FMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeei  852
             F N LR  L   +  P  E F+ +C+G S++GPFW+HVL YWK+S+E P KVLFL YEEI
Sbjct  178   FTNNLR--LHHKDIHPIEEKFESFCKGVSLYGPFWNHVLDYWKQSIEKPNKVLFLMYEEI  235

Query  853   keepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNV  1032
             K +P+++L+R+A FL CPFS EEE  GV+  I R+CSFE+LSNLEVN  GK      NN 
Sbjct  236   KVQPKLQLKRLAEFLECPFSIEEENCGVMDEILRMCSFENLSNLEVNADGKLSTGEENNA  295

Query  1033  YFRKGKV  1053
             +FRKG+V
Sbjct  296   FFRKGEV  302



>emb|CDP00476.1| unnamed protein product [Coffea canephora]
Length=333

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 153/295 (52%), Positives = 204/295 (69%), Gaps = 7/295 (2%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             K+ Q++   +E  E +   SLP+E+GW+  ++Y Y+GFW  +  L G + CQKHF+AQ S
Sbjct  15    KYLQDDKLTQECEELL--PSLPKEKGWVSSYLYQYRGFWHSARQLQGVVACQKHFEAQDS  72

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISP  528
             DI + T PK GTTWLKAL+FAL  R QF   +Q HPLL  SP EL+  ++ + Y    +P
Sbjct  73    DIFLVTTPKSGTTWLKALLFALVNRMQFSFMEQ-HPLLMHSPHELVPYLDSNIYVENQTP  131

Query  529   DFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGL  708
             D   +    R+ +THLPL  LP+SV E  CK++ +CR+ KDT VS WHF NKLR E   +
Sbjct  132   DLS-SFTSPRLFATHLPLVSLPQSVHECPCKIVYLCRDPKDTFVSLWHFANKLRLE--NM  188

Query  709   EAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIA  888
             E+    + FDR+C+G S++GPFWDHVLGYWKESLENP KVLFLKYE++KE+P  +L++I+
Sbjct  189   ESNSLEDVFDRFCKGVSVYGPFWDHVLGYWKESLENPDKVLFLKYEDLKEKPTSQLKKIS  248

Query  889   GFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              FLG PFS EEE  G++ GI  LCSF+ LSNLEVNK+GK      N  +FR+G+V
Sbjct  249   DFLGYPFSSEEEASGLLEGIIDLCSFDKLSNLEVNKSGKLSSGEENKAFFRRGEV  303



>ref|XP_003628738.1| Flavonol sulfotransferase-like protein [Medicago truncatula]
 gb|AET03214.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=333

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 163/315 (52%), Positives = 204/315 (65%), Gaps = 17/315 (5%)
 Frame = +1

Query  124   MAAPSDPNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEF  303
             M   SD N +  LP  K+ +E+   +E ++ I   +LP  EGW+ P  + Y+GFW   + 
Sbjct  1     MTKSSDENPT--LP--KYLKEDDLGQECKDLI--QTLPLVEGWIDPTFHEYQGFWFAPKI  54

Query  304   LHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQE  483
             L GAL  QKHFQA  +DII+ T PK GTTWLKAL FAL  R ++P   + HPLLT++P  
Sbjct  55    LQGALSFQKHFQAIDTDIILVTNPKSGTTWLKALTFALINRNKYPNIHKNHPLLTSNPHV  114

Query  484   LIRNMEFS--YSREISPDFPMNGNGF---RVLSTHLPLELLPKSVWESKCKLICVCRNQK  648
             L+  ME +  Y  +I P+     N     R+ STH P  LLPKS+ ES CK++ +CR+ K
Sbjct  115   LVPFMEINLYYETDIVPEL----NSLSPPRIFSTHNPYVLLPKSLKESNCKVVYLCRDPK  170

Query  649   DTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKV  828
             DT VS WHF NKLR +  G   +P  E F+ +CRG + +GPFWDHVLGYWKESLE P KV
Sbjct  171   DTFVSLWHFSNKLREQSRG--TLPLEEAFESFCRGTTSYGPFWDHVLGYWKESLERPEKV  228

Query  829   LFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKT  1008
             +FLKYEE+K +P   L+ IA FLGCPFSEEEE  GVV  I  LCSFE LSNLE+NK GK 
Sbjct  229   MFLKYEEMKMKPNFVLKEIAKFLGCPFSEEEESNGVVDDILHLCSFEKLSNLEINKNGKI  288

Query  1009  YHERPNNVYFRKGKV  1053
               E  N  +FR GKV
Sbjct  289   SSEIENKNFFRLGKV  303



>ref|XP_009598362.1| PREDICTED: cytosolic sulfotransferase 12-like [Nicotiana tomentosiformis]
Length=333

 Score =   277 bits (708),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 156/294 (53%), Positives = 202/294 (69%), Gaps = 11/294 (4%)
 Frame = +1

Query  196   PKELRESIISS-------SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSD  354
             PK LRE  ++        +LP+E GWL  H+YNY+GFW+    L G + CQ+ FQAQ SD
Sbjct  12    PKYLREDELNEESKKLLLTLPKERGWLASHIYNYQGFWIAPRHLQGVIACQQQFQAQDSD  71

Query  355   IIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPD  531
             II+ T PK GTTWLKALVFAL  R +FP S+Q HPLL  +P +L+  +E   Y     P+
Sbjct  72    IILVTSPKSGTTWLKALVFALVNRIRFPFSEQNHPLLVNNPHDLVPFLELKLYIDGQVPN  131

Query  532   FPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLE  711
             F  +    R+LSTHLP   LPKSV  SK KL+ +CRN +D  +S +HF N LR E +G  
Sbjct  132   FS-SFTSPRLLSTHLPYGSLPKSVQHSKNKLVYLCRNPRDIFISLFHFTNNLRIENMGTN  190

Query  712   AIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAG  891
             +I   E  D +C+G S++GPFW+HVL YWK+S+ENP+KVLFL YEE+KE+PE++L+R+A 
Sbjct  191   SI--EEMLDLFCKGVSLYGPFWNHVLDYWKKSIENPKKVLFLMYEEMKEQPEIQLKRLAE  248

Query  892   FLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             FLGC FS EEE+ GVV  I ++CSFE+LSNLEVNK  K      N V+FR+GKV
Sbjct  249   FLGCSFSIEEEKSGVVDEILKMCSFENLSNLEVNKNEKLSTGEENKVFFRRGKV  302



>gb|KDP41358.1| hypothetical protein JCGZ_15765 [Jatropha curcas]
Length=310

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/285 (52%), Positives = 200/285 (70%), Gaps = 5/285 (2%)
 Frame = +1

Query  199   KELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPK  378
             ++ R+ I+S  LP E+GW+  H++ Y+GFW  +  L G + CQ HFQAQ +DI + T PK
Sbjct  3     QDFRDFIVS--LPTEKGWVANHLHQYQGFWHPTRQLKGVIACQNHFQAQENDIFLITTPK  60

Query  379   CGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFR  558
              GTTWLKAL FAL  R +FP  ++ HPLLT +P  L+  ++ +Y    SPDF  +    R
Sbjct  61    SGTTWLKALTFALVNRVRFPNPKENHPLLTNNPHVLVPFLDMAYIDTDSPDFS-SFTSPR  119

Query  559   VLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFD  738
             + STHLP   LPKSV +  CK++ +CRN KDT VS +HF N+LR +  G  ++   E FD
Sbjct  120   LFSTHLPFVSLPKSVEDLGCKIVYLCRNPKDTFVSLYHFTNRLRHKEKGENSLE--EVFD  177

Query  739   RYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSee  918
             ++CRG S++GPFWDHVLGYWK+SLENP++VLFLKYE+ KEEP++ L++++ FL CPFSEE
Sbjct  178   KFCRGVSLYGPFWDHVLGYWKQSLENPKRVLFLKYEDFKEEPKLHLKKLSEFLECPFSEE  237

Query  919   eeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             EE   V+  I  LCSF++LSNLEVNKTGK      N  +FR+G++
Sbjct  238   EENHTVIDQILNLCSFDNLSNLEVNKTGKLPSGEENCAFFRRGEI  282



>gb|KDO70277.1| hypothetical protein CISIN_1g019700mg [Citrus sinensis]
Length=337

 Score =   276 bits (705),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 158/312 (51%), Positives = 204/312 (65%), Gaps = 11/312 (4%)
 Frame = +1

Query  127   AAPSDPNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFL  306
             + P+ P ++ SLP  K+ QE+   +E RE I  SSLP E GW+  H+Y Y+GFW  S  L
Sbjct  4     SLPTQP-SAVSLP--KYLQEDELTQECRELI--SSLPAETGWVVDHLYQYQGFWHTSREL  58

Query  307   HGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQEL  486
              G L CQKHFQAQ SDI++ T PK GTTWLKA+ FA+  R ++  +   HPLLT +P EL
Sbjct  59    QGVLACQKHFQAQDSDILLVTTPKAGTTWLKAITFAIVNRLRYVDNPCNHPLLTNNPHEL  118

Query  487   IRNMEFS-YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESK--CKLICVCRNQKDTV  657
             +  +E   Y     PD        R+ +THLP   LP SV +S   CKL+ +CRN KD  
Sbjct  119   VPFIELKLYVDNQVPDL-TTLTSPRLFATHLPFVSLPASVKDSSSACKLVYLCRNPKDIF  177

Query  658   VSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFL  837
             VS WHF NKLR E  G  ++   ETFD++CRG S++GPFWDH+LGYWK S+E P +V FL
Sbjct  178   VSLWHFTNKLRPEEKGTNSLE--ETFDKFCRGVSLYGPFWDHILGYWKASMEKPDRVFFL  235

Query  838   KYeeikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHE  1017
             KYEE+KE+P + L+ +A FLGCPFS  EE  G+V  I +LCSF++LSNLEVN+ GK    
Sbjct  236   KYEELKEQPSLRLKMLAEFLGCPFSPAEEANGLVDDILKLCSFDNLSNLEVNRNGKMSSG  295

Query  1018  RPNNVYFRKGKV  1053
                N +FR+G V
Sbjct  296   EGYNAFFRRGVV  307



>ref|XP_006484253.1| PREDICTED: cytosolic sulfotransferase 12-like [Citrus sinensis]
Length=337

 Score =   275 bits (704),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 158/312 (51%), Positives = 204/312 (65%), Gaps = 11/312 (4%)
 Frame = +1

Query  127   AAPSDPNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFL  306
             + P+ P ++ SLP  K+ QE+   +E RE I  SSLP E GW+  H+Y Y+GFW  S  L
Sbjct  4     SLPTQP-SAVSLP--KYLQEDELTQECRELI--SSLPAETGWVVDHLYQYQGFWHTSREL  58

Query  307   HGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQEL  486
              G L CQKHFQAQ SDI++ T PK GTTWLKA+ FA+  R ++  +   HPLLT +P EL
Sbjct  59    QGVLACQKHFQAQDSDILLVTTPKAGTTWLKAITFAIVNRLRYVDNPCNHPLLTNNPHEL  118

Query  487   IRNMEFS-YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESK--CKLICVCRNQKDTV  657
             +  +E   Y     PD        R+ +THLP   LP SV +S   CKL+ +CRN KD  
Sbjct  119   VPFIELKLYVDNQVPDL-TTLTSPRLFATHLPFVSLPASVKDSSSACKLVYLCRNPKDIF  177

Query  658   VSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFL  837
             VS WHF NKLR E  G  ++   ETFD++CRG S++GPFWDH+LGYWK S+E P +V FL
Sbjct  178   VSLWHFTNKLRPEEKGTNSLE--ETFDKFCRGVSLYGPFWDHILGYWKASMEKPDRVFFL  235

Query  838   KYeeikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHE  1017
             KYEE+KE+P + L+ +A FLGCPFS  EE  G+V  I +LCSF++LSNLEVN+ GK    
Sbjct  236   KYEELKEQPSLRLKMLAEFLGCPFSPAEEANGLVDDILKLCSFDNLSNLEVNRNGKMSSG  295

Query  1018  RPNNVYFRKGKV  1053
                N +FR+G V
Sbjct  296   EGYNTFFRRGVV  307



>ref|XP_009620813.1| PREDICTED: cytosolic sulfotransferase 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=369

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 154/297 (52%), Positives = 207/297 (70%), Gaps = 9/297 (3%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             K  +EN + +  ++ +  SSLP+ +GWL PH+Y Y+GFWL +  LHG L  Q  FQAQ S
Sbjct  46    KCLEENGFSQTFKDLL--SSLPKAKGWLSPHLYKYQGFWLTALHLHGTLSFQHCFQAQDS  103

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSRE---I  522
             DI++ T PK GT WLKA+VF L  R   P+  Q HPLLT +P +L+  +E +Y++E   I
Sbjct  104   DILLITSPKSGTIWLKAMVFTLINRMSHPILSQEHPLLTINPHDLVPFLELNYAQEKNPI  163

Query  523   SPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELL  702
             SP+  +   G  + STHLP   LP+SV  +KCK+I +CRN +DT VS WH+++KLR++  
Sbjct  164   SPNSSLTSPG--LYSTHLPYVSLPESVKNTKCKIIYMCRNPRDTFVSLWHYISKLRSQ--  219

Query  703   GLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRR  882
               + IPF E FD +C G +M GPFWDHVL YW++SLE P+KV FLKYEE+KE+P + L+ 
Sbjct  220   DSKMIPFEEAFDMFCNGLTMAGPFWDHVLSYWEKSLEMPQKVFFLKYEEVKEQPCLHLKC  279

Query  883   IAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +A FL  PFS EEEE G++  I +LCSFE+LSNLEVNK+GKT     N V+FRKG+V
Sbjct  280   LAEFLERPFSLEEEESGLMNEIIKLCSFENLSNLEVNKSGKTVFGNDNRVFFRKGEV  336



>ref|XP_009620812.1| PREDICTED: cytosolic sulfotransferase 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=378

 Score =   276 bits (706),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 154/297 (52%), Positives = 207/297 (70%), Gaps = 9/297 (3%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             K  +EN + +  ++ +  SSLP+ +GWL PH+Y Y+GFWL +  LHG L  Q  FQAQ S
Sbjct  46    KCLEENGFSQTFKDLL--SSLPKAKGWLSPHLYKYQGFWLTALHLHGTLSFQHCFQAQDS  103

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSRE---I  522
             DI++ T PK GT WLKA+VF L  R   P+  Q HPLLT +P +L+  +E +Y++E   I
Sbjct  104   DILLITSPKSGTIWLKAMVFTLINRMSHPILSQEHPLLTINPHDLVPFLELNYAQEKNPI  163

Query  523   SPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELL  702
             SP+  +   G  + STHLP   LP+SV  +KCK+I +CRN +DT VS WH+++KLR++  
Sbjct  164   SPNSSLTSPG--LYSTHLPYVSLPESVKNTKCKIIYMCRNPRDTFVSLWHYISKLRSQ--  219

Query  703   GLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRR  882
               + IPF E FD +C G +M GPFWDHVL YW++SLE P+KV FLKYEE+KE+P + L+ 
Sbjct  220   DSKMIPFEEAFDMFCNGLTMAGPFWDHVLSYWEKSLEMPQKVFFLKYEEVKEQPCLHLKC  279

Query  883   IAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +A FL  PFS EEEE G++  I +LCSFE+LSNLEVNK+GKT     N V+FRKG+V
Sbjct  280   LAEFLERPFSLEEEESGLMNEIIKLCSFENLSNLEVNKSGKTVFGNDNRVFFRKGEV  336



>ref|XP_006437857.1| hypothetical protein CICLE_v10031848mg [Citrus clementina]
 gb|ESR51097.1| hypothetical protein CICLE_v10031848mg [Citrus clementina]
Length=377

 Score =   276 bits (705),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 161/324 (50%), Positives = 209/324 (65%), Gaps = 13/324 (4%)
 Frame = +1

Query  91    YLQINTIHFNSMAAPSDPNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMY  270
             Y+Q + I   S+  P+ P ++ SLP  K+ QE+   +E RE I  SSLP E GW+  H+Y
Sbjct  34    YIQASPIMPTSV--PTQP-SAVSLP--KYLQEDELTQECRELI--SSLPAETGWVVDHLY  86

Query  271   NYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQ  450
              Y+GFW  S  L G L CQKHFQAQ SDI++ T PK GTTWLKA+ FA+  R ++  +  
Sbjct  87    QYQGFWHTSRELQGVLACQKHFQAQDSDILLVTTPKAGTTWLKAITFAIVNRLRYVDNPC  146

Query  451   THPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESK--CK  621
              HPLLT +P EL+  +E   Y     PD        R+ +THLP   LP SV +S   CK
Sbjct  147   NHPLLTNNPHELVPFIELKLYVDNQVPDL-TTLTSPRLFATHLPFVSLPASVKDSSSACK  205

Query  622   LICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWK  801
             L+ +CRN KD  VS WHF NKLR E  G  ++   ETFD++CRG S++GPFWDH+LGYWK
Sbjct  206   LVYLCRNPKDIFVSLWHFTNKLRPEEKGTNSLE--ETFDKFCRGVSLYGPFWDHILGYWK  263

Query  802   ESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSN  981
              S+E P +V FLKYEE+KE+P + L+ +A F GCPFS  EE  G+V  I +LCSF++LSN
Sbjct  264   ASMEKPDRVFFLKYEELKEQPSLRLKMLAEFWGCPFSPAEEANGLVDDILKLCSFDNLSN  323

Query  982   LEVNKTGKTYHERPNNVYFRKGKV  1053
             LEVN+ GK       N +FR+G V
Sbjct  324   LEVNRNGKMSSGEGYNTFFRRGVV  347



>ref|XP_006348794.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=332

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/303 (51%), Positives = 206/303 (68%), Gaps = 7/303 (2%)
 Frame = +1

Query  148   TSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQ  327
             TS + P  K+ +E+S  +E ++ +  S LP+E+GW+  ++YNY+GFW+    L G + CQ
Sbjct  3     TSQTFP-PKYLKEDSLSEECKKLL--SILPKEKGWIGSYIYNYQGFWISPRLLQGVIACQ  59

Query  328   KHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS  507
             K FQAQ SDI + T PK GT WLK+L+FAL  R + P+ +Q HPLL  +P +L+  +E +
Sbjct  60    KQFQAQDSDIFLVTNPKSGTIWLKSLLFALVNRMKHPMFEQNHPLLNKNPHDLVPFLELT  119

Query  508   -YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNK  684
              Y     PDF  +    R+LSTHLP   LPKS  +SK KL+ +CRN KDT +S WHF N 
Sbjct  120   LYVDGQVPDFS-SFTTPRLLSTHLPFASLPKSAQDSKTKLVYLCRNPKDTFISMWHFSNN  178

Query  685   LRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeep  864
             LR       +I   E FD YC+G S++GPFWDHVL YWK+S+ENP KVLFL YEEIKE+P
Sbjct  179   LRLHHKDTNSIE--EMFDLYCKGMSVYGPFWDHVLDYWKQSIENPNKVLFLMYEEIKEQP  236

Query  865   eveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRK  1044
             ++ L+R+A FL CPFS +EE  GVV  I R+CSF++LSNLEVN TGK      N V+FR+
Sbjct  237   KMHLKRLAEFLECPFSIKEENCGVVDEILRMCSFKNLSNLEVNTTGKLSTGEENKVFFRR  296

Query  1045  GKV  1053
             G++
Sbjct  297   GEI  299



>ref|XP_009616636.1| PREDICTED: cytosolic sulfotransferase 12-like [Nicotiana tomentosiformis]
Length=335

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/295 (52%), Positives = 205/295 (69%), Gaps = 6/295 (2%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             K+ QE+   +E ++ +  S+LP+E+G +  ++YNY+GFW+    + G + CQK FQAQ S
Sbjct  13    KYLQEDGLSEECKKLL--STLPKEKGLIGSYIYNYQGFWVSPRIIQGVIACQKQFQAQES  70

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISP  528
             DII+ T PK GTTWLKALVF L  R +FP+S Q HPLL  +P  L+  +E   Y     P
Sbjct  71    DIILVTTPKSGTTWLKALVFTLVNRIRFPLSAQNHPLLVKNPHSLVPFLELKLYIDGQVP  130

Query  529   DFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGL  708
             DF  +    R+L+THLP   LPKSV +SK KLI +CRN +DT +S WHF NKLR+  +  
Sbjct  131   DFS-SFTTHRLLATHLPFASLPKSVQDSKSKLIYLCRNPRDTFISMWHFTNKLRSHYIDT  189

Query  709   EAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIA  888
              +I   E FD +C+G S+FGPFWDHVL YWK+SLE P++VLFL YEEIKE+PE++L+R+A
Sbjct  190   NSIE--EMFDLFCKGVSLFGPFWDHVLDYWKKSLEKPKRVLFLMYEEIKEKPEIQLKRLA  247

Query  889   GFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              FL C FSEEEE  GVV  I ++CSFE+LSNLEVNK  K      + ++FR+G+V
Sbjct  248   EFLECSFSEEEETSGVVNEILKMCSFENLSNLEVNKNEKWPTGEEHKLFFRRGEV  302



>ref|XP_006388018.1| hypothetical protein POPTR_0396s00220g [Populus trichocarpa]
 gb|ERP46932.1| hypothetical protein POPTR_0396s00220g [Populus trichocarpa]
Length=304

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/264 (56%), Positives = 188/264 (71%), Gaps = 4/264 (2%)
 Frame = +1

Query  262   HMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPV  441
             H++ Y+GFW  +  L G L CQKHFQAQ  DI + T PK G+TWLKA++F+L  R  FP 
Sbjct  4     HLHRYQGFWHSTRQLQGVLACQKHFQAQDGDIFLVTTPKSGSTWLKAVMFSLVNRVSFPD  63

Query  442   SQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCK  621
             ++Q HPLLT +P  L+  +E  Y  + + DF  N    R+ STHLPL  LP+SV +S CK
Sbjct  64    TKQ-HPLLTNNPHALVPFLEMEYIGKENLDF-TNFTFPRLFSTHLPLLSLPRSVEDSDCK  121

Query  622   LICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWK  801
             L+ +CRN KDT VS+WHF NKL    +G  A    ETFD++CRG S++GPFWDHVLGYWK
Sbjct  122   LVYLCRNPKDTFVSFWHFTNKLTP--IGWSATSLEETFDKFCRGVSLYGPFWDHVLGYWK  179

Query  802   ESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSN  981
             ESLE P +V FLKYEE+K EP ++LRR++ FLGCPFS EEE  GV+  I  LCSFE+LSN
Sbjct  180   ESLERPHRVFFLKYEEMKREPRIQLRRLSEFLGCPFSLEEENSGVLDEILELCSFENLSN  239

Query  982   LEVNKTGKTYHERPNNVYFRKGKV  1053
             LEVNK GK +  + + V+FR+G+V
Sbjct  240   LEVNKIGKLHSGQEHRVFFRRGEV  263



>ref|XP_011070903.1| PREDICTED: cytosolic sulfotransferase 12-like [Sesamum indicum]
Length=356

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 158/323 (49%), Positives = 212/323 (66%), Gaps = 11/323 (3%)
 Frame = +1

Query  94    LQINTIHFNS-MAAPSDPNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMY  270
             +QI T   +S    PSD  T    P     QE +  +E +  I  S+LP+E+GWL  H+Y
Sbjct  12    VQIQTQDCHSRQNMPSDRTTV--FPPKYLQQEETLAEECKNLI--STLPKEKGWLASHLY  67

Query  271   NYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQ  450
              Y+GFW  +  L G + CQKHFQAQ SDI + T+PK GTTWLKA++F L  RK++PV + 
Sbjct  68    QYQGFWYAARHLQGVISCQKHFQAQDSDIFLVTIPKSGTTWLKAIIFTLVNRKRYPVVK-  126

Query  451   THPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWES-KCKL  624
              HPL++ +P +L+  +E   Y+    PD  ++    R+ STHLP   LP+S   S K KL
Sbjct  127   NHPLISHNPHDLVPFLEIKLYADNQIPDI-VSSPSPRLFSTHLPYVSLPESAKNSSKSKL  185

Query  625   ICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKE  804
             + +CRN KDT VS WHF NKLR + +G  ++   E F+ Y +G S+FGPFWDHV  YWK+
Sbjct  186   VYLCRNPKDTFVSLWHFTNKLRLQEMGSNSMG--EVFELYSKGVSLFGPFWDHVQEYWKQ  243

Query  805   SLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNL  984
             SLENP ++LFLK+E++KE P V LRR+A FLGCPF   EEE G+V  I +LCSF++LS L
Sbjct  244   SLENPDRILFLKFEDMKERPAVHLRRLAEFLGCPFEGYEEESGLVEEILKLCSFDNLSGL  303

Query  985   EVNKTGKTYHERPNNVYFRKGKV  1053
             EVNKTGK      NN +FR+G++
Sbjct  304   EVNKTGKLSSGEENNAFFRRGEI  326



>gb|KEH33293.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=334

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 209/316 (66%), Gaps = 18/316 (6%)
 Frame = +1

Query  124   MAAPSDPNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEF  303
             MA   D N+   +P  K+ QE+   KE +E I   +LP E+GW+  H + Y+GFW+ +  
Sbjct  1     MAKLGDENSL--VP--KYLQEDELGKECKELI--QTLPLEKGWISTHFHQYQGFWIGTRI  54

Query  304   LHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFP-VSQQTHPLLTTSPQ  480
             L G L CQKHFQA ++DI++ T PK GTTWLKAL FAL  RK++  +    HPLLT++P 
Sbjct  55    LQGVLSCQKHFQALNTDILLVTTPKSGTTWLKALTFALINRKKYQNIHNFNHPLLTSNPH  114

Query  481   ELIRNMEFS--YSREISPDFPMNGNGF---RVLSTHLPLELLPKSVWESKCKLICVCRNQ  645
              L+  +E    Y ++  P    N N     R+ +TH+P ELLPKSV ES CK++ +CR+ 
Sbjct  115   VLVPFLEVDLYYDKDYVP----NLNSLSPPRLFATHIPYELLPKSVKESSCKVVYLCRDP  170

Query  646   KDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRK  825
             KDT  S WHF NK+R++  G   +P  E+F  + RG ++FGPFW+HVLGYWKESLE   K
Sbjct  171   KDTFASLWHFSNKVRSQSSG--TLPLEESFHNFTRGVTLFGPFWEHVLGYWKESLERSNK  228

Query  826   VLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGK  1005
             V+FL++EE+K +P+  L+++A FL CPF+++EE  GVV  I  LCSFE LSNLEVNKTGK
Sbjct  229   VMFLRFEEMKMKPDFHLKKLAEFLECPFTKDEESKGVVDDILNLCSFEKLSNLEVNKTGK  288

Query  1006  TYHERPNNVYFRKGKV  1053
                   N  +FR+G+V
Sbjct  289   VSFGVENKAFFRRGQV  304



>ref|XP_007045763.1| Flavonol 4'-sulfotransferase, putative [Theobroma cacao]
 gb|EOY01595.1| Flavonol 4'-sulfotransferase, putative [Theobroma cacao]
Length=395

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 157/300 (52%), Positives = 200/300 (67%), Gaps = 8/300 (3%)
 Frame = +1

Query  157   SLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHF  336
             SLP  K+ QE    +E R+ I  +SLP E+GW+  H++ Y+GFW  +  L   L CQ  F
Sbjct  73    SLP--KYLQEECLTQERRQLI--ASLPTEKGWVANHLHQYQGFWHTTRQLLAVLTCQNQF  128

Query  337   QAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YS  513
             QAQ +DI++ T PK GTTWLKA+VFAL  R Q+P  +  HPLL  +P  L+  +E   Y 
Sbjct  129   QAQDTDILLVTTPKSGTTWLKAIVFALMNRVQYPNPEVKHPLLAENPHVLVPFLELELYI  188

Query  514   REISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRA  693
                  DF       R+  THLPL  LP SV  S CKL+ +CRN KDT VS WHF NKLR 
Sbjct  189   DNRVADF-TTFTSPRLFGTHLPLVSLPDSVKNSACKLVYLCRNPKDTFVSLWHFTNKLRT  247

Query  694   ELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeve  873
             + +G  ++   ETFD++CRG  ++GPFWDHVL YWKESL+ P +VLFLKYEEIKE+P+V+
Sbjct  248   KDMGENSLE--ETFDKFCRGVCLYGPFWDHVLEYWKESLKKPERVLFLKYEEIKEQPKVQ  305

Query  874   LRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             L R+A FLGCPFS +EE  GVV  I +LCSF++LSNLEVNKTGK         +FR+G+V
Sbjct  306   LVRLAQFLGCPFSAQEETNGVVDEILKLCSFDTLSNLEVNKTGKLVSGEEYKAFFRRGEV  365



>gb|KEH16899.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
 gb|AES70035.2| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=333

 Score =   270 bits (689),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 199/300 (66%), Gaps = 14/300 (5%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             K+ QE+    E +E I   +LP E+GW+  H++ Y+GFW   + L G L  QKHFQA  +
Sbjct  12    KYLQEDDITLECKELI--QTLPMEKGWVSTHLHQYQGFWQTKKHLQGVLSFQKHFQAHDT  69

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFP-VSQQTHPLLTTSPQELIRNMEFS--YSREI  522
             DII+ T PK GTTWLKAL+FAL  RK++P +    HPLLTT+P  L+  +E S    ++I
Sbjct  70    DIILATSPKAGTTWLKALIFALLNRKRYPNIHDNNHPLLTTNPHVLVPFLELSLYIEKDI  129

Query  523   SPDFPMNGNGF---RVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRA  693
              PD     N F   R+ STH+P + LPKS+ +S CK++ +CR+ KDT  S WHF NK+R 
Sbjct  130   LPDI----NSFSAPRLFSTHVPYKSLPKSIKDSTCKVVYLCRDPKDTFASMWHFTNKIRP  185

Query  694   ELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeve  873
             +    E +   E+F+++ RG S+FGPFW+H+LGYWKESLE   KV+FL+YEE+K +P   
Sbjct  186   Q--NRETLQLEESFEKFSRGVSLFGPFWEHLLGYWKESLERQEKVMFLRYEEMKMKPCFY  243

Query  874   LRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             L+ +A FLGCPFS+EEE  GVV  I  LCSFE LSNLEVNK GK      N  +FR GKV
Sbjct  244   LKEVAEFLGCPFSKEEESKGVVDDILNLCSFEKLSNLEVNKFGKLPSGEENKAFFRSGKV  303



>ref|XP_010023658.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 gb|KCW59960.1| hypothetical protein EUGRSUZ_H02685 [Eucalyptus grandis]
Length=329

 Score =   269 bits (687),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 148/309 (48%), Positives = 207/309 (67%), Gaps = 14/309 (5%)
 Frame = +1

Query  133   PSDPNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHG  312
             PS P+ +      K+ QEN   ++ R+ +   SLP E+GW+ P +Y Y+GFW+  + L+G
Sbjct  3     PSQPSQA------KYLQENDISQKCRDLL--PSLPHEKGWITPSLYQYQGFWVAPKLLNG  54

Query  313   ALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIR  492
              L CQ +F+ Q +DI++ T PKCGTTWLKA++F L+TR ++  S Q HPLLT SP +L+ 
Sbjct  55    VLACQDNFRVQETDILLITAPKCGTTWLKAILFCLSTRGRYSGSMQQHPLLTQSPHDLVP  114

Query  493   NMEFS--YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSY  666
              +E    + +EI P+   +    R+ +THLP + LP+SV +S CKL+ +CRN KDT VS 
Sbjct  115   FLELKLYFGQEI-PNL-TSLPSPRLFATHLPYQSLPQSVKDSGCKLVYLCRNPKDTFVSL  172

Query  667   WHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYe  846
             WHF NKLR++  G   +P  E  D +C+G S FGP+WDHV GY+K SLE P + LFL+YE
Sbjct  173   WHFANKLRSKETG--GMPLGECLDAFCQGVSPFGPYWDHVQGYYKVSLEMPDRALFLRYE  230

Query  847   eikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPN  1026
             ++KE+P   ++R+A FLGCPF E+E   G V GI R+CSF+SLS LEVNK+G+    +  
Sbjct  231   DMKEDPHAHVKRLADFLGCPFGEQELRDGTVDGIVRMCSFDSLSMLEVNKSGRLSTGQET  290

Query  1027  NVYFRKGKV  1053
               YFRKG V
Sbjct  291   KSYFRKGDV  299



>ref|XP_007045765.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOY01597.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=331

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 157/305 (51%), Positives = 207/305 (68%), Gaps = 8/305 (3%)
 Frame = +1

Query  142   PNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALR  321
             P T  SLP  K+ QE    +E +E I  SSLP E+GW+ P +Y ++GFW  S+ L   L 
Sbjct  4     PQTGLSLP--KYLQEEELTEECKELI--SSLPTEKGWIGPPLYQFQGFWHSSKILSTILT  59

Query  322   CQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNME  501
             CQK+FQAQ SDI + T PK GTTWLKA+VFAL  R+++P     HPL+T +P  L+R +E
Sbjct  60    CQKNFQAQDSDIFLTTTPKSGTTWLKAIVFALVNRRKYP-DPINHPLVTNNPHALVRYLE  118

Query  502   FSYSREISP-DFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFM  678
                  +    D        R+++THLP   LP+SV  S CKL+ +CRN KD  VS+W F 
Sbjct  119   LEPRIDYQAYDTSTTIASPRLIATHLPFVSLPESVKNSACKLVYLCRNPKDNFVSFWQFA  178

Query  679   NKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeike  858
             N +  + +G  ++   ET D++CRG +++GPFWDHVLGYWKESLENP+K+LFLKYEE+KE
Sbjct  179   NAVIPKEMGTNSLE--ETLDKFCRGGNIYGPFWDHVLGYWKESLENPQKLLFLKYEEMKE  236

Query  859   epeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYF  1038
              PE+ LRRIA F+GCP S EEE  GVV  I +LCSF++LSNLEVNK+GK       +V+F
Sbjct  237   HPEIHLRRIAEFIGCPLSLEEESKGVVDDILKLCSFDTLSNLEVNKSGKLSSGHDTSVFF  296

Query  1039  RKGKV  1053
             R+G+V
Sbjct  297   RRGEV  301



>ref|XP_010052979.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 gb|KCW77152.1| hypothetical protein EUGRSUZ_D01498 [Eucalyptus grandis]
Length=329

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 148/313 (47%), Positives = 207/313 (66%), Gaps = 20/313 (6%)
 Frame = +1

Query  130   APSDPNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLH  309
              PS P+ +      K+ QE+   ++ R+ +   SLP E+GW+ P +Y Y+GFW+  + L+
Sbjct  2     TPSQPSQA------KYLQEDDISQKCRDLL--PSLPHEKGWITPSLYQYQGFWVAPKLLN  53

Query  310   GALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELI  489
             G L CQ +F+AQ +DI++ T PK GTTWLKA++F L+ R ++P S Q HPLLT SP +L+
Sbjct  54    GVLACQDNFRAQETDILLITGPKSGTTWLKAILFCLSNRAKYPASMQQHPLLTQSPHDLV  113

Query  490   RNMEFS--YSREISPDFPMNGNGF---RVLSTHLPLELLPKSVWESKCKLICVCRNQKDT  654
               +E    + +EI      N N     R+ +THLP + LP+SV +S CKL+ +CRN KDT
Sbjct  114   PFLELKLYFGQEIP-----NLNSLPPPRLFTTHLPYQSLPQSVKDSGCKLVYLCRNPKDT  168

Query  655   VVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLF  834
              VS WHF NKLR++  G   +P  E  D +C+G S FGP+WDHV GY+K SLE P + LF
Sbjct  169   FVSLWHFANKLRSKETG--GMPLGECLDAFCQGVSPFGPYWDHVQGYYKVSLEMPDRALF  226

Query  835   LKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYH  1014
             L+YE++K++P V ++R+A FLGCPF E+E   G V GI R+CSF+SLS LEVNK+G+   
Sbjct  227   LRYEDMKKDPHVHVKRLADFLGCPFGEQELRDGTVDGIVRMCSFDSLSMLEVNKSGRLST  286

Query  1015  ERPNNVYFRKGKV  1053
              +    YFRKG V
Sbjct  287   GQETKSYFRKGDV  299



>ref|XP_004239453.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum lycopersicum]
Length=332

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/303 (50%), Positives = 207/303 (68%), Gaps = 7/303 (2%)
 Frame = +1

Query  148   TSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQ  327
             TS + P  ++ +E+S  +E ++ +  S LP+E+GW+  ++YNY+GFW+    L GA+ CQ
Sbjct  3     TSQTFP-PRYLKEDSLSEECKKLL--SILPKEKGWIGSYIYNYQGFWISPRLLQGAIACQ  59

Query  328   KHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS  507
             + FQAQ SDI + T PK GT WLK+L+FAL  R + P+ +  HPLL  +P +L+  +E +
Sbjct  60    QQFQAQDSDIFLVTNPKSGTIWLKSLIFALVNRMKHPMFEPNHPLLIKNPHDLVPFLELT  119

Query  508   -YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNK  684
              Y     PDF  +    R+LS+HLP   LPKSV +SK KL+ +CRN KDT +S WHF N 
Sbjct  120   LYVDGQVPDFS-SFTTPRLLSSHLPFASLPKSVQDSKTKLVYLCRNPKDTFISVWHFANS  178

Query  685   LRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeep  864
             LR  L   +     E FD +C+G S++GPFWDH+L YWK+S+ENP KVLFL YEEIKE+P
Sbjct  179   LR--LHHKDTNSLEEMFDLFCKGMSVYGPFWDHMLDYWKKSIENPNKVLFLMYEEIKEQP  236

Query  865   eveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRK  1044
             ++ L+R+A FL CPFS +EE  G+V  I R+CSF+SLSNLEVN TGK      N V+FR+
Sbjct  237   KMHLKRLAEFLECPFSIKEENCGIVDEILRMCSFKSLSNLEVNTTGKLSTGEENKVFFRR  296

Query  1045  GKV  1053
             G++
Sbjct  297   GEI  299



>ref|XP_009767933.1| PREDICTED: cytosolic sulfotransferase 12 [Nicotiana sylvestris]
Length=335

 Score =   268 bits (684),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 154/295 (52%), Positives = 205/295 (69%), Gaps = 6/295 (2%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             K+ QE+   +E ++ +  S+LP+E+G +  ++YNY+GFW+    + G + CQK F AQ S
Sbjct  13    KYLQEDGLGEECKKLL--STLPKEKGLIGSYIYNYQGFWVSPRIIQGVIACQKQFHAQDS  70

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISP  528
             DII+ T+PK GTTWLKALVFAL  R +FP+S Q HPLL  +P  L+  +E   Y     P
Sbjct  71    DIILVTIPKSGTTWLKALVFALVNRIRFPLSGQNHPLLVKNPHALVPFLELKLYVDGQVP  130

Query  529   DFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGL  708
             DF  +    R+L+THLP   LPKSV +S+ KLI +CRN +DT VS WHF NKLR+  +  
Sbjct  131   DFS-SFTTPRLLATHLPYASLPKSVQDSESKLIYLCRNPRDTFVSMWHFTNKLRSHYMDT  189

Query  709   EAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIA  888
              +I   E FD + +G S+FGPFWDHVL YWK+SLE P +VLFL YEEIKE+PE++++R+A
Sbjct  190   NSI--EEMFDLFYKGVSLFGPFWDHVLDYWKKSLEKPTRVLFLMYEEIKEKPEIQVKRLA  247

Query  889   GFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              FL CPFSEEEE  GVV  I +LCSFE+LSNLEVNK  K      + ++FR+G+V
Sbjct  248   EFLECPFSEEEETSGVVNEILKLCSFENLSNLEVNKNEKWPTGEDHKLFFRRGEV  302



>ref|XP_010046610.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 gb|KCW86457.1| hypothetical protein EUGRSUZ_B03124 [Eucalyptus grandis]
Length=330

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 151/304 (50%), Positives = 204/304 (67%), Gaps = 10/304 (3%)
 Frame = +1

Query  151   SNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQK  330
             S SLP  K+ Q++   +E R+ +   SLP E+GW+   ++ Y+GFW+    L G L CQ+
Sbjct  4     SPSLP--KYLQDDDVSQECRDLL--PSLPSEQGWVGTTLHLYQGFWVGPRHLKGVLACQR  59

Query  331   HFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVS--QQTHPLLTTSPQELIRNMEF  504
             HF+AQ +DI++ T PK GTTWLKA++FAL  R ++  S  Q  HPLL  +P +L+  +E 
Sbjct  60    HFRAQDTDILLVTTPKSGTTWLKAILFALLNRTKYSGSGSQGQHPLLNHNPHDLVPFLEL  119

Query  505   S-YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMN  681
               Y  + +PD   +    R+ +THLP + LP+ V +SKCKL+ +CRN KDT VS WHF N
Sbjct  120   KLYVEQDTPDL-ASLPPPRLFATHLPYQSLPQPVRDSKCKLVYLCRNPKDTCVSLWHFTN  178

Query  682   KLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikee  861
             KLR +  G  ++   E+ DR+CRG S+FGP+WDHVLGY K S E P KVLFLKYE++KE+
Sbjct  179   KLRPKERGENSLQ--ESLDRFCRGVSLFGPYWDHVLGYHKASSETPEKVLFLKYEDMKED  236

Query  862   peveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFR  1041
             P   LRR+AGFL CPFS+EE   G+V  I RLCSF++LS LEVNK GK      N  +FR
Sbjct  237   PYANLRRLAGFLECPFSQEELREGMVDEILRLCSFDNLSGLEVNKRGKLASGEENKAFFR  296

Query  1042  KGKV  1053
             +G+V
Sbjct  297   RGEV  300



>ref|XP_008352940.1| PREDICTED: cytosolic sulfotransferase 12-like [Malus domestica]
Length=332

 Score =   264 bits (674),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 148/296 (50%), Positives = 195/296 (66%), Gaps = 8/296 (3%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             ++ QE    +E ++ I S  LP E+ W+   ++ Y GFWL ++ + G L CQKHFQA  S
Sbjct  13    RYLQEKELSQEDKDDIFS--LPTEKAWVAHGLHKYHGFWLSTKQMQGVLACQKHFQAVDS  70

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSY--SREIS  525
             DI++ T PK GTTWL+AL+FAL  R  + +  Q HPLLT +P  L+ N+EF     R++ 
Sbjct  71    DIVLVTTPKSGTTWLQALLFALVKRAHY-LDPQRHPLLTENPHVLVPNLEFDIYTDRQVL  129

Query  526   PDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLG  705
             PD        R++STHLP   LP SV  S CK++ VCR+ KD  VS WHF NKLR   +G
Sbjct  130   PDLSSLARP-RLISTHLPYVCLPDSVKHSGCKVVYVCRDPKDVFVSLWHFSNKLRP--VG  186

Query  706   LEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRI  885
                +   E FD++CRG +  GPFWDHVLG+WKESL+ P    F+K+EE+K+EP + LRR+
Sbjct  187   SGTMSLDEAFDKFCRGVNTSGPFWDHVLGFWKESLKRPESAFFIKFEEMKQEPALHLRRL  246

Query  886   AGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             A FLGCPFS EEE  GVV GI RLCSFE+LSNL+VNK+G        + +FRKG+V
Sbjct  247   AKFLGCPFSPEEETHGVVDGILRLCSFENLSNLDVNKSGILSSGMEKSAFFRKGEV  302



>ref|XP_006348796.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=335

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/295 (47%), Positives = 204/295 (69%), Gaps = 6/295 (2%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             K+ QE+   ++ ++ +  S+LP+E+GW+  ++YNY+GFW     + G + CQ+ FQAQ+S
Sbjct  13    KYLQEDGVSEDCKKLL--STLPKEKGWIGSYIYNYQGFWTSPRLIQGVIACQQQFQAQNS  70

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISP  528
             DII+ T PK GTTWLKAL+F+L  RK++P+ +Q HPLL  +P +L+  +E   Y     P
Sbjct  71    DIILVTTPKSGTTWLKALLFSLVNRKKYPIFEQNHPLLVKNPHDLVPFLELKLYVDGQVP  130

Query  529   DFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGL  708
             DF  +    R++STHLP + LPKSV +S+ KL+ +CRN +DT +S WHF N LR + +  
Sbjct  131   DFS-SFTPPRIMSTHLPYDSLPKSVQDSRTKLVYLCRNPRDTFISMWHFTNNLRLDYIDT  189

Query  709   EAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIA  888
              +I   E FD +C+G S++GPFW+HVL YW + +E P+KV+FL YEEIKE+P ++L+R+A
Sbjct  190   NSI--EEMFDHFCKGVSLYGPFWNHVLDYWGKRIEKPKKVIFLMYEEIKEKPTIQLKRLA  247

Query  889   GFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              FL  PFS EEE  GV+  I R+CSF++LSNL+VN  GK        ++FR+G+V
Sbjct  248   EFLEFPFSIEEENCGVIDEILRMCSFDNLSNLDVNINGKLSTGEETKMFFRRGEV  302



>ref|XP_006348647.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=330

 Score =   263 bits (671),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 143/277 (52%), Positives = 191/277 (69%), Gaps = 4/277 (1%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             S LP+E+GW+  ++YNY+GFW     + GA+ CQ+ FQAQ SDII+ T PK GTTWLK+L
Sbjct  24    SVLPKEKGWMGSYIYNYQGFWASPRTIQGAIACQQQFQAQDSDIILVTPPKSGTTWLKSL  83

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPL  582
             +F L  R + PV +Q HPLL  +P +LI  ME + Y     P+F    +  R+LSTH+P 
Sbjct  84    LFVLVNRMKHPVFEQNHPLLDKNPHDLIPFMELTLYVDGHVPNFSAFTSP-RLLSTHVPF  142

Query  583   ELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASM  762
               LPKS+ +SK KL+ +CRN KDT +S WHF N LR     + +I   E F+ +C+G S 
Sbjct  143   ASLPKSIKDSKTKLVYLCRNPKDTFISMWHFTNNLRLHHKDIHSIE--EIFESFCKGVSP  200

Query  763   FGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvg  942
             +GPFW+H+L YWK+S+E P KVLFL YEEIK +P+++L+R+A +L CPFS EEE  GV+ 
Sbjct  201   YGPFWNHILDYWKQSIEKPNKVLFLMYEEIKVQPKLQLKRLAEYLECPFSIEEENCGVMD  260

Query  943   gISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              I R+CSFE+LSNLEVN  GK      N V+FRKG+V
Sbjct  261   EILRMCSFENLSNLEVNTNGKLSTGAENKVFFRKGEV  297



>ref|XP_004297202.1| PREDICTED: cytosolic sulfotransferase 12-like [Fragaria vesca 
subsp. vesca]
Length=335

 Score =   262 bits (669),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 145/298 (49%), Positives = 200/298 (67%), Gaps = 8/298 (3%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             ++ QEN   +E R+ I  S+LPR++GW+  H+Y Y+GFW  +  + G L CQ++F+AQ S
Sbjct  12    QYLQENEISQETRDMI--STLPRDQGWIASHIYQYQGFWHSTRQIEGVLACQENFRAQDS  69

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQ-QTHPLLTTSPQELIRNMEFS-YSREIS  525
             DI++ T PK GTTWLKA++F+L  R ++   + Q HPLLT +P  L+ ++E   Y ++  
Sbjct  70    DILLVTTPKSGTTWLKAILFSLVKRGEYYHPEPQDHPLLTKNPHVLVPHLEIGLYLQKPV  129

Query  526   PDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLG  705
             PD   +    R+ S+HLPL  LP+SV E+ CK++ +CRN KDT VS WHF NKLR E  G
Sbjct  130   PDLMTSYAPPRLFSSHLPLVSLPESVKETACKVVYLCRNPKDTFVSLWHFANKLRPESWG  189

Query  706   LEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKY--eeikeepeveLR  879
               +I   E  + +CRG SM GPFWDHVLGYW ESL+ P+ V F+KY   + +EE    LR
Sbjct  190   --SISLEEALELFCRGVSMCGPFWDHVLGYWNESLKRPQSVFFIKYEEMKEEEEAGSHLR  247

Query  880   RIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             ++A FLGCPFS EEE  GVVG I + CSFE+LSNL+VNK GK      ++ +FR+G+ 
Sbjct  248   KLAEFLGCPFSPEEEAQGVVGNILKQCSFETLSNLDVNKRGKLSSGEEHSAFFRRGEA  305



>ref|XP_010681134.1| PREDICTED: cytosolic sulfotransferase 12-like [Beta vulgaris 
subsp. vulgaris]
Length=336

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 141/295 (48%), Positives = 195/295 (66%), Gaps = 6/295 (2%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             K+ QE+   ++ +  I  S+LP+++GWL  ++Y Y+GFW     L G L CQ+HFQA+ +
Sbjct  17    KYLQEDDISQDCKALI--STLPKDQGWLICNVYQYQGFWHPIRQLQGVLTCQRHFQARDT  74

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISP  528
             D+I+ T PKCGTTWLKAL + +  RK  P+    HP+L  +P EL+  +E   +     P
Sbjct  75    DLILTTSPKCGTTWLKALAYVVVNRKTNPLGCDNHPILINNPHELVPFLELKVFVDNQVP  134

Query  529   DFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGL  708
             D   N    RV STHLP+E LP S+ E+ CK++ + R+ KD  +S WHF NKLR +  G 
Sbjct  135   DL-TNLPSPRVFSTHLPVESLPLSIKETGCKVVYLARDPKDAFISLWHFANKLRPKDGG-  192

Query  709   EAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIA  888
               I   E FD++C+G S+ GPFWDHVL YWK SL+NP+KV FL YE++K +P++ L+++A
Sbjct  193   -EISLAEAFDKFCKGVSLCGPFWDHVLSYWKYSLDNPQKVYFLTYEDLKRQPKLHLKKLA  251

Query  889   GFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              F GCPFS EEE  G+V  I +LCSF++LSNLEVNK GK      N  +FRKG+V
Sbjct  252   EFWGCPFSVEEENEGLVEDILKLCSFDNLSNLEVNKNGKLSSGEENRAFFRKGEV  306



>ref|XP_011102095.1| PREDICTED: cytosolic sulfotransferase 12-like [Sesamum indicum]
Length=329

 Score =   259 bits (663),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 141/293 (48%), Positives = 192/293 (66%), Gaps = 7/293 (2%)
 Frame = +1

Query  181   QENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDII  360
             QE +  +E +  I  S+LP+E GWL  H+Y Y+GFW     L G + CQKHFQAQ+SDI 
Sbjct  12    QEETLTQECK--IFISTLPKERGWLASHLYQYQGFWYPVRHLQGVISCQKHFQAQNSDIF  69

Query  361   VCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFP  537
             + T PK GTTWLKA++F L  R ++P   + HPLL+ +P +L+  +E   Y     PDF 
Sbjct  70    LVTTPKSGTTWLKAIIFTLVNRTRYPPVAKNHPLLSNNPHDLVPFLEIKLYVDNQIPDFS  129

Query  538   MNGNGFRVLSTHLPLELLPKSVWE-SKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEA  714
              +    R+ STH P   LP+S+ + S CK++ +CRN KD  VS WHF N+LR +  G  +
Sbjct  130   -SFPSLRLFSTHSPHVSLPESIKQNSACKIVYLCRNPKDIFVSLWHFTNELRPQETGTNS  188

Query  715   IPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGF  894
             I   E FD +CRG ++FGPFW+H L YWK S+ENP +VLFLK+E++K +P   LRR+A F
Sbjct  189   I--SEVFDLFCRGVTLFGPFWEHALEYWKLSIENPDRVLFLKFEDMKNQPGTHLRRLAEF  246

Query  895   LGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             LG PFS  EEE G+V  I +LCSF++LS L++N+ GK      N V+FR+G V
Sbjct  247   LGSPFSAGEEESGLVEEILKLCSFDNLSALDINRNGKLTSGEENKVFFRRGVV  299



>ref|XP_011102114.1| PREDICTED: cytosolic sulfotransferase 12-like [Sesamum indicum]
Length=329

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 141/293 (48%), Positives = 192/293 (66%), Gaps = 7/293 (2%)
 Frame = +1

Query  181   QENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDII  360
             QE +  +E +  I  S+LP+E GWL  H+Y Y+GFW     L G + CQKHFQAQ+SDI 
Sbjct  12    QEETLTQECKNFI--STLPKERGWLASHLYQYQGFWYPVRHLQGVISCQKHFQAQNSDIF  69

Query  361   VCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFP  537
             + T PK GTTWLKA++F L  R ++P   + HPLL+ +P +L+  +E   Y     PDF 
Sbjct  70    LVTTPKSGTTWLKAIIFTLVNRTRYPPVAKNHPLLSNNPHDLVPFLEIKLYVDNQIPDFS  129

Query  538   MNGNGFRVLSTHLPLELLPKSVWE-SKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEA  714
              +    R+ STH P   LP+S+ + S CK++ +CRN KD  VS WHF N+LR +  G  +
Sbjct  130   -SFPSLRLFSTHSPHVSLPESIKQNSACKIVYLCRNPKDIFVSLWHFTNELRPQETGTNS  188

Query  715   IPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGF  894
             I   E FD +CRG ++FGPFW+H L YWK S+ENP +VLFLK+E++K +P   LRR+A F
Sbjct  189   I--SEVFDLFCRGVTLFGPFWEHALEYWKLSIENPDRVLFLKFEDMKNQPGTHLRRLAEF  246

Query  895   LGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             LG PFS  EEE G+V  I +LCSF++LS L++N+ GK      N V+FR+G V
Sbjct  247   LGSPFSAGEEESGLVEEILKLCSFDNLSALDINRNGKLTSGEENKVFFRRGVV  299



>ref|XP_004239020.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum lycopersicum]
Length=336

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/303 (47%), Positives = 202/303 (67%), Gaps = 6/303 (2%)
 Frame = +1

Query  148   TSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQ  327
             TS+  P HK+ QE+   ++ ++ +  S+LP+E GW+  ++YNY+GFW     + G + CQ
Sbjct  6     TSSPTP-HKYLQEDDVSEDCKKLL--STLPKERGWVGSYVYNYQGFWALPRLIQGVIACQ  62

Query  328   KHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS  507
             + +QAQ +DII+ T PK GTTWLKAL+F+L  RK++PV ++ HPLL  +P +L+  +E  
Sbjct  63    RQYQAQDNDIILVTAPKSGTTWLKALLFSLVNRKKYPVFEKNHPLLVKNPHDLVPLLEQD  122

Query  508   -YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNK  684
              Y     PDF +  +   +++TH+P   LPKSV  S+ KL+ +CRN +DT +S W F N 
Sbjct  123   LYVDGQVPDFSLFTSP-TLIATHVPFASLPKSVQNSRTKLVYLCRNPRDTFISMWQFTNN  181

Query  685   LRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeep  864
             LR +    +     E FD +C+G  ++GPFWDHVLGYWKES+EN  KVLFL YEEIK++P
Sbjct  182   LRLDS-HRDTNSIEEMFDHFCKGVGLYGPFWDHVLGYWKESIENSDKVLFLMYEEIKKQP  240

Query  865   eveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRK  1044
             +++L+R+A FL CPFS EEE+  VV  I R+CSF +L NLEVN  G       N  +FR+
Sbjct  241   KIQLKRLAEFLDCPFSIEEEDCRVVDEILRMCSFGNLRNLEVNVNGNMSAGMANKNFFRR  300

Query  1045  GKV  1053
             G+V
Sbjct  301   GEV  303



>ref|XP_004247253.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum lycopersicum]
Length=332

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/297 (48%), Positives = 193/297 (65%), Gaps = 9/297 (3%)
 Frame = +1

Query  166   YHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQ  345
             Y + F    W K L      S+LP+E+GW+   +YNY+GFW  S    G + CQK FQAQ
Sbjct  11    YLQEFSSEEWKKFL------STLPKEKGWMESTIYNYQGFWSSSRATQGVMACQKQFQAQ  64

Query  346   HSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREI  522
               DII+ T PK GT WLK+L+FAL  RK  P+ +Q HPLL  +P +L+  +E   Y    
Sbjct  65    DDDIILVTTPKSGTVWLKSLLFALVNRKSNPIFEQDHPLLVKNPHDLVLFLELDLYVDGQ  124

Query  523   SPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELL  702
              PDF +  +  R+++TH+P   LPKSV  S+ K++ +CRN +DT +S W F N LR +  
Sbjct  125   VPDFSLFTSP-RLMATHVPFASLPKSVRNSRTKIVYLCRNPRDTFISMWQFANNLRLDNY  183

Query  703   GLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRR  882
               +     E FD +C+G S++GPFW+HVL YW+ESLENP KV+FL YEEIK++P+++L+R
Sbjct  184   K-DTNSIEEMFDHFCKGMSLYGPFWNHVLDYWRESLENPDKVIFLMYEEIKKQPKIQLKR  242

Query  883   IAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +A FL CPFS EEE  GVV  I R+CSFE+L NLEVN  GK      N  +FR+G++
Sbjct  243   LAEFLECPFSNEEENCGVVDEILRVCSFENLRNLEVNTNGKLSAGVANKNFFRRGEI  299



>emb|CDP14958.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   256 bits (655),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 146/279 (52%), Positives = 188/279 (67%), Gaps = 15/279 (5%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             S+LP+E      ++Y Y GFWL  + L G + CQ HFQAQ +D+++ T PK GTTWLKAL
Sbjct  29    STLPKERWLGSSYLYKYNGFWLIHKVLPGLIACQNHFQAQDTDVLLITTPKSGTTWLKAL  88

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSRE-ISPDF--PMNGNGFRVLSTHL  576
             +FAL  RK +P++Q  HPLL  +P  L+  MEF +S E ++PDF  P+     R+ STH 
Sbjct  89    MFALANRKIYPINQN-HPLLKQNPHSLVPFMEFFFSPEKMNPDFSCPLG----RLYSTHY  143

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             PL LLP+SV  S CK++ +CRN KDT VSYWHF  KL AE          E FD +C G 
Sbjct  144   PLTLLPESVLNSGCKIVYLCRNIKDTFVSYWHFSKKLGAE------ASLEEFFDMFCEGV  197

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
             S+ GP WDHVLGYW+ESLE P KVLFLK+E ++E+P   L+ +A F+GCP S EEE  G 
Sbjct  198   SLSGPVWDHVLGYWRESLEKPEKVLFLKFEALQEKPSFHLKLLAEFMGCPISPEEETCGF  257

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             V  +  LCSF++LSNLEVNK+G T+    N ++FRKGKV
Sbjct  258   VDEVLGLCSFDNLSNLEVNKSG-TWRAARNEMFFRKGKV  295



>ref|XP_004298345.1| PREDICTED: cytosolic sulfotransferase 5-like [Fragaria vesca 
subsp. vesca]
Length=301

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 141/280 (50%), Positives = 191/280 (68%), Gaps = 7/280 (3%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             ++ QEN   +E R+ I  S+LPR++GW+  H+Y Y+GFWL +  + G L  Q++F+AQ S
Sbjct  12    QYLQENDLSQETRDMI--STLPRDQGWISNHVYQYQGFWLTTIQIEGVLSFQENFRAQDS  69

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQ--FPVSQQTHPLLTTSPQELIRNMEFS-YSREI  522
             DI++   PK GTTWLKA++F+L  ++   +    Q HPLLT +P  L+  +E   Y R+ 
Sbjct  70    DILLVATPKSGTTWLKAILFSLENKRGEYYHPEPQDHPLLTKNPHVLVPYLEIGLYLRKP  129

Query  523   SPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELL  702
              PD   +    R+ S+HLPL  LP+SV +S CK++ +CRN KDTVVS WHF N++R E  
Sbjct  130   VPDLMTSYAPPRLFSSHLPLVSLPESVKDSACKVVYLCRNPKDTVVSLWHFANRMRPESW  189

Query  703   GLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRR  882
             G  +I   E    +CRG S++GPFWDHVLGYW ESL+ P  V F+ + E+KE+P  +LRR
Sbjct  190   G--SISLEEALKMFCRGVSLYGPFWDHVLGYWNESLKRPESVFFITFAELKEQPGFQLRR  247

Query  883   IAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTG  1002
             +A FLGCPFS EEE  GVV  ISRLCSFE+LSNL+VNK G
Sbjct  248   LAEFLGCPFSPEEEAQGVVENISRLCSFENLSNLDVNKNG  287



>ref|XP_010044374.1| PREDICTED: cytosolic sulfotransferase 5-like [Eucalyptus grandis]
 gb|KCW86456.1| hypothetical protein EUGRSUZ_B03123 [Eucalyptus grandis]
Length=337

 Score =   256 bits (655),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 144/281 (51%), Positives = 193/281 (69%), Gaps = 6/281 (2%)
 Frame = +1

Query  220   ISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLK  399
             + SSLP EEGW+      Y+GFW  +   +G L CQ HFQAQ SDI++ T PK GTTWLK
Sbjct  27    LVSSLPSEEGWVATSFCLYQGFWFPTWLFNGVLACQNHFQAQPSDILLVTNPKSGTTWLK  86

Query  400   ALVFALTTRKQFPVS--QQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLST  570
             A++FAL  R ++  S  +Q HPLLT +P +L+  +E   Y ++ +PD        R+ +T
Sbjct  87    AILFALLNRAKYSDSDSKQRHPLLTQNPHDLVPFLEVKLYLQQENPDL-TTFESPRLFAT  145

Query  571   HLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCR  750
             HLP   LP SV +S+CKL+ +CRN KD  +S WH++NK RAE  G   IP P+  D++CR
Sbjct  146   HLPYSSLPGSVRDSRCKLVYLCRNPKDMFISLWHYVNKRRAEEKG--QIPLPKCLDKFCR  203

Query  751   GASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeg  930
             G S +GP+WDHV+GY K SLE P +VLFL YEE+KE+P V + R+A FLGCPFS+EE   
Sbjct  204   GLSPYGPYWDHVMGYHKASLEMPEQVLFLMYEELKEDPRVHVSRLADFLGCPFSDEELRD  263

Query  931   gvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             G V GI R+CSF++LS+LEVNK+GK +  + N  +FR+GKV
Sbjct  264   GTVEGIMRMCSFDNLSSLEVNKSGKLWTGQENQWFFRRGKV  304



>ref|XP_010050823.1| PREDICTED: cytosolic sulfotransferase 13-like [Eucalyptus grandis]
 gb|KCW80587.1| hypothetical protein EUGRSUZ_C01948 [Eucalyptus grandis]
Length=321

 Score =   256 bits (653),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 147/293 (50%), Positives = 199/293 (68%), Gaps = 6/293 (2%)
 Frame = +1

Query  184   ENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIV  363
             ++S P +    +ISS LP ++GW  P +  Y+GFW  S    G L CQKHFQA +SDII+
Sbjct  2     QSSQPSQACTDLISS-LPSDKGWDNPSLILYQGFWFPSWLFDGVLACQKHFQAHNSDIIL  60

Query  364   CTLPKCGTTWLKALVFALTTRKQF--PVSQQTHPLLTTSPQELIRNMEFS-YSREISPDF  534
              T PK GTTWLKA++FAL  R ++  P S++ HPL T +P +L+  +EF  Y ++  PD 
Sbjct  61    VTSPKSGTTWLKAILFALLNRAEYSDPNSERCHPLQTRNPHDLVPYLEFQLYLQQEDPDH  120

Query  535   PMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEA  714
                 +  R+L+THLP   LP+SV +SKCKL+ +CRN KD  +S WHF  K+  +  G + 
Sbjct  121   ATFASP-RLLATHLPYSSLPQSVRDSKCKLVYLCRNPKDNFISLWHFTKKMMLKENG-DQ  178

Query  715   IPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGF  894
              P PE  D++C+G SM+GP+WDHVLGY K S E P KVLF+K+EE+KE+P V +RR+A F
Sbjct  179   TPLPECLDKFCQGLSMYGPYWDHVLGYHKMSSEMPEKVLFMKFEEMKEDPCVHVRRLADF  238

Query  895   LGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +GCPFSEEE  GG V GI R+CSF++LS LEVNK G  +    N  +FR+G+V
Sbjct  239   VGCPFSEEELRGGTVEGILRMCSFDNLSTLEVNKGGSLWTGAENKSFFRRGEV  291



>ref|XP_010050705.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 gb|KCW80289.1| hypothetical protein EUGRSUZ_C01647 [Eucalyptus grandis]
Length=321

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 144/279 (52%), Positives = 193/279 (69%), Gaps = 5/279 (2%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SS+P ++GW  P +  Y+GFW  S   +G L CQKHFQA +SDII+ T PK GTTWLKA+
Sbjct  15    SSVPSDKGWDNPSLILYQGFWFPSWLFNGVLACQKHFQAHNSDIILVTSPKSGTTWLKAI  74

Query  406   VFALTTRKQF--PVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHL  576
             +FAL    ++  P S+Q HPL T +P +L+  +EF  Y ++  PD     +  R+L+THL
Sbjct  75    LFALLNLAKYSDPNSEQCHPLQTRNPHDLVPYLEFQLYLQQEDPDHATFASP-RLLATHL  133

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P   LP+SV +SKCKL+ +CRN KD  +S WHF  K+  +  G +  P PE  D++C+G 
Sbjct  134   PYSSLPQSVRDSKCKLVYLCRNPKDNFISLWHFTKKMMLKENG-DQTPLPECLDKFCQGL  192

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
             SM+GP+WDHVLGY K S E P KVLF+KYEE+KE+P V +RR+A F+GCPFSEEE  GG 
Sbjct  193   SMYGPYWDHVLGYHKMSSEMPEKVLFMKYEEMKEDPCVHVRRLATFVGCPFSEEELRGGT  252

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             V GI R+CSF++LS LEVNK+G  +    N  +FR+G+V
Sbjct  253   VEGILRMCSFDNLSTLEVNKSGSLWTGAENKSFFRRGEV  291



>ref|XP_004297203.1| PREDICTED: cytosolic sulfotransferase 12-like [Fragaria vesca 
subsp. vesca]
Length=334

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 142/298 (48%), Positives = 197/298 (66%), Gaps = 9/298 (3%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             ++ QEN   +E R+ I  S+LPR++GW+  H+Y Y+GFW  +  + G L CQ++F+AQ S
Sbjct  12    QYLQENEISQETRDMI--STLPRDQGWVVSHLYQYQGFWHSTRQIEGVLACQENFRAQDS  69

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQ-FPVSQQTHPLLTTSPQELIRNMEFS-YSREIS  525
             DI++ T PK GTTWLKA++F+L  R + +    + HP LT +P  L+  +E   Y ++  
Sbjct  70    DILLVTTPKSGTTWLKAILFSLVKRGEYYHPDPKDHPFLTKNPHVLVPFLELGLYLQKPV  129

Query  526   PDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLG  705
             PD        R+ STHLPL  LP+SV +S CK++ +CRN KDT VS WHF N+LR E  G
Sbjct  130   PDLASYAPP-RLFSTHLPLVSLPESVKDSACKVVYLCRNPKDTFVSLWHFANRLRPESRG  188

Query  706   LEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKY--eeikeepeveLR  879
               +I   E  + +CRG S++GPFWDHVLGYW ESL+ P+ V F+KY   + +EE    LR
Sbjct  189   --SISLEEALELFCRGVSLYGPFWDHVLGYWNESLKRPQSVFFIKYEEMKEEEEAGSHLR  246

Query  880   RIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             ++A FLGCPFS EEE  GVVG I + CSFE+LSNL+VNK GK      ++ +FR+G+ 
Sbjct  247   KLAEFLGCPFSPEEEAQGVVGNILKHCSFETLSNLDVNKRGKLSSGEEHSAFFRRGEA  304



>ref|XP_010260931.1| PREDICTED: cytosolic sulfotransferase 5-like [Nelumbo nucifera]
Length=338

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 148/295 (50%), Positives = 190/295 (64%), Gaps = 6/295 (2%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             K+ QE     +     +  SLPR  GW+  H+Y Y+GFW  +  L GA+ CQ HF+AQ +
Sbjct  19    KYLQEEVEELKGEGKHLLPSLPRGVGWICNHLYQYQGFWYTARKLLGAINCQGHFKAQDT  78

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISP  528
             D+++ T PK GTTWLKA+ FA+  RK++  S   HPLLTT+P EL+  +E   Y  +  P
Sbjct  79    DLLLVTNPKSGTTWLKAIAFAIVNRKRYSFSH--HPLLTTNPHELVPFLEIKLYVDDHVP  136

Query  529   DFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGL  708
             D     +  R+ STHLP   LP SV  SKCK++ +CR+ KDT +S WHF +KLR    G 
Sbjct  137   DLATFTSP-RLFSTHLPYLSLPDSVKHSKCKVVFLCRDPKDTFISLWHFTSKLRTS--GQ  193

Query  709   EAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIA  888
             E I   E F R+CRG S++GPFWDHVLGYW ES E P +V F KYEE+KE+P V +RR+A
Sbjct  194   EPISLEEAFHRFCRGVSLYGPFWDHVLGYWNESQERPDRVCFFKYEEMKEQPAVHIRRLA  253

Query  889   GFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              FLG PFS EEEE G V  I RLCSF++LSNL+VNK GK         +FR+G V
Sbjct  254   KFLGYPFSPEEEEEGTVEEIFRLCSFDTLSNLDVNKNGKMESGEEYRTFFRRGVV  308



>ref|XP_008339764.1| PREDICTED: cytosolic sulfotransferase 12-like [Malus domestica]
Length=332

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 149/296 (50%), Positives = 194/296 (66%), Gaps = 8/296 (3%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             ++ QE    +E ++ I S  LP E+GW+   ++ Y GFWL ++ +HG L CQKHFQA  S
Sbjct  13    RYLQEKEXSQEDKDFIFS--LPTEKGWVADGLHKYHGFWLSTKQMHGVLACQKHFQAVDS  70

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSY--SREIS  525
             DI++ T  K GTTWLKAL+FAL  R  + +  Q HPLLT +P  L+  +EF     +++ 
Sbjct  71    DIVLVTTVKSGTTWLKALMFALVKRAHY-LDPQRHPLLTENPHVLVPCLEFDVYTDKQVL  129

Query  526   PDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLG  705
             PD        R++STHLP   LP SV  S CK++   R+ KD  VS WHF NKLR   +G
Sbjct  130   PDLSSLSRP-RLISTHLPYVCLPDSVKHSGCKVVYAWRDPKDVFVSLWHFSNKLRP--VG  186

Query  706   LEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRI  885
                +   E FD++CRG +  GPFWDHVLG+WKESL+ P    F+KYEE+KEEP + LRR+
Sbjct  187   SGTMSLDEAFDKFCRGVNTSGPFWDHVLGFWKESLKRPESXFFIKYEEMKEEPALHLRRL  246

Query  886   AGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             A FLGCPFS EEE  GVV GI RLCSF++LSNL VNK+GK      N+ +FRKG+V
Sbjct  247   AEFLGCPFSPEEETHGVVDGILRLCSFDNLSNLVVNKSGKLPAGIENSAFFRKGEV  302



>ref|XP_006348797.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=332

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/297 (48%), Positives = 195/297 (66%), Gaps = 9/297 (3%)
 Frame = +1

Query  184   ENSWPKELRESIIS------SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQ  345
             +NS PK L+E          S+LP+E+GW+   +YNY+GFW  S  + G + CQ+ FQAQ
Sbjct  5     QNSPPKYLQEDQSEECKKFLSTLPKEKGWMESTIYNYQGFWSSSRAIQGVIACQQQFQAQ  64

Query  346   HSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREI  522
              SDII+ T PK GT WLK+L+FAL  R   P+ ++ HPLL  +P +L+  +E   Y+   
Sbjct  65    DSDIILVTSPKSGTVWLKSLLFALVNRNNHPIFEKDHPLLLKNPHDLVLFLELDLYADGQ  124

Query  523   SPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELL  702
              PDF  +    R+L+TH+P   LPKSV  S+ KL+ +CRN +DT +S W+F N LR +  
Sbjct  125   VPDFS-SFTSPRLLATHVPFASLPKSVKNSRTKLVYLCRNPRDTFISMWNFANNLRLDNH  183

Query  703   GLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRR  882
               +     E FD +C+G S++GPFW+ VL YWKES+ENP KV FL YEEIK++P+++L+R
Sbjct  184   K-DINSIEEMFDHFCKGVSLYGPFWNQVLDYWKESIENPDKVFFLMYEEIKKQPKIQLKR  242

Query  883   IAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +A FL CPFS EEE  GVV  I R+CSFE+L NLEVN  GK      N  +FR+GKV
Sbjct  243   LAEFLECPFSIEEENCGVVDEILRMCSFENLRNLEVNTHGKMSAGVANKNFFRRGKV  299



>ref|XP_010091629.1| Flavonol sulfotransferase-like protein [Morus notabilis]
 gb|EXB44895.1| Flavonol sulfotransferase-like protein [Morus notabilis]
Length=332

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/309 (46%), Positives = 201/309 (65%), Gaps = 9/309 (3%)
 Frame = +1

Query  130   APSDPNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLH  309
             +P   ++ + +P  K+ QE    +E ++ I+S  L RE+GW+  H++ Y+GFW  +  L 
Sbjct  2     SPVQTSSPSDMP--KYLQETQVSQEFKDLILS--LRREKGWVASHLHQYQGFWHTTRQLQ  57

Query  310   GALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELI  489
             G L CQKHFQ+Q +D+++ T PK GTTWLK+++F+L  R  F    + HPLLTT+P  L+
Sbjct  58    GVLACQKHFQSQDTDVLLVTNPKSGTTWLKSILFSLINRSVF-TDPKKHPLLTTNPHVLV  116

Query  490   RNMEFS-YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSY  666
               +E   Y     P+   + +  R+ STHLP   LP+SV  S CKL+ +CR+ KD  VS+
Sbjct  117   PFLELDLYVENRRPNISYSSSP-RLFSTHLPYVSLPESVKSSACKLVYLCRSPKDAFVSH  175

Query  667   WHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYe  846
             WHF N+LR E LG  ++   E F+++C+G S+ GPFWDH LGYW ES + P KVLFL +E
Sbjct  176   WHFANRLRPESLGENSME--EIFEKFCKGVSLCGPFWDHSLGYWNESFKRPEKVLFLSFE  233

Query  847   eikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPN  1026
             E+K EP   +RR+A F+GCPFSEEEE    V  +  +CSF+SLSNLEVNK GK      +
Sbjct  234   EMKREPVFHVRRLAEFIGCPFSEEEEAKSEVEDVLEMCSFDSLSNLEVNKIGKLPSGEDH  293

Query  1027  NVYFRKGKV  1053
               +FR+G+V
Sbjct  294   KAFFRRGEV  302



>ref|XP_003628737.1| Flavonol sulfotransferase-like protein [Medicago truncatula]
 gb|AET03213.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=318

 Score =   253 bits (647),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 192/313 (61%), Gaps = 28/313 (9%)
 Frame = +1

Query  124   MAAPSDPNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEF  303
             M   SD N+  +    K+ Q++   +E +E I   +LP E+ W+  H Y Y+GFW+ ++ 
Sbjct  1     MVKSSDENSFVA----KYLQDDDLSQECKELI--PTLPSEKAWILTHTYQYQGFWIATKK  54

Query  304   LHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQE  483
               G L CQKHFQA  SDII+ T PK GTTWLKAL FAL  R ++P+    HPLL ++P  
Sbjct  55    FQGVLSCQKHFQALDSDIILVTAPKSGTTWLKALTFALLNRNKYPIIHNNHPLLISNPHS  114

Query  484   LIRNMEFSYSREISPDFPMNGNGF---RVLSTHLPLELLPKSVWESKCKLICVCRNQKDT  654
             L+  +E     +   D+  N N     R+ STH+P  LLPKSV ES CK++ +CR+ KD 
Sbjct  115   LVPFLEIDLYSD--KDYVPNLNSLSHPRLFSTHIPCALLPKSVKESTCKVVYLCRDPKDM  172

Query  655   VVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLF  834
              VS +                 F E F+ +CRG S +GPFW+HVLGYWKE+LE P KV+F
Sbjct  173   FVSLY-----------------FEEAFESFCRGVSSYGPFWEHVLGYWKENLERPEKVMF  215

Query  835   LKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYH  1014
             +K+EE+K +P   L++IA FLGCPF  EEE  G++  I  LCSFE+LSNLEVNKT +   
Sbjct  216   IKFEEMKMKPSFYLKKIAEFLGCPFFNEEESKGMIDDILNLCSFENLSNLEVNKTVRVAT  275

Query  1015  ERPNNVYFRKGKV  1053
                N  +FR+G+V
Sbjct  276   GVENKAFFRRGQV  288



>ref|XP_006348798.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=329

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 141/295 (48%), Positives = 198/295 (67%), Gaps = 6/295 (2%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             K+ QE+S  +E ++ +  S LP+E+GW+  ++YNY+G W     L G + CQ+ FQA+ S
Sbjct  7     KYLQEDSLSEECKKLL--SILPKEKGWVGSYIYNYQGCWTPPRLLQGVIACQQQFQAEDS  64

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISP  528
             D+I+ T PK GTTWLK+L+FAL  R + P+ +  HPLL  +P  L+  +E + Y     P
Sbjct  65    DVILVTTPKSGTTWLKSLLFALMNRVKHPMFEPNHPLLVNNPHVLVPFLEHTLYVDGQVP  124

Query  529   DFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGL  708
             DF    +  R+L+TH+P   LPKS+ +S+ KLI +CRN KDT +S WHF N LR      
Sbjct  125   DFSTFTSP-RLLATHVPFASLPKSIMDSRTKLIYLCRNPKDTFISMWHFANNLRLHHKDT  183

Query  709   EAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIA  888
              +I   E FD +C G S++GPFW+HVL YWK+S+ENP K+ FL YEEIKE+P+++L+R+A
Sbjct  184   NSIH--EMFDLFCEGLSLYGPFWNHVLDYWKQSIENPNKMFFLMYEEIKEKPKIQLKRLA  241

Query  889   GFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              +L CPFS EEE  GV+  I R+CSFE+L NLEVN  GK      N V+FR+G++
Sbjct  242   EYLECPFSMEEENCGVLNEILRMCSFENLRNLEVNTNGKLSTGEGNKVFFRRGEI  296



>emb|CDP00475.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 144/305 (47%), Positives = 194/305 (64%), Gaps = 10/305 (3%)
 Frame = +1

Query  145   NTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRC  324
             + S S    K+ QE+    E ++ +  S+LP+E+GW  PH+Y Y+GFW  +    G L C
Sbjct  15    SISQSSAAPKYLQEDEIVPECKDLL--STLPKEKGWAEPHLYKYQGFWYPAWQFQGVLEC  72

Query  325   QKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQ-QTHPLLTTSPQELIRNME  501
             Q+HFQAQ +DI++ + PKCGTTWLKAL F +  R    +     HPL   +P +L+  +E
Sbjct  73    QQHFQAQDTDILLVSAPKCGTTWLKALAFTIINRNSHSIDDPGKHPLFYNNPHDLVHQIE  132

Query  502   FSYSREISPDFPM-NGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFM  678
                  E   D P+ N +  R+ +THLP   LPK    S+CKL+ +CRN KDT +S WHFM
Sbjct  133   L----ESHIDNPIFNPSSPRLFATHLPYISLPKCAKNSECKLVYICRNPKDTFISLWHFM  188

Query  679   NKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeike  858
             N+LR  L  L +I     FD++CRG S+FGPFWDHV  YW+ES + P KVLFLKYE++KE
Sbjct  189   NELR--LNHLASISLEVAFDKFCRGVSIFGPFWDHVSDYWEESRKRPNKVLFLKYEDMKE  246

Query  859   epeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYF  1038
             +P + ++R+A F G PFS EE   GVV GI +LCSFE+LS L+VNK GK      N  +F
Sbjct  247   DPNLHVKRLAEFFGVPFSIEEATSGVVDGIIKLCSFENLSKLKVNKDGKLPSGVENKTFF  306

Query  1039  RKGKV  1053
             R+G V
Sbjct  307   RRGGV  311



>ref|XP_008339761.1| PREDICTED: cytosolic sulfotransferase 5-like [Malus domestica]
Length=331

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 144/296 (49%), Positives = 195/296 (66%), Gaps = 8/296 (3%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             ++ QEN   +E ++ I  SSLP E+GW+   ++ Y+GFW  +  + G L CQKHF+A  S
Sbjct  12    RYLQENEPSQEDKDLI--SSLPTEKGWIGNSLHKYQGFWQATAHMQGVLACQKHFRALES  69

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSY--SREIS  525
             DII+ T PK GTTWL A++FAL  R  + +  + HPLLT +P  L+  +E      +++ 
Sbjct  70    DIILVTTPKSGTTWLMAILFALVKRAHY-LDLRRHPLLTENPHVLVPCLELDVYTDKQVL  128

Query  526   PDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLG  705
             PD        R+ STHLP   LP SV  S CK++ + R+ KD  VS WHF+NKLR   +G
Sbjct  129   PDLSSLAPP-RLFSTHLPYVSLPDSVKHSGCKVVYLSRDPKDAFVSLWHFVNKLRP--VG  185

Query  706   LEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRI  885
                +   E FD++CRG S FGPFWDHVLG+W ESL+ P    F+K+EE+K+EP ++LRR+
Sbjct  186   SGTMSLHEAFDKFCRGVSSFGPFWDHVLGFWNESLKRPESAFFIKFEEMKQEPALQLRRL  245

Query  886   AGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             A FLGCPFS EEE  G+V GI RLCSF++LSNL VNK+GK      N+ +FRKG+V
Sbjct  246   AEFLGCPFSPEEETHGIVDGILRLCSFDNLSNLVVNKSGKLPAGMENSAFFRKGEV  301



>ref|XP_006339394.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=328

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 144/302 (48%), Positives = 205/302 (68%), Gaps = 9/302 (3%)
 Frame = +1

Query  151   SNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQK  330
             + SLP  ++ +E++  +E ++ +  S LP+E+GW+   +YNY+GFW   +FL G + CQ+
Sbjct  2     TTSLP--EYLEEDNLSEECKKLL--SILPKEKGWVRS-VYNYQGFWTSLKFLQGVIACQQ  56

Query  331   HFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-  507
              FQAQ SDII+ T PK G+TWLK+L+FAL  R + P+ + +HPLL  +P  L+  +E + 
Sbjct  57    QFQAQDSDIILVTTPKSGSTWLKSLLFALVNRVKHPIFEPSHPLLVENPHVLVPFLEHTL  116

Query  508   YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKL  687
             Y      DF    +  R+L+TH+P   LPKSV +SK KL+ +CRN +DT +S WHF N L
Sbjct  117   YIDGRVIDFSTFTSP-RLLATHVPFASLPKSVQDSKTKLVYLCRNPRDTFISMWHFANNL  175

Query  688   RAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepe  867
                     +I   E FD +C+G S++GPFW+HVL YWK+SLENP K+LFL YEEIK++P+
Sbjct  176   LLHHKDTNSIE--EMFDLFCKGVSLYGPFWNHVLDYWKQSLENPNKILFLMYEEIKKKPK  233

Query  868   veLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKG  1047
             ++L+R+A FL CPFS EEE  GVV  I ++CSFE+L NLEVN  GK     P  V+FR+G
Sbjct  234   IQLKRLAEFLECPFSIEEENSGVVDEILKMCSFENLRNLEVNTNGKFSTGEPYKVFFRRG  293

Query  1048  KV  1053
             ++
Sbjct  294   EI  295



>ref|XP_006339391.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=329

 Score =   251 bits (642),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 136/294 (46%), Positives = 198/294 (67%), Gaps = 4/294 (1%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             K+ +E++  +E ++ +  S+LP+E+GWL  + YNY+GFW+  +FL   +  Q+ FQ Q S
Sbjct  7     KYLEEDNLSEETKKLL--STLPKEKGWLGSYAYNYQGFWVPQKFLQAVIAFQQQFQVQDS  64

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPD  531
             DII+ T PK GTTWLK+L+FAL  R + P+ +  HPLL  +P  L+  +E +   +    
Sbjct  65    DIILVTTPKSGTTWLKSLLFALVNRVKHPIFESNHPLLVENPHVLVPFLEHTLYFDGRTV  124

Query  532   FPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLE  711
                     R+L+TH+P   LPKSV  SK KL+ +CRN +DT +S WHF N L  +    +
Sbjct  125   DISTFTSPRLLATHVPFASLPKSVQVSKSKLVYLCRNPRDTFISMWHFTNNLLPDHKDTD  184

Query  712   AIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAG  891
             +I   E F+ +C+G S++GPFW+HVL YWK+S+ENP K+LFL YEEIK++P+++L+R+A 
Sbjct  185   SIE--EMFNLFCKGVSLYGPFWNHVLDYWKQSIENPNKILFLMYEEIKKKPKIQLKRLAE  242

Query  892   FLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             FL CPFS EEE  GVV  I ++CSFE+LSNLEVN+ GK        V+FR+G++
Sbjct  243   FLECPFSIEEENSGVVDDILKMCSFENLSNLEVNRNGKFSTGEAYKVFFRRGEI  296



>ref|XP_007010821.1| Sulfotransferase 2A [Theobroma cacao]
 gb|EOY19631.1| Sulfotransferase 2A [Theobroma cacao]
Length=349

 Score =   252 bits (643),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 134/276 (49%), Positives = 183/276 (66%), Gaps = 4/276 (1%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+E+GW  P +Y ++GFW   + +   +  QKHFQA+ SD+I+ T+PK GTTW+KAL 
Sbjct  43    SLPKEKGWRTPFIYLFQGFWCQPKEIQAIISFQKHFQARDSDVILATIPKSGTTWIKALT  102

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPLE  585
             FA+  RK+F  S + HPLLT++P +L+   E+  Y+    PD   N    R+  TH+P  
Sbjct  103   FAIMNRKRFTTSSKNHPLLTSNPHDLVPFFEYKLYANNQIPDLS-NLPKPRLFGTHVPFA  161

Query  586   LLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMF  765
              L +S+  S C++I VCRN  DT +S WH++NK+R E   L   P  E F+ YC+G   F
Sbjct  162   SLQESIKSSSCRIIYVCRNPFDTFISSWHYINKVRPE--SLPPFPLEEAFNLYCKGVVGF  219

Query  766   GPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvgg  945
             GPFW+H+LGYWKES E P KVLF+KYE++KE+    L+ +A FLG PFS EEEE G++  
Sbjct  220   GPFWEHMLGYWKESTERPEKVLFMKYEDMKEDTVSHLKMLANFLGVPFSIEEEEEGMIKD  279

Query  946   ISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             I++LCSFE+L +LEVNK GK+     N   FRKG V
Sbjct  280   IAKLCSFENLKDLEVNKCGKSIKNFENKHLFRKGAV  315



>ref|XP_010048649.1| PREDICTED: cytosolic sulfotransferase 5-like [Eucalyptus grandis]
 gb|KCW80980.1| hypothetical protein EUGRSUZ_C02348 [Eucalyptus grandis]
Length=333

 Score =   251 bits (641),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 151/310 (49%), Positives = 201/310 (65%), Gaps = 12/310 (4%)
 Frame = +1

Query  133   PSDPNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHG  312
             PS P+  N     K+ +++   K L    + SSL  EE W+   +  Y+GFW  S  L+ 
Sbjct  3     PSQPSPLN----EKYLRDDV--KSLECEDLLSSLRSEEDWVPTSLRLYQGFWFPSWLLNS  56

Query  313   ALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFP--VSQQTHPLLTTSPQEL  486
              + CQ HFQA  SDI++ T PKCGTTWLKA++FAL  R ++    SQQ HPLLT +P +L
Sbjct  57    VVACQNHFQAHPSDILLVTSPKCGTTWLKAILFALLNRAKYSDSYSQQRHPLLTQNPHDL  116

Query  487   IRNMEFS-YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVS  663
             +  +EF  Y +  +PD     +  R+L+THLP   LP+SV +S CKL+ +CRN KDT +S
Sbjct  117   VPFLEFRLYLQNKNPDLTAFTSP-RLLATHLPYSSLPRSVRDSNCKLVYLCRNPKDTFIS  175

Query  664   YWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKY  843
              WH  NK+R E  G   +P  E  D++CRG S  GP+WDHVLGY K S E P KVLF+KY
Sbjct  176   MWHHFNKMRPEEKG--QLPLSEGLDKFCRGVSRCGPYWDHVLGYHKASSEMPEKVLFMKY  233

Query  844   eeikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERP  1023
             EE+K +P V++RR+A F+GCPFSEEE   G V GI R+CSF++LS LEVN++GK      
Sbjct  234   EEMKADPSVQVRRLADFMGCPFSEEELRNGTVEGILRMCSFDNLSALEVNRSGKLPTGLE  293

Query  1024  NNVYFRKGKV  1053
             N  +FRKG+V
Sbjct  294   NKWFFRKGEV  303



>ref|XP_009129071.1| PREDICTED: cytosolic sulfotransferase 12-like isoform X1 [Brassica 
rapa]
 ref|XP_009129072.1| PREDICTED: cytosolic sulfotransferase 12-like isoform X2 [Brassica 
rapa]
Length=326

 Score =   251 bits (640),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 142/294 (48%), Positives = 182/294 (62%), Gaps = 11/294 (4%)
 Frame = +1

Query  175   FFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSD  354
             +  +    +E R+ I  SSLPRE+GWL   MY ++G W     L G + CQK F+A+ SD
Sbjct  11    YLGDEDLTQETRDLI--SSLPREKGWLVSQMYQFQGRWHTQALLQGLMECQKRFEAKDSD  68

Query  355   IIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDF  534
             II+ T PK GTTWLKALVFAL TR +FPVS   HPLL T+P  L+  +E  Y    SPDF
Sbjct  69    IILVTNPKSGTTWLKALVFALITRHKFPVSSGDHPLLVTNPHLLVPFLEGVYYE--SPDF  126

Query  535   PMNGNGF-RVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLE  711
               +   F R+++TH+PL  LP++V  S CK++  CRN KD  VS WHF  KL  E     
Sbjct  127   DFSKLSFPRLMNTHIPLLSLPETVKSSSCKIVYCCRNPKDMFVSLWHFGKKLAPEETA--  184

Query  712   AIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAG  891
               P  +  + +C+G  + GPFWDHVL YW  SLENP KVLF+ YEE+K++    ++RIA 
Sbjct  185   DYPIEKAVEAFCQGKFIGGPFWDHVLEYWYASLENPNKVLFVTYEELKKQTGDTIKRIAE  244

Query  892   FLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             FLGC F         V GI +LCSFESLS+LEVN+ GK  +      +FRKG V
Sbjct  245   FLGCGF----IGEEEVSGIVKLCSFESLSSLEVNREGKLPNGMETKAFFRKGDV  294



>ref|XP_010051322.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 gb|KCW81764.1| hypothetical protein EUGRSUZ_C03130 [Eucalyptus grandis]
Length=315

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/279 (49%), Positives = 185/279 (66%), Gaps = 6/279 (2%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SSLP EE W+      Y+GFWL      G L CQ HFQA  SDI++ T PK GTTWLKA+
Sbjct  10    SSLPSEEDWITASFRLYQGFWLSPRLFKGILTCQNHFQAHPSDILLVTSPKSGTTWLKAI  69

Query  406   VFALTTRKQFP--VSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHL  576
             +FAL  R ++   VSQQ HPLLT +  +L+  +E + Y  + +PD     +  R+ +TH+
Sbjct  70    LFALLNRAKYSDSVSQQRHPLLTQNSHDLVPFLELNLYLGQENPDLTAIASP-RLFATHM  128

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P  LLP+SV +S CKL+ +CRN KDT VS WHF N++R E  G   IP  E  D++CRG 
Sbjct  129   PYSLLPQSVRDSNCKLVYLCRNPKDTFVSTWHFANRMRPEEKG--QIPIQEGLDKFCRGV  186

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
             S+ GP+WDHVLGY K SL+ P KVLF+ YE+++ +P V +RR+A FLGCPFS+EE   G 
Sbjct  187   SVCGPYWDHVLGYHKASLDMPEKVLFMMYEQMRVDPHVHVRRLADFLGCPFSKEELRDGT  246

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             V GI ++CSF+++S LEVNK GK +       +FR+G+ 
Sbjct  247   VEGILKMCSFDNMSALEVNKRGKLWTGAETKWFFRRGEA  285



>ref|XP_010514146.1| PREDICTED: cytosolic sulfotransferase 12-like [Camelina sativa]
Length=330

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 142/297 (48%), Positives = 189/297 (64%), Gaps = 6/297 (2%)
 Frame = +1

Query  169   HKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQH  348
             H F  +    +E R+ I  SSLP+E+GWL   +Y ++G+W     L G L CQK F+A+ 
Sbjct  6     HAFLGDKLLTQETRDLI--SSLPKEKGWLGSELYQFQGYWHTQALLQGLLTCQKRFEAKD  63

Query  349   SDIIVCTLPKCGTTWLKALVFALTTRKQFPV-SQQTHPLLTTSPQELIRNMEFSYSREIS  525
             SDII+ T PK GTTWLKALVF+L  R +FPV S   HPLL T+P  L+  +E  Y   +S
Sbjct  64    SDIILITSPKSGTTWLKALVFSLVNRHKFPVPSSGNHPLLFTNPHLLLPFLEGVYY--VS  121

Query  526   PDFPMNGNGF-RVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELL  702
             P+F   G+ F R+++TH+    LP+SV  S CK++  CRN KD  VS+WHF   L  E  
Sbjct  122   PEFDFTGSLFPRLMNTHISHRSLPESVKSSSCKIVYCCRNPKDMFVSFWHFGKTLTREET  181

Query  703   GLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRR  882
                  P  +  + +C G SM GPFWDH+L YW  S ENP KV F+ YEE+K++P + +RR
Sbjct  182   TDTEYPIEKAVEAFCNGKSMSGPFWDHILEYWYASRENPNKVFFVTYEELKKQPGLVIRR  241

Query  883   IAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             IA FLGC F++EE+  G V  I  LCSFESLSNLEVN+ GK  +   +  +FRKG++
Sbjct  242   IAEFLGCGFTDEEKVQGKVEEIVNLCSFESLSNLEVNRQGKLPNGTESKAFFRKGEI  298



>gb|KCW80596.1| hypothetical protein EUGRSUZ_C01959 [Eucalyptus grandis]
Length=302

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 144/292 (49%), Positives = 192/292 (66%), Gaps = 23/292 (8%)
 Frame = +1

Query  184   ENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIV  363
             ++S P +    +ISS LP ++GW  P +  Y+GFW  S    G L CQKHFQA +SDII+
Sbjct  2     QSSQPSQACTDLISS-LPSDKGWDNPSLILYQGFWFPSWLFDGVLACQKHFQAHNSDIIL  60

Query  364   CTLPKCGTTWLKALVFALTTRKQF--PVSQQTHPLLTTSPQELIRNMEFSYSREISPDFP  537
              T PK GTTWLKA++FAL  R ++  P S+Q HPL T +P +L+  +E            
Sbjct  61    VTSPKSGTTWLKAILFALLNRAKYSDPNSEQCHPLQTRNPHDLVPYLE------------  108

Query  538   MNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAI  717
                    +L+THLP   LP+SV +SKCKL+ +CRN KD  +S WHF  K+  +  G +  
Sbjct  109   -------LLATHLPYSSLPQSVRDSKCKLVYLCRNPKDNFISLWHFTKKMMLKENG-DQT  160

Query  718   PFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFL  897
             P PE  D++C+G SM+GP+WDHVLGY K S E P KVLF+KYEE+KE+P V +RR+A F+
Sbjct  161   PLPECLDKFCQGLSMYGPYWDHVLGYHKMSSEMPEKVLFMKYEEMKEDPCVHVRRLATFV  220

Query  898   GCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             GCPFSEEE  GG V GI R+CSF++LS LEVNK+G  +    N  +FR+G+V
Sbjct  221   GCPFSEEELRGGTVEGILRMCSFDNLSTLEVNKSGSLWTGAENKSFFRRGEV  272



>ref|XP_009129073.1| PREDICTED: cytosolic sulfotransferase 12-like isoform X3 [Brassica 
rapa]
Length=331

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 144/295 (49%), Positives = 184/295 (62%), Gaps = 8/295 (3%)
 Frame = +1

Query  175   FFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSD  354
             +  +    +E R+ I  SSLPRE+GWL   MY ++G W     L G + CQK F+A+ SD
Sbjct  11    YLGDEDLTQETRDLI--SSLPREKGWLVSQMYQFQGRWHTQALLQGLMECQKRFEAKDSD  68

Query  355   IIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDF  534
             II+ T PK GTTWLKALVFAL TR +FPVS   HPLL T+P  L+  +E  Y    SPDF
Sbjct  69    IILVTNPKSGTTWLKALVFALITRHKFPVSSGDHPLLVTNPHLLVPFLEGVYYE--SPDF  126

Query  535   PMNGNGF-RVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLE  711
               +   F R+++TH+PL  LP++V  S CK++  CRN KD  VS WHF  KL  E     
Sbjct  127   DFSKLSFPRLMNTHIPLLSLPETVKSSSCKIVYCCRNPKDMFVSLWHFGKKLAPEETA--  184

Query  712   AIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAG  891
               P  +  + +C+G  + GPFWDHVL YW  SLENP KVLF+ YEE+K++    ++RIA 
Sbjct  185   DYPIEKAVEAFCQGKFIGGPFWDHVLEYWYASLENPNKVLFVTYEELKKQTGDTIKRIAE  244

Query  892   FLGCPF-SeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             FLGC F  EEE       GI +LCSFESLS+LEVN+ GK  +      +FRKG V
Sbjct  245   FLGCGFIGEEEVREEEERGIVKLCSFESLSSLEVNREGKLPNGMETKAFFRKGDV  299



>emb|CDP16517.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/279 (49%), Positives = 185/279 (66%), Gaps = 6/279 (2%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             ++LP+E GW   H+Y ++GFW   + +   +  Q++F AQ SD+++ T+PK GTTWLKA+
Sbjct  31    NTLPKERGWRTQHLYLFQGFWCQPKEIQAIMSVQRNFIAQDSDVVLATIPKSGTTWLKAI  90

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPL  582
              F +  RK  PV    HPLLT +P EL+  +E+  Y+    PDF       ++L+TH+P 
Sbjct  91    AFTIVNRKNIPVQNDHHPLLTANPHELVPFLEYKLYADNCIPDFSTIPCP-KLLATHMPF  149

Query  583   ELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASM  762
               LP+SV ES C+++ + RN  DT VS WHFM KLR E  G   + F E FD YC G   
Sbjct  150   SALPQSVKESGCRVVYLARNPFDTFVSIWHFMEKLRPESFG--CLSFEEAFDMYCSGVVG  207

Query  763   FGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvg  942
             FGP+WDH+LGYW ESL+  +KVLFLKYEE+KE+   +L+++A FLG PFS EEE+GGVV 
Sbjct  208   FGPYWDHLLGYWNESLQRTQKVLFLKYEEMKEDTNSQLKKLAEFLGLPFSIEEEKGGVVD  267

Query  943   gISRLCSFESLSNLEVNKTGK--TYHERPNNVYFRKGKV  1053
              ISRLCSF++L ++EVNK GK   + +  N   FRKG V
Sbjct  268   EISRLCSFQTLKDMEVNKNGKGAIFADSENKDLFRKGVV  306



>ref|XP_010051374.1| PREDICTED: cytosolic sulfotransferase 5-like [Eucalyptus grandis]
 gb|KCW81880.1| hypothetical protein EUGRSUZ_C03239 [Eucalyptus grandis]
Length=315

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/279 (50%), Positives = 185/279 (66%), Gaps = 6/279 (2%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SSLP EE W+      Y+GFWL      G L CQ HFQA  SDI++ T PK GTTWLKA+
Sbjct  10    SSLPSEEDWITASFRLYQGFWLSPRLFKGILTCQNHFQAHPSDILLVTSPKSGTTWLKAI  69

Query  406   VFALTTRKQFPVS--QQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHL  576
             +FAL  R ++  S  QQ HPLLT +  +L+  +E + Y  + +PD     +  R+ +TH+
Sbjct  70    LFALLNRAKYSDSDSQQRHPLLTQNSHDLVPFLELNLYLGQENPDLTAIASP-RLFATHM  128

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P  LLP+SV +S CKL+ +CRN KDT VS WHF N++R E  G   IP  E  D++CRG 
Sbjct  129   PYSLLPQSVRDSNCKLVYLCRNPKDTFVSTWHFANRMRPEEKG--QIPIQEGLDKFCRGV  186

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
             S+ GP+WDHVLGY K SL+ P KVLF+ YE++K +P V +RR+A FLGCPFS+EE   G 
Sbjct  187   SVCGPYWDHVLGYHKASLDMPEKVLFMMYEQMKVDPHVHVRRLADFLGCPFSKEELRDGT  246

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             V GI ++CSF+++S LEVNK GK +       +FR+G+V
Sbjct  247   VEGILKMCSFDNMSALEVNKCGKLWTGAETKWFFRRGEV  285



>ref|XP_010051309.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 gb|KCW81745.1| hypothetical protein EUGRSUZ_C03104 [Eucalyptus grandis]
Length=314

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 138/278 (50%), Positives = 186/278 (67%), Gaps = 5/278 (2%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SSLP EE W+      Y+GFWL S    G L CQ HFQA  SDI++ T PK GTTWLKA+
Sbjct  10    SSLPSEEDWITASFRLYQGFWLSSRLFKGILTCQNHFQAHPSDILLVTSPKSGTTWLKAI  69

Query  406   VFALTTRKQFPV-SQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLP  579
             +FAL  R ++   SQ+ HPLLT +  +L+  +E + Y  + +PD     +  R+ +TH+P
Sbjct  70    LFALLNRAKYSANSQRRHPLLTQNSHDLVPFLELNLYLGQENPDLTAIASP-RLFATHMP  128

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
               LLP+SV +S CKL+ +CRN KDT VS WHF N++R E  G   IP  E  +++CRG S
Sbjct  129   YSLLPQSVRDSNCKLVYLCRNPKDTFVSMWHFANRMRPEEKG--QIPIQEGLNKFCRGVS  186

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
             + GP+WDHVLGY K SL+ P KVLF+ YE++K +P V +RR+A FLGCPFS+EE   G V
Sbjct  187   VCGPYWDHVLGYHKASLDMPEKVLFMMYEQMKVDPHVHVRRLADFLGCPFSKEELRDGTV  246

Query  940   ggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              GI ++CSF+++S LEVNK GK +       +FR+G+V
Sbjct  247   EGILKMCSFDNMSALEVNKCGKLWTGAETKWFFRRGEV  284



>emb|CDP07173.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 147/306 (48%), Positives = 199/306 (65%), Gaps = 16/306 (5%)
 Frame = +1

Query  145   NTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRC  324
              T++ +P  K  ++    +E  ++++S+ LPR+  +   ++Y Y GFWL  + + G + C
Sbjct  3     TTASLVPCSKDQKQEELMQEYCKNLLST-LPRKRWYGSSYLYKYNGFWLGPKGMPGLIAC  61

Query  325   QKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEF  504
             Q HFQA+ +D ++ T PK GTTWLKAL+F L  RK +P++Q  HPLL  +P  L+  MEF
Sbjct  62    QNHFQARDTDFLLITTPKSGTTWLKALMFTLANRKIYPINQN-HPLLKQNPHSLVPFMEF  120

Query  505   SYSRE-ISPDF--PMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHF  675
               S E ++PDF  P+     R+ STH PL LLP+SV  S CK++ +CRN KDT VSYWHF
Sbjct  121   FCSPEKMNPDFSCPLG----RLYSTHCPLTLLPESVLNSGCKIVYLCRNIKDTFVSYWHF  176

Query  676   MNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeik  855
               KL AE          E FD +C G S+ GP WDHVLGYW+ESLE P KVLFLKYE ++
Sbjct  177   SKKLGAE------ASLEEFFDMFCEGVSLSGPVWDHVLGYWRESLEKPEKVLFLKYEALQ  230

Query  856   eepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVY  1035
             E+P   L+ +A F+GCP S EEE  G V  +  LCSF++LSNLE NK+G T+    N ++
Sbjct  231   EKPSFHLKLLAEFMGCPISPEEETCGFVDEVLGLCSFDNLSNLEANKSG-TFKTVGNEMF  289

Query  1036  FRKGKV  1053
             FRKGKV
Sbjct  290   FRKGKV  295



>ref|XP_003599784.1| Flavonol sulfotransferase-like protein [Medicago truncatula]
Length=372

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 151/339 (45%), Positives = 199/339 (59%), Gaps = 53/339 (16%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             K+ QE+    E +E I   +LP E+GW+  H++ Y+GFW   + L G L  QKHFQA  +
Sbjct  12    KYLQEDDITLECKELI--QTLPMEKGWVSTHLHQYQGFWQTKKHLQGVLSFQKHFQAHDT  69

Query  352   DIIVCTLPKCGT---------------------------------------TWLKALVFA  414
             DII+ T PK GT                                       TWLKAL+FA
Sbjct  70    DIILATSPKAGTKFVKIASRLIRAIISSLLAVNSNFRKIGNETHFARSFCTTWLKALIFA  129

Query  415   LTTRKQFP-VSQQTHPLLTTSPQELIRNMEFS--YSREISPDFPMNGNGF---RVLSTHL  576
             L  RK++P +    HPLLTT+P  L+  +E S    ++I PD     N F   R+ STH+
Sbjct  130   LLNRKRYPNIHDNNHPLLTTNPHVLVPFLELSLYIEKDILPDI----NSFSAPRLFSTHV  185

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P + LPKS+ +S CK++ +CR+ KDT  S WHF NK+R +    E +   E+F+++ RG 
Sbjct  186   PYKSLPKSIKDSTCKVVYLCRDPKDTFASMWHFTNKIRPQ--NRETLQLEESFEKFSRGV  243

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
             S+FGPFW+H+LGYWKESLE   KV+FL+YEE+K +P   L+ +A FLGCPFS+EEE  GV
Sbjct  244   SLFGPFWEHLLGYWKESLERQEKVMFLRYEEMKMKPCFYLKEVAEFLGCPFSKEEESKGV  303

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             V  I  LCSFE LSNLEVNK GK      N  +FR GKV
Sbjct  304   VDDILNLCSFEKLSNLEVNKFGKLPSGEENKAFFRSGKV  342



>emb|CDP19484.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 146/306 (48%), Positives = 200/306 (65%), Gaps = 16/306 (5%)
 Frame = +1

Query  145   NTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRC  324
              T++ +P  K   +    +E  ++++S+ LP+E  +   ++Y Y GFWL  E L G + C
Sbjct  3     TTASLVPCSKDQNQEELKQEYCKTLLST-LPKERWFGSSYLYKYNGFWLSPEMLPGLIAC  61

Query  325   QKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEF  504
             Q +FQAQ +D+++ + PK GTTWLKAL F L  RK +P++Q  HPLL  +P  L+  MEF
Sbjct  62    QNNFQAQDTDVLLISTPKSGTTWLKALTFTLANRKIYPINQN-HPLLKQNPHSLMPIMEF  120

Query  505   SYSRE-ISPDF--PMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHF  675
              +S E ++PD   P+     R+ S+H PL LLP+SV +S CK++ +CRN KDT VSYWHF
Sbjct  121   FFSPEKLNPDLSCPLG----RLYSSHCPLALLPESVLKSGCKIVYLCRNIKDTFVSYWHF  176

Query  676   MNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeik  855
               KL AE          E F  +C G S+ GP WDH+LGYW+ESLENP KVLFLKYE ++
Sbjct  177   SKKLGAE------ASLEEFFYMFCEGMSLSGPVWDHLLGYWRESLENPEKVLFLKYEALQ  230

Query  856   eepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVY  1035
             E+P   L+ +A F+GCP S EEE  G V  +  LCSF++LSNLEVNK+G  +  R N ++
Sbjct  231   EKPSFHLKLLAEFMGCPISPEEETCGFVDEVLGLCSFDNLSNLEVNKSGTFWTVR-NEMF  289

Query  1036  FRKGKV  1053
             FRKGKV
Sbjct  290   FRKGKV  295



>ref|XP_002265137.1| PREDICTED: cytosolic sulfotransferase 15 [Vitis vinifera]
Length=332

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/292 (48%), Positives = 188/292 (64%), Gaps = 7/292 (2%)
 Frame = +1

Query  181   QENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDII  360
              E     E +E ++S  LP+E GW   H+Y Y+ FW   + +   +  Q+HFQA+ SD+I
Sbjct  14    DEEELSDEFKELLLS--LPKERGWRTSHIYLYQEFWCQPKEIQAIINFQQHFQARDSDLI  71

Query  361   VCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFP  537
             + T+PK GTTWLKA+ FA+  RK F +S+  HPLLT++P +L+  +E+  Y+    PD  
Sbjct  72    LVTMPKSGTTWLKAMAFAVLNRKSFSISK-NHPLLTSNPHDLVPFLEYKLYANNQLPDLS  130

Query  538   MNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAI  717
             M     R+L+TH+P   LP S+  S C+++  CRN  DT VS WHF+ K+R E LG   I
Sbjct  131   MLPQP-RLLATHVPFSSLPASIKNSDCRIVYWCRNPLDTFVSSWHFLMKVRPETLG--PI  187

Query  718   PFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFL  897
                E F+ YCRGA  FGPFW H+L YW ESLE P K+LF+KYE+ KE+P  +L+R+A FL
Sbjct  188   SIEEGFEMYCRGAMAFGPFWKHMLEYWNESLEPPNKMLFMKYEDAKEDPVFQLKRLANFL  247

Query  898   GCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             G PFS EEE  GV   ISRLCSFE+L NLEVN+TG++     N   FR G V
Sbjct  248   GVPFSFEEEREGVAEEISRLCSFENLKNLEVNQTGRSIGYFENKNLFRTGVV  299



>ref|XP_003530555.2| PREDICTED: cytosolic sulfotransferase 5-like [Glycine max]
Length=361

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 196/308 (64%), Gaps = 8/308 (3%)
 Frame = +1

Query  142   PNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALR  321
             P  + S    K+ QEN   +E +E I  S+LP E GW+  H++ Y+GFW  +  L G L 
Sbjct  28    PTEAESSVTPKYLQENELSQECKEVI--STLPMERGWVASHLHQYQGFWHTTRQLQGVLS  85

Query  322   CQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQF-PVSQ-QTHPLLTTSPQELIRN  495
             CQKHF+A  +D+++ + PK GTTWLKA  F+L  R Q  P +Q Q HPLL  +P  L+  
Sbjct  86    CQKHFKALDTDVLIVSTPKSGTTWLKAWTFSLLHRNQHDPNTQNQNHPLLFNNPHFLVPF  145

Query  496   MEFS--YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYW  669
             +E          PD        R+ STHLP   LPKSV ES CK+I +CR+ KD  +S W
Sbjct  146   LELDLYIDDNTLPDLTSLITSPRLFSTHLPYVSLPKSVQESACKIIYLCRDPKDAFISLW  205

Query  670   HFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYee  849
             HF N LR +  G+ ++   E FD++CRG S++GPFW HVL YW++SL  P K++F+++EE
Sbjct  206   HFTNMLRPKSRGMNSLQ--EAFDKFCRGVSLYGPFWAHVLDYWQKSLSEPNKIMFMRFEE  263

Query  850   ikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNN  1029
             +K +P + L+ +A F+GCPFS+EEEE GVV  I +LCSF++LSNL+VNK GK      + 
Sbjct  264   MKMKPRLVLQELATFVGCPFSKEEEEAGVVDHILKLCSFDNLSNLQVNKNGKLSSGEEHK  323

Query  1030  VYFRKGKV  1053
              +FR G++
Sbjct  324   AFFRCGQI  331



>ref|XP_010050715.1| PREDICTED: cytosolic sulfotransferase 13-like [Eucalyptus grandis]
 gb|KCW80300.1| hypothetical protein EUGRSUZ_C01660 [Eucalyptus grandis]
Length=321

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/293 (49%), Positives = 198/293 (68%), Gaps = 6/293 (2%)
 Frame = +1

Query  184   ENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIV  363
             ++S P +   ++ISS LP ++GW    +  Y+GFW  S    G L CQKHFQA + DII+
Sbjct  2     QSSQPSQACTNLISS-LPSDKGWDNFSLILYQGFWFPSWLFDGVLACQKHFQAHNYDIIL  60

Query  364   CTLPKCGTTWLKALVFALTTRKQF--PVSQQTHPLLTTSPQELIRNMEFS-YSREISPDF  534
              T PK GTTWLK ++FAL  R ++  P S++ HPLLT +P +L+  +EF  Y ++  PD 
Sbjct  61    VTSPKSGTTWLKVILFALLNRAKYSDPHSERCHPLLTRNPHDLVPYLEFQLYLQQEDPDH  120

Query  535   PMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEA  714
                 +  R+L+THLP   LP+S+ +SKCKL+ +C+N KD  +S WHF  K+  +    + 
Sbjct  121   ATFASP-RLLATHLPYSSLPQSMRDSKCKLVHLCKNPKDNFISLWHFTKKMMLKENSGQT  179

Query  715   IPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGF  894
              P PE  D++C+G SM+GP+WDHVLGY K SLE P KV F+KYEE+KE+P V +RR+A F
Sbjct  180   -PLPECLDKFCQGLSMYGPYWDHVLGYHKMSLEMPEKVFFMKYEEMKEDPCVHVRRLADF  238

Query  895   LGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +GCPFSEEE  GG V GI R+CSF++LS LEVNK+G  +    N  +FR+G+V
Sbjct  239   VGCPFSEEELRGGTVEGILRMCSFDNLSTLEVNKSGSHWTGAENKSFFRRGEV  291



>ref|XP_010039273.1| PREDICTED: cytosolic sulfotransferase 5-like [Eucalyptus grandis]
 gb|KCW49987.1| hypothetical protein EUGRSUZ_K03444 [Eucalyptus grandis]
Length=331

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/278 (51%), Positives = 188/278 (68%), Gaps = 6/278 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP EE WL P +  Y+GFW  S  L G L  Q HFQAQ SDI++ T PK GTTWLKA++
Sbjct  27    SLPLEEDWLVPTLCLYQGFWFPSHLLKGVLAFQNHFQAQPSDILLVTSPKSGTTWLKAVL  86

Query  409   FALTTRKQFPV--SQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLP  579
             F+L  R ++    SQQ HPLLT +P +L+  ++   Y  + +PD     +  R+ +THLP
Sbjct  87    FSLLNRAKYSDLDSQQPHPLLTQNPHDLVPFLDVKLYLEQENPDLAAFASP-RLFATHLP  145

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
                LP+SV +S CKL+ +CRN KD +VS WHF NK++A+  G   IP PE  D++ RG S
Sbjct  146   FSSLPRSVRDSTCKLVYLCRNPKDVLVSLWHFTNKVKAKEKG--QIPLPECLDKFSRGLS  203

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
             ++GP+W+HVL Y K S E P KVLFL YEE+ E+P V+LRR+A FLGCPFSEEE + G V
Sbjct  204   LYGPYWEHVLDYHKASSEMPGKVLFLMYEEMTEDPHVQLRRLADFLGCPFSEEELKDGTV  263

Query  940   ggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              GI R+CSF++LS LEVNK+ K      N  +FR+G+V
Sbjct  264   EGILRMCSFDNLSALEVNKSEKGSLGVENKWFFRRGEV  301



>ref|XP_002268667.1| PREDICTED: flavonol 3-sulfotransferase [Vitis vinifera]
 emb|CAN73997.1| hypothetical protein VITISV_043371 [Vitis vinifera]
 emb|CAN75262.1| hypothetical protein VITISV_041145 [Vitis vinifera]
 emb|CBI18154.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 142/296 (48%), Positives = 184/296 (62%), Gaps = 21/296 (7%)
 Frame = +1

Query  190   SWPKELRESIISSSLPREEGW-LYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVC  366
             S P + +E I  S+LP+  GW +    Y+Y+GFW  S FL G ++ Q+HFQAQ  DII+ 
Sbjct  14    SLPTKYKEKI--STLPKHHGWRVNADFYHYQGFWCYSFFLEGIMKSQQHFQAQSGDIILS  71

Query  367   TLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREI---SPDFP  537
             + PK GTTWLKAL FA+ TR  F  S  T+PLLTT P E +  +E     +    SP  P
Sbjct  72    SAPKTGTTWLKALTFAIVTRHHFDDS--TNPLLTTVPHECVPLLEVDAVEDAFHRSPKLP  129

Query  538   MNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAI  717
             +       L+THLP   LP S+  S CK++ +CR  KD  +S WHF+ KL  +    E +
Sbjct  130   L-------LATHLPYTSLPNSIMSSHCKIVYICREPKDAFISLWHFICKLAPQ--EEEHV  180

Query  718   PFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFL  897
             P     D +C+G S +GP+WDHVLGYWK SLE P +VLFLKYE++K +    ++ +A F+
Sbjct  181   PLEAALDMFCKGISQYGPYWDHVLGYWKASLECPERVLFLKYEDLKSDTLHYIKTLADFM  240

Query  898   GCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERP----NNVYFRKGKV  1053
             GCPFS EEE  GVV  I  LCSFE+LSNL+VNKTG      P    N+VYFRKG V
Sbjct  241   GCPFSLEEESEGVVQKIMNLCSFETLSNLKVNKTGMHRSTTPLATKNDVYFRKGNV  296



>ref|XP_002314916.2| hypothetical protein POPTR_0010s14820g [Populus trichocarpa]
 gb|EEF01087.2| hypothetical protein POPTR_0010s14820g [Populus trichocarpa]
Length=334

 Score =   246 bits (629),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 138/250 (55%), Positives = 174/250 (70%), Gaps = 4/250 (2%)
 Frame = +1

Query  304   LHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQE  483
             L G L CQKH QAQ  DI + T PK G+TWLKA++FAL  R  FP ++Q HPLLT +P  
Sbjct  59    LQGVLACQKHLQAQDGDIFLVTTPKSGSTWLKAVMFALVNRVSFPDTKQ-HPLLTNNPHA  117

Query  484   LIRNMEFSYSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVS  663
             L+  +E  Y  + + DF  N    R+ STHLPL  LP+SV +S+CKL+ +CRN KD  VS
Sbjct  118   LLPFLEMQYIGKENLDF-TNYTFPRLFSTHLPLLSLPRSVEDSECKLVYLCRNPKDIFVS  176

Query  664   YWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKY  843
              WHF NKLR    G  A    ETFD++CRG +++GPFWDHVLGYWKESLE P +V FLKY
Sbjct  177   LWHFTNKLRPIDWG--ASSLEETFDKFCRGVNLYGPFWDHVLGYWKESLERPHRVFFLKY  234

Query  844   eeikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERP  1023
             EE+K EP ++LRR++ FLGCPFS EEE  GV+  I  LCSFE+LSNLEVN  G+ +    
Sbjct  235   EEMKNEPRIQLRRLSEFLGCPFSLEEENSGVLDEILELCSFENLSNLEVNNIGRLHSGEE  294

Query  1024  NNVYFRKGKV  1053
             +  +FR+G+V
Sbjct  295   HQAFFRRGEV  304



>ref|XP_010048648.1| PREDICTED: cytosolic sulfotransferase 13-like [Eucalyptus grandis]
 gb|KCW80976.1| hypothetical protein EUGRSUZ_C02341 [Eucalyptus grandis]
Length=344

 Score =   246 bits (629),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 146/292 (50%), Positives = 194/292 (66%), Gaps = 8/292 (3%)
 Frame = +1

Query  187   NSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVC  366
             +S P E  E  I +SL  EE      ++ Y+GFW  S  L+  + CQ HFQA  SDI++ 
Sbjct  28    SSLPSE--EDWIPTSLSSEEDCSPSSLHLYQGFWFPSGLLNSVVACQNHFQAHPSDILLV  85

Query  367   TLPKCGTTWLKALVFALTTRKQFPVS--QQTHPLLTTSPQELIRNMEFSYS-REISPDFP  537
             T PKCGTTWLKA++FAL+ R ++  S  QQ HPLLT +P +L+  +E S++ +  +PD  
Sbjct  86    TSPKCGTTWLKAILFALSNRAEYSDSNPQQRHPLLTQNPHDLVPFLELSFNLQNKNPDL-  144

Query  538   MNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAI  717
                   R+L+THLP   LP+SV +S CKL+ +CRN KDT +S WH +NKLR E  G   +
Sbjct  145   TTFTSPRLLATHLPYSSLPRSVRDSNCKLVYLCRNPKDTFISMWHHINKLRPEEKG--QL  202

Query  718   PFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFL  897
             P PE  D++CRG S  GP+WDHVLGY K S E P KVLF+KYEE+K +P V++RR+A F+
Sbjct  203   PLPEGLDKFCRGMSWCGPYWDHVLGYHKASSEMPEKVLFMKYEEMKADPSVQVRRLADFM  262

Query  898   GCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             G PFSEEE   G V GI R+CSF++LS LEVN++GK         +FRKG+V
Sbjct  263   GRPFSEEELRNGTVEGILRMCSFDNLSALEVNRSGKLLIGLEKKWFFRKGEV  314



>ref|XP_009590910.1| PREDICTED: cytosolic sulfotransferase 15-like [Nicotiana tomentosiformis]
Length=339

 Score =   246 bits (628),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 131/281 (47%), Positives = 196/281 (70%), Gaps = 8/281 (3%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             +SLP+E+GW  P+++ ++GFW   + +   +  Q+HF+AQ+SD+IV ++PK GTTWLKAL
Sbjct  29    TSLPKEKGWRTPNLFFFQGFWCQPKEIRAIISTQQHFKAQNSDLIVASIPKSGTTWLKAL  88

Query  406   VFALTTRKQFPVSQQT--HPLLTTSPQELIRNMEFSYSREIS--PDFPMNGNGFRVLSTH  573
              F++  RK+F V Q+   HPLLT +P EL+  +E+    E +  PD  +  +  R+++TH
Sbjct  89    TFSIVNRKKFNVQQKNINHPLLTHNPHELVPFLEYKLYAEYNSPPDLSLLPSP-RLIATH  147

Query  574   LPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRG  753
             +P   LP SV  +KCK++ +CRN  DT VS WH++ K+R E LG       E FD YCRG
Sbjct  148   VPFGALPNSVKTTKCKIVYICRNPFDTFVSVWHYIVKIRPESLG--PFTLEEAFDLYCRG  205

Query  754   ASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeegg  933
              + FGP+W+H+LGYW+ESLE+P KVLFLKYE++K +   +L+R+A F+G PF++EEE+GG
Sbjct  206   ITGFGPYWEHMLGYWRESLESPNKVLFLKYEDMKVDMCNQLKRLAEFMGFPFTKEEEKGG  265

Query  934   vvggISRLCSFESLSNLEVNKTGK-TYHERPNNVYFRKGKV  1053
             ++  +S LCSF++L +L+VNK GK    +  N   FRKG++
Sbjct  266   IIKDVSNLCSFQNLRDLQVNKKGKGAISDFENRNLFRKGEI  306



>ref|XP_002265863.1| PREDICTED: cytosolic sulfotransferase 15 [Vitis vinifera]
 emb|CAN66204.1| hypothetical protein VITISV_041148 [Vitis vinifera]
 emb|CBI35072.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   246 bits (627),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 135/276 (49%), Positives = 180/276 (65%), Gaps = 5/276 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+E GW  PH+Y Y+GFW   + +      Q HFQA+ +D+I+ T+PK GTTWLKA+ 
Sbjct  29    SLPKERGWRTPHIYLYQGFWCQPKEIQAITNFQHHFQARDTDLILATMPKAGTTWLKAMA  88

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPLE  585
             FA+  RK  PVS  THPL T++P +L+  +E+  Y+    PD        R+ +TH+P  
Sbjct  89    FAILNRKPIPVST-THPLHTSNPHDLVPFLEYKLYANNNFPDLSKLPQP-RLFATHVPFA  146

Query  586   LLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMF  765
              LP+S+ +S  +++ +CRN  D   S WHF+ K R E LG   I   E F  YC+G+  F
Sbjct  147   SLPESITKSNSRVVYMCRNPLDAFASSWHFLMKARPESLG--PISIEEGFQMYCKGSMAF  204

Query  766   GPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvgg  945
             GPFW H+LGYWKES+E P KVLFLKYE+ KE+   +L+R+A FLG PFS EEE  GV+  
Sbjct  205   GPFWKHMLGYWKESIERPHKVLFLKYEDTKEDIIFQLKRLAKFLGVPFSLEEERKGVIEE  264

Query  946   ISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             I+RLCSFE+L NLEVN++GK+     N   FRKG V
Sbjct  265   IARLCSFENLKNLEVNQSGKSIGYFENKDLFRKGVV  300



>gb|KDP40565.1| hypothetical protein JCGZ_24564 [Jatropha curcas]
Length=346

 Score =   246 bits (628),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 127/279 (46%), Positives = 185/279 (66%), Gaps = 10/279 (4%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+E GW  P++Y ++GFW   + +   L  +KHFQA++ D+++ T+PK GTTWLKALV
Sbjct  40    SLPKERGWRTPYIYRFQGFWCQPKEIQAILSFRKHFQARNGDVVLATVPKSGTTWLKALV  99

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPD---FPMNGNGFRVLSTHL  576
             FA+  R  +P++  +HPLL ++P +L+  +E+  Y+    PD   FP  G    + +TH+
Sbjct  100   FAILNRNLYPLNSNSHPLLVSNPHDLVPFLEYKIYANNQIPDLSKFPEPG----IFATHV  155

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P   + +S+ +S CK++ +CRN  DT +S W F +K+ AE     ++   E F+ YC G 
Sbjct  156   PFAAVKESINKSSCKIVYICRNPFDTFISSWIFCSKIGAE--NFPSLSIEEAFNMYCNGT  213

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
               FGPFW+H+LGYWKES E P KVLFLKYE++K +    L ++A FLGCPFS EE++ G+
Sbjct  214   IGFGPFWEHMLGYWKESQERPEKVLFLKYEDLKGDITFHLNKLAKFLGCPFSMEEQKQGI  273

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             V  +++LCSFE+L NLEVNKTGK      N   FRKG++
Sbjct  274   VEEVAKLCSFENLKNLEVNKTGKAIMNFENRHLFRKGEI  312



>ref|XP_004239455.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum lycopersicum]
Length=332

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 141/277 (51%), Positives = 188/277 (68%), Gaps = 3/277 (1%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             S+LP+E+GW+   +YNY+GFW  S  + G +  Q+ FQAQ SDII+ T PK G+ WLK+L
Sbjct  25    STLPKEKGWIESTIYNYQGFWSSSRSIQGVIAFQQQFQAQDSDIILVTSPKSGSVWLKSL  84

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPL  582
             +FAL  RK  P+SQQ HPLL  +P +L+  +E   Y+ +  PDF +  +  R+++TH+P 
Sbjct  85    LFALVNRKNNPISQQDHPLLVKNPHDLVLFLELDLYADDQVPDFSLFTSP-RLMATHVPF  143

Query  583   ELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASM  762
               LPKSV  S+ KL+ +CRN KD  +S W F N LR +    +     E FD +C+G S+
Sbjct  144   ASLPKSVQNSRTKLVYLCRNPKDAFISMWQFANNLRLDNHK-DTNSIEEMFDHFCKGVSI  202

Query  763   FGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvg  942
             +GPFWDHVLGYWKES ENP KV FL YEEIK++P++ L+R+A FL CPFS+EEE  GVV 
Sbjct  203   YGPFWDHVLGYWKESKENPDKVFFLMYEEIKKQPKIYLKRLAEFLKCPFSKEEENCGVVD  262

Query  943   gISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              I RLCSF +L NLEVN  GK      N  +FR+G+V
Sbjct  263   EILRLCSFGNLRNLEVNVNGKMLTGIANKNFFRQGEV  299



>ref|XP_004240284.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum lycopersicum]
Length=329

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 141/295 (48%), Positives = 194/295 (66%), Gaps = 6/295 (2%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             ++ QE++  +E ++ +    LP+E+GW+  ++YNY+G W+    L G + CQ+ FQA+ S
Sbjct  7     RYLQEDNLSEECKKLL--RILPKEKGWIGSYIYNYQGCWIPPRLLQGMIACQQRFQAEDS  64

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISP  528
             DII+ T PK GTTWLK+L+FAL  R + P+ +  HPLL  SP  L+  +E + Y     P
Sbjct  65    DIILVTTPKSGTTWLKSLLFALIYRVKHPIFEPNHPLLVKSPHVLVPFLEHTLYVDGQVP  124

Query  529   DFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGL  708
             DF    +  R+ +TH+P   LPKSV  SK KL+ +CRN KDT VS WHF N LR      
Sbjct  125   DFSTFTSP-RLFATHVPFASLPKSVLVSKTKLVYLCRNPKDTFVSMWHFANNLRLHHKDT  183

Query  709   EAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIA  888
              +I   E FD +C G S++GPFW+HVL YWK+S+ENP KV FL YEEIKE+P+++L+R+A
Sbjct  184   SSIH--EMFDLFCEGLSIYGPFWNHVLDYWKQSIENPNKVFFLMYEEIKEKPKIQLKRLA  241

Query  889   GFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              FL  PFS EEE  GVV  I R+CSFE+L +LEVN  GK      N  +FR+G++
Sbjct  242   EFLKIPFSIEEENCGVVDEILRVCSFENLRSLEVNTNGKLSTGEGNKAFFRRGEI  296



>ref|XP_002538120.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
 gb|EEF24263.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
Length=326

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 131/292 (45%), Positives = 192/292 (66%), Gaps = 6/292 (2%)
 Frame = +1

Query  181   QENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDII  360
             +E +   E +E ++S  LPR  GW  P++Y ++GFW   + +   L  QKHFQA+++D++
Sbjct  6     EEENVTHECKELLLS--LPRHRGWRTPYIYQFQGFWCQPKEIQSILSFQKHFQARNNDVV  63

Query  361   VCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFP  537
             + T+PK GTTWLKAL F++  RK FP+S + HPLL ++P +L+   E+  Y+    PD  
Sbjct  64    IATIPKSGTTWLKALTFSILNRKSFPLSSKAHPLLNSNPHDLVPFFEYKVYANGQVPDVS  123

Query  538   MNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAI  717
                +  R+ +THLP   L +S+ +S CK++ +CRN  DT +S W ++NKLR++      +
Sbjct  124   KLPDP-RLFATHLPFSSLQESIKKSSCKIVYICRNPFDTFISSWIYINKLRSDTR--PPL  180

Query  718   PFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFL  897
                + F+ YC+G   FGPFWDH+LGYW ES E P KVLFLKYE++KE+    L+++A FL
Sbjct  181   SLDDCFNMYCKGIVGFGPFWDHMLGYWNESKERPDKVLFLKYEDMKEDISFHLKKLAEFL  240

Query  898   GCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             GCPFS EEE+ G V  +++LCS E L +LEVNK+GK+     N   FRKG+V
Sbjct  241   GCPFSMEEEKAGEVEEVAKLCSLEKLKDLEVNKSGKSILNFENRHLFRKGEV  292



>gb|AAC63113.1| steroid sulfotransferase 3 [Brassica napus]
Length=325

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 142/304 (47%), Positives = 191/304 (63%), Gaps = 13/304 (4%)
 Frame = +1

Query  145   NTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRC  324
             ++S+S+P   + ++    +E R+ I  SSLP E+GWL   +Y ++G W     L G L C
Sbjct  2     SSSSSVP--DYLRDEKLTQETRDLI--SSLPSEKGWLVSQIYQFQGRWHTEALLQGILTC  57

Query  325   QKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEF  504
             QKHF+A+ SDII+ T PK GTTWLK+LVFAL  R +FPVS   HPLL T+P  L+  ME 
Sbjct  58    QKHFKAKDSDIILVTNPKSGTTWLKSLVFALINRHKFPVSSGDHPLLVTNPHLLVPFMEG  117

Query  505   SYSREISPDFPMNGNGF-RVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMN  681
              Y    SPDF  +   F R+++TH+    LP+SV  S C+++  CRN KD  VS WHF  
Sbjct  118   VYYE--SPDFDFSLLPFPRLMNTHISHLSLPESVKSSSCQIVYCCRNPKDMFVSLWHFGK  175

Query  682   KLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikee  861
             KL  +       P  +  + +C+G  + GPFWDHVL YW  SLENP KVLF+ YEE+K++
Sbjct  176   KLAPQETA--DYPLEKAVEAFCQGKFIAGPFWDHVLEYWYASLENPNKVLFVTYEELKKQ  233

Query  862   peveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFR  1041
              EVE++RIA F+GC F+        V  I +LCSFESLS LEVN+ GK  +    N +FR
Sbjct  234   TEVEVKRIAEFIGCGFT----AEEEVSEIVKLCSFESLSRLEVNRQGKLPNGIETNAFFR  289

Query  1042  KGKV  1053
             KG++
Sbjct  290   KGEI  293



>ref|XP_008240107.1| PREDICTED: flavonol sulfotransferase-like [Prunus mume]
Length=336

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 132/300 (44%), Positives = 193/300 (64%), Gaps = 10/300 (3%)
 Frame = +1

Query  178   FQENSWPKELRESI--ISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             +QE    K++ ++   I S+LP++ GW   H Y Y+GFW    FL G +  Q +F+A+ +
Sbjct  9     YQEQEEKKDVLQNCEEIISTLPKDTGWGTEHYYQYEGFWYPKIFLEGVIWAQANFRARDN  68

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPD  531
             DI + T PKCGTTW+KAL+FA+  R+ +  S  +HPLLT SP + +  +E     +   D
Sbjct  69    DIFLATFPKCGTTWVKALMFAIQNRENYDFS--SHPLLTKSPHDCVPYIELLAHHDNPID  126

Query  532   FPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLE  711
             +       R L+TH+P   LPKS+  S  K++ V RN KD ++SYW F  K+R+    L 
Sbjct  127   YLDAMASTRFLATHIPHRSLPKSILNSGTKIVSVARNPKDVLISYWVFSQKIRSSKNKLA  186

Query  712   AIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAG  891
              +P  E F+ +C+G ++ GPFWD+VLGYW+ SLENP KVLFLK+E+IK + E  ++R+A 
Sbjct  187   PLPIEEGFELFCKGVALSGPFWDNVLGYWEASLENPEKVLFLKFEDIKIDTECSVKRLAE  246

Query  892   FLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTG------KTYHERPNNVYFRKGKV  1053
             F+G PFS +EE+ G V  I +LCSF++LSNLEVNK+G      KT  +  N+V+FR+G+ 
Sbjct  247   FMGLPFSSKEEQEGAVREIIKLCSFDNLSNLEVNKSGTFGVGSKTDGKFSNDVFFRRGQT  306



>ref|XP_010534326.1| PREDICTED: cytosolic sulfotransferase 15-like [Tarenaya hassleriana]
Length=367

 Score =   244 bits (624),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 130/278 (47%), Positives = 184/278 (66%), Gaps = 5/278 (2%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
              SLPRE+GW   ++Y Y+GFW  ++ +   +  QKHF++ ++DII+ T+PK GTTWLKAL
Sbjct  60    DSLPREKGWRTRYLYQYQGFWCQAKEIQSIISFQKHFKSVNNDIILATIPKSGTTWLKAL  119

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREIS--PDFPMNGNGFRVLSTHLP  579
              FAL  R QFPVS   HPLLT++P +L+   E+      S  PD     +  R  +TH+P
Sbjct  120   TFALVNRHQFPVSSSDHPLLTSNPHDLVPFFEYKLYANDSDIPDLSHIPSP-RTFATHVP  178

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
                L  S+  S  K++ +CRN  DT VS WH++N +++E   +  +   E FD YCRG  
Sbjct  179   FGSLKDSIKSSNVKVVYLCRNPFDTFVSSWHYVNNIKSE--SMSPVSLDEGFDLYCRGVI  236

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
              FGPFW+H+LGYWKESLE P ++LFL+YE++KE+    L ++A FLG PFS+EE++ GV+
Sbjct  237   GFGPFWEHMLGYWKESLERPDRMLFLQYEDMKEDIVSNLTKLANFLGFPFSKEEQQQGVI  296

Query  940   ggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
               I++LCSF+SL +LEVNK+ K+     N   FRKG+V
Sbjct  297   QRIAKLCSFDSLKSLEVNKSSKSIKNFENRFLFRKGQV  334



>ref|XP_009114137.1| PREDICTED: cytosolic sulfotransferase 12 [Brassica rapa]
Length=331

 Score =   243 bits (621),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 141/294 (48%), Positives = 184/294 (63%), Gaps = 11/294 (4%)
 Frame = +1

Query  175   FFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSD  354
             + ++    +E R+ I  SSLP E+GWL   +Y ++G W     L G L CQKHF+A+ SD
Sbjct  16    YLRDEKLTQETRDLI--SSLPSEKGWLVSQIYQFQGRWHTEALLQGILTCQKHFKAKDSD  73

Query  355   IIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDF  534
             II+ T PK GTTWLK+LVFAL  R +FPVS   HPLL T+P  L+  ME  Y    SPDF
Sbjct  74    IILVTNPKSGTTWLKSLVFALINRHKFPVSSGDHPLLVTNPHLLVPFMEGVYYE--SPDF  131

Query  535   PMNGNGF-RVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLE  711
               +   F R+++TH+    LP+SV  S CK++  CRN KD  VS WHF  KL  +     
Sbjct  132   DFSLLPFPRLMNTHISHLSLPESVKSSSCKIVYCCRNPKDMFVSLWHFGKKLAPQETA--  189

Query  712   AIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAG  891
               P  +  + +C+G  + GPFWDHVL YW  SLENP KVLF+ YEE+K++ EVE++RIA 
Sbjct  190   DYPIEKAVEAFCQGKFIAGPFWDHVLEYWYASLENPNKVLFVTYEELKKQTEVEVKRIAE  249

Query  892   FLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             F+GC F+        V  I +LCSFESLS+LEVNK GK  +    N +FRKG+ 
Sbjct  250   FIGCGFT----AEEEVSEIVKLCSFESLSSLEVNKQGKLPNGIETNAFFRKGET  299



>ref|XP_002304810.1| sulfotransferase family protein [Populus trichocarpa]
 gb|EEE79789.1| sulfotransferase family protein [Populus trichocarpa]
Length=337

 Score =   243 bits (621),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 132/276 (48%), Positives = 179/276 (65%), Gaps = 4/276 (1%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLPRE+GW    +Y YKGFW   + +   +  QKHF+ + +D+I+ ++PK GTTWLKAL 
Sbjct  31    SLPREKGWRTACLYKYKGFWCQPKEIQAIISFQKHFEPRDTDVILASIPKSGTTWLKALS  90

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPLE  585
             FA+  RK+F +S   HPLL ++P +L    E+  Y+ +  PD     +  R+ +TH+P  
Sbjct  91    FAILNRKKFAISSNDHPLLVSNPHDLAPFFEYKLYADKQVPDLSKLPDP-RLFATHIPFA  149

Query  586   LLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMF  765
              L  S+ +S C++I +CRN  DT +S W F NKLR+E   +  +   ETF  YC G   F
Sbjct  150   SLQDSIKKSNCRIIYICRNPFDTFISSWTFSNKLRSE--TVPPLLLEETFKMYCEGVVGF  207

Query  766   GPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvgg  945
             GPFWDH+LGYWKESLE   KVLFLKYE++K +    L++IA FLGCPFS EEE+ GVV  
Sbjct  208   GPFWDHMLGYWKESLERQDKVLFLKYEDMKADVTFYLKKIAKFLGCPFSMEEEKEGVVEK  267

Query  946   ISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             I+ LCSFE + NLEVNK+G++     N   FRK +V
Sbjct  268   IASLCSFEKMKNLEVNKSGRSITNFENKHLFRKAEV  303



>ref|XP_010048646.1| PREDICTED: cytosolic sulfotransferase 5-like [Eucalyptus grandis]
 gb|KCW80974.1| hypothetical protein EUGRSUZ_C02339 [Eucalyptus grandis]
Length=344

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 141/284 (50%), Positives = 189/284 (67%), Gaps = 6/284 (2%)
 Frame = +1

Query  211   ESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTT  390
             E  + +SLP EE  +   +  Y+GFW  S  L+  + CQ HFQA  SDI++ T PKCGTT
Sbjct  34    EDWVPTSLPSEEDCVPSTLRLYQGFWFPSWVLNSVVACQNHFQAHPSDILLVTSPKCGTT  93

Query  391   WLKALVFALTTRKQFPVS--QQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRV  561
             WLKA++FAL  R ++  S  Q+ HPLLT +P +L+  +EF  Y +  +PD     +  R+
Sbjct  94    WLKAILFALLNRAKYSDSNSQKRHPLLTQNPHDLVPFLEFRLYLQNKNPDLTAFASP-RL  152

Query  562   LSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDR  741
             L+THLP   LP+SV +S CKL+ +CRN KDT +S WH+ NK R E  G   +P PE  D+
Sbjct  153   LATHLPYSSLPRSVRDSNCKLVYLCRNPKDTFISMWHYFNKFRPEEKG--QLPLPEGLDK  210

Query  742   YCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeee  921
             +CRG +  GP+WDHVLGY K S E P KVLF+KYEE+K +P V++RR+A F+G PFSEEE
Sbjct  211   FCRGVNWCGPYWDHVLGYHKASSEMPEKVLFVKYEEMKADPSVQVRRLADFMGRPFSEEE  270

Query  922   eeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
                G V GI R+CSF++LS LEVN++GK         +FRKG+V
Sbjct  271   LRNGTVEGILRMCSFDNLSALEVNRSGKLPSGLEKKWFFRKGEV  314



>gb|EYU26929.1| hypothetical protein MIMGU_mgv1a009329mg [Erythranthe guttata]
Length=345

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 144/291 (49%), Positives = 190/291 (65%), Gaps = 15/291 (5%)
 Frame = +1

Query  202   ELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKC  381
             E +E +IS  LP+E GW  P++Y Y+ FW   + +   +  Q H+ A+++D+IV T+PK 
Sbjct  24    ECKELLIS--LPKERGWRTPNLYLYQHFWCQPKEIQAIISVQNHYNAENTDLIVATIPKS  81

Query  382   GTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSY--SREISPD---FPMNG  546
             GTTWLKAL FA+  R+ F  +Q+ HPLLT++  EL+  +E+      E  PD   FP   
Sbjct  82    GTTWLKALSFAIVNRRNFAHNQKNHPLLTSNSHELVPFLEYKLFADYENIPDMSRFPRP-  140

Query  547   NGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFP  726
                 +L TH+P+  LP SV + KCK++ + RN  DT VS WHFMNKLR E LG   +   
Sbjct  141   ---LLLGTHMPINALPDSVMDLKCKIVYMVRNPFDTFVSIWHFMNKLRPEYLG--PLSLE  195

Query  727   ETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCP  906
             E FD YCRGA  FGP+WDH+LGYW ESL  P+KVLFLKYEE+KE     L+++A FLG P
Sbjct  196   EAFDMYCRGAIGFGPYWDHMLGYWYESLRAPQKVLFLKYEEVKENTCFHLKKLAEFLGFP  255

Query  907   FSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHER--PNNVYFRKGKV  1053
             FS EEEEGG V GI++LCSF+ + +L+VNKTGK        N   FRKG+V
Sbjct  256   FSLEEEEGGAVEGIAKLCSFDKMKDLDVNKTGKGAITAGFENRDLFRKGEV  306



>ref|XP_010425175.1| PREDICTED: cytosolic sulfotransferase 12-like [Camelina sativa]
Length=334

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 140/297 (47%), Positives = 184/297 (62%), Gaps = 6/297 (2%)
 Frame = +1

Query  169   HKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQH  348
             H F  +    +E R+ I  SSLP+E+GWL   MY ++G+W     L G L CQK F+A+ 
Sbjct  10    HAFLGDELLTQETRDLI--SSLPKEKGWLGSEMYQFQGYWHTQALLQGLLTCQKRFEAKD  67

Query  349   SDIIVCTLPKCGTTWLKALVFALTTRKQFPV-SQQTHPLLTTSPQELIRNMEFSYSREIS  525
             SDII+ T PK GTTWLKALVF+L  R +FPV S   HPLL T+P  L+  +E  Y +  +
Sbjct  68    SDIILVTSPKSGTTWLKALVFSLVNRHKFPVPSSGNHPLLFTNPHLLLPFLEGVYYK--T  125

Query  526   PDFPMNGNGF-RVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELL  702
             P+F   G    R+++TH+    LP+SV  S CK++  CRN KD  VS+WHF   L  E  
Sbjct  126   PEFDFTGLPIPRLMNTHIAHRSLPESVKSSSCKIVYCCRNPKDMFVSFWHFGKTLAREET  185

Query  703   GLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRR  882
                  P  +  + +C+G SM GP WDH+L YW  S E+P KV F+ YEE+K++P V L R
Sbjct  186   TDAEFPIEKAVEAFCKGKSMSGPLWDHILEYWYASREDPNKVFFVTYEELKKQPGVVLGR  245

Query  883   IAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             IA FLGC F++EE   G V  I  LCSFESLSNLEVN+ GK  +   +  +FRKG+ 
Sbjct  246   IAEFLGCGFTDEEIVQGKVEEIVNLCSFESLSNLEVNRQGKLPNGTESKAFFRKGET  302



>ref|XP_004253506.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum lycopersicum]
Length=329

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 138/295 (47%), Positives = 195/295 (66%), Gaps = 6/295 (2%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             K+ QE++  +E ++ +  S LP+++GW+  ++YNY+GFW    FL G +  Q+ FQA+ S
Sbjct  7     KYLQEDNLSEECKKFL--SILPKDKGWVGSYIYNYQGFWTPPRFLQGVIAFQQQFQAEDS  64

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISP  528
             DII+ T PK GTTWLK+L+FAL  R + P+ +  HPLL  +P  L+  +E   Y     P
Sbjct  65    DIILVTTPKSGTTWLKSLLFALVNRVKHPIFEPNHPLLVINPHVLVPFLEHELYIDGRVP  124

Query  529   DFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGL  708
             DF    +  ++L+TH+P   LPKSV  SK KL+ +CRN +DT +S WHF N L       
Sbjct  125   DFSTFTSP-KLLATHVPFASLPKSVQHSKTKLVYLCRNPRDTFISMWHFTNNLLLHHNDT  183

Query  709   EAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIA  888
              +I   E FD +C G S++GPFW+HVL YW++S+ENP K+LFL YEEIK++P+V+L+R+A
Sbjct  184   NSIE--EMFDLFCEGVSLYGPFWNHVLDYWEKSIENPTKILFLMYEEIKKKPKVQLKRLA  241

Query  889   GFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              FL C  S EEE  GVV  I ++CSFE+L NLEVN  GK       N++FRKG++
Sbjct  242   EFLECLISPEEENSGVVDEILKMCSFENLRNLEVNTNGKFSTGEEYNLFFRKGEI  296



>emb|CDP14620.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 144/295 (49%), Positives = 191/295 (65%), Gaps = 15/295 (5%)
 Frame = +1

Query  184   ENSWPKELRESI---ISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSD  354
             E+S  +EL E     + S+LPR+  W   ++Y Y GFW  +  + G +  +KHFQA+ SD
Sbjct  105   EDSELQELMEQQRKNLLSTLPRQR-WQGSYLYKYNGFWFSTMQMPGLVEFRKHFQARDSD  163

Query  355   IIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS--YSREISP  528
             +++ T PK GTTWLKAL FAL  R   P++Q  HPLL  +P  L+ ++E+   Y ++  P
Sbjct  164   VLIITTPKSGTTWLKALAFALMNRNICPINQ-NHPLLNQNPHTLVLHLEYPNPYDKQ-HP  221

Query  529   DFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGL  708
             D+   G+  R+L TH PL LLP+SV  S CK++ + RN KD  VSYWHF NKL     G 
Sbjct  222   DYSFQGSR-RLLGTHCPLALLPESVMNSGCKIVYLSRNIKDIFVSYWHFTNKL-----GS  275

Query  709   EAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIA  888
                 F E FD +C+G S+ GP WDHVLGYWK SL+ P+KVLFLKYEE+ +EP   L+ +A
Sbjct  276   TETSFEEFFDLFCKGVSLSGPIWDHVLGYWKASLDKPQKVLFLKYEEMTQEPAFNLKHLA  335

Query  889   GFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              FLGCP S+EEE  GVV  I  LCSF+ + NLEVNK+G  ++   N V+FR GKV
Sbjct  336   EFLGCPISQEEETAGVVDEILGLCSFDHMRNLEVNKSGTMWN-HSNQVFFRNGKV  389



>ref|XP_007156373.1| hypothetical protein PHAVU_003G280800g [Phaseolus vulgaris]
 gb|ESW28367.1| hypothetical protein PHAVU_003G280800g [Phaseolus vulgaris]
Length=332

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 136/307 (44%), Positives = 201/307 (65%), Gaps = 9/307 (3%)
 Frame = +1

Query  142   PNTSNSLPYHKFFQEN-SWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGAL  318
             P T +S+   K+ +EN    +E +E I   +LP E+GW+  H++ Y+GFW  +  L G L
Sbjct  2     PETESSV-VPKYLEENRELSQECKELI--PTLPLEKGWVASHLHQYQGFWHTTRQLQGLL  58

Query  319   RCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNM  498
              CQ HFQA H+D+++ T PK GTTWLKA  ++L  R +   + Q HPLLT +P  L+  +
Sbjct  59    SCQNHFQAHHTDLLIVTTPKSGTTWLKAWTYSLLHRHKHHPTNQNHPLLTHNPHFLVPFL  118

Query  499   EFSYSREIS--PDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWH  672
             E     + S  PD     +  R+ STHLP   LPKSV ++ CK++ +CR+ KD  +S WH
Sbjct  119   ELDLYIDNSSVPDLSSLPSP-RLFSTHLPFVSLPKSVTQTSCKIVYLCRDPKDAFISLWH  177

Query  673   FMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeei  852
             F N LR + +G  ++   E F ++CRG S++GPFW+HVL YW++SLE+P K++F+++EE+
Sbjct  178   FTNSLRLQSMGANSLH--EAFHKFCRGVSLYGPFWEHVLEYWQKSLEHPSKIMFMRFEEM  235

Query  853   keepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNV  1032
             K +PE  L+ +A F+GCP S EEEE GVV  I +LCSF++LSNL+VNK GK      +  
Sbjct  236   KLKPEFVLKELATFVGCPVSREEEEAGVVQEILKLCSFDNLSNLQVNKNGKLSSGEAHQA  295

Query  1033  YFRKGKV  1053
             +FR+G++
Sbjct  296   FFRRGEI  302



>ref|XP_008347825.1| PREDICTED: cytosolic sulfotransferase 15-like [Malus domestica]
 ref|XP_008344564.1| PREDICTED: cytosolic sulfotransferase 15-like [Malus domestica]
Length=329

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 126/279 (45%), Positives = 177/279 (63%), Gaps = 6/279 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+E GW   H+Y ++GFW  +  +   +  QKHFQA  +DI++ T+PK GTTWLKAL 
Sbjct  19    SLPKERGWRTLHLYQFQGFWCQAAEIQSIITFQKHFQATDTDIVLATIPKSGTTWLKALA  78

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNG---NGFRVLSTHL  576
             FA   R +F  + ++HPLL ++P +L+   E+  Y+    PD        +  R+  TH+
Sbjct  79    FATVNRHRFTTNSKSHPLLXSNPHDLVPFFEYKLYANNQIPDLTTTNLPDDQPRLFGTHI  138

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P   L  S+ +S  K++ +CRN  DT VS WHF+NK++ E      +   E FD YC+G 
Sbjct  139   PFASLANSIRKSNSKIVYICRNPFDTFVSSWHFLNKVKPE--SKAQLSMEEAFDMYCKGI  196

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
               FGPFWDH+LGYW ESL  P+KVLFLKYE++KE+   +L+++A FLGCPF+  EE+ GV
Sbjct  197   VGFGPFWDHMLGYWNESLLRPQKVLFLKYEDLKEDGVFQLKKLAKFLGCPFTLVEEKNGV  256

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +  IS+LC FE++  LEVNKTG +     N   FRK +V
Sbjct  257   IESISKLCCFENMKKLEVNKTGTSIKNFENKNLFRKAEV  295



>ref|XP_010518598.1| PREDICTED: cytosolic sulfotransferase 12 [Camelina sativa]
Length=325

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 141/304 (46%), Positives = 188/304 (62%), Gaps = 14/304 (5%)
 Frame = +1

Query  148   TSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQ  327
             +S+S+P   +  +    +E R+ I  SSLP+E+GWL   MY Y+G W     L G L CQ
Sbjct  2     SSSSVP--AYLGDEDLTQETRDLI--SSLPKEKGWLVSEMYQYQGRWHTQALLQGILICQ  57

Query  328   KHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQ-THPLLTTSPQELIRNMEF  504
             K F+A+ SDII+ T PK GTTWLKALVFAL  R +FP+S    HPLL T+P  L+  +E 
Sbjct  58    KRFEAKDSDIILVTNPKSGTTWLKALVFALLNRHKFPISSSGNHPLLVTNPHLLVPFLEG  117

Query  505   SYSREISPDFPMNG-NGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMN  681
              Y    SPDF  +G    R+++TH+    LP+S+  S CK++  CRN KD  VS WHF  
Sbjct  118   VYYE--SPDFDFSGLPSPRLMNTHISHLSLPESIKSSSCKIVYCCRNPKDMFVSLWHFGK  175

Query  682   KLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikee  861
             KL  E     A P  +  + +C G  + GPFWDH+L YW  S ENP KVLF+ YE++K++
Sbjct  176   KLAPEETA--AYPIEKAVETFCEGKFIGGPFWDHILEYWYASRENPNKVLFVTYEDLKKQ  233

Query  862   peveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFR  1041
              E E++RIA FLGC F     E   V  I++LCSFESLS+LEVN+ GK  +      +FR
Sbjct  234   TEAEMKRIAEFLGCGF----IEEEEVREIAKLCSFESLSDLEVNRQGKLPNGMETKTFFR  289

Query  1042  KGKV  1053
             KG++
Sbjct  290   KGEI  293



>ref|XP_010670538.1| PREDICTED: cytosolic sulfotransferase 15-like [Beta vulgaris 
subsp. vulgaris]
Length=342

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 133/292 (46%), Positives = 195/292 (67%), Gaps = 8/292 (3%)
 Frame = +1

Query  187   NSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVC  366
             N   KE ++ +IS  LP+ +GW   ++Y ++ FW   + +   +  QKHF AQ SD+I+ 
Sbjct  20    NGITKECKQLLIS--LPKVKGWRTQNLYLFQSFWCQPKEIQAIISSQKHFAAQDSDVIIA  77

Query  367   TLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMN  543
             T+PK GTTWLKALVFA+ +R +F V+ + HPLL ++P +L+  +E+  Y+ +  P    N
Sbjct  78    TVPKSGTTWLKALVFAIISRHRFDVNSKDHPLLRSNPHDLVPFLEYKVYANQQIPTLS-N  136

Query  544   GNGFRVLSTHLPLELLPKSVWE--SKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAI  717
              +  R  ++H+P   LPK++ +  S CK++ +CRN  DT  S WHFM K+R + LG    
Sbjct  137   LDSPRFFASHVPYHSLPKTMTKNNSNCKIVYICRNPFDTFASIWHFMKKIRPKYLG--PF  194

Query  718   PFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFL  897
                E FD YC+G   +GP+WDH+LGYW+ESL++P KV+FLKYE++K +  V++R+I  F 
Sbjct  195   SLEEAFDMYCKGEIGYGPYWDHMLGYWEESLKSPEKVMFLKYEDLKGDVLVQMRKIGEFF  254

Query  898   GCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             G PFS EEEE GVV  I++LCSF+SLS+LE+NK GK+  +  N   FRKG+V
Sbjct  255   GHPFSPEEEENGVVEEIAKLCSFKSLSDLEINKNGKSILDFDNKGLFRKGEV  306



>ref|XP_010523117.1| PREDICTED: cytosolic sulfotransferase 12-like [Tarenaya hassleriana]
Length=326

 Score =   241 bits (614),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 145/304 (48%), Positives = 185/304 (61%), Gaps = 11/304 (4%)
 Frame = +1

Query  145   NTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRC  324
             N+   +P   F   +S  +E RE +  S LPRE GW+   +Y Y+GFW     L   + C
Sbjct  3     NSETQVP--AFLDLDSISQECREMM--SRLPRERGWMNLFLYQYQGFWHPPRQLQATINC  58

Query  325   QKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEF  504
             Q+HFQAQ SDII+ T PK GTTWLKALVF+L  R      +  HPLLT SP  L+  +E 
Sbjct  59    QRHFQAQDSDIILVTYPKSGTTWLKALVFSLMNRHNL---RDHHPLLTNSPHLLVPFLEL  115

Query  505   S-YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMN  681
               Y    +PD     +  R+ +THLP   LP+ +  S CK++   RN KDT VS WHF  
Sbjct  116   DLYFDAHAPDLSQMTSP-RLFATHLPFVSLPEPIRRSSCKIVYCYRNPKDTFVSLWHFSK  174

Query  682   KLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikee  861
             KLR +   L ++P    FDR+C G S +GPFWDHVLGYW+   E P K  F+ YEE+K E
Sbjct  175   KLRPK--ELPSLPMELLFDRFCSGVSAYGPFWDHVLGYWENPRETPGKTFFITYEEMKAE  232

Query  862   peveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFR  1041
             P  +L+R+A FL CPFS EEE+ G V  I+RLCSF+SLS LE NK GK      +N +FR
Sbjct  233   PRAQLKRLAEFLECPFSREEEDKGTVDDIARLCSFDSLSGLEPNKIGKLPIGVDSNSFFR  292

Query  1042  KGKV  1053
             KG+V
Sbjct  293   KGEV  296



>ref|XP_010050960.1| PREDICTED: cytosolic sulfotransferase 5-like [Eucalyptus grandis]
Length=329

 Score =   241 bits (614),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 142/292 (49%), Positives = 192/292 (66%), Gaps = 8/292 (3%)
 Frame = +1

Query  187   NSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVC  366
             +S P E  E  + +SLP EE  +   +  Y+GFW  S  L+  + CQ HFQA  SDI++ 
Sbjct  13    SSLPSE--EDWVPTSLPFEEDCVPSSLRLYQGFWFPSWLLNSVVACQNHFQAHPSDILLV  70

Query  367   TLPKCGTTWLKALVFALTTRKQFP--VSQQTHPLLTTSPQELIRNMEFS-YSREISPDFP  537
             T PKCGTTWLKA++FAL  R ++    SQ  HPLLT +P +L+  +EF  Y +  +PD  
Sbjct  71    TSPKCGTTWLKAILFALLNRAKYSDSYSQPRHPLLTQNPHDLVSFLEFGLYLQNKNPDLT  130

Query  538   MNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAI  717
                +  R+L++HLP  LLP+SV  S CKL+ +CRN KDT +S WH+ NK R E  G   +
Sbjct  131   AFTSP-RLLASHLPYSLLPRSVRHSNCKLVYLCRNPKDTFISMWHYFNKFRPEEKG--QL  187

Query  718   PFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFL  897
             P  E  D++CRG S +GP+WDHVLGY K S E P KVLF+KYEE+K +P V++RR+A F+
Sbjct  188   PLLEGLDKFCRGMSAYGPYWDHVLGYHKASSEMPEKVLFVKYEEMKADPSVQVRRLADFI  247

Query  898   GCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             G PF+EEE   G + GI R+CSF++LS LEVN++GK         +FRKG+V
Sbjct  248   GRPFNEEELRNGTMEGILRMCSFDNLSALEVNRSGKLPGGVEKKWFFRKGEV  299



>ref|XP_010677191.1| PREDICTED: flavonol sulfotransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=330

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 131/283 (46%), Positives = 180/283 (64%), Gaps = 11/283 (4%)
 Frame = +1

Query  220   ISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLK  399
             I  SLP+E+GW    +Y YKGFW D   L G L  QK F+AQ + +++ TLPK GTTW  
Sbjct  20    ILPSLPKEKGWWLETLYKYKGFWFDEPLLQGTLITQKTFKAQPNTVVLATLPKSGTTWFA  79

Query  400   ALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTHLP  579
             AL+F    R ++  S  +HPLLT+SP + +  +EF  S+  +P  P     F +++ H+P
Sbjct  80    ALLFTTMNRTRY--SYSSHPLLTSSPHDCVPGIEFYASK--NPSNPTMPTTFPLVAAHIP  135

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
               LLP+S+  S C +I VCRN  D  VS WHF NKLR +   L+ +   E FD +C+G S
Sbjct  136   YPLLPESIKSSSCPIIYVCRNPNDVFVSLWHFANKLRPK--ELQPLNIEEAFDLFCKGVS  193

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
              FG +WDHVLG+WK S+E P KVLF++YE++K +P   L+++A F+GCPF+  EEE GV+
Sbjct  194   PFGSYWDHVLGFWKASIEMPNKVLFVRYEDMKNQPFTLLKKLAEFVGCPFTLAEEESGVI  253

Query  940   ggISRLCSFESLSNLEVNKTGKTYH-----ERPNNVYFRKGKV  1053
               I   CSFESL++ EVN+     +       PNNV+FRKGKV
Sbjct  254   EKIIDFCSFESLTSFEVNRVEVERNTLPGANVPNNVFFRKGKV  296



>ref|XP_002272968.2| PREDICTED: cytosolic sulfotransferase 13-like [Vitis vinifera]
Length=343

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 136/286 (48%), Positives = 189/286 (66%), Gaps = 7/286 (2%)
 Frame = +1

Query  208   RESIISSSLPREEGWLYPHMYNYKGFWLDSEF-LHGALRCQKHFQAQHSDIIVCTLPKCG  384
             R S I S+LP+E+GW   HMY Y+GFW  S   L G +  ++HF+ +H D+++ + PK G
Sbjct  25    RYSEIISTLPKEKGWTTEHMYQYQGFWYHSVVGLQGIMWVEEHFKPRHEDLLLVSAPKSG  84

Query  385   TTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVL  564
             TTW K+L+FA+  R Q+  S  THPLLTTSP EL+   E  +   I    P   +  ++ 
Sbjct  85    TTWFKSLMFAIMNRGQYDCS--THPLLTTSPHELVPFSEIFFHLNIPFPNPDTLSPPQIF  142

Query  565   STHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRY  744
              THLP   L +SV +S+C+++ VCRN KDT VS +HF+ K + E    E + F E F+++
Sbjct  143   HTHLPFTSLSQSVLDSQCRIVYVCRNPKDTFVSLFHFLQK-KEEENPREPLSFEEAFEQF  201

Query  745   CRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeee  924
             C+G S++GPFWDHVLGYWK SLE P +VLFLKYE++K +    L+R+A F+G  FS EEE
Sbjct  202   CKGVSVYGPFWDHVLGYWKASLEWPERVLFLKYEDMKVDSSFHLKRLAEFMGYAFSLEEE  261

Query  925   eggvvggISRLCSFESLSNLEVNKTGK---TYHERPNNVYFRKGKV  1053
             + G+V  I +LCSFE+ SNL VNKTG+    +    NN +FRKG+V
Sbjct  262   KQGLVKEILKLCSFENQSNLRVNKTGRFRVGHMSMENNPFFRKGEV  307



>ref|XP_009779416.1| PREDICTED: cytosolic sulfotransferase 15 [Nicotiana sylvestris]
Length=344

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/281 (46%), Positives = 191/281 (68%), Gaps = 8/281 (3%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             +SLP+E+GW  P+++ ++ FW   + +   +  QKHF+AQ +D+I+ ++PK GTTWLKAL
Sbjct  29    NSLPKEKGWRTPNLFLFQNFWCQPKEIRAIISTQKHFKAQDNDLILASIPKSGTTWLKAL  88

Query  406   VFALTTRKQFPVSQQT--HPLLTTSPQELIRNMEFSYSREIS--PDFPMNGNGFRVLSTH  573
              F++  R +F V Q+   HPLLT +P EL+  +E+    + +  PD  +  +  R+++TH
Sbjct  89    TFSIVNRNKFNVQQKNINHPLLTHNPHELVPFLEYKLYADFNSLPDLSLLPSP-RLVATH  147

Query  574   LPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRG  753
             +P   LP SV  SKCK++ +CRN  D  VS WH++ K+R E LG       E FD YCRG
Sbjct  148   VPFGALPNSVKTSKCKIVYICRNPFDAFVSVWHYLVKIRPESLG--PFTLEEAFDLYCRG  205

Query  754   ASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeegg  933
                FGP+W+H+LGYW+ESLENP KVLFLKYE++K +   +L+R+A FLG PF++EEE+GG
Sbjct  206   VIGFGPYWEHMLGYWRESLENPNKVLFLKYEDMKLDVCNQLKRLADFLGFPFTKEEEKGG  265

Query  934   vvggISRLCSFESLSNLEVNKTGK-TYHERPNNVYFRKGKV  1053
             ++  +S LCSF++L +L+VNK GK    +  N   FRKG++
Sbjct  266   IIKDVSSLCSFQNLRDLQVNKKGKGAISDFENRNLFRKGEI  306



>ref|XP_008393378.1| PREDICTED: cytosolic sulfotransferase 13-like [Malus domestica]
Length=323

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/283 (45%), Positives = 186/283 (66%), Gaps = 10/283 (4%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             S+LP++ GW   H Y Y+ FW    FL G +  Q+ F+A+ SD+ + T PKCGTTW+KAL
Sbjct  14    STLPKDTGWAAEHYYQYQNFWYPQVFLEGVIWAQQDFRARDSDVFLATFPKCGTTWVKAL  73

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTHLPLE  585
             + A+  RK    S  +HPLLT +P +++R +E    ++   ++  +    R+L+TH+P  
Sbjct  74    MIAIKNRKDCDYS--SHPLLTKNPHDIVRYIELLVHQDNPVEYLDSMASPRLLATHVPHS  131

Query  586   LLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMF  765
              LP SV +S  +++ V RN KD +VS W F  KLR+++  L  +P  E F+ +C+G ++ 
Sbjct  132   SLPNSVLDSDTRVVYVARNPKDVLVSLWAFSEKLRSKVYRLPPLPLEEGFELFCKGVALA  191

Query  766   GPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvgg  945
             GPFWDHVLGYW+ SL+NP KVLF K+E++K + E  ++R+A F+G PFS EEE+ G V  
Sbjct  192   GPFWDHVLGYWEASLKNPNKVLFFKFEDLKADTEGYVKRLAEFIGYPFSSEEEKEGAVQX  251

Query  946   ISRLCSFESLSNLEVNKTGKTYHERP-------NNVYFRKGKV  1053
             I + CSFE+LS+LEVNK+G TYH  P       N+V+FR+G+ 
Sbjct  252   IIKFCSFENLSSLEVNKSG-TYHVGPKTDEKFSNDVFFRRGET  293



>ref|XP_007045764.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOY01596.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=284

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 168/247 (68%), Gaps = 4/247 (2%)
 Frame = +1

Query  316   LRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRN  495
             L CQK+FQAQ SDI + T PK GTTWLKA+ FAL  R+++P     HPL+T +P  L+R 
Sbjct  32    LTCQKNFQAQDSDIFLATTPKSGTTWLKAIGFALVNRRKYP-DPINHPLVTNNPHALVRY  90

Query  496   MEFSYSREISPDFPMNGNGF-RVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWH  672
             +E     +   D         R+++THLP   LP+SV  S CKL+ +CRN KD  VS W 
Sbjct  91    LELEPRIDYQADNTSTTTASPRLIATHLPFVSLPESVKNSACKLVYLCRNPKDNFVSVWQ  150

Query  673   FMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeei  852
             F NK+R + +G    P  ETFD++CRG +++ PFWDH LGYWKESLENP+  LFLKY+++
Sbjct  151   FANKVRTKEMGTN--PLEETFDKFCRGVNVYEPFWDHALGYWKESLENPQGFLFLKYDDM  208

Query  853   keepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNV  1032
             KE PE+ LRRIA F+GCP S EEE  GVV  I  LCSF++LSNLEVNK+GK       NV
Sbjct  209   KEHPEIHLRRIAEFIGCPLSLEEESRGVVDDILNLCSFDTLSNLEVNKSGKLSSGHDTNV  268

Query  1033  YFRKGKV  1053
             +FR+G+V
Sbjct  269   FFRRGEV  275



>ref|XP_008231647.1| PREDICTED: cytosolic sulfotransferase 15-like [Prunus mume]
Length=326

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/276 (47%), Positives = 179/276 (65%), Gaps = 4/276 (1%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+E GW   H+Y ++GFW  S  +   +  QKHFQA  +DI+V ++PK GTTWLKAL 
Sbjct  20    SLPKERGWRTLHLYQFQGFWCQSAEIQSIMSFQKHFQANDTDIVVASIPKSGTTWLKALA  79

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPLE  585
             FA++ R +F  + ++HPLL ++P +L+  +E+  Y+    PD   N +  R+  TH+P  
Sbjct  80    FAVSNRHRFIPNSKSHPLLNSNPHDLVPFLEYKLYANNQLPDL-TNISEPRLFGTHIPFA  138

Query  586   LLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMF  765
              L  S+  S  K++ +CRN  DT VS WHF+NK++ E      I   E FD YC+G   F
Sbjct  139   SLGNSIKNSDAKIVFICRNPLDTFVSSWHFLNKVKPE--SGSPISMEEAFDMYCKGIVGF  196

Query  766   GPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvgg  945
             GPFWDH+LGYWKESL  P KVLFLKYE++KE+   +L+++A FLG PF+ EEE GGVV  
Sbjct  197   GPFWDHMLGYWKESLLRPNKVLFLKYEDMKEDGAFQLKKLAKFLGFPFTLEEERGGVVEN  256

Query  946   ISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             I++LC FE++  LEVNK G +     N   FRK +V
Sbjct  257   IAKLCCFENMKKLEVNKIGSSIENFENKNLFRKAEV  292



>ref|XP_004308399.1| PREDICTED: cytosolic sulfotransferase 15-like [Fragaria vesca 
subsp. vesca]
Length=339

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/280 (49%), Positives = 182/280 (65%), Gaps = 12/280 (4%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDS-EFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SLP+E GW+    Y Y+GFW  + E L   +  QKHFQA+ SDI+V +LPKCGTTWLKAL
Sbjct  24    SLPKERGWVALPQYLYQGFWCPTPEVLQAIIAFQKHFQARDSDIVVASLPKCGTTWLKAL  83

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGF---RVLSTH  573
              FA+  R +F +  +THPLLT++  +L+       Y     PDF  +   F   R+  TH
Sbjct  84    TFAVVNRHRFAI--ETHPLLTSNSHKLVPYFTMDLYINNRVPDF--SSKYFPEPRLFGTH  139

Query  574   LPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRG  753
             LP   L  SV ES CK+I  CRN  D+ VS WHF+NK R + LG   +   E FDRYC+G
Sbjct  140   LPYPSL-GSVKESNCKIIYTCRNPFDSFVSTWHFINKARPQSLG--PLSLDEAFDRYCQG  196

Query  754   ASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeegg  933
                +GPFWDH+LGYWKESL+ P  VLFLKYE++K++    L+++A F+ CPFSEEEE  G
Sbjct  197   MDGWGPFWDHILGYWKESLKRPNNVLFLKYEDMKKDVVSHLKKLAEFIDCPFSEEEERNG  256

Query  934   vvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             V+  I++LCSF+++  LE+NKTGK   +  N   FRK +V
Sbjct  257   VIEAIAKLCSFDTMKKLEINKTGKLVMDMENRSLFRKAEV  296



>gb|KDP44529.1| hypothetical protein JCGZ_16362 [Jatropha curcas]
Length=302

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 135/284 (48%), Positives = 178/284 (63%), Gaps = 17/284 (6%)
 Frame = +1

Query  220   ISSSLPREEGWLYP-HMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWL  396
             I S LP+E  WL   +++ Y+ FW    FL G +  QK+F  Q +DII+CTLPK GTTWL
Sbjct  28    IISDLPKETSWLLSQNLHKYQDFWCYPNFLEGIILAQKYFIPQPTDIIICTLPKSGTTWL  87

Query  397   KALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTHL  576
             KAL F +  R Q       +PLLT  P +++  +EF Y +      P+       LSTH+
Sbjct  88    KALCFTIFRRSQHSGGSSINPLLTNMPHDIVPFIEFLYCKGRDSQNPL-------LSTHV  140

Query  577   PLELLPKSVWE-SKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRG  753
             P   LP+S+ + S CK+I +CR+ KD  VS WHF NK     L  + + + E FD++C G
Sbjct  141   PYASLPESIVKCSTCKIIYMCRDPKDVFVSLWHFNNKS----LDTDVLSWEEAFDKFCTG  196

Query  754   ASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeegg  933
              S  GPFWD++LGYWK SLENP K+LFLKYE+++ +    ++RIA F+GCPFS EEE  G
Sbjct  197   LSAGGPFWDNILGYWKASLENPEKILFLKYEDLQNDTLFYVKRIAEFMGCPFSVEEERQG  256

Query  934   vvggISRLCSFESLSNLEVNKTGKTYHERP----NNVYFRKGKV  1053
             +V  I   CSFESLSNLEVNK  K  +E P    NN +FRKGK+
Sbjct  257   IVQNIVNFCSFESLSNLEVNKRNKVGNEIPFKVENNAFFRKGKI  300



>ref|XP_007028479.1| Sulfotransferase 2A, putative [Theobroma cacao]
 gb|EOY08981.1| Sulfotransferase 2A, putative [Theobroma cacao]
Length=377

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/293 (44%), Positives = 191/293 (65%), Gaps = 8/293 (3%)
 Frame = +1

Query  181   QENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDII  360
             Q+    KE  E ++S  LP+E+GW  P++Y ++GFW   + +   +  QKHFQA+ +D+I
Sbjct  61    QQEKMDKECEELVLS--LPKEKGWRTPYLYKFQGFWCQPKEIQAIISFQKHFQARATDVI  118

Query  361   VCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFP  537
             + T+PK GTTW+KALVFA   R++F +S   HPLLT++P +L+  +E+  Y+    PD  
Sbjct  119   LATIPKSGTTWIKALVFATMNRQRFGISN-CHPLLTSNPHDLVPFLEYKLYADNEIPDLS  177

Query  538   MNGNGFRVLSTHLPLELLPKSVWE-SKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEA  714
                N  R+ +TH+P   L  S+   S  +++ +CRN  DT +S WHF+NK+R++   L  
Sbjct  178   DLPNP-RLFATHVPFASLQNSIKNNSDRRIVYLCRNPFDTFISSWHFINKVRSD--SLPP  234

Query  715   IPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGF  894
             +P  E FD YC G   FGPFW+H+LGYWK+SLE P+ VLFLKY+++K++    L  +A F
Sbjct  235   LPLEEAFDMYCNGVVGFGPFWEHMLGYWKQSLERPKNVLFLKYDDMKKDIISHLMVLAKF  294

Query  895   LGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             LG PFS  EE+ GV+  I++LCSF++L +LEVN +GK      N   FRKG+V
Sbjct  295   LGLPFSVAEEKEGVIEEIAKLCSFDNLKDLEVNNSGKAIKNFENKHLFRKGEV  347



>ref|XP_004250849.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum lycopersicum]
Length=329

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 136/295 (46%), Positives = 195/295 (66%), Gaps = 6/295 (2%)
 Frame = +1

Query  172   KFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             K+ QE++  +E ++ +  S LP+++GW+  ++YNY+GFW    FL G +  Q+ FQA+ S
Sbjct  7     KYLQEDNLSEECKKLL--SILPKDKGWVGSYIYNYQGFWTPPRFLQGVIAFQQQFQAEDS  64

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISP  528
             DII+ T PK GTTWLK+L+FAL  R + P+ +  HPLL  +P  L+  +E   Y      
Sbjct  65    DIILVTTPKSGTTWLKSLLFALINRVKHPIFEPNHPLLVNNPHVLVPFLEHDLYIDGRVH  124

Query  529   DFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGL  708
             DF    +  ++L+TH+P   LPKSV +SK KL+ +CRN +DT +S WHF N L       
Sbjct  125   DFSTFTSP-KLLATHVPFASLPKSVQDSKTKLVYLCRNPRDTFISMWHFTNNLLLHHNDT  183

Query  709   EAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIA  888
              +I   E FD +C G S++GPFW+HVL YWK+S+E P K+LFL YEEIK++P+V+L+R+A
Sbjct  184   NSIE--EKFDLFCEGVSLYGPFWNHVLDYWKKSIEMPTKILFLMYEEIKKKPKVQLKRLA  241

Query  889   GFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              FL CP S EEE  GVV  I ++CSF++L NLEVN  G+       N++FRKG++
Sbjct  242   KFLECPISTEEENCGVVDEILKMCSFKNLRNLEVNTNGRFSTGEAYNLFFRKGEI  296



>gb|KCW80972.1| hypothetical protein EUGRSUZ_C02337 [Eucalyptus grandis]
Length=398

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 142/292 (49%), Positives = 192/292 (66%), Gaps = 8/292 (3%)
 Frame = +1

Query  187   NSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVC  366
             +S P E  E  + +SLP EE  +   +  Y+GFW  S  L+  + CQ HFQA  SDI++ 
Sbjct  82    SSLPSE--EDWVPTSLPFEEDCVPSSLRLYQGFWFPSWLLNSVVACQNHFQAHPSDILLV  139

Query  367   TLPKCGTTWLKALVFALTTRKQFP--VSQQTHPLLTTSPQELIRNMEFS-YSREISPDFP  537
             T PKCGTTWLKA++FAL  R ++    SQ  HPLLT +P +L+  +EF  Y +  +PD  
Sbjct  140   TSPKCGTTWLKAILFALLNRAKYSDSYSQPRHPLLTQNPHDLVSFLEFGLYLQNKNPDLT  199

Query  538   MNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAI  717
                +  R+L++HLP  LLP+SV  S CKL+ +CRN KDT +S WH+ NK R E  G   +
Sbjct  200   AFTSP-RLLASHLPYSLLPRSVRHSNCKLVYLCRNPKDTFISMWHYFNKFRPEEKG--QL  256

Query  718   PFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFL  897
             P  E  D++CRG S +GP+WDHVLGY K S E P KVLF+KYEE+K +P V++RR+A F+
Sbjct  257   PLLEGLDKFCRGMSAYGPYWDHVLGYHKASSEMPEKVLFVKYEEMKADPSVQVRRLADFI  316

Query  898   GCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             G PF+EEE   G + GI R+CSF++LS LEVN++GK         +FRKG+V
Sbjct  317   GRPFNEEELRNGTMEGILRMCSFDNLSALEVNRSGKLPGGVEKKWFFRKGEV  368



>ref|XP_010523501.1| PREDICTED: cytosolic sulfotransferase 12-like [Tarenaya hassleriana]
Length=335

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 195/308 (63%), Gaps = 12/308 (4%)
 Frame = +1

Query  148   TSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQ  327
             T++      F  +    +E+++ +  SSLPR++GW+  +MY ++GFWL    L G + CQ
Sbjct  2     TNSDASVLSFLGDEGITEEIKDMM--SSLPRQKGWMVKYMYQFQGFWLPPSLLQGTINCQ  59

Query  328   KHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS  507
             KHFQAQ SD+I+ T PK GTTWLKAL+FAL  RK+F  SQ  HPLLT +P  L+  +E  
Sbjct  60    KHFQAQDSDVILVTNPKSGTTWLKALIFALINRKKFHDSQHQHPLLTHNPHALVPFLEEV  119

Query  508   YSR--EISPDFPMNGNGF--RVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHF  675
             Y +  ++ PD  ++ +    R    H+    LP S+  S CK++  CRN KD  VS+WHF
Sbjct  120   YYKYPQVLPDDVVSSSSSCPRFFGAHMAHVSLPDSIKGSSCKIVYCCRNPKDMFVSFWHF  179

Query  676   MNKLRAELLGLEAI--PFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYee  849
               K+ ++    E++  P  E    +C G+ + G FWDHVLGYW+ S +NP KV F+ YEE
Sbjct  180   GQKMASK----ESLFCPIEEAVKLFCEGSFLSGSFWDHVLGYWEASQKNPDKVFFITYEE  235

Query  850   ikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNN  1029
             +KE P   L+++A FLGC F++EEEE G+V  I RLCSFESLS+ EVN+ GK  +    N
Sbjct  236   MKERPRTHLKQMADFLGCSFTKEEEEKGMVDEIIRLCSFESLSSFEVNRKGKLPNGIETN  295

Query  1030  VYFRKGKV  1053
              +FRKGK+
Sbjct  296   TFFRKGKI  303



>ref|XP_009370647.1| PREDICTED: cytosolic sulfotransferase 15-like [Pyrus x bretschneideri]
Length=329

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/279 (44%), Positives = 178/279 (64%), Gaps = 6/279 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+E GW   H+Y ++GFW  +  +   +  QKHFQA  +DI++ T+PK GTTWLKAL 
Sbjct  19    SLPKERGWRTLHLYQFQGFWCQAAEIQSIITFQKHFQATDTDIVLATIPKSGTTWLKALA  78

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNG---NGFRVLSTHL  576
             FA   R +F  + ++HPLLT++P +L+   E+  Y+    PD        +  R+  TH+
Sbjct  79    FATVNRHRFTTNSKSHPLLTSNPHDLVPFFEYKLYANNQIPDLTTTNLPDDQPRLFGTHI  138

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P   L  S+ +S  K++ +CRN  DT VS WHF++K++ E      +   + FD YC+G 
Sbjct  139   PFASLANSIRKSNSKIVYICRNPFDTFVSSWHFLDKVKPE--SKAPLSMEDAFDMYCKGI  196

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
               FGPFWDH+LGYW ESL  P+KVLFLKYE++KE+   +L+++A FLGCPF+  EE+ GV
Sbjct  197   VGFGPFWDHMLGYWNESLLRPQKVLFLKYEDLKEDGVFQLKKLAKFLGCPFTLVEEKNGV  256

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +  IS+LC F+++  LEVNKTG +     N   FRK +V
Sbjct  257   IESISKLCCFDNMKKLEVNKTGSSIKNFENKNLFRKAEV  295



>ref|XP_007208898.1| hypothetical protein PRUPE_ppa026895mg, partial [Prunus persica]
 ref|XP_007211062.1| hypothetical protein PRUPE_ppa018068mg, partial [Prunus persica]
 gb|EMJ10097.1| hypothetical protein PRUPE_ppa026895mg, partial [Prunus persica]
 gb|EMJ12261.1| hypothetical protein PRUPE_ppa018068mg, partial [Prunus persica]
Length=321

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/281 (45%), Positives = 184/281 (65%), Gaps = 5/281 (2%)
 Frame = +1

Query  220   ISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLK  399
             I S+LP++ GW   H Y Y+GFW    FL G +  Q +F+A+  DI + T PKCGTTW+K
Sbjct  13    IISTLPKDRGWGTEHYYQYEGFWYPPIFLEGVIWAQANFRARDDDIFLATFPKCGTTWVK  72

Query  400   ALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTHLP  579
             AL+FA+  R+ +     +HPLLT SPQ+ +  +E    ++   D+       R L+TH+P
Sbjct  73    ALMFAIQNRENYDF--LSHPLLTKSPQDCVPYIELLAHQDNPIDYLDAIASPRFLATHIP  130

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
                LP+S+  S  K++ V RN KD ++SYW F  K+R+ +  L  +P  E F+ +C+G +
Sbjct  131   HRSLPRSILNSGTKIVSVARNPKDVLISYWVFSQKIRSSINKLAPLPMEEGFELFCKGVA  190

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
             + GPFWD+VLGYW+ SLENP KVLFLK+E+IK + +  ++R+A F+G PFS +EE+ GVV
Sbjct  191   LSGPFWDNVLGYWEASLENPEKVLFLKFEDIKIDTDCSVKRLAEFMGLPFSSKEEQEGVV  250

Query  940   ggISRLCSFESLSNLEVNKTGKTYHER---PNNVYFRKGKV  1053
               I +LCSF++LSNLEVNK+G   +      N V+FR+G+ 
Sbjct  251   REIIKLCSFDNLSNLEVNKSGTFSNADGKFSNAVFFRRGQT  291



>gb|KFK38089.1| hypothetical protein AALP_AA3G068100 [Arabis alpina]
Length=325

 Score =   238 bits (606),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 139/279 (50%), Positives = 171/279 (61%), Gaps = 10/279 (4%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SSLPRE+GWL   MY Y+G W     L G L CQKHFQA+ SDII+ T PK GTTWLKAL
Sbjct  22    SSLPREKGWLVSQMYQYQGRWHTPALLQGILNCQKHFQAKDSDIILVTNPKSGTTWLKAL  81

Query  406   VFALTTRKQFPVSQQT--HPLLTTSPQELIRNMEFSYSREISPDFPMNG-NGFRVLSTHL  576
             VFAL  R +FPVS  +  HPLL T+P  L+  +E  Y    SPDF  +     R+++TH+
Sbjct  82    VFALLNRHKFPVSSSSGDHPLLVTNPHLLVPFLEGVYYE--SPDFDFSELPSPRLMNTHI  139

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
                 LP+ V  S CK++  CRN KD  VS WHF  KL  E       P  +  + +C G 
Sbjct  140   SHFSLPEPVQNSACKIVYCCRNPKDMFVSLWHFGKKLAPEETA--DYPIEKAVEAFCEGK  197

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
              + GPFWDHVL YW  S ENP KVLF+ YEE+K +   E++RIA FLGC F+    E   
Sbjct  198   FIGGPFWDHVLEYWYASRENPNKVLFVTYEELKTQTGAEVKRIAEFLGCGFT---GEEEQ  254

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             V  I +LCSFESLSNLEVN+ GK  +       FRKG++
Sbjct  255   VEEIVKLCSFESLSNLEVNRQGKLPNGMETKALFRKGEI  293



>ref|XP_009129074.1| PREDICTED: cytosolic sulfotransferase 12-like [Brassica rapa]
Length=341

 Score =   238 bits (608),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 136/285 (48%), Positives = 173/285 (61%), Gaps = 9/285 (3%)
 Frame = +1

Query  199   KELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPK  378
             +E R+ I  SSLP E+GWL  H+Y ++G W     L G L CQKHF+A+ SDII+ T PK
Sbjct  19    QETRDLI--SSLPSEKGWLVSHLYQFQGRWHTQALLQGLLECQKHFEAKDSDIILVTNPK  76

Query  379   CGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFR  558
              GTTWLKALVF+L  R +FPVS   HPLL T+P  LI  +E  Y      DFP   +  R
Sbjct  77    SGTTWLKALVFSLLNRHKFPVSSGNHPLLDTNPHLLIPFLEGVYHEFPDFDFPKLPSP-R  135

Query  559   VLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFD  738
             +++TH+PL  LP+SV  S CK++  CR  KD  VS WHF  KL  E       P  +  +
Sbjct  136   LMNTHIPLLSLPESVKSSSCKIVYCCRTPKDMFVSLWHFRKKLAPEETA--DCPIEKAIE  193

Query  739   RYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSee  918
              +C+G    GPFWDHVL YW  SLENP KVLF+ YEE+K++    +++I  FLGC F   
Sbjct  194   AFCQGKFTSGPFWDHVLEYWHASLENPNKVLFVTYEELKKQTGDTIKKICEFLGCGF---  250

Query  919   eeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
                     GI +LCSFESLS+ EVN+ GK  +      +FRKG V
Sbjct  251   -VGEEEERGIVKLCSFESLSSSEVNREGKLPNGMETKAFFRKGDV  294



>ref|XP_010425174.1| PREDICTED: cytosolic sulfotransferase 12-like [Camelina sativa]
Length=325

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 142/304 (47%), Positives = 185/304 (61%), Gaps = 14/304 (5%)
 Frame = +1

Query  148   TSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQ  327
             +S+S+P   +  +    +E R+ I  SSL +E+GWL   MY Y+G W     L G L CQ
Sbjct  2     SSSSVP--AYLGDEDLTQETRDLI--SSLAKEKGWLVSEMYQYQGRWHTQALLQGILICQ  57

Query  328   KHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQ-THPLLTTSPQELIRNMEF  504
             K F+A+ SDII+ T PK GTTWLKALV+AL  R +FPVS    HPLL T+P  L+  +E 
Sbjct  58    KRFEAKDSDIILVTNPKSGTTWLKALVYALLNRHKFPVSSSGNHPLLVTNPHLLVPFLEG  117

Query  505   SYSREISPDFPMNG-NGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMN  681
              Y    SPDF  +G    R+++TH+    LP+SV  S CK++  CRN KD  VS WHF  
Sbjct  118   VYYE--SPDFAFSGLPSPRLMNTHISHPSLPESVKSSSCKIVYCCRNPKDMFVSLWHFGK  175

Query  682   KLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikee  861
             KL  E     A P  +    +C G  + GPFWDH+L YW  S ENP KVLF+ YE++K++
Sbjct  176   KLAPEETA--AYPIEKAVKAFCEGKFIGGPFWDHILEYWYASRENPNKVLFVTYEDLKKQ  233

Query  862   peveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFR  1041
                E++RIA FLGC F     E G V  I +LCSFESLSNLEVN+ GK  +      +FR
Sbjct  234   TGAEMKRIAEFLGCGF----IEEGEVRDIVKLCSFESLSNLEVNRQGKLPNGMETKTFFR  289

Query  1042  KGKV  1053
             KG++
Sbjct  290   KGEI  293



>ref|XP_010534168.1| PREDICTED: cytosolic sulfotransferase 12-like [Tarenaya hassleriana]
 ref|XP_010523512.1| PREDICTED: cytosolic sulfotransferase 12-like [Tarenaya hassleriana]
Length=336

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 192/308 (62%), Gaps = 11/308 (4%)
 Frame = +1

Query  145   NTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRC  324
             N++ SLP   +  +    +E+++ +  +SLPR++GW+  H Y ++GFWL    L G + C
Sbjct  3     NSNASLPV--YLGDEGMTEEIKDMM--TSLPRQKGWMVNHTYQFQGFWLPPSLLQGTINC  58

Query  325   QKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNME-  501
             QKHFQAQ SD+I+ T PK GTTWLKAL+FAL  R +F   Q  HPLLT +P  L+  +E 
Sbjct  59    QKHFQAQDSDVILVTNPKSGTTWLKALIFALINRNKFHDCQHQHPLLTHNPHSLVSFLEG  118

Query  502   --FSYSREI-SPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWH  672
               ++Y   +       + +  R  +TH+    LP S+  S CK++  CRN KD  VS WH
Sbjct  119   VYYNYPHGLPDDVVSSSSSCTRFFNTHMAHVSLPDSIKGSSCKIVYCCRNPKDMFVSLWH  178

Query  673   FMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeei  852
             F +KL ++       P  E    +C G+ + GPFWDHVLGYW+ S +NP KV F+ YEE+
Sbjct  179   FGHKLASQ--ETLVCPIEEAVKLFCEGSFIGGPFWDHVLGYWEASQKNPDKVFFVTYEEM  236

Query  853   keepeveLRRIAGFLGCPFSeeeeegg-vvggISRLCSFESLSNLEVNKTGKTYHERPNN  1029
             KE P   L+R+A FLGC F++EEEE   +V  I RLCSFESLSNLEVN+ GK  +    N
Sbjct  237   KERPRTHLKRMADFLGCSFTKEEEEEKGMVDEIIRLCSFESLSNLEVNRKGKLPNGIETN  296

Query  1030  VYFRKGKV  1053
              +FRKG++
Sbjct  297   AFFRKGQI  304



>ref|XP_006395675.1| hypothetical protein EUTSA_v10004585mg [Eutrema salsugineum]
 gb|ESQ32961.1| hypothetical protein EUTSA_v10004585mg [Eutrema salsugineum]
Length=326

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/294 (47%), Positives = 175/294 (60%), Gaps = 11/294 (4%)
 Frame = +1

Query  175   FFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSD  354
             +  +    +E R+ I  SSLP E+GWL   MY ++G W     L G L+CQKHF+AQ SD
Sbjct  11    YLGDEDLTQETRDLI--SSLPSEKGWLVSQMYQFQGRWHTQALLQGILKCQKHFEAQDSD  68

Query  355   IIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDF  534
             II+ T PK GTTWLKALVFAL  R + PVS   HPLL T+P  L+  +E  Y    SP F
Sbjct  69    IILVTNPKSGTTWLKALVFALINRHKLPVSSGKHPLLVTNPHLLVPFLEGVYYE--SPGF  126

Query  535   PMNG-NGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLE  711
               +     R+++TH+    LP+SV  S CK++  CRN KD  VS WHF  KL  E     
Sbjct  127   DFSALPSPRLMNTHISHLSLPESVKSSSCKIVYCCRNPKDMFVSLWHFGKKLAPEETA--  184

Query  712   AIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAG  891
               P  +  + +C G  + GPFWDHVL YW  S ENP KVLF+ YE++K++   E++RIA 
Sbjct  185   DYPIEKAVEAFCEGKFIGGPFWDHVLEYWYTSRENPNKVLFVTYEDLKKQTGNEIKRIAE  244

Query  892   FLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             FLGC F         V  I RLCSFESLS LEVN+ GK  +      +FRKG++
Sbjct  245   FLGCGF----IGDEEVRDIVRLCSFESLSTLEVNREGKLPNGMETKAFFRKGEI  294



>ref|XP_011020444.1| PREDICTED: cytosolic sulfotransferase 15-like [Populus euphratica]
 ref|XP_011015958.1| PREDICTED: cytosolic sulfotransferase 15-like [Populus euphratica]
Length=337

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/276 (47%), Positives = 177/276 (64%), Gaps = 4/276 (1%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLPRE+GW    +Y YKGFW   + +   +  QK+FQ + +D+I+ ++PK GTTWLKAL 
Sbjct  31    SLPREKGWRTACLYKYKGFWCQPKEIQAIISFQKNFQPRDTDVILASIPKSGTTWLKALS  90

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPLE  585
             FA+  RK+F +S   HPLL ++P +L    E+  Y+ +  PD     +  R+ +TH+P  
Sbjct  91    FAIMNRKKFAISSNDHPLLVSNPHDLAPFFEYKLYADKQVPDLSKLPDP-RLFATHIPFA  149

Query  586   LLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMF  765
              L  S+ +S C++I +CRN  DT +S W F NKLR+E   +  +   ETF  +C G   F
Sbjct  150   SLQDSIKKSNCRIIYICRNPFDTFISSWTFSNKLRSE--TVPPLLLEETFKMFCEGVVGF  207

Query  766   GPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvgg  945
             GPFWDH+LGYWKESLE   KVLFLKYE++K +    L++IA F+GCPFS EEE+ GVV  
Sbjct  208   GPFWDHMLGYWKESLERQDKVLFLKYEDMKADVTFYLKKIAKFVGCPFSMEEEKEGVVEK  267

Query  946   ISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             I+ LCSFE +  LEVNK+G +     N   FRK +V
Sbjct  268   IASLCSFEKMKTLEVNKSGSSIKNFENKHLFRKAEV  303



>gb|KDO44381.1| hypothetical protein CISIN_1g019118mg [Citrus sinensis]
Length=346

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/299 (43%), Positives = 189/299 (63%), Gaps = 15/299 (5%)
 Frame = +1

Query  181   QENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDII  360
             +E     E +E ++S  LP+E GW    +Y ++G+W  ++ +   +  QKHF+A+ +DII
Sbjct  21    EEKHLSSECKEVLLS--LPKERGWRTAFLYKFQGYWCQAKEIQAIMAFQKHFKAKDTDII  78

Query  361   VCTLPKCGTTWLKALVFALTTRKQFPVSQQ----THPLLTTSPQELIRNMEFS-YSREIS  525
             + ++PK GTTW+KAL FA+  RK FP+        HPLLT++P +L+  +E+  Y+    
Sbjct  79    LASIPKSGTTWMKALSFAIINRKNFPIISDHHGHPHPLLTSNPHDLVPFLEYKLYANNQI  138

Query  526   PDFPMNGNGFRVLSTHLP---LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAE  696
             P+     +  RV +TH+P   L LLP     +  K++ +CRN  DT +S WHF+NKLR++
Sbjct  139   PELSQIADEPRVFATHIPFASLNLLPSM---NNIKIVYICRNPFDTFISSWHFLNKLRSQ  195

Query  697   LLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveL  876
               GL  I   E F  YC G   FGPFW+H+LGYW ESL+ P  VLFLKY+++K++    L
Sbjct  196   --GLPEISLEEAFKMYCDGVIGFGPFWEHMLGYWNESLKRPNNVLFLKYDDMKQDIVSNL  253

Query  877   RRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +++A FLG PFS EEE+ GV+  I++LCSFE +  L+VNK GK+  +  N   FRKG+V
Sbjct  254   KKLASFLGFPFSPEEEKQGVIQDIAKLCSFEEMKKLDVNKNGKSIKDIENKYLFRKGEV  312



>emb|CDY55733.1| BnaAnng13870D [Brassica napus]
Length=589

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/277 (50%), Positives = 176/277 (64%), Gaps = 9/277 (3%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SSLP E+GWL   +Y ++G W     L G L CQKHF+A+ SDII+ T PK GTTWLK+L
Sbjct  289   SSLPSEKGWLVSQIYQFQGRWHTEALLQGILTCQKHFKAKDSDIILVTNPKSGTTWLKSL  348

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGF-RVLSTHLPL  582
             VFAL  R +FPVS   HPLL T+P  L+  ME  Y    SPDF  +   F R+++TH+  
Sbjct  349   VFALINRHKFPVSSGDHPLLVTNPHLLVPFMEGVYYE--SPDFDFSLLPFPRLMNTHISH  406

Query  583   ELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASM  762
               LP+SV  S CK++  CRN KD  VS WHF  KL  +       P  +  + +C+G  +
Sbjct  407   LSLPESVKSSSCKIVYCCRNPKDMFVSLWHFGKKLAPQETA--DYPIEKAVEAFCQGKFI  464

Query  763   FGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvg  942
              GPFWDHVL YW  SLENP KVLF+ YEE+K++ EVE++RIA F+GC F+        V 
Sbjct  465   AGPFWDHVLEYWYASLENPNKVLFVTYEELKKQTEVEVKRIAEFIGCGFT----AEEEVS  520

Query  943   gISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              I +LCSFESLS+LEVNK GK  +    N +FRKG+ 
Sbjct  521   EIVKLCSFESLSSLEVNKQGKLPNGIETNAFFRKGET  557



>ref|XP_002264512.1| PREDICTED: flavonol sulfotransferase-like [Vitis vinifera]
Length=343

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/290 (47%), Positives = 190/290 (66%), Gaps = 15/290 (5%)
 Frame = +1

Query  208   RESIISSSLPREEGWLYPHMYNYKGFWLDS-EFLHGALRCQKHFQAQHSDIIVCTLPKCG  384
             R + I SSL +EEGW+  + Y Y+GFW  S   + G +  Q++F+ +H DI++ TLPK G
Sbjct  25    RNNEIISSLGKEEGWMEEYTYEYQGFWYPSVTLVEGVMWVQQNFKPRHEDILLVTLPKSG  84

Query  385   TTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGF---  555
             TTW K L+FA+  R  F +S  THP+LTTSP +L+  +E   S +I   FP N + F   
Sbjct  85    TTWFKPLMFAVMNRTHFDLS--THPILTTSPHDLVPFLELYLSHKIP--FP-NPDTFYPP  139

Query  556   RVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETF  735
             ++  TH+P   L + V ES+C+++ +CRN KD  VS ++F+ K+R +   L  +   + F
Sbjct  140   QLFQTHIPFTSLSQYVMESQCRIVYICRNPKDVFVSTFYFLEKVRDK--KLTPLSLEKAF  197

Query  736   DRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSe  915
             +R+C+G S++GPFWDHVLGYWK SLE P +VLFLKYE++K +    L+R+A F+G PFS 
Sbjct  198   ERFCKGVSLYGPFWDHVLGYWKASLEVPDRVLFLKYEDMKRDSSFHLKRLAEFMGYPFSV  257

Query  916   eeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNV----YFRKGKV  1053
             EEE+ GV   I  LCSFE+L NL+VNKTGK      N V    +FRKG+V
Sbjct  258   EEEKQGVAHDILELCSFENLRNLKVNKTGKIITSNNNQVENHRFFRKGEV  307



>ref|XP_006591672.1| PREDICTED: cytosolic sulfotransferase 15-like [Glycine max]
Length=342

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/277 (46%), Positives = 173/277 (62%), Gaps = 5/277 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLPRE+GW  P++Y ++GFW     +   +  QKHFQA+ SD++V T+PK GTTWLKAL 
Sbjct  35    SLPREKGWRTPYVYLFQGFWCQPHEIQAIITFQKHFQAKDSDVLVATVPKSGTTWLKALT  94

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSY--SREISPDFPMNGNGFRVLSTHLPL  582
             FA  +R  F    + HPLL  +P +L+   E++     +  PD   N +  R+  TH+P 
Sbjct  95    FATVSRHNFSSFNKNHPLLNFNPHDLVPFFEYTVYDKHDKVPDLS-NMHEPRLFGTHVPF  153

Query  583   ELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASM  762
               L KS+ ES CK+I +CRN  DT +S W F NK++     L  +   E F+ YC+G   
Sbjct  154   ASLSKSIKESNCKVIYICRNPFDTFISSWFFANKIKPG--SLPTLALDEAFEMYCKGVVG  211

Query  763   FGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvg  942
             FGPFW H+LGYWKES+E P KVLFL YE++K +    L+R+A FLGCPF+ EEE  GV+ 
Sbjct  212   FGPFWTHMLGYWKESIEKPNKVLFLMYEDLKGDINFHLKRVAEFLGCPFTLEEENRGVIE  271

Query  943   gISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              I +LCSF+ +  LEVNK+G       N   FRKG++
Sbjct  272   NIIKLCSFQKMKELEVNKSGTFGRNFENKFLFRKGEI  308



>ref|XP_006465789.1| PREDICTED: cytosolic sulfotransferase 15-like [Citrus sinensis]
Length=346

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 128/299 (43%), Positives = 188/299 (63%), Gaps = 15/299 (5%)
 Frame = +1

Query  181   QENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDII  360
             +E     E +E ++S  LP+E GW    +Y ++G+W  +  +   +  QKHF+A+ +DII
Sbjct  21    EEKHLSSECKEVLLS--LPKERGWRTAFLYQFQGYWCQAREIQAIMAFQKHFKAKDTDII  78

Query  361   VCTLPKCGTTWLKALVFALTTRKQFPVSQQ----THPLLTTSPQELIRNMEFS-YSREIS  525
             + ++PK GTTW+KAL FA+  RK FP+        HPLLT++P +L+  +E+  Y+    
Sbjct  79    LASIPKSGTTWMKALSFAIINRKNFPIISDHHGHPHPLLTSNPHDLVPFLEYKLYANNQI  138

Query  526   PDFPMNGNGFRVLSTHLP---LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAE  696
             P+     +  RV +TH+P   L LLP     +  K++ +CRN  DT +S WHF+NKLR++
Sbjct  139   PELSQIADEPRVFATHIPFASLNLLPSM---NNIKIVYICRNPFDTFISSWHFLNKLRSQ  195

Query  697   LLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveL  876
               GL  I   E F  YC G   FGPFW+H+LGYW ESL+ P  VLFLKY+++K++    L
Sbjct  196   --GLPEISLEEAFKMYCDGVIGFGPFWEHMLGYWNESLKRPNNVLFLKYDDMKQDIVSNL  253

Query  877   RRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +++A FLG PFS EEE+ GV+  I++LCSFE +  L+VNK GK+  +  N   FRKG+V
Sbjct  254   KKLASFLGFPFSPEEEKQGVIQDIAKLCSFEEMKKLDVNKNGKSIKDIENKYLFRKGEV  312



>gb|AAR14296.1| steroid sulfotransferase 4 [Brassica napus]
 emb|CDY45713.1| BnaC02g35150D [Brassica napus]
Length=323

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 139/294 (47%), Positives = 182/294 (62%), Gaps = 11/294 (4%)
 Frame = +1

Query  175   FFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSD  354
             + ++    +E R+ I  SSLP E+GWL   MY ++G W     L G L+ QKHF+A+ SD
Sbjct  8     YLRDEDLTQETRDLI--SSLPSEKGWLVSQMYQFQGRWHTQALLQGLLQYQKHFEAKDSD  65

Query  355   IIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDF  534
             II+ T PK GTTWLKALVF+L  R +FPVS   HPLL T+P  LI  +E  Y    SP+F
Sbjct  66    IILVTNPKSGTTWLKALVFSLINRHKFPVSSGDHPLLVTNPHLLIPFLEGVYYE--SPNF  123

Query  535   PMNG-NGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLE  711
                     R+++TH+ L  LP+SV  S CK++  CRN KD  VS WHF  KL ++     
Sbjct  124   DFTELPSPRLMNTHISLLSLPESVKSSSCKIVYCCRNPKDMFVSLWHFGKKLASQETA--  181

Query  712   AIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAG  891
               P  +  + +C+G  + GPFWDHVL YW  SLENP KVLF+ YEE+K++    ++RIA 
Sbjct  182   DYPIEKAVEAFCQGKFIGGPFWDHVLEYWYASLENPNKVLFVTYEELKKQTGDTIKRIAE  241

Query  892   FLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             FLGC F     E   VGGI +LCSFESLS+LE N+ GK  +      +FRKG+V
Sbjct  242   FLGCGF----IEEEEVGGIVKLCSFESLSSLEANREGKLPNGVETKAFFRKGEV  291



>ref|XP_006418637.1| hypothetical protein EUTSA_v10002851mg [Eutrema salsugineum]
 gb|ESQ37073.1| hypothetical protein EUTSA_v10002851mg [Eutrema salsugineum]
Length=327

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 140/306 (46%), Positives = 182/306 (59%), Gaps = 16/306 (5%)
 Frame = +1

Query  148   TSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQ  327
             +S+S+P   + +++   +E R+ I  SSLP E+GWL   MY +KGFW     L G L+CQ
Sbjct  2     SSSSVP--DYLRDDDLTQETRDLI--SSLPSEKGWLVSQMYQFKGFWQTQALLQGILKCQ  57

Query  328   KHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQT---HPLLTTSPQELIRNM  498
             KHF+A+ SDII+ T PK GTTWLKAL+FAL  R +FPVS  +   HPLL T+P  L+  +
Sbjct  58    KHFEAKDSDIILVTNPKSGTTWLKALLFALINRHKFPVSSSSSGDHPLLVTNPHLLVPFL  117

Query  499   EFSYSREISPDFPMNG-NGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHF  675
             E  Y    SPDF  +     R+++TH+    LP+SV  S CK++  CRN KD  VS WHF
Sbjct  118   EGVYYE--SPDFNFSELPSPRLMNTHISYLSLPESVKSSSCKIVYCCRNPKDMFVSLWHF  175

Query  676   MNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeik  855
               KL  E       P  +    +C G  + GPFWDHVL YW  S ENP KVLF+ YE++K
Sbjct  176   GKKLAPEETA--DYPIEKAVKAFCEGKFIAGPFWDHVLEYWYASRENPNKVLFVTYEDLK  233

Query  856   eepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVY  1035
             ++   E+ RIA FLGC           V  I RLCSFE LS LEVNK G   +      +
Sbjct  234   KQTGKEITRIAEFLGC----GSIGEEEVKDIVRLCSFEHLSKLEVNKEGTLPNGIETKAF  289

Query  1036  FRKGKV  1053
             FRKG++
Sbjct  290   FRKGEI  295



>ref|XP_010031022.1| PREDICTED: cytosolic sulfotransferase 15-like [Eucalyptus grandis]
 gb|KCW50285.1| hypothetical protein EUGRSUZ_J00069 [Eucalyptus grandis]
Length=341

 Score =   236 bits (603),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/280 (45%), Positives = 186/280 (66%), Gaps = 11/280 (4%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+E+GW   H+Y ++GFW   + +   L  Q+HFQAQ SDI++ T+PK GTTWLKAL 
Sbjct  32    SLPKEKGWRTKHIYLFQGFWCQPKEIQSILSFQRHFQAQDSDIVLSTIPKSGTTWLKALA  91

Query  409   FALTTRKQFPVSQQ-THPLLTTSPQELIRNMEFS-YSREISPD---FPMNGNGFRVLSTH  573
             FA+  R+++P+S++ +HPLLT++P +L+   E+  Y+    PD   FP      R+  TH
Sbjct  92    FAIANREKYPISKKKSHPLLTSNPHDLVPFFEYKVYASSDLPDLSKFPEP----RIFGTH  147

Query  574   LPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRG  753
             +P   L + +  S+CK++ +CRN  DT VS W ++NK++ + + +  +   E F+ YC G
Sbjct  148   IPFPALAEPIKNSQCKIVYICRNPFDTFVSSWMYLNKVKPDSMPM--VQLEEAFEMYCNG  205

Query  754   ASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeegg  933
                +GPFW+H+LGYW ESL+ P KVLFLKYEE+KE+    ++++A FLG PFS +EE  G
Sbjct  206   TMGYGPFWNHMLGYWNESLKRPDKVLFLKYEEMKEDIVSHVKKLAIFLGYPFSVQEERDG  265

Query  934   vvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             VV  +S LCSFE + +LEVN++GK+     N   FRK ++
Sbjct  266   VVEDLSELCSFEKMKDLEVNRSGKSIMNFENKNLFRKAEI  305



>gb|KHN26485.1| Flavonol sulfotransferase-like [Glycine soja]
Length=342

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 173/277 (62%), Gaps = 5/277 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLPRE+GW  P++Y ++GFW     +   +  QKHFQA+ SD++V T+PK GTTWLKAL 
Sbjct  35    SLPREKGWRTPYVYLFQGFWCQPHEIQAIITFQKHFQAKDSDVLVATVPKSGTTWLKALT  94

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSY--SREISPDFPMNGNGFRVLSTHLPL  582
             FA  +R  F    + HPLL  +P +L+   E++     +  PD   N +  R+  TH+P 
Sbjct  95    FATVSRHNFSSFNKNHPLLNFNPHDLVPFFEYTVYDKHDKVPDLS-NMHEPRLFGTHVPF  153

Query  583   ELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASM  762
               L KS+ +S CK+I +CRN  DT +S W F NK++     L  +   E F+ YC+G   
Sbjct  154   ASLSKSIKDSNCKVIYICRNPFDTFISSWFFANKIKPG--SLPTLALDEAFEMYCKGVVG  211

Query  763   FGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvg  942
             FGPFW H+LGYWKES+E P KVLFL YE++K +    L+R+A FLGCPF+ EEE  GV+ 
Sbjct  212   FGPFWTHMLGYWKESIEKPNKVLFLMYEDLKGDINFHLKRVAEFLGCPFTLEEENRGVIE  271

Query  943   gISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              I +LCSF+ +  LEVNK+G       N   FRKG++
Sbjct  272   NIIKLCSFQKMKELEVNKSGTFGRNFENKFLFRKGEI  308



>ref|XP_006432398.1| hypothetical protein CICLE_v10003688mg [Citrus clementina]
 gb|ESR45638.1| hypothetical protein CICLE_v10003688mg [Citrus clementina]
Length=346

 Score =   236 bits (602),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 128/298 (43%), Positives = 187/298 (63%), Gaps = 17/298 (6%)
 Frame = +1

Query  181   QENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDII  360
             +E     E +E ++S  LP+E GW    +Y ++G+W  ++ +   +  QKHF+A+ +DII
Sbjct  21    EEKHLSSECKEVLLS--LPKERGWRTAFLYKFQGYWCQAKEIQAIMAFQKHFKAKDTDII  78

Query  361   VCTLPKCGTTWLKALVFALTTRKQFPVSQQTH----PLLTTSPQELIRNMEFSYSREISP  528
             + ++PK GTTW+KAL FA+  RK FP+    H    PLLT++P +L+    F Y+    P
Sbjct  79    LASIPKSGTTWMKALSFAIINRKNFPIISDHHGHHHPLLTSNPHDLV---PFLYANNQIP  135

Query  529   DFPMNGNGFRVLSTHLP---LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAEL  699
             +     +  RV +TH+P   L LLP     +  K++ +CRN  DT +S WHF+NKLR++ 
Sbjct  136   ELSQIADEPRVFATHIPFASLNLLPSM---NNIKIVYICRNPFDTFISSWHFLNKLRSQ-  191

Query  700   LGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLR  879
              GL  I   E F  YC G   FGPFW+H+LGYW ESL+ P  VLFLKY+++K++    L+
Sbjct  192   -GLPEISLEEAFKMYCDGVIGFGPFWEHMLGYWNESLKRPNNVLFLKYDDMKQDIVSNLK  250

Query  880   RIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             ++A FLG PFS EEE+ GV+  I++LCSFE +  L+VNK GK+  +  N   FRKG+V
Sbjct  251   KLASFLGFPFSPEEEKQGVIQDIAKLCSFEEMKKLDVNKNGKSIKDIENKYLFRKGEV  308



>ref|XP_010502398.1| PREDICTED: cytosolic sulfotransferase 12-like [Camelina sativa]
Length=325

 Score =   235 bits (600),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 143/304 (47%), Positives = 187/304 (62%), Gaps = 14/304 (5%)
 Frame = +1

Query  148   TSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQ  327
             +S+S+P   +  +    +E R+ I  SSLP+E+GWL   MY Y+G W     L G L CQ
Sbjct  2     SSSSVP--AYLGDEDLTQETRDLI--SSLPKEKGWLVSEMYQYQGRWNTQALLQGILICQ  57

Query  328   KHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQ-THPLLTTSPQELIRNMEF  504
             K F+A+ SDII+ T PK GTTWLKALVFAL  R +FPVS    HPLL T+P  L+  +E 
Sbjct  58    KRFEAKDSDIILVTNPKSGTTWLKALVFALLNRHKFPVSSSGNHPLLVTNPHLLVPFLEG  117

Query  505   SYSREISPDFPMNG-NGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMN  681
              Y    SPD   +G    R+++TH+    LP+SV  S CK++  CRN KD  VS WHF  
Sbjct  118   VYYE--SPDSDFSGLPSPRLMNTHISHLSLPESVKSSSCKIVYCCRNPKDMFVSLWHFGK  175

Query  682   KLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikee  861
             KL  E     A P  +  + +C G  + GPFWDH+L YW  S ENP KVLF+ YE++K++
Sbjct  176   KLAPEETA--AYPIEKAVEAFCEGKFIGGPFWDHILEYWYASRENPNKVLFVTYEDLKKQ  233

Query  862   peveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFR  1041
                E++RIA FLGC F EEEE   +     +LCSFESLSNLEVN+ GK  +      +FR
Sbjct  234   TGTEMKRIAEFLGCGFIEEEEVREI----VKLCSFESLSNLEVNRHGKLPNGMETKTFFR  289

Query  1042  KGKV  1053
             KG++
Sbjct  290   KGEI  293



>ref|XP_010044375.1| PREDICTED: cytosolic sulfotransferase 5-like [Eucalyptus grandis]
Length=337

 Score =   236 bits (601),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 139/313 (44%), Positives = 201/313 (64%), Gaps = 12/313 (4%)
 Frame = +1

Query  124   MAAPSDPNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEF  303
             M A   P  S+++    +++++  P+  ++ +  SSLP EE W+   +  Y+GF   +  
Sbjct  1     MQASQPPRPSHAI----YWRDDDMPQACKDLV--SSLPSEEDWIATSLCLYQGFRFPTWL  54

Query  304   LHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVS--QQTHPLLTTSP  477
               G L CQ HFQAQ SDI++ T  K  TTWLKA++FAL  R ++  S  Q+ HPLLT +P
Sbjct  55    FKGVLACQNHFQAQPSDILLVTKLKSDTTWLKAILFALLNRAKYSDSDSQRCHPLLTQNP  114

Query  478   QELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDT  654
              +L+  +E   Y  + +P+     +  R+ +THLP   LP+SV + +CKL+ +CRN KD 
Sbjct  115   HDLVPFLELKLYLEQENPNLTAFESP-RLFATHLPYSSLPRSVRDFRCKLVYLCRNPKDM  173

Query  655   VVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLF  834
              +S WHF+NKLR E  G    P P+  D++C+G S +GP+WDHVLG+ K SLE P +V F
Sbjct  174   FISLWHFVNKLRPE--GKGQTPLPKCLDKFCQGLSPYGPYWDHVLGFHKASLEMPEQVFF  231

Query  835   LKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYH  1014
             L YEE+KE+P V + R+A FLGCPFS+EE     V GI R+CSF +LS+LEVNK+GK + 
Sbjct  232   LMYEEMKEDPRVHVSRLADFLGCPFSDEELRDETVDGILRMCSFNNLSSLEVNKSGKLWT  291

Query  1015  ERPNNVYFRKGKV  1053
              + N  +FR+G+V
Sbjct  292   GQENKWFFRRGEV  304



>ref|XP_006385980.1| hypothetical protein POPTR_0003s19280g [Populus trichocarpa]
 gb|ERP63777.1| hypothetical protein POPTR_0003s19280g [Populus trichocarpa]
Length=333

 Score =   236 bits (601),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 135/299 (45%), Positives = 192/299 (64%), Gaps = 16/299 (5%)
 Frame = +1

Query  181   QENSWPKELRESI----ISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQH  348
             Q NS   E  ES     I SSLP+EEGW+  +MY Y+GFW   + +H  +  Q +FQA +
Sbjct  8     QRNSTVSETGESDQCRDIISSLPKEEGWVSGYMYLYQGFWCPPKEIHAVVSFQNNFQACN  67

Query  349   SDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREIS  525
             +D I+ ++PK GTTWLKALVF++  R+++  ++   PL + +P +L+   E+  Y+    
Sbjct  68    TDTILVSMPKSGTTWLKALVFSIINREKYQTAES--PLNSFNPHDLVPFFEYRLYANNQV  125

Query  526   PD---FPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAE  696
             PD   FP      R+ STH+P   LP+S+  S C+++ +CRN  D  +S+WHF++K R E
Sbjct  126   PDLSAFPSP----RIFSTHVPYPSLPESIRNSTCRVVYICRNPLDNFISFWHFLSKARPE  181

Query  697   LLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveL  876
               G   +   E FD +C G   FGPF+DHVLGYWKESLE P KVLFLK+E++KE+   ++
Sbjct  182   RRG--PLLLEEAFDSFCNGVVGFGPFFDHVLGYWKESLERPEKVLFLKFEDLKEDINSQM  239

Query  877   RRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             + +A FLGCPFS EEE  GV+  IS+LCS +SL ++E NK GK+     NN  FR+G+V
Sbjct  240   KSLAVFLGCPFSLEEERDGVIEDISKLCSLDSLKDIEANKRGKSIPYFENNTLFRRGEV  298



>ref|XP_010095979.1| Flavonol sulfotransferase-like protein [Morus notabilis]
 gb|EXB62672.1| Flavonol sulfotransferase-like protein [Morus notabilis]
Length=329

 Score =   235 bits (600),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 131/282 (46%), Positives = 172/282 (61%), Gaps = 13/282 (5%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SSLP+E GW   H+Y Y+GFW     +   +  Q HFQA  +DII+ T+PK GTTWLKAL
Sbjct  20    SSLPKERGWRTSHLYQYQGFWCQPAEIQAIVSFQNHFQAYDNDIILATMPKSGTTWLKAL  79

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPM----NGNGFRVLST  570
              FA+  R  FPV    HPLLT++P +L+  +E+  Y+    PD       + +  R+  T
Sbjct  80    AFAVVNRDHFPVDSDKHPLLTSNPHDLVPFLEYKIYANNQIPDLSKLSADDQDRPRLFGT  139

Query  571   HLPLELLPKSVWESK-CKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYC  747
             H+P   L  SV +S  C+++ +CRN  DT +S WHF+         +      E F+  C
Sbjct  140   HIPFPSLANSVKKSNSCRVVYLCRNPFDTFISSWHFIG-------SMSPFTLEEAFEMCC  192

Query  748   RGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeee  927
             RG   FGPFWDH+LGYWKESL  P  VLFL YE++KE+    L+R+A FLG PFS EEE 
Sbjct  193   RGVIGFGPFWDHMLGYWKESLARPENVLFLTYEDLKEDAVFHLKRLAKFLGRPFSFEEET  252

Query  928   ggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              G+V  I++LCSFE+L  LEVNK GK+     NN  FRKG+V
Sbjct  253   SGLVEKIAKLCSFENLKGLEVNKKGKSIKNFENNKLFRKGEV  294



>ref|XP_007225044.1| hypothetical protein PRUPE_ppa019825mg [Prunus persica]
 gb|EMJ26243.1| hypothetical protein PRUPE_ppa019825mg [Prunus persica]
Length=257

 Score =   233 bits (594),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 173/264 (66%), Gaps = 12/264 (5%)
 Frame = +1

Query  124  MAAPSDPNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEF  303
            MA P  P    +LP  ++ QE+ + +E R+ I  SSLP E+GW+  H++ Y+GFW  +  
Sbjct  1    MATPQPPP---ALP--QYLQEHEFSQENRDFI--SSLPTEKGWVSNHLHQYQGFWHATRH  53

Query  304  LHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQE  483
            + G L CQKHFQA  +DI++ + PK GTTWLKA++FAL  R Q P  QQ H L+T  P  
Sbjct  54   MQGVLACQKHFQALDTDILLVSTPKSGTTWLKAILFALVKRAQHPDPQQ-HLLITNIPHV  112

Query  484  LIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVV  660
            L+  +E + Y  +  PD        R+ STHLP   LP SV  S CK++ +CR+ KDT V
Sbjct  113  LVPFLELNVYMEKEVPDL-TALTPPRLFSTHLPYVSLPDSVKHSACKVVYLCRDPKDTFV  171

Query  661  SYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLK  840
            S WHF NKLRA+  G   I   E FD++C+G S+ GP WDHVLGYWKESLE P KV+F K
Sbjct  172  SLWHFANKLRAKSRG--TISLEEAFDKFCKGVSLDGPLWDHVLGYWKESLERPEKVMFFK  229

Query  841  YeeikeepeveLRRIAGFLGCPFS  912
            +EE+KEEP + LRR+A FLGCPFS
Sbjct  230  FEEMKEEPTLHLRRLAEFLGCPFS  253



>gb|AAC63111.1| steroid sulfotransferase 1 [Brassica napus]
Length=323

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 137/301 (46%), Positives = 185/301 (61%), Gaps = 12/301 (4%)
 Frame = +1

Query  151   SNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQK  330
             S+S+P   + ++ +  +E R+ +  SSLP E+GWL   MY ++G W     + G + CQK
Sbjct  3     SSSVPV--YLKDENLTQETRDLL--SSLPSEKGWLVSQMYQFEGIWQTQALVQGIVNCQK  58

Query  331   HFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSY  510
             HF+A  SD+I+ TL K GTTWLKAL+FAL  R +FPVS + HPLL T+P  L+  +E  Y
Sbjct  59    HFEANDSDVILATLAKSGTTWLKALLFALIHRHKFPVSGK-HPLLVTNPHSLVPYLEGDY  117

Query  511   SREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLR  690
                   +F    +  R++ THL    LP S+  S CK+I  CRN KD  VS WHF  KL 
Sbjct  118   CSSPEVNFAELPSP-RLMQTHLTHHSLPVSIKSSSCKIIYCCRNPKDMFVSIWHFGRKLA  176

Query  691   AELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepev  870
              E       P       +C+G  + GPFWDHVL YW ESL+NP KVLF+ YEE+K++ EV
Sbjct  177   PEKTA--EYPIETAVAAFCKGKFIGGPFWDHVLEYWYESLKNPNKVLFVTYEELKKQTEV  234

Query  871   eLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGK  1050
             E++RIA F+GC F+        V  I +LCSFESLS+LEVN+ GK  +   +N +FRKG+
Sbjct  235   EVKRIAEFIGCGFT----AEEEVSEIVKLCSFESLSSLEVNRQGKLPNGIESNAFFRKGE  290

Query  1051  V  1053
              
Sbjct  291   T  291



>ref|XP_002876896.1| hypothetical protein ARALYDRAFT_484285 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53155.1| hypothetical protein ARALYDRAFT_484285 [Arabidopsis lyrata subsp. 
lyrata]
Length=325

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 143/304 (47%), Positives = 184/304 (61%), Gaps = 14/304 (5%)
 Frame = +1

Query  148   TSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQ  327
             +S+S+P   + ++    +E R+ I  SSLP+E+GWL   MY Y+G W     L G L CQ
Sbjct  2     SSSSVP--DYLRDEDVTQETRDLI--SSLPKEKGWLVSEMYQYQGRWHTQALLQGILICQ  57

Query  328   KHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQ-THPLLTTSPQELIRNMEF  504
             K F+A+ SDII+ T PK GTTWLKALVFAL  R +FPVS    HPLL T+P  L+  +E 
Sbjct  58    KRFEAKDSDIILVTNPKSGTTWLKALVFALLNRHKFPVSSSGNHPLLVTNPHLLVPFLEG  117

Query  505   SYSREISPDFPMNG-NGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMN  681
              Y    SPDF  +G    R+++TH+    LP+SV  S CK++  CRN KD  VS WHF  
Sbjct  118   VYYE--SPDFDFSGLPSPRLMNTHISHLSLPESVKSSSCKIVYCCRNPKDMFVSLWHFGK  175

Query  682   KLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikee  861
             KL  E       P  +  + +C G  + GPFWDH+L YW  S ENP KVLF+ YEE+K++
Sbjct  176   KLAPEETA--DYPIEKAVEAFCEGKFIGGPFWDHILEYWYASRENPNKVLFVTYEELKKQ  233

Query  862   peveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFR  1041
                E++RIA FLGC F     E   V  I  LCSFESLS LEVNK GK  +      +FR
Sbjct  234   TGAEMKRIAEFLGCGFI----EEEEVKEIVTLCSFESLSKLEVNKEGKLPNGMETKTFFR  289

Query  1042  KGKV  1053
             KG++
Sbjct  290   KGEI  293



>ref|XP_006395674.1| hypothetical protein EUTSA_v10005340mg [Eutrema salsugineum]
 gb|ESQ32960.1| hypothetical protein EUTSA_v10005340mg [Eutrema salsugineum]
Length=324

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 135/303 (45%), Positives = 191/303 (63%), Gaps = 13/303 (4%)
 Frame = +1

Query  148   TSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQ  327
             T++     K   E+++ +E +E +  S LP++  +   ++Y Y+GFW     L G L  Q
Sbjct  2     TNSKTTLSKLLAESNFSQECKELL--SYLPKDRSFFAEYLYQYQGFWYPPNLLEGVLYSQ  59

Query  328   KHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS  507
             KHFQA+ SDII+ + PK GTTWLKALVFA   R++F    ++HPLL  +P  L+  +E +
Sbjct  60    KHFQARDSDIILVSSPKSGTTWLKALVFASVYRQEFQTPLESHPLLDNNPHSLVPFIE-A  118

Query  508   YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKL  687
             ++      FP      R+ STH+PL  LP+S+ +S CK++  CRN KD  VS WHFM  L
Sbjct  119   FNFHTQDTFP------RIFSTHIPLGSLPESIKKSSCKVVYCCRNPKDAFVSLWHFMKDL  172

Query  688   R-AELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeep  864
                E++G       +    +CRG+S++GPFWDH L YWKESLENP+KV F+KYE+++E+P
Sbjct  173   VLKEMVG---CTMEQMVKGFCRGSSVYGPFWDHALEYWKESLENPKKVFFVKYEDMREKP  229

Query  865   eveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRK  1044
             E  + RIA FLG  F+E E E GV+  I +LCS E+LS LEVNK GK  +      +FRK
Sbjct  230   EDWVMRIAEFLGYSFTEREIENGVLEDIIKLCSLENLSKLEVNKVGKLMNGMETKAFFRK  289

Query  1045  GKV  1053
             G++
Sbjct  290   GEI  292



>ref|XP_002876897.1| sulfotransferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53156.1| sulfotransferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=324

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 137/305 (45%), Positives = 194/305 (64%), Gaps = 17/305 (6%)
 Frame = +1

Query  148   TSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQ  327
             T +     K   E+ + +E +E +  SSLPR+  +   ++Y Y+GFW     L G L  Q
Sbjct  2     TKSETTLSKLLVESEFCQECKELL--SSLPRDRSFYAEYLYQYQGFWYPPNLLEGVLYSQ  59

Query  328   KHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNME-F  504
             KHFQA+ SDII+ + PK GTTWLK+LVFAL  R++F    ++HPLL  +P  L+  +E F
Sbjct  60    KHFQARDSDIILVSSPKSGTTWLKSLVFALIHRQEFQTPLESHPLLDNNPHTLVTFIEGF  119

Query  505   SY-SREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMN  681
              + +++ SP          + STH+PL  LP+SV +S CK++  CRN KD  VS WHF+ 
Sbjct  120   QFHTQDTSPS---------IYSTHIPLGSLPESVKDSSCKVVYCCRNPKDAFVSLWHFVK  170

Query  682   KLR-AELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeike  858
             +L   E++G       E    +C+G+S++GPFWDH L YWKES ENP+KV+F+ YEE++E
Sbjct  171   RLTLKEMVG---CTMEEMVSGFCKGSSVYGPFWDHALEYWKESRENPKKVMFVMYEEMRE  227

Query  859   epeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYF  1038
             +P+  L RIA FLGC F+EEE E GV+  I +LCS E+LS LEVN+ GK  +      +F
Sbjct  228   QPQNSLMRIAEFLGCSFTEEEIENGVLEDIVKLCSLENLSKLEVNEKGKLLNGMETKAFF  287

Query  1039  RKGKV  1053
             RKG++
Sbjct  288   RKGEI  292



>gb|KDP44527.1| hypothetical protein JCGZ_16360 [Jatropha curcas]
Length=323

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 137/298 (46%), Positives = 188/298 (63%), Gaps = 24/298 (8%)
 Frame = +1

Query  199   KELRESIIS-----SSLPREEGWLYP-HMYNYKGFWLDSEFLHGALRCQKHFQAQHSDII  360
             +EL E++I      S+LP+E  W  P +++ Y+ FW    FL G +  QK F  Q +DII
Sbjct  7     EELPETVIECQKIISNLPKEISWKLPLNLHKYQEFWCYPNFLEGVMLAQKCFTPQPTDII  66

Query  361   VCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSY--SREISPDF  534
             +CTLPK GTTWLKAL FA+  R Q+    + +PLL   P +++  +EF Y   R+     
Sbjct  67    LCTLPKSGTTWLKALCFAIFARSQYSDGSKINPLLKKMPHDIVPVLEFLYCMGRQRDSRT  126

Query  535   PMNGNGFRVLSTHLPLELLPKSVWE-SKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLE  711
             P+       LSTH+P   LPKS+ + S CK+I +CR+ KD  +S WHF+       L ++
Sbjct  127   PL-------LSTHVPYASLPKSIIKCSTCKVIYMCRDPKDVFISQWHFV----CRQLDID  175

Query  712   AIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAG  891
             AIP  E FD++C G S +GP+WD++LGYWK SLE+P K+LFLKYE+++ +    ++RIA 
Sbjct  176   AIPLQEAFDKFCIGLSAYGPYWDNILGYWKASLEHPEKILFLKYEDLQHDTLFYVKRIAE  235

Query  892   FLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERP----NNVYFRKGKV  1053
             F+G PF+ EEE  G+V  I  LCSFESLSNLEVNK+ K     P    NN +FRKGKV
Sbjct  236   FMGYPFTAEEERQGIVQNIVNLCSFESLSNLEVNKSDKIGTAFPSKFENNAFFRKGKV  293



>gb|KCW81180.1| hypothetical protein EUGRSUZ_C02547, partial [Eucalyptus grandis]
Length=317

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/289 (45%), Positives = 186/289 (64%), Gaps = 10/289 (3%)
 Frame = +1

Query  208   RESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGT  387
             RE  ISSSLPRE+GWL  H+YNY+GFW D+ FL G +  Q+HF+A+ +D ++ T PK G 
Sbjct  2     REVAISSSLPREKGWLTQHLYNYQGFWYDNHFLGGVIWAQQHFEARPTDTLLATFPKTGL  61

Query  388   TWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNG-NGFRVL  564
             TW+KAL FA+  R    + +  H LLT +P E +  +EF ++ E  P   ++     R+L
Sbjct  62    TWIKALSFAIANRHNQDLPR--HTLLTKNPHECVPFIEF-FAYEKDPISALHALPSPRLL  118

Query  565   STHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRY  744
             STH+P   LP+SV  S C+++C+ R+ KD  VS W F++K++        +   E F  +
Sbjct  119   STHIPYASLPRSVATSGCRIVCIVRDPKDVFVSMWSFISKVKYTDSDRPPVSLEEAFGLF  178

Query  745   CRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeee  924
              RG S+ GP+WDHVLGYWK SLE P KVL LK+E++K E E  ++R+A FLGCPF+ EE 
Sbjct  179   SRGVSLSGPYWDHVLGYWKASLEYPNKVLILKFEDLKRETEPNVKRLANFLGCPFTPEEI  238

Query  925   eggvvggISRLCSFESLSNLEVNKTG------KTYHERPNNVYFRKGKV  1053
             +GG +  I +LCS ESL  +EVNK+G      ++     N+ +FR+G+V
Sbjct  239   DGGGLQEIIKLCSIESLKQMEVNKSGVFRMGTQSSGTVENSGFFRRGEV  287



>ref|XP_010677194.1| PREDICTED: flavonol sulfotransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=330

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/283 (45%), Positives = 177/283 (63%), Gaps = 11/283 (4%)
 Frame = +1

Query  220   ISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLK  399
             I  SLP+E+GW    +Y YKGFW D   L G L  QK F+AQ + +++ TLPK GTTW  
Sbjct  20    ILPSLPKEKGWWLETLYKYKGFWFDEPLLQGTLITQKTFKAQPNTVVLATLPKSGTTWFA  79

Query  400   ALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTHLP  579
             AL+F    R ++  S  +HPLLT+SP + +  +EF  S+  +P  P     F +++ H+P
Sbjct  80    ALLFTTMNRTRY--SYSSHPLLTSSPHDCVPGIEFYASK--NPSNPTMPTTFPLVAAHIP  135

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
               LLP+S+  S C +I VC N  D  VS WHF NKLR +   L+ +   E FD +C+G S
Sbjct  136   YPLLPESIKSSSCPIIYVCCNPNDVFVSLWHFANKLRPK--ELQPLNIEEAFDLFCKGVS  193

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
              FG +WDHVLG+WK S+E P KVLF++YE++K +    L+++A F+GCPF+  EEE GV+
Sbjct  194   PFGSYWDHVLGFWKASIEMPNKVLFVRYEDMKNQTFTLLKKLAEFVGCPFTLAEEESGVI  253

Query  940   ggISRLCSFESLSNLEVNKTGKTYH-----ERPNNVYFRKGKV  1053
                   CSFESL++ EVN+     +       PNNV+FRKGKV
Sbjct  254   EKNIDFCSFESLTSFEVNRVEVERNTLPGANVPNNVFFRKGKV  296



>ref|XP_004291155.1| PREDICTED: cytosolic sulfotransferase 15-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=332

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/296 (44%), Positives = 192/296 (65%), Gaps = 12/296 (4%)
 Frame = +1

Query  181   QENSWPKELRESIISSSLPREEG-WLYPHMYNYKGFW-LDSEFLHGALRCQKHFQAQHSD  354
             +E +   E +E ++S  LP+E G WL P  Y Y+GFW + ++ +   +  Q+ FQA+ SD
Sbjct  5     EEKNLSDECKELLLS--LPKERGGWLGPPQYQYQGFWCVTADIVQATIAFQRQFQARDSD  62

Query  355   IIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPD  531
             I+V ++PKCGTTWLKAL FA+  R +F +  + HPLLT++   L+++ E   Y     PD
Sbjct  63    IVVASVPKCGTTWLKALTFAVVNRHRFEI--EAHPLLTSNSHNLVQHFEVDLYINNRVPD  120

Query  532   FPMN--GNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLG  705
             F     G   R+ +TH+P   L  ++ +S CK++ VCRN  D+ VSYWHF+NK+R + LG
Sbjct  121   FSSKFPGEPRRLFATHIPFPSL-GTITKSNCKIVYVCRNPFDSFVSYWHFINKVRPQSLG  179

Query  706   LEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRI  885
                +   ETFD+YC+G   FGPFWDH+L YWKESL+ P  VLF KYE++K++  + L+ +
Sbjct  180   --PLSLDETFDKYCQGMDGFGPFWDHILRYWKESLKRPNNVLFFKYEDMKKDVVLHLKAL  237

Query  886   AGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             A F+ CPF+EEEE  GV+  +++LCSF+++  LEVNKTG       +   FRK +V
Sbjct  238   AKFIDCPFTEEEERNGVIEDMAKLCSFDTMKKLEVNKTGTFVMNLESKHLFRKAEV  293



>emb|CDY58630.1| BnaC09g52480D [Brassica napus]
Length=673

 Score =   243 bits (621),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 142/304 (47%), Positives = 191/304 (63%), Gaps = 13/304 (4%)
 Frame = +1

Query  145   NTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRC  324
             ++S+S+P   + ++    +E R+ I  SSLP E+GWL   +Y ++G W     L G L C
Sbjct  2     SSSSSVP--DYLRDEKLTQETRDLI--SSLPSEKGWLVSQIYQFQGRWHTEALLQGILTC  57

Query  325   QKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEF  504
             QKHF+A+ SDII+ T PK GTTWLK+LVFAL  R +FPVS   HPLL T+P  L+  ME 
Sbjct  58    QKHFKAKDSDIILVTNPKSGTTWLKSLVFALINRHKFPVSSGDHPLLVTNPHLLVPFMEG  117

Query  505   SYSREISPDFPMNGNGF-RVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMN  681
              Y    SPDF  +   F R+++TH+    LP+SV  S C+++  CRN KD  VS WHF  
Sbjct  118   VYYE--SPDFDFSLLPFPRLMNTHISHLSLPESVKSSSCQIVYCCRNPKDMFVSLWHFGK  175

Query  682   KLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikee  861
             KL  +       P  +  + +C+G  + GPFWDHVL YW  SLENP KVLF+ YEE+K++
Sbjct  176   KLAPQETA--DYPLEKAVEAFCQGKFIAGPFWDHVLEYWYASLENPNKVLFVTYEELKKQ  233

Query  862   peveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFR  1041
              EVE++RIA F+GC F+        V  I +LCSFESLS LEVN+ GK  +    N +FR
Sbjct  234   TEVEVKRIAEFIGCGFT----AEEEVSEIVKLCSFESLSRLEVNRQGKLPNGIETNAFFR  289

Query  1042  KGKV  1053
             KG++
Sbjct  290   KGEI  293



>emb|CDY04166.1| BnaA09g19440D [Brassica napus]
Length=323

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 185/308 (60%), Gaps = 24/308 (8%)
 Frame = +1

Query  148   TSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQ  327
              S+S+P   +  + +  +E R+ +  SSLP E+GWL   MY Y+G W     L G + CQ
Sbjct  2     ASSSVPV--YLGDENLTQETRDLL--SSLPSEKGWLVSQMYQYEGSWHTKAMLQGIVNCQ  57

Query  328   KHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS  507
             KHF+A+ SDII+ T+PK GTTWLKAL+FAL  + +FPVS   HPLL T+P  L+  +E  
Sbjct  58    KHFEAKDSDIILATIPKSGTTWLKALLFALIHQNKFPVSGN-HPLLATNPHPLVPYLEGD  116

Query  508   YSREISPDFPMNGNGF------RVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYW  669
             Y   +SPD      GF      R++ THL    LP S+  S CK++  CRN KD  VS W
Sbjct  117   YC--VSPDV-----GFSKLPSPRLMQTHLTHHSLPVSIKSSSCKIVYCCRNPKDVFVSLW  169

Query  670   HFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYee  849
             HF  KL  E       P  +  + +C+G  + GPFW+HVL YW ES +NP KVLF+ YEE
Sbjct  170   HFGKKLAPEETA--DYPIEKAVEAFCQGKFIGGPFWEHVLEYWYESRKNPNKVLFVTYEE  227

Query  850   ikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNN  1029
             +K++    ++R+A FLGC F+        V  I +LCSFESLS+LEVN+ GK  +    N
Sbjct  228   LKKQTGDMVKRMAEFLGCGFT----AEEEVSEIVKLCSFESLSSLEVNRQGKLPNGIETN  283

Query  1030  VYFRKGKV  1053
              +FRKG+ 
Sbjct  284   AFFRKGET  291



>ref|XP_010087683.1| Flavonol sulfotransferase-like protein [Morus notabilis]
 gb|EXC35772.1| Flavonol sulfotransferase-like protein [Morus notabilis]
Length=329

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/282 (46%), Positives = 172/282 (61%), Gaps = 13/282 (5%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SSLP+E GW   H+Y Y+GFW     +   +  Q HFQA  +DII+ T+PK GTTWLKAL
Sbjct  20    SSLPKERGWRTSHLYQYQGFWCQPAEIQAIVSFQNHFQAYDNDIILATMPKSGTTWLKAL  79

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPM----NGNGFRVLST  570
              FA+  R  FPV    HPLLT++P +L+  +E+  Y+    PD       + +  R+  T
Sbjct  80    AFAVVNRDHFPVDSDKHPLLTSNPHDLVPFLEYKLYANNQIPDLSKLSADDQDRPRLFGT  139

Query  571   HLPLELLPKSVWESK-CKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYC  747
             H+P   L  SV +S  C+++ +CRN  DT +S WHF+         +      E F+  C
Sbjct  140   HIPFPSLANSVKKSNSCRVVYLCRNPFDTFISSWHFIG-------SMSPFTLEEAFEMCC  192

Query  748   RGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeee  927
             RG   FGPFWDH+LGYWKESL  P  VLFL YE++KE+    L+R+A FLG PFS EEE 
Sbjct  193   RGVIGFGPFWDHMLGYWKESLARPENVLFLTYEDLKEDAVFHLKRLAKFLGRPFSFEEET  252

Query  928   ggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              GVV  I++LCSFE+L  LEVNK GK+     N+  FRKG+V
Sbjct  253   SGVVEKIAKLCSFENLKGLEVNKKGKSIKNFENDKLFRKGEV  294



>gb|KHN21542.1| Flavonol sulfotransferase-like [Glycine soja]
Length=304

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/275 (47%), Positives = 179/275 (65%), Gaps = 6/275 (2%)
 Frame = +1

Query  241   EEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALT  420
             E GW+  H++ Y+GFW  +  L G L CQKHF+A  +D+++ + PK GTTWLKA  F+L 
Sbjct  2     ERGWVASHLHQYQGFWHTTRQLQGVLSCQKHFKALDTDVLIVSTPKSGTTWLKAWTFSLL  61

Query  421   TRKQF-PVSQ-QTHPLLTTSPQELIRNMEFS--YSREISPDFPMNGNGFRVLSTHLPLEL  588
              R Q  P +Q Q HPLL  +P  L+  +E          PD        R+ STHLP   
Sbjct  62    HRNQHDPNTQNQNHPLLFNNPHFLVPFLELDLYIDDNTLPDLTSLITSPRLFSTHLPYVS  121

Query  589   LPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFG  768
             LPKSV ES CK+I +CR+ KD  +S WHF N LR +  G+ ++   E FD++CRG S++G
Sbjct  122   LPKSVQESACKIIYLCRDPKDAFISLWHFTNMLRPKSRGMNSLQ--EAFDKFCRGVSLYG  179

Query  769   PFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvggI  948
             PFW HVL YW++SL  P K++F+++EE+K +P + L+ +A F+GCPFS+EEEE GVV  I
Sbjct  180   PFWAHVLDYWQKSLSEPNKIMFMRFEEMKMKPRLVLQELATFVGCPFSKEEEEAGVVDHI  239

Query  949   SRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              +LCSF++LSNL+VNK GK      +  +FR G++
Sbjct  240   LKLCSFDNLSNLQVNKNGKLSSGEEHKAFFRCGQI  274



>gb|KHN37710.1| Flavonol sulfotransferase-like [Glycine soja]
Length=337

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/301 (44%), Positives = 185/301 (61%), Gaps = 21/301 (7%)
 Frame = +1

Query  181   QENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDII  360
             +EN   ++ +E I+S  LPRE+GW+ P++Y ++GFW  S  +      Q  FQA+ +D++
Sbjct  9     EENKLSQDCKELILS--LPREKGWITPYLYLFQGFWYSSTEIQAINTFQNQFQAKDNDVV  66

Query  361   VCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPM  540
             + ++PK GTTWLKAL FA+  R+ FP S + HPLL  +P EL+   EF    EI      
Sbjct  67    IASVPKSGTTWLKALTFAILHRQYFP-SLENHPLLIFNPHELVPPFEFVIYDEI------  119

Query  541   NGNGF--------RVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAE  696
             NG           R+  TH+P   L KS+ E+ CK+I +CRN  DT VS W F+NK+  +
Sbjct  120   NGQTHDLSKMPKPRIFGTHVPFTSLAKSIKETDCKIIYICRNLFDTFVSTWVFVNKIMPK  179

Query  697   LLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveL  876
              L    +P  E F+RYC G   FGP W+H+L YWKES+  P+KVLFLKYE++KE     +
Sbjct  180   FLP--TLPLEEAFERYCEGIIGFGPSWNHILDYWKESIARPKKVLFLKYEDLKENVHFNV  237

Query  877   RRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHER--PNNVYFRKGK  1050
             ++IA FLGCPF++EEE   V+  I +LCSFE +  L+VNK+G     R   N  +FRK +
Sbjct  238   KKIAEFLGCPFTKEEENSEVIENIIKLCSFEKMKELKVNKSGTMGKGRIVENKYFFRKAE  297

Query  1051  V  1053
             +
Sbjct  298   I  298



>ref|XP_003542799.1| PREDICTED: cytosolic sulfotransferase 15-like [Glycine max]
Length=337

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/301 (44%), Positives = 185/301 (61%), Gaps = 21/301 (7%)
 Frame = +1

Query  181   QENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDII  360
             +EN   ++ +E I+S  LPRE+GW+ P++Y ++GFW  S  +      Q  FQA+ +D++
Sbjct  9     EENKLSQDCKELILS--LPREKGWITPYLYLFQGFWYSSTEIQAINTFQNQFQAKDNDVV  66

Query  361   VCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPM  540
             + ++PK GTTWLKAL FA+  R+ FP S + HPLL  +P EL+   EF    EI      
Sbjct  67    IASVPKSGTTWLKALTFAILHRQYFP-SLENHPLLIFNPHELVPPFEFVIYDEI------  119

Query  541   NGNGF--------RVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAE  696
             NG           R+  TH+P   L KS+ E+ CK+I +CRN  DT VS W F+NK+  +
Sbjct  120   NGQTHDLSKMPEPRIFGTHVPFTSLAKSIKETDCKIIYICRNLFDTFVSTWVFVNKIMPK  179

Query  697   LLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveL  876
              L    +P  E F+RYC G   FGP W+H+L YWKES+  P+KVLFLKYE++KE     +
Sbjct  180   FLP--TLPLEEAFERYCEGIIGFGPSWNHILDYWKESIARPKKVLFLKYEDLKENVHFNV  237

Query  877   RRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHER--PNNVYFRKGK  1050
             ++IA FLGCPF++EEE   V+  I +LCSFE +  L+VNK+G     R   N  +FRK +
Sbjct  238   KKIAEFLGCPFTKEEENSEVIENIIKLCSFEKMKELKVNKSGTMGKGRIVENKYFFRKAE  297

Query  1051  V  1053
             +
Sbjct  298   I  298



>ref|XP_004292840.1| PREDICTED: cytosolic sulfotransferase 15-like [Fragaria vesca 
subsp. vesca]
Length=331

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/279 (45%), Positives = 180/279 (65%), Gaps = 9/279 (3%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFW-LDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SLP+E GWL+   Y Y+GFW   ++ +   +  Q+ FQA+ SDI+V ++PKCGTTWLKAL
Sbjct  19    SLPKERGWLHLPQYQYQGFWCARADIVQATIAFQRQFQARDSDIVVASVPKCGTTWLKAL  78

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMN--GNGFRVLSTHL  576
              FA+  R +F +  + HPLLT++  +L+  +E   Y     PDF     G   R+ +TH+
Sbjct  79    TFAVVNRHRFEI--EAHPLLTSNSHKLVPFLEVDLYINNRVPDFSSKFPGEPRRLFATHI  136

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P   L  ++ +S CK++ VCRN  D+ VSYWHF+NK+R + +G   +   E FDRYC+G 
Sbjct  137   PFPSL-GTITKSNCKIVYVCRNPFDSFVSYWHFVNKIRQQSIG--PMSLDEAFDRYCQGL  193

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
               +GPFWDH+LGYWKESL+ P  VLF KYE++K++    L+ +A F+  PF+EEEE   V
Sbjct  194   HPYGPFWDHMLGYWKESLKRPNNVLFFKYEDMKKDVVSHLKALAKFIDYPFTEEEERNSV  253

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +  I++LCSFE++  LEVNKTG         + FRK +V
Sbjct  254   IEDIAKLCSFETMKELEVNKTGTFVMNVEKKILFRKAEV  292



>ref|XP_010051030.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
Length=390

 Score =   236 bits (601),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/291 (45%), Positives = 186/291 (64%), Gaps = 10/291 (3%)
 Frame = +1

Query  202   ELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKC  381
             E RE  ISSSLPRE+GWL  H+YNY+GFW D+ FL G +  Q++F+A+ +D ++ T PK 
Sbjct  73    EKREVAISSSLPREKGWLTQHLYNYQGFWYDNHFLGGVIWAQQNFEARPTDTLLATFPKT  132

Query  382   GTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNG-NGFR  558
             G TW+KAL FA+  R    + +  H LLT +P E +  +EF Y+ E  P   ++     R
Sbjct  133   GLTWIKALSFAIANRHNQDLPR--HTLLTKNPHECVPYIEF-YAYEKDPISALDALPSPR  189

Query  559   VLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFD  738
             +LSTH+P   LP+SV  S C+++C+ R  KD  VS W F++K++        +   E F 
Sbjct  190   LLSTHIPYASLPRSVATSGCRIVCIVREPKDVFVSMWSFISKVKYTNSDRPPVSLEEAFG  249

Query  739   RYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSee  918
              + RG S+ GP+WDHVLGYWK SLE P KVL LK+E++K E E  ++R+A FLGCPF+ E
Sbjct  250   LFSRGVSLSGPYWDHVLGYWKASLEYPNKVLILKFEDLKRETEANVKRLANFLGCPFTPE  309

Query  919   eeeggvvggISRLCSFESLSNLEVNKTG------KTYHERPNNVYFRKGKV  1053
             E +GG +  I +LCS ESL  +EVNK+G      ++     N+ +FR+G+V
Sbjct  310   EIDGGGLQEIIKLCSIESLKQMEVNKSGVFRMGTQSSGTVENSGFFRRGEV  360



>ref|XP_007022041.1| Sulfotransferase 2A, putative [Theobroma cacao]
 gb|EOY13566.1| Sulfotransferase 2A, putative [Theobroma cacao]
Length=335

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/286 (45%), Positives = 182/286 (64%), Gaps = 5/286 (2%)
 Frame = +1

Query  202   ELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKC  381
             +L E +I + LP+E+ W+   +Y Y+GFW         +  Q H +A  +DI + T+PK 
Sbjct  16    KLMEELIQT-LPQEKDWVGSTLYQYQGFWYPFFAPKAVIAFQNHVKAHETDIFLITMPKS  74

Query  382   GTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFP-MNGNGF  555
             GTTWLKAL+F++  R QFP++Q   PLLT +P EL+  ++F+ YS+  +PD    N    
Sbjct  75    GTTWLKALIFSIVNRNQFPLTQS--PLLTANPHELVPFIDFNIYSKNQTPDLENENFPSP  132

Query  556   RVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETF  735
             R+ +TH P   LP S+ +S C+++ +CRN  D  +S WHF+          +     E F
Sbjct  133   RIFATHTPYGTLPSSILKSNCRIVYLCRNPLDQFISDWHFIVDNFPRNEDFKPFSIEEGF  192

Query  736   DRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSe  915
             DR+C+G   FGPFW+HVLG+WK SLE+P KVLFLKYE++K++    L+++A FLG PFSE
Sbjct  193   DRFCKGIHAFGPFWEHVLGFWKMSLEHPEKVLFLKYEDLKKDIASNLKKLADFLGYPFSE  252

Query  916   eeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             EE   GVV  IS+LC FE+L  LEVN TG++Y    N+ +FR GKV
Sbjct  253   EEIRQGVVEEISKLCRFETLKTLEVNITGESYVGLKNSAFFRNGKV  298



>ref|XP_010520091.1| PREDICTED: cytosolic sulfotransferase 15-like [Tarenaya hassleriana]
Length=360

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 129/277 (47%), Positives = 178/277 (64%), Gaps = 3/277 (1%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
              SLPRE GW   ++Y ++ FW  ++ +   +  QKHF++   DII+ T+PK GTTWLKAL
Sbjct  53    DSLPRERGWRTRYLYLFQEFWCQAKEIQSIMSFQKHFKSVDGDIIIATIPKSGTTWLKAL  112

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPL  582
              FAL  R  FPVS   HPLLT++P +LI   E+  Y+         +    R  +TH+P 
Sbjct  113   TFALVNRHSFPVSSSGHPLLTSNPHDLIPFFEYKLYANHRYIPHLSHIPSPRTFATHVPF  172

Query  583   ELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASM  762
               L  S+  S  K++ +CRN  DT VS WH++N +++E      I   E FD YCRG   
Sbjct  173   GSLKDSIKNSNVKVVYLCRNPFDTFVSSWHYVNNIKSE--STSPISLDEGFDLYCRGVIG  230

Query  763   FGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvg  942
             FGPFW+H+LGYWKESLE P ++LFL+YE++KE+ E  L+++A FLG PF+EEEE+ GV  
Sbjct  231   FGPFWEHMLGYWKESLERPDRLLFLQYEDMKEDIESNLKKLADFLGLPFTEEEEKQGVAR  290

Query  943   gISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              I++LCSF++L NLEVNK+ K+     N   FRKG+V
Sbjct  291   EIAKLCSFDNLRNLEVNKSSKSIKNFENRFLFRKGQV  327



>ref|XP_002264929.1| PREDICTED: flavonol sulfotransferase-like [Vitis vinifera]
Length=343

 Score =   234 bits (596),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 134/290 (46%), Positives = 191/290 (66%), Gaps = 15/290 (5%)
 Frame = +1

Query  208   RESIISSSLPREEGWLYPHMYNYKGFWLDS-EFLHGALRCQKHFQAQHSDIIVCTLPKCG  384
             R + I SSL +EEGW+  + Y Y+GFW  S   + G +  Q++F+ +H DI++ TLPK G
Sbjct  25    RNNEIISSLGKEEGWMEEYTYEYQGFWYPSVTVVEGVMWVQQNFKPRHEDILLVTLPKSG  84

Query  385   TTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGF---  555
             TTW K L+FA+  R  F +S  THPLLTTSP +L+  +E   S +I   FP N + F   
Sbjct  85    TTWFKPLMFAVMNRTHFDLS--THPLLTTSPHDLVPFLELFLSHKIP--FP-NPDTFYPP  139

Query  556   RVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETF  735
             ++  TH+P   L + V ES+C+++ +CRN KD  VS ++F+ K+R +   L  +   + F
Sbjct  140   QLFQTHIPFSSLSQYVMESQCRIVYICRNPKDVFVSTFYFLEKVRDK--KLTPLSLEKAF  197

Query  736   DRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSe  915
             + +C+G S++GPFWDHVLGYWK SLE P +VLFLKYE++K +    L+R+A F+G PFS 
Sbjct  198   ELFCKGVSLYGPFWDHVLGYWKASLEVPDRVLFLKYEDMKRDSSFHLKRLAEFMGYPFSV  257

Query  916   eeeeggvvggISRLCSFESLSNLEVNKTGKTY----HERPNNVYFRKGKV  1053
             EEE+ GV   I  LCSFE+L NL+VNKTGK      ++  N+ +FRKG+V
Sbjct  258   EEEKQGVAHDILELCSFENLRNLKVNKTGKIITSNNNQLENHRFFRKGEV  307



>ref|XP_009339576.1| PREDICTED: cytosolic sulfotransferase 5-like [Pyrus x bretschneideri]
Length=323

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 123/285 (43%), Positives = 186/285 (65%), Gaps = 10/285 (4%)
 Frame = +1

Query  220   ISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLK  399
             I S+LP++ GW   H Y Y+ FW    FL G +  Q+ F+A+ SDI + T PKCGTTW+K
Sbjct  12    IISTLPKDTGWAAEHYYQYQNFWYPQVFLEGVIWAQQDFRARDSDIFLATFPKCGTTWVK  71

Query  400   ALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTHLP  579
             AL+ A+  RK    S  +HPLLT +P +++  +E    ++   ++  +    R+L++H+P
Sbjct  72    ALMIAIKNRKDCDYS--SHPLLTKNPHDIVPYIELLVHQDNPVEYLDSMASPRLLASHIP  129

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
                LP S+ +S  +++ + RN KD +VS+W F  KLR+++  L  +   E F+ +C+G +
Sbjct  130   HSSLPNSLLDSDTRVVYIARNPKDVLVSFWAFSEKLRSKVYRLPPLSLEEGFELFCKGVA  189

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
             + GPFWDHVLGYW+ SL+NP KVLF K+E++K + E  ++R+A F+G PFS EEE+ G V
Sbjct  190   LAGPFWDHVLGYWEASLKNPNKVLFFKFEDLKADTEGCVKRLAEFIGYPFSSEEEKEGAV  249

Query  940   ggISRLCSFESLSNLEVNKTGKTYHERP-------NNVYFRKGKV  1053
               I + CSFE+LS+LEVNK+G TYH  P       N+V+FR+G+ 
Sbjct  250   QEIIKFCSFENLSSLEVNKSG-TYHVGPKTDEKFSNDVFFRRGET  293



>ref|XP_009130975.1| PREDICTED: cytosolic sulfotransferase 15-like [Brassica rapa]
Length=360

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 128/276 (46%), Positives = 176/276 (64%), Gaps = 4/276 (1%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+E GW   H+Y ++GFW  ++ +H  +  QKHF+    D+I+ T+PK GTTWLKAL 
Sbjct  55    SLPKERGWRTRHLYQFQGFWCQAKEIHAIMSFQKHFKTLPKDVILATIPKSGTTWLKALT  114

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPLE  585
             F L  R +F      HPLLT++P +L+  +E+  Y+    PD     +  R  +TH+P  
Sbjct  115   FTLLNRHRFDPVVSDHPLLTSNPHDLVPFLEYKLYANGEVPDLSGLASP-RTFATHVPFG  173

Query  586   LLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMF  765
              L  S+ E   K++ +CRN  DT +S WHF N +++E   +  +   E FD YCRG   F
Sbjct  174   SLKGSIEEPGAKVVYLCRNPFDTFISSWHFSNSIKSE--SVSPVSLEEGFDLYCRGVIGF  231

Query  766   GPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvgg  945
             GPFW+H+LGYW+ESLE P KVLFLKYE++KE+ E  L+++A FLG  F+EEEE  GVV  
Sbjct  232   GPFWEHMLGYWRESLERPEKVLFLKYEDLKEDIETNLKKLASFLGVSFTEEEEVKGVVKA  291

Query  946   ISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             ++ LCSFESL  LEVNK+ K+     N   FRKG+V
Sbjct  292   VADLCSFESLKKLEVNKSNKSIKNFENRYLFRKGEV  327



>ref|XP_010514147.1| PREDICTED: cytosolic sulfotransferase 13-like [Camelina sativa]
Length=324

 Score =   233 bits (594),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 137/305 (45%), Positives = 188/305 (62%), Gaps = 17/305 (6%)
 Frame = +1

Query  148   TSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQ  327
             T +     K   E  + +E  E  + SSLP++  +   ++Y Y+GFW     L G L  Q
Sbjct  2     TKSKTTLSKLLAEAKFSQECEE--LMSSLPKDRSFFAEYLYQYQGFWYPPNILEGVLYSQ  59

Query  328   KHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNME-F  504
             KHFQA+ SDII+ + PK GTTWLKALVFAL  R +F    ++HPLL  +P  L+  +E F
Sbjct  60    KHFQAKDSDIILVSSPKSGTTWLKALVFALIHRHEFLTPLESHPLLDNNPHSLVPFIEGF  119

Query  505   SY-SREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMN  681
              + +++ SP         ++ STH+PL  LP S+ +S CK++  CRN KD  VS WHF+ 
Sbjct  120   QFHTQDTSP---------KIFSTHIPLRSLPASIKDSSCKVVYCCRNPKDAFVSIWHFLK  170

Query  682   KLR-AELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeike  858
              L   E++G       E    +CRG+S++GPFWDH L YWKES ENP KVLF+ YEE++E
Sbjct  171   SLMLKEMVG---CTIEEMVSGFCRGSSVYGPFWDHALEYWKESQENPDKVLFVMYEEMRE  227

Query  859   epeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYF  1038
             +P   + RIA FLGC F+EEE E GV+  I +LCS E+LS LEVN+ GK  +      +F
Sbjct  228   QPRDWVMRIAEFLGCSFTEEEIENGVLDSIIKLCSLENLSKLEVNEKGKLVNGMETKAFF  287

Query  1039  RKGKV  1053
             RKG++
Sbjct  288   RKGEI  292



>ref|XP_004306829.1| PREDICTED: cytosolic sulfotransferase 15-like [Fragaria vesca 
subsp. vesca]
Length=341

 Score =   233 bits (595),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 133/288 (46%), Positives = 183/288 (64%), Gaps = 11/288 (4%)
 Frame = +1

Query  202   ELRESIISSSLPREEGWLYPHMYNYK--GFWL-DSEFLHGALRCQKHFQAQHSDIIVCTL  372
             E +E I+S  LP+E GW+  H+Y Y+  GFW   ++     +  QKHFQA+ SDI+V +L
Sbjct  17    ECKELILS--LPKERGWVPRHIYQYQYQGFWCPTADTFQAIVNFQKHFQARDSDIVVASL  74

Query  373   PKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGN  549
             PK GTTWLKAL FA+  R +F V  + HPLLTT+ Q+L+  ++   Y+    PDF  N +
Sbjct  75    PKSGTTWLKALTFAVVNRHRFEV--KNHPLLTTNSQKLVPFLDVDLYANNKVPDFSSNIH  132

Query  550   GFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPE  729
               R+ +TH+P   L  ++ ES CK++ VCRN  DT VSYW F N+ R E LG   +   E
Sbjct  133   EPRLFATHIPFPSL-GTIKESNCKIVYVCRNPFDTFVSYWQFFNRARPESLG--PLSLDE  189

Query  730   TFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPF  909
              FDRYC+G  ++GPFW+  LGYWKESL+ P  VLF KYEE+K +    L+ +A F+  PF
Sbjct  190   AFDRYCQGTDVYGPFWNTSLGYWKESLKRPNNVLFFKYEEMKNDVAYHLKTLAKFIDYPF  249

Query  910   SeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +E+EE  G+   I++LCSFE++  LE+NKTG       N   FRK +V
Sbjct  250   TEDEERNGLTEDIAKLCSFETMKKLEINKTGAFVMNIGNKCLFRKAEV  297



>ref|XP_010051056.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
Length=470

 Score =   237 bits (604),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 139/328 (42%), Positives = 199/328 (61%), Gaps = 11/328 (3%)
 Frame = +1

Query  91    YLQINTIHFNSMAAPSDPNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMY  270
             +L  N  H    A  SD ++   L   +   E     E RE  ISSSLPRE+GWL  H+Y
Sbjct  117   WLPSNLCHLVPHAVASDLSSQEELLKEQIALECQ-GAEKREVAISSSLPREKGWLTQHLY  175

Query  271   NYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQ  450
             NY+GFW D+ FL G +  Q+HF+A+ +D ++ T PK G TW+KAL FA+  R    + + 
Sbjct  176   NYQGFWYDNHFLGGVIWAQQHFEARPTDTLLATFPKTGLTWIKALSFAIANRHNQDLPR-  234

Query  451   THPLLTTSPQELIRNMEFSYSREISPDFPMNG-NGFRVLSTHLPLELLPKSVWESKCKLI  627
              H LLT +P E +  +EF ++ E  P   ++     R+LSTH+P   LP+SV  S C+++
Sbjct  235   -HTLLTKNPHECVPFIEF-FAYEKDPISALHALPSPRLLSTHIPYASLPRSVATSGCRIV  292

Query  628   CVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKES  807
             C+ R+ KD  VS W F++K++        +   E F  + RG S+ GP+WDHVLGYWK S
Sbjct  293   CIVRDPKDVFVSMWSFISKVKYTDSDRPPVSLEEAFGLFSRGVSLSGPYWDHVLGYWKAS  352

Query  808   LENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLE  987
             LE P KVL LK+E++K E E  ++R+A FLGCPF+ EE +GG +  I +LCS ESL  +E
Sbjct  353   LEYPNKVLILKFEDLKRETEPNVKRLANFLGCPFTPEEIDGGGLQEIIKLCSIESLKQME  412

Query  988   VNKTG------KTYHERPNNVYFRKGKV  1053
             VNK+G      ++     N+ +FR+G+V
Sbjct  413   VNKSGVFRMGTQSSGTVENSGFFRRGEV  440



>ref|XP_002514611.1| Flavonol 3-sulfotransferase, putative [Ricinus communis]
 gb|EEF47717.1| Flavonol 3-sulfotransferase, putative [Ricinus communis]
Length=330

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 131/285 (46%), Positives = 187/285 (66%), Gaps = 16/285 (6%)
 Frame = +1

Query  220   ISSSLPREEGW-LYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWL  396
             I SS P+E+GW    +MY Y+GFW    F  G +  Q+HF+AQ +DIIV + PK GTTWL
Sbjct  17    IISSFPKEKGWDTRNYMYKYQGFWYYESFAEGVMSAQEHFKAQPNDIIVASCPKTGTTWL  76

Query  397   KALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTHL  576
             KAL FA+ TR  F     T+PLL   P E +  +E     +++ D     +   +++TH+
Sbjct  77    KALTFAIVTRGVF--DDSTNPLLKKVPHECVPFLEL----DLAKDSRDRDSAIPLVATHV  130

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLG--LEAIPFPETFDRYCR  750
             P   LPK++ +S CK++ VCR+ KD  VS W+F+ K   +L+   +E IP  + F+ +C+
Sbjct  131   PYISLPKTILDSGCKIVYVCRDPKDVFVSLWYFVAK---QLISKNIEPIPKEDAFELFCK  187

Query  751   GASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeg  930
             G + +GP+WDHVLGYWK S+E P KVLFLKYEE+K++P   ++++A F+G PFS EEEE 
Sbjct  188   GTAHYGPYWDHVLGYWKASVEYPDKVLFLKYEEMKKDPSFYVKKLAQFMGYPFSLEEEEK  247

Query  931   gvvggISRLCSFESLSNLEVNKTG----KTYHERPNNVYFRKGKV  1053
             GV+  ++ +CSFE+LSNLEVNK+G     T    PN+VYFR G+ 
Sbjct  248   GVMQKVTNMCSFENLSNLEVNKSGGHRENTTLAIPNHVYFRNGQA  292



>ref|NP_190093.1| sulfotransferase 5 [Arabidopsis thaliana]
 sp|Q9M1V2.1|SOT5_ARATH RecName: Full=Cytosolic sulfotransferase 5; Short=AtSOT5; AltName: 
Full=Flavonoid 7-sulfotransferase 3a; Short=AtST3a [Arabidopsis 
thaliana]
 emb|CAB72145.1| sulfotransferase-like protein [Arabidopsis thaliana]
 gb|AAS49096.1| At3g45070 [Arabidopsis thaliana]
 gb|AEE77988.1| sulfotransferase 5 [Arabidopsis thaliana]
Length=323

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/277 (47%), Positives = 176/277 (64%), Gaps = 3/277 (1%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SSLP ++ +    +  Y+G W     L   L  QK F+ Q +DIIV + PKCGTTWLKAL
Sbjct  19    SSLPSDKDFTGKTICKYQGCWYTHNVLQAVLNFQKSFKPQDTDIIVASFPKCGTTWLKAL  78

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPL  582
              FAL  R + P     HPLL+ +P  L+   E   Y R  +PD     +  R+ STH+P 
Sbjct  79    TFALLHRSKQPSHDDDHPLLSNNPHVLVPYFEIDLYLRSENPDLTKFSSSPRLFSTHVPS  138

Query  583   ELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASM  762
               L + +  S CK++ + RN KDT+VSYWHF  K + +   + +  F +TF+ +CRG S+
Sbjct  139   HTLQEGLKGSTCKIVYISRNVKDTLVSYWHFFTKKQTDEKIISS--FEDTFEMFCRGVSI  196

Query  763   FGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvg  942
             FGPFWDHVL YW+ SLE+P  VLF+K+EE+K EP  ++++ A FLGCPF++EEEE G V 
Sbjct  197   FGPFWDHVLSYWRGSLEDPNHVLFMKFEEMKAEPRDQIKKFAEFLGCPFTKEEEESGSVD  256

Query  943   gISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              I  LCS  +LS+LE+NKTGK    R N ++FRKG+V
Sbjct  257   EIIDLCSLRNLSSLEINKTGKLNSGRENKMFFRKGEV  293



>emb|CDY54154.1| BnaA09g53490D [Brassica napus]
Length=323

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 134/294 (46%), Positives = 181/294 (62%), Gaps = 12/294 (4%)
 Frame = +1

Query  175   FFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSD  354
             + ++ +  +E R+ +  SSLP E+GWL   MY ++G W     L G + CQKHF+A  SD
Sbjct  9     YLKDENLTQETRDLL--SSLPSEKGWLVSQMYQFEGSWQAPALLQGIVNCQKHFEANDSD  66

Query  355   IIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDF  534
             +I+ T PK GTTWLKAL+FAL  R +FPVS + HPLL T+P  L+  +E  Y   +SP+ 
Sbjct  67    VILATFPKSGTTWLKALLFALIHRHKFPVSGK-HPLLVTNPHSLVPFLEGDYC--VSPEV  123

Query  535   PMNG-NGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLE  711
               +     R++ TH+    LP S+  S CK++  CRN KD  VS WHF  KL  E     
Sbjct  124   KFSELPSPRIMQTHVTHHSLPVSIKSSCCKIVYCCRNPKDKFVSLWHFGRKLAPEETA--  181

Query  712   AIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAG  891
               P     + +C G  + GPFWDHVL YW ES +NP KVLF+ YEE+K++ EVE++RIA 
Sbjct  182   EYPIETAVEAFCEGKFIGGPFWDHVLEYWYESRKNPNKVLFVTYEELKKQTEVEVKRIAN  241

Query  892   FLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             F+GC F+        V  I +LCSFESLS LEVN+ GK  +   +N YFRKG++
Sbjct  242   FIGCGFT----AEEEVSEIVKLCSFESLSKLEVNRQGKLPNGIESNSYFRKGEI  291



>ref|XP_009114139.1| PREDICTED: cytosolic sulfotransferase 12-like [Brassica rapa]
Length=323

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 134/294 (46%), Positives = 181/294 (62%), Gaps = 12/294 (4%)
 Frame = +1

Query  175   FFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSD  354
             + ++ +  +E R+ +  SSLP E+GWL   MY ++G W     L G + CQKHF+A  SD
Sbjct  9     YLKDENLTQETRDLL--SSLPTEKGWLVSQMYQFEGSWQAPALLQGIVNCQKHFEANDSD  66

Query  355   IIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDF  534
             +I+ T PK GTTWLKAL+FAL  R +FPVS + HPLL T+P  L+  +E  Y   +SP+ 
Sbjct  67    VILATFPKSGTTWLKALLFALIPRHKFPVSGK-HPLLVTNPHSLVPFLEGDYC--VSPEV  123

Query  535   PMNG-NGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLE  711
               +     R++ TH+    LP S+  S CK++  CRN KD  VS WHF  KL  E     
Sbjct  124   KFSELPSPRIMQTHVTHHSLPVSIKSSCCKIVYCCRNPKDKFVSLWHFGRKLAPEETA--  181

Query  712   AIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAG  891
               P     + +C G  + GPFWDHVL YW ES +NP KVLF+ YEE+K++ EVE++RIA 
Sbjct  182   EYPIETAVEAFCEGKFIGGPFWDHVLEYWYESRKNPNKVLFVTYEELKKQTEVEVKRIAD  241

Query  892   FLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             F+GC F+        V  I +LCSFESLS LEVN+ GK  +   +N YFRKG++
Sbjct  242   FIGCGFT----AEEEVSEIVKLCSFESLSKLEVNRQGKLPNGIESNSYFRKGEI  291



>ref|XP_006292772.1| hypothetical protein CARUB_v10019022mg [Capsella rubella]
 gb|EOA25670.1| hypothetical protein CARUB_v10019022mg [Capsella rubella]
Length=326

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/279 (45%), Positives = 183/279 (66%), Gaps = 7/279 (3%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SSLP ++      +  Y+G W   + L G LR QK+F+ Q +D+IV + PKCGTTWLKAL
Sbjct  22    SSLPSDKDSCGKSICKYQGCWYTHQALQGVLRFQKNFKPQDTDVIVASFPKCGTTWLKAL  81

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPL  582
              FAL  R + P     HPLL+ +P  L+  +E + Y     PD     +  R+ STH+PL
Sbjct  82    TFALVRRSEHPSQDHHHPLLSDNPHVLVPYLEMNLYYYSEKPDLTKFLSSPRLFSTHMPL  141

Query  583   ELLPKSVWESKCKLICVCRNQKDTVVSYWHF--MNKLRAELLGLEAIPFPETFDRYCRGA  756
               L + + +S CK++ +CRN KDT+VSYWHF  M +   E++        +TF+ +C+G 
Sbjct  142   HPLQEGLKDSPCKIVYMCRNVKDTLVSYWHFFCMKQSNDEVVS----SLEDTFEYFCKGV  197

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
             ++FG FWDHVL YW+ SLE+P  VLF+++E++K+EP  +++++A FLGCPF++EEEE G 
Sbjct  198   NLFGSFWDHVLSYWRGSLEDPNHVLFMRFEDMKKEPREQIKKLAEFLGCPFTKEEEESGT  257

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +  +  LCS  +LS+LE+NKTGK Y+ R N  +FRKG+V
Sbjct  258   MDEVIDLCSLRNLSSLEINKTGKLYNGRDNKTFFRKGEV  296



>gb|AFK43741.1| unknown [Lotus japonicus]
Length=345

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 129/279 (46%), Positives = 178/279 (64%), Gaps = 6/279 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLPRE GW+ P    ++GFW  S  +   +  QK FQA+ SDI+V TLPK GTTWLKAL 
Sbjct  36    SLPRENGWITPDFTFFQGFWCVSTLIQPIITFQKQFQAKDSDILVATLPKSGTTWLKALT  95

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSY---SREISPDFPMNG-NGFRVLSTHL  576
             FA+T R++F   +  HPLL ++  EL+  +E ++   + +  P F M+     R+  TH+
Sbjct  96    FAITNRQRFSPLEDHHPLLKSNSHELVPFLEINFYGQTLDGIPQFDMSKMTEPRIFGTHI  155

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P   L KS+ +SKCK+I +CRN  DT VS W F+NK++ E   L      E F+RYC+G 
Sbjct  156   PFNSLAKSIKDSKCKIIYICRNPFDTFVSQWIFLNKIKPE--ELPEFTLEEAFERYCKGV  213

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
             + +GP WDH+LGY KES+  P KVLFLKYE++KE+    ++RI  FLG PF++EEE G V
Sbjct  214   TEYGPTWDHMLGYLKESVARPNKVLFLKYEDLKEDVNFHVKRIFEFLGVPFTQEEESGEV  273

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             V  I +LCSFE + +LEVNK+G          +FRK ++
Sbjct  274   VENIIKLCSFEKMKDLEVNKSGTLGLNFEKKYFFRKAEI  312



>ref|XP_002264574.2| PREDICTED: cytosolic sulfotransferase 15-like [Vitis vinifera]
 emb|CBI35080.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 138/304 (45%), Positives = 194/304 (64%), Gaps = 11/304 (4%)
 Frame = +1

Query  151   SNSLPYHKFFQENSWPKELRE-SIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQ  327
             S+++P   FF+E  + K   E   + ++LPRE+ W   + Y Y+GFW  +  LHG +  Q
Sbjct  6     SSAIP---FFEEVDFEKLSDECQQLLATLPREKTWDGSYYYLYQGFWFRAIPLHGIILFQ  62

Query  328   KHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS  507
             KHFQA+  D+++ T  K GTTWLKAL FA+  RK  P++Q   PLLTTSP +L+R +E+ 
Sbjct  63    KHFQAEDEDVLIITSAKSGTTWLKALTFAIANRKDSPLTQS--PLLTTSPHQLVRFLEYD  120

Query  508   --YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMN  681
               Y +    D   +    R L+THLP ELLP S+ +SKC+++ +CRN  D  +S WHF+N
Sbjct  121   LYYMKSEYSDL-QDLPRPRFLATHLPYELLPPSIKDSKCRIVYMCRNPVDKFISLWHFVN  179

Query  682   KLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikee  861
               R E L  +++      +  C+G    GP+WDHVLGYW+ S E P KVLFLKYE++K++
Sbjct  180   HNRPEPLQPDSLE--AGLEMVCKGIEGCGPYWDHVLGYWRMSRERPEKVLFLKYEDLKKD  237

Query  862   peveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFR  1041
                +L+R+A FLG PFSEEEE  G++  ISRLCS +SL NLEVN  G       N+ ++R
Sbjct  238   IICQLKRLAHFLGVPFSEEEERQGMIEEISRLCSLDSLKNLEVNMNGMHTSGLKNSSFYR  297

Query  1042  KGKV  1053
             KG+V
Sbjct  298   KGEV  301



>ref|NP_178472.1| cytosolic sulfotransferase 13 [Arabidopsis thaliana]
 sp|Q9ZPQ5.1|SOT13_ARATH RecName: Full=Cytosolic sulfotransferase 13; Short=AtSOT13 [Arabidopsis 
thaliana]
 gb|AAD20079.1| putative steroid sulfotransferase [Arabidopsis thaliana]
 gb|AEC05747.1| cytosolic sulfotransferase 13 [Arabidopsis thaliana]
Length=324

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 136/305 (45%), Positives = 191/305 (63%), Gaps = 17/305 (6%)
 Frame = +1

Query  148   TSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQ  327
             T +     K   E+   +E  E +  SSLPR+      ++Y Y+GFW     L G L  Q
Sbjct  2     TKSETTLSKLLVESELVQECEELL--SSLPRDRSVFAEYLYQYQGFWYPPNLLEGVLYSQ  59

Query  328   KHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNME--  501
             KHFQA+ SDI++ ++PK GTTWLK+LVFAL  R++F     +HPLL  +P  L+  +E  
Sbjct  60    KHFQARDSDIVLASIPKSGTTWLKSLVFALIHRQEFQTPLVSHPLLDNNPHTLVTFIEGF  119

Query  502   FSYSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFM-  678
               ++++ SP         R+ STH+P+  LP+SV +S CK++  CRN KD  VS WHFM 
Sbjct  120   HLHTQDTSP---------RIFSTHIPVGSLPESVKDSSCKVVYCCRNPKDAFVSLWHFMK  170

Query  679   NKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeike  858
             N +  E++G       E    +CRG+S++GPFWDHVL YWKES ENP+KV+F+ YEE++E
Sbjct  171   NLIVKEMVG---CTMEEMVRFFCRGSSIYGPFWDHVLQYWKESRENPKKVMFVMYEEMRE  227

Query  859   epeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYF  1038
             +P+  + RIA FLG  F+EEE E GV+  I +LCS E+LS LEVN+ GK  +      +F
Sbjct  228   QPQEWVMRIAEFLGYSFTEEEIENGVLEDIIKLCSLENLSKLEVNEKGKLLNGMETKAFF  287

Query  1039  RKGKV  1053
             RKG++
Sbjct  288   RKGEI  292



>ref|XP_009114140.1| PREDICTED: cytosolic sulfotransferase 12-like [Brassica rapa]
Length=328

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 138/307 (45%), Positives = 185/307 (60%), Gaps = 16/307 (5%)
 Frame = +1

Query  145   NTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRC  324
             ++S+S+P   + ++ +  ++ ++ I  SSLP E+GWL   MY ++G W     L G L C
Sbjct  2     SSSSSVP--DYLRDENLTQKTKDLI--SSLPSEKGWLVCQMYQFQGRWHTQALLKGILTC  57

Query  325   QKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPV---SQQTHPLLTTSPQELIRN  495
             QK F+A+ SDII+ T PK GTTWLKALVFAL  R +FPV   S   HPLL T+P  L+  
Sbjct  58    QKQFEAKDSDIILVTNPKSGTTWLKALVFALINRHKFPVYSSSSGEHPLLVTNPHSLVPF  117

Query  496   MEFSYSREISPDFPMNG-NGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWH  672
             +E  Y    SPDF  +  +  R+++TH+    LP+SV  S CK++  CR  KD  VS WH
Sbjct  118   LEGVYYE--SPDFDFSQLSSPRLMNTHISHLSLPESVKSSPCKIVYCCRKPKDMFVSLWH  175

Query  673   FMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeei  852
             F  KL  E       P  +  + +C+G  + GPFWDHVL YW  SLENP KVLF+ YEE+
Sbjct  176   FGKKLAPEETA--DYPIEKAVEAFCQGKFIGGPFWDHVLEYWYASLENPNKVLFVSYEEL  233

Query  853   keepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNV  1032
             K++    ++RIA FLGC F         V  I +LCSFESLS+LEVN+ GK         
Sbjct  234   KKKTGDTIKRIAEFLGCGF----VGEEEVRAIVKLCSFESLSSLEVNREGKLPSGMETRA  289

Query  1033  YFRKGKV  1053
             +FRKG+V
Sbjct  290   FFRKGEV  296



>ref|XP_006292654.1| hypothetical protein CARUB_v10018897mg [Capsella rubella]
 gb|EOA25552.1| hypothetical protein CARUB_v10018897mg [Capsella rubella]
Length=326

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 140/305 (46%), Positives = 187/305 (61%), Gaps = 14/305 (5%)
 Frame = +1

Query  145   NTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRC  324
             ++S+S+P   + ++    +E R+ I  SSLP+E+GWL   MY ++G W     L G L C
Sbjct  2     SSSSSVP--DYLRDELLTQETRDMI--SSLPKEKGWLVSEMYQFQGRWHTQALLQGILIC  57

Query  325   QKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPV-SQQTHPLLTTSPQELIRNME  501
             QK F+A+ SDII+ T PK GTTWLKALVFAL  R +FPV S   HPLL T+P  L+  +E
Sbjct  58    QKRFEAKDSDIILVTNPKSGTTWLKALVFALLHRHKFPVPSLGNHPLLVTNPHLLVPFLE  117

Query  502   FSYSREISPDFPMNGNGF-RVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFM  678
               Y    SPDF  +G    R+++TH+P   LP+S+  S CK++  CRN KD  VS WHF 
Sbjct  118   GVYYE--SPDFDFSGLPTPRLMNTHIPYLSLPESIKSSSCKIVYCCRNPKDMFVSLWHFG  175

Query  679   NKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeike  858
              KL  E       P  +  + +C G  + GPFW+H+L YW  S ENP KVLF+ YEE+K+
Sbjct  176   KKLAPEETA--DYPIEKAVEAFCEGKFIGGPFWEHILEYWYASRENPNKVLFVTYEELKK  233

Query  859   epeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYF  1038
             +   E+++IA FLGC F     E   V  I +LCSFESLSNLEVN+ GK  +      +F
Sbjct  234   QTGAEMKQIAEFLGCGFI----EEEEVREIVKLCSFESLSNLEVNRAGKLPNGIETKSFF  289

Query  1039  RKGKV  1053
             RKG+ 
Sbjct  290   RKGET  294



>ref|XP_011070292.1| PREDICTED: cytosolic sulfotransferase 15-like [Sesamum indicum]
Length=328

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 129/295 (44%), Positives = 188/295 (64%), Gaps = 15/295 (5%)
 Frame = +1

Query  184   ENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIV  363
             +NS   E +E +   +L R+  W    +  Y+GFWL        L  QK+F+A+ +D+I+
Sbjct  12    DNSAKDEFQELL--QTLERQTNWDGQRLVKYEGFWLLELLFRPILSAQKYFKAKGTDVIL  69

Query  364   CTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSY---SREISPDF  534
              T+PK GTTWLKAL F++  R   P+ Q   PLLT++P +++  +EF        + P+ 
Sbjct  70    LTMPKSGTTWLKALTFSIANRNAIPIDQS--PLLTSNPHKVVPALEFDLYWGQENLDPEQ  127

Query  535   PMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFM--NKLRAELLGL  708
              ++    R+LSTH+PLE+LP S+ E+ C++I VCRN  D  +S+ HF+  NK   + + L
Sbjct  128   ILDP---RILSTHIPLEILPDSIREAGCRIIYVCRNPLDVFISHRHFLLENKFAKDAVPL  184

Query  709   EAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIA  888
             E     E FD +C+G   +GPFWDH+LGYW   L+NP +VLF+KYE++KE+    +++IA
Sbjct  185   E---LDEAFDMFCQGIHPYGPFWDHMLGYWNAHLKNPERVLFIKYEDLKEDIFSNIKKIA  241

Query  889   GFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              F+G PFS EEE+ GVV  ISRLCSFE+L NLEVNK+G       N+ +FRKG+V
Sbjct  242   EFIGSPFSPEEEKQGVVEQISRLCSFENLKNLEVNKSGNVLGLMKNSSFFRKGEV  296



>gb|AFK33848.1| unknown [Lotus japonicus]
Length=339

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 133/295 (45%), Positives = 182/295 (62%), Gaps = 9/295 (3%)
 Frame = +1

Query  181   QENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDII  360
             +E S  +E +E I   +LPRE+GW   ++Y ++GFW +   +      QK FQA+ SD+I
Sbjct  16    EEESLSRECKELI--PTLPREKGWTVRYLYLFQGFWCNPHRIQPIYTFQKQFQAKDSDVI  73

Query  361   VCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFP  537
             V T PK GTTWLKAL FA+  R  FP S + HPLLT++P  L+   E S Y   I    P
Sbjct  74    VATYPKSGTTWLKALTFAVVNRHNFP-SSENHPLLTSNPHHLVPFFETSIYGEMIHDQIP  132

Query  538   MNGNGF--RVLSTHLPLELLPKSVWE-SKCKLICVCRNQKDTVVSYWHFMNKLRAELLGL  708
                N    R+  TH+P   L KS+ + SKCK+I +CRN  D  VS W F+NK++ E    
Sbjct  133   DLSNVIERRIFGTHVPFPSLAKSIKDNSKCKIIYLCRNPFDNFVSLWMFVNKVKLE--SA  190

Query  709   EAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIA  888
               +   E F+ +C G + +GPFW+H+LGYWKES+  P KVLFLKYE++K++    ++R+ 
Sbjct  191   PTLMLEEAFEMHCNGTTRYGPFWNHILGYWKESIARPEKVLFLKYEDLKDDVNFYVKRVG  250

Query  889   GFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              FLGCPF+ EEE  GV+  I +LCSFE +  LEVNK G    +  N  +FRKG+V
Sbjct  251   EFLGCPFTHEEESSGVIEDIVQLCSFEKMKELEVNKCGTFTRDVGNKHFFRKGEV  305



>ref|XP_007029974.1| Sulfotransferase 2A, putative [Theobroma cacao]
 gb|EOY10476.1| Sulfotransferase 2A, putative [Theobroma cacao]
Length=339

 Score =   231 bits (588),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 127/292 (43%), Positives = 180/292 (62%), Gaps = 8/292 (3%)
 Frame = +1

Query  184   ENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIV  363
             E SW  E  + ++ + L +E  W   H+Y Y+GFW  S  L   +  QKHFQA  +DI +
Sbjct  18    EESWDDEEVQELVQT-LSKERNWYGNHLYFYQGFWCTSRVLRAMISFQKHFQALDNDIFL  76

Query  364   CTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPM  540
              +LPKCGTTW+KAL+F +  R  F +  + +PLL+  P + +  +E   Y +  SPD   
Sbjct  77    TSLPKCGTTWMKALIFTIVNRNHFEL--KNNPLLSLGPHQAVPYLELDLYLKNHSPDLE-  133

Query  541   NGNGFRVLSTHLPLELLPKSVWE-SKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAI  717
             N    R+ STH P   LP S+ E S  K++ +CRN  D  +SYWHF + LR+E   ++ +
Sbjct  134   NIPQPRIFSTHTPYASLPPSIKECSTPKIVYICRNPMDMFISYWHFTDILRSE--NVDPL  191

Query  718   PFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFL  897
             P  E F+ +C+G   FGPF DHVLGYWK   ENP  ++FLKYE++K++    ++++A FL
Sbjct  192   PLDEAFEMFCQGIHGFGPFPDHVLGYWKAKQENPNNIMFLKYEDLKKDIVFHVKKLANFL  251

Query  898   GCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             G PFS+EEE  G    I+ LCSFE+L  +EVNK+GK     PN  +FRKG+V
Sbjct  252   GFPFSKEEERQGEAEEIAMLCSFENLKGMEVNKSGKQPFGAPNTAFFRKGEV  303



>emb|CDY58879.1| BnaA03g55570D [Brassica napus]
Length=359

 Score =   231 bits (589),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 179/278 (64%), Gaps = 7/278 (3%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
              SLP+E GW   H+Y ++GFW  ++ +H  +  QKHF+    D+I+ T+PK GTTWLKAL
Sbjct  54    DSLPKERGWRTRHLYLFQGFWCQAKEIHAIMSFQKHFKTLPKDVILATIPKSGTTWLKAL  113

Query  406   VFALTTRKQF-PVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLP  579
              F L  R +F PVS   HPLLT++P +L+  +E+  Y+    PD     +  R  +TH+P
Sbjct  114   TFTLLNRHRFDPVSD--HPLLTSNPHDLVPFLEYKLYANGEVPDLSGLASP-RTFATHVP  170

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
                L  S+ E   K++ +CRN  DT +S WHF N +++E   +  +   E FD YCRG  
Sbjct  171   FGSLKGSIEEPGAKVVYLCRNPFDTFISSWHFSNSIKSE--SVSPVSLEEGFDLYCRGVI  228

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
              FGPFW+H+LGYW+ESLE P KVLFLKYE++KE+ E  L+++A FLG  F+EEEE  GVV
Sbjct  229   GFGPFWEHMLGYWRESLERPEKVLFLKYEDLKEDIETNLKKLASFLGVSFTEEEEVKGVV  288

Query  940   ggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
               ++ LCSFESL  LEVNK+ K+     N   FRKG+V
Sbjct  289   KAVADLCSFESLKKLEVNKSNKSIKNFENRYLFRKGEV  326



>ref|XP_009125671.1| PREDICTED: cytosolic sulfotransferase 15-like [Brassica rapa]
Length=368

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 178/278 (64%), Gaps = 6/278 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+E GW   H+Y ++GFW  S+ +   +  QKHF+   +D+++ T+PK GTTWLKAL 
Sbjct  61    SLPKERGWRTRHLYLFQGFWCQSKEIQAIMSIQKHFKPLQNDVVIATIPKSGTTWLKALT  120

Query  409   FALTTRKQF-PVSQQT-HPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLP  579
             + L  R +F PVS  T HPLLT++P +L+   E+  Y+    PD     +  R  +TH+P
Sbjct  121   YTLLNRHRFDPVSSNTDHPLLTSNPHDLVPFFEYKLYANGDVPDLSGLASP-RTFATHVP  179

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
                L  S+ +   K++ +CRN  DT +S WH+ N +++E   +  +   E FD YCRG  
Sbjct  180   FGSLKDSIEKPGVKVVHLCRNPFDTFISSWHYTNSIKSE--SVSPVSLDEGFDMYCRGLI  237

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
              FGPFW+H+LGYWKESL+ P KVLFL+YE++K++ E  L+++A FLG PF+EEEE  GV 
Sbjct  238   GFGPFWEHMLGYWKESLKRPDKVLFLRYEDLKQDIESNLKKLASFLGVPFTEEEEGKGVT  297

Query  940   ggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
               I  LCSFESL  LEVNK GK+     N   FRKG+V
Sbjct  298   KAIVALCSFESLKKLEVNKAGKSIKNFENRHLFRKGEV  335



>ref|XP_010430710.1| PREDICTED: cytosolic sulfotransferase 13 [Camelina sativa]
Length=324

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 134/305 (44%), Positives = 189/305 (62%), Gaps = 17/305 (6%)
 Frame = +1

Query  148   TSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQ  327
             T +     K   +  + +E  E +  SSLP++  +   ++Y Y+GFW     L G L  Q
Sbjct  2     TKSKTTLSKLLADAKFSQECEELL--SSLPKDRSFFAEYLYQYQGFWYPPNLLEGVLYSQ  59

Query  328   KHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNME-F  504
             KHFQA+ SDII+ + PK G TWLKALVFAL  R++F    ++HPLL  +P  L+  +E F
Sbjct  60    KHFQARDSDIILVSSPKSGATWLKALVFALIHRREFQTPLESHPLLDNNPHSLVPFIEGF  119

Query  505   SY-SREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMN  681
              + +++ SP         ++ STH+PL  LP+S+ +S CK++  CRN KD  VS WHF+ 
Sbjct  120   QFHTQDTSP---------KIFSTHIPLRSLPESIKDSSCKVVYCCRNPKDAFVSLWHFVK  170

Query  682   KL-RAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeike  858
              L   E++G       E    +CRG+S++GPFWDH L YWKES ENP KVLF+ YEE++E
Sbjct  171   SLILKEMVG---CTMEEMVSGFCRGSSVYGPFWDHALEYWKESQENPDKVLFVMYEEMRE  227

Query  859   epeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYF  1038
             +P   + RIA FLGC F+EEE E GV+  I +LCS E++S LEVN+ GK  +      +F
Sbjct  228   QPRDWVIRIAEFLGCSFTEEEIENGVLDSIIKLCSLENMSKLEVNEKGKLVNGMETKAFF  287

Query  1039  RKGKV  1053
             RKG++
Sbjct  288   RKGEI  292



>ref|XP_009122389.1| PREDICTED: cytosolic sulfotransferase 15-like [Brassica rapa]
 emb|CDY70313.1| BnaAnng33290D [Brassica napus]
Length=363

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 182/278 (65%), Gaps = 6/278 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+E GW   ++Y ++GFW  S+ +   L  QKHF++  +D+++ T+PK GTTWLKAL 
Sbjct  56    SLPKERGWRTRYLYLFQGFWCQSKEIQAILSFQKHFKSLQNDVVLATIPKSGTTWLKALT  115

Query  409   FALTTRKQF-PVSQQT-HPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLP  579
             + +  R +F PVS  T HPLLT++P +L+   E+  Y+    PD     +  R  +TH+P
Sbjct  116   YTVLNRDRFDPVSSTTDHPLLTSNPHDLVPFFEYKLYANGDVPDLSGLASP-RTFATHVP  174

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
                L  S+ E   K++ +CRN  DT +S WH++N +++E   +  +   E FD YCRG  
Sbjct  175   FGSLKDSIEEPGVKVVYLCRNPFDTFISSWHYINNIKSE--AVSPVSLEEGFDLYCRGVI  232

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
              FGPFW+H+LGYWKESL  P KVLFL+YE++K++ E  L+++A FLG PF+EEEE+ GVV
Sbjct  233   GFGPFWEHMLGYWKESLRTPEKVLFLRYEDLKQDMESNLKKLASFLGVPFTEEEEQKGVV  292

Query  940   ggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
               IS LCSFE+L  LEVNK+ K+     N   FRKG+V
Sbjct  293   HSISDLCSFENLKKLEVNKSSKSIKNFENRHLFRKGEV  330



>emb|CDY05012.1| BnaAnng01940D [Brassica napus]
Length=368

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 178/278 (64%), Gaps = 6/278 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+E GW   H+Y ++GFW  S+ +   +  QKHF+   +D+++ T+PK GTTWLKAL 
Sbjct  61    SLPKERGWRTRHLYLFQGFWCQSKEIQAIMSFQKHFKPLQNDVVIATIPKSGTTWLKALT  120

Query  409   FALTTRKQF-PVSQQT-HPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLP  579
             + L  R +F PVS  T HPLLT++P +L+   E+  Y+    PD     +  R  +TH+P
Sbjct  121   YTLLNRHRFDPVSSNTDHPLLTSNPHDLVPFFEYKLYANGDVPDLSGLASP-RTFATHVP  179

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
                L  S+ +   K++ +CRN  DT +S WH+ N +++E   +  +   E FD YCRG  
Sbjct  180   FGSLKDSIEKPGVKVVYLCRNPFDTFISSWHYTNSIKSE--SVSPVSLDEGFDMYCRGLI  237

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
              FGPFW+H+LGYWKESL+ P KVLFL+YE++K++ E  L+++A FLG PF+EEEE  GV 
Sbjct  238   GFGPFWEHMLGYWKESLKRPDKVLFLRYEDLKQDIESNLKKLASFLGVPFTEEEEGKGVT  297

Query  940   ggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
               I  LCSFESL  LEVNK GK+     N   FRKG+V
Sbjct  298   KAIVALCSFESLKKLEVNKAGKSIKNFENRHLFRKGEV  335



>ref|NP_178471.1| sulphotransferase 12 [Arabidopsis thaliana]
 sp|P52839.2|SOT12_ARATH RecName: Full=Cytosolic sulfotransferase 12; Short=AtSOT12; AltName: 
Full=Sulfotransferase 1; Short=AtST1 [Arabidopsis thaliana]
 pdb|1Q44|A Chain A, Crystal Structure Of An Arabidopsis Thaliana Putative 
Steroid Sulfotransferase
 pdb|2Q3M|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of An Arabidopsis Thaliana Putative Steroid Sulphotransferase
 gb|AAK53042.1|AF375458_1 At2g03760/F19B11.21 [Arabidopsis thaliana]
 gb|AAD20078.1| putative steroid sulfotransferase [Arabidopsis thaliana]
 gb|AAM47358.1| At2g03760/F19B11.21 [Arabidopsis thaliana]
 gb|AEC05746.1| sulphotransferase 12 [Arabidopsis thaliana]
Length=326

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 143/305 (47%), Positives = 187/305 (61%), Gaps = 14/305 (5%)
 Frame = +1

Query  145   NTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRC  324
             ++S+S+P   +  +    +E R  I  SSLP+E+GWL   +Y ++G W     L G L C
Sbjct  2     SSSSSVP--AYLGDEDLTQETRALI--SSLPKEKGWLVSEIYEFQGLWHTQAILQGILIC  57

Query  325   QKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQ-THPLLTTSPQELIRNME  501
             QK F+A+ SDII+ T PK GTTWLKALVFAL  R +FPVS    HPLL T+P  L+  +E
Sbjct  58    QKRFEAKDSDIILVTNPKSGTTWLKALVFALLNRHKFPVSSSGNHPLLVTNPHLLVPFLE  117

Query  502   FSYSREISPDFPMNG-NGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFM  678
               Y    SPDF  +     R+++TH+    LP+SV  S CK++  CRN KD  VS WHF 
Sbjct  118   GVYYE--SPDFDFSSLPSPRLMNTHISHLSLPESVKSSSCKIVYCCRNPKDMFVSLWHFG  175

Query  679   NKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeike  858
              KL  E       P  +  + +C G  + GPFWDH+L YW  S ENP KVLF+ YEE+K+
Sbjct  176   KKLAPEETA--DYPIEKAVEAFCEGKFIGGPFWDHILEYWYASRENPNKVLFVTYEELKK  233

Query  859   epeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYF  1038
             + EVE++RIA FL C F EEEE   +     +LCSFESLSNLEVNK GK  +      +F
Sbjct  234   QTEVEMKRIAEFLECGFIEEEEVREI----VKLCSFESLSNLEVNKEGKLPNGIETKTFF  289

Query  1039  RKGKV  1053
             RKG++
Sbjct  290   RKGEI  294



>emb|CAA86850.1| Flavonol sulfotransferase [Arabidopsis thaliana]
Length=302

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 143/305 (47%), Positives = 187/305 (61%), Gaps = 14/305 (5%)
 Frame = +1

Query  145   NTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRC  324
             ++S+S+P   +  +    +E R  I  SSLP+E+GWL   +Y ++G W     L G L C
Sbjct  2     SSSSSVP--AYLGDEDLTQETRALI--SSLPKEKGWLVSEIYEFQGLWHTQAILQGILIC  57

Query  325   QKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQ-THPLLTTSPQELIRNME  501
             QK F+A+ SDII+ T PK GTTWLKALVFAL  R +FPVS    HPLL T+P  L+  +E
Sbjct  58    QKRFEAKDSDIILVTNPKSGTTWLKALVFALLNRHKFPVSSSGNHPLLVTNPHLLVPFLE  117

Query  502   FSYSREISPDFPMNG-NGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFM  678
               Y    SPDF  +     R+++TH+    LP+SV  S CK++  CRN KD  VS WHF 
Sbjct  118   GVYYE--SPDFDFSSLPSPRLMNTHISHLSLPESVKSSSCKIVYCCRNPKDMFVSLWHFG  175

Query  679   NKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeike  858
              KL  E       P  +  + +C G  + GPFWDH+L YW  S ENP KVLF+ YEE+K+
Sbjct  176   KKLAPEETA--DYPIEKAVEAFCEGKFIGGPFWDHILEYWYASRENPNKVLFVTYEELKK  233

Query  859   epeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYF  1038
             + EVE++RIA FL C F EEEE   +     +LCSFESLSNLEVNK GK  +      +F
Sbjct  234   QTEVEMKRIAEFLECGFIEEEEVREI----VKLCSFESLSNLEVNKEGKLPNGIETKTFF  289

Query  1039  RKGKV  1053
             RKG++
Sbjct  290   RKGEI  294



>ref|XP_002303947.1| hypothetical protein POPTR_0003s19270g [Populus trichocarpa]
 gb|EEE78926.1| hypothetical protein POPTR_0003s19270g [Populus trichocarpa]
Length=337

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 131/299 (44%), Positives = 192/299 (64%), Gaps = 16/299 (5%)
 Frame = +1

Query  181   QENSWPKELRESI----ISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQH  348
             Q NS   E  ES     + SSLP+E+ W+  +MY ++GFW   + +H  +  Q +FQ+ +
Sbjct  8     QRNSTVSETGESDQCRDLLSSLPKEKDWISCYMYLFQGFWCPPKEIHAVVSFQNNFQSCN  67

Query  349   SDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREIS  525
             +D I+ ++PK GTTWLKALVF++  R+++  ++   PL + +P +L+   E+  Y+    
Sbjct  68    TDTILVSMPKSGTTWLKALVFSIMNREKYQTAES--PLNSFNPHDLVPFFEYRLYANNQV  125

Query  526   PD---FPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAE  696
             PD   FP      R+ STH+P   LP+S+  S C+++ +CRN  D  +S+WHF++K R E
Sbjct  126   PDLSAFP----SPRIFSTHVPYPSLPESIRNSTCRVVYICRNPLDNFISFWHFLSKARPE  181

Query  697   LLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveL  876
              LG   +   E FD +C G   FGPF+DHVLGYWKESLE P KVLFLK+E++KE+   ++
Sbjct  182   RLG--PLLLEEAFDSFCNGVVGFGPFFDHVLGYWKESLERPEKVLFLKFEDLKEDINSQM  239

Query  877   RRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             + +A FLGCPFS EEE  GV+  IS+LCS +SL ++E NK GK+     NN  FR+G+V
Sbjct  240   KSLAVFLGCPFSLEEERDGVIEDISKLCSLDSLKDIEANKRGKSIPYFENNTLFRRGEV  298



>ref|XP_010663822.1| PREDICTED: uncharacterized protein LOC100261498 [Vitis vinifera]
Length=670

 Score =   237 bits (605),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 135/291 (46%), Positives = 189/291 (65%), Gaps = 14/291 (5%)
 Frame = +1

Query  199   KELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPK  378
             K  RE  I S+LP+E GW   HMY Y+GFW  S  L G +  Q+HF+A H D+ + + PK
Sbjct  352   KRYRE--IMSTLPKELGWTSDHMYQYQGFWYTSMNLEGVMWAQQHFKATHLDVFLASTPK  409

Query  379   CGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREI---SPDFPMNGN  549
              GTTWLKAL+FA+  R +F  S  THPLLT++P EL+  +EF +   I   +P+ P+   
Sbjct  410   SGTTWLKALMFAIMNRTRFDFS--THPLLTSNPHELVTLLEFYFHWNIPYPNPNTPLPKT  467

Query  550   GFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPE  729
               ++  TH+P   LP+S+ +S+C+++ +CRN KD  VS + F   L    + L  +   E
Sbjct  468   --QLFQTHIPFTSLPESIVDSQCRILYLCRNPKDVFVSMYCFKENLTD--INLAPLSIEE  523

Query  730   TFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPF  909
               +++C+G S+FGPFWDHVLGYWK SLE P +VLFLKYE++K +    ++R+A FLGCPF
Sbjct  524   AIEQFCKGVSLFGPFWDHVLGYWKVSLEWPERVLFLKYEDLKRDSLFHVKRLAEFLGCPF  583

Query  910   SeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHER---PNNVYFRKGKV  1053
             S EEE+ G+V  I +LCSFE+LSNL+VNKTG             +F+KG+V
Sbjct  584   SLEEEKEGIVHEIIKLCSFENLSNLKVNKTGVLQARDFIIEKKKFFQKGEV  634



>ref|XP_006292192.1| hypothetical protein CARUB_v10018398mg [Capsella rubella]
 gb|EOA25090.1| hypothetical protein CARUB_v10018398mg [Capsella rubella]
Length=324

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 130/278 (47%), Positives = 179/278 (64%), Gaps = 13/278 (5%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             S LP+++G+   ++Y Y+GFW     L G L  QKHFQA+ SDII+ + PK GTTWLKAL
Sbjct  26    SCLPKDKGFFAEYLYQYQGFWYPPNILEGVLYSQKHFQAKDSDIILVSSPKSGTTWLKAL  85

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNME-FSY-SREISPDFPMNGNGFRVLSTHLP  579
             VFAL  R +F   Q++HPLL  +P  L+  +E F + +++ SP          + STH+P
Sbjct  86    VFALIHRHEFQNPQESHPLLDNNPHTLVPFIEGFQFHNQDASPS---------IFSTHIP  136

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
             L  LP+SV +S CK++  CRN KD  VS WHF+  L  E   +      E    +CRG+S
Sbjct  137   LVSLPESVKDSSCKVVYCCRNPKDAFVSLWHFVKSLVLE--EMVGCTMEEMVSGFCRGSS  194

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
             ++GPFWDH L YWKES ENP KV+F+ YEE++E+P+  + RIA FLGC  +EEE E GV+
Sbjct  195   VYGPFWDHALEYWKESRENPEKVMFVMYEEMREQPKDWVLRIAEFLGCSLTEEEIEKGVL  254

Query  940   ggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
               I +LCS E+LS L+VN+ GK  +      +FRKG++
Sbjct  255   EDIIKLCSLENLSKLKVNEKGKLVNGMETKAFFRKGEI  292



>gb|KCW80592.1| hypothetical protein EUGRSUZ_C01953, partial [Eucalyptus grandis]
Length=290

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 131/272 (48%), Positives = 176/272 (65%), Gaps = 19/272 (7%)
 Frame = +1

Query  247   GWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTR  426
             GW  P +  Y+GFW  S  L G L CQKHFQA +SDII+ T PK GTTWLKA++FAL   
Sbjct  5     GWDNPSLILYQGFWFPSWPLDGVLACQKHFQAHNSDIILVTSPKSGTTWLKAILFALLNH  64

Query  427   KQF--PVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPLELLPK  597
              ++  P S+Q HPLLT +P +L+  +EF  Y ++  PD     +  R+L+THLP  LLP+
Sbjct  65    AKYSNPNSEQCHPLLTRNPHDLVPYLEFQLYLQQEDPDHATFASP-RLLATHLPYSLLPQ  123

Query  598   SVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFW  777
             SV +SKCKL+ +CRN KD  +S WHF  K+  +  G +  P  E  D++C+  SM+GP+W
Sbjct  124   SVRDSKCKLVYLCRNPKDNFISLWHFTKKMMLKENG-DQTPLSECLDKFCQRLSMYGPYW  182

Query  778   DHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvggISRL  957
             DHVLGY K S E P KVLF+KYEE+KE+P V +RR+A F+G              GI R+
Sbjct  183   DHVLGYHKMSSEMPEKVLFMKYEEMKEDPCVHVRRLADFVG--------------GILRM  228

Query  958   CSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              SF++LS LEVNK+G  +    N  +FR+G+V
Sbjct  229   WSFDNLSTLEVNKSGSLWTGAENKSFFRRGEV  260



>ref|XP_006292601.1| hypothetical protein CARUB_v10018842mg [Capsella rubella]
 gb|EOA25499.1| hypothetical protein CARUB_v10018842mg [Capsella rubella]
Length=324

 Score =   228 bits (580),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 133/278 (48%), Positives = 173/278 (62%), Gaps = 10/278 (4%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SSLP+ +GWL   +  ++G+W     L G L CQK F+A+ SDII+ T PK GTTWLKAL
Sbjct  23    SSLPKVKGWLVSEVCQFQGYWYTQAILQGLLLCQKRFEAKDSDIILVTNPKSGTTWLKAL  82

Query  406   VFALTTRKQFPV-SQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGF-RVLSTHLP  579
             VFAL  R +FPV S   HPLL T+P  L+  +E  Y    SPDF   G    R+++TH+P
Sbjct  83    VFALLNRHKFPVPSSGNHPLLVTNPHLLVPFLEGVYYE--SPDFDFLGLPTPRLMNTHIP  140

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
                LP+SV  S CK++  CRN KD  VS WHF  KL  +       P  +  + +C G  
Sbjct  141   YPSLPESVKSSSCKIVYCCRNPKDMFVSLWHFGKKLAPKETA--DYPIEKAVEAFCEGKF  198

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
             + GPFWDH+L YW  S ENP KV+F+ YE++K++  VE++RIA FLGC F     E G V
Sbjct  199   IGGPFWDHILEYWYASRENPDKVMFVTYEDLKKQTGVEIKRIAEFLGCGF----IEEGQV  254

Query  940   ggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
               I +LCSFESLSNLEVN+ GK  +      +FRKG++
Sbjct  255   EEIVKLCSFESLSNLEVNREGKLPNGIETKSFFRKGEI  292



>ref|XP_003627983.1| Flavonol sulfotransferase-like protein [Medicago truncatula]
 gb|AET02459.1| sulfotransferase [Medicago truncatula]
Length=348

 Score =   228 bits (582),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 125/279 (45%), Positives = 172/279 (62%), Gaps = 5/279 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLPRE G    +MY + GFW  S  +      Q +F A+ SDI+V ++PK GTTWLK L 
Sbjct  37    SLPRENGCETQYMYFFHGFWCPSTLIQSVNSFQNNFHAKDSDIVVASIPKSGTTWLKGLA  96

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPM----NGNGFRVLSTHL  576
             +A+  R+ F   +  HPLL  +P EL+   E +   +     P     N    R+  TH+
Sbjct  97    YAIVNRQHFTSLENNHPLLLFNPHELVPQFEVNLYGDKDGPLPQIDVSNMTEPRLFGTHM  156

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P   LPKSV ES CK+I +CRN  DT VSYW F+NK+R     L  +   E+F+RYC+G 
Sbjct  157   PFPSLPKSVKESNCKIIYICRNPFDTFVSYWIFINKIRLRK-SLTELTLEESFERYCKGI  215

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
              +FGPFWD++LGY KES+E P +VLFLKYE++KE+     +RIA F+G PF++EEE  GV
Sbjct  216   CLFGPFWDNMLGYLKESIERPDRVLFLKYEDLKEDVNFHTKRIAEFVGIPFTQEEENNGV  275

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +  I +LCSFES+  +E N++G    +     YFRKG++
Sbjct  276   IENIIKLCSFESMKEIEGNQSGTISGDIEKEFYFRKGEI  314



>emb|CDP11652.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   228 bits (582),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 139/318 (44%), Positives = 195/318 (61%), Gaps = 18/318 (6%)
 Frame = +1

Query  124   MAAPSDPNTSNSLPYHKFFQENSW---PKELRESIISSSLPREEGWLYPHMYNYKGFWLD  294
             MA PS   T NS  Y +   E +     KE     I S LPRE GWL  HMY Y+GFW  
Sbjct  1     MAIPS--LTQNSSSYIEGGDEQTLFNKEKEDDSDQILSVLPRERGWLSEHMYLYQGFWCP  58

Query  295   SEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTS  474
             +  L G L  QKHF+AQ SDI++ T PK GTTWLKAL+F +T R       Q +PLLT +
Sbjct  59    TRVLKGLLILQKHFRAQPSDILLATYPKSGTTWLKALLFTITNRTCISHPDQ-NPLLTAN  117

Query  475   PQELIRNME-FSYSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKD  651
             P EL+  +E ++ +  ++P  P +     ++ TH+P   LP+S   S C ++ V R+ KD
Sbjct  118   PHELVPMLESYAAANPVNPRPPNS-----LMHTHIPYNSLPESTKSSGCHIVYVYRDPKD  172

Query  652   TVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVL  831
              +VS WHF+NKL+ E   +  I   E F+++ +GAS FGP+W+HVLGYWK S+E P +V 
Sbjct  173   VLVSCWHFVNKLKPE--AVPRISLAEAFEKFSKGASPFGPYWNHVLGYWKASIEWPERVF  230

Query  832   FLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGK--  1005
             FL+YE++K+EP    +R+A FLG PF+ ++E   +V  +   CSF++LSNL+VNKTG   
Sbjct  231   FLRYEDLKKEPCFHTKRLAEFLGQPFTADKEGESLVSKVVEFCSFKNLSNLDVNKTGSHS  290

Query  1006  --TYHERPNNVYFRKGKV  1053
                +    N  +FR+G+V
Sbjct  291   AVGFQVIENKTFFREGQV  308



>ref|XP_007022042.1| Sulfotransferase 2A, putative [Theobroma cacao]
 gb|EOY13567.1| Sulfotransferase 2A, putative [Theobroma cacao]
Length=434

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/277 (46%), Positives = 174/277 (63%), Gaps = 6/277 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             +LP+E+ W+   +Y Y+GFW         +  Q HF+A  +DI + T PK GTTWLKAL+
Sbjct  24    TLPQEKDWVGSTLYQYQGFWYSLVPAKAVISFQNHFKAHDTDIFLITAPKSGTTWLKALI  83

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGN--GFRVLSTHLP  579
             F++  RKQFP +Q   PLL TSP +L+  +EFS YS+  + D   NGN    R+ +TH P
Sbjct  84    FSIVNRKQFPHTQS--PLLATSPHDLVPIIEFSIYSKNQTLDL-GNGNFPSPRIFATHTP  140

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
                LP S+ +S C+++ +CRN  D  +S WHF+          +     E FDR+C+G  
Sbjct  141   YGTLPSSILKSNCRIVYLCRNPLDQFISDWHFIVNNFPRKEDFKPFSIEEGFDRFCKGIH  200

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
              FGPFW+HVLGYWK SLE+P KVLFLKYE++K++    L ++A FLG PFSEEE   GVV
Sbjct  201   AFGPFWEHVLGYWKMSLEHPEKVLFLKYEDLKKDITSNLMKLADFLGYPFSEEEIRQGVV  260

Query  940   ggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGK  1050
               IS+LCSFE+L  +EVN TG+      N+ +FR  K
Sbjct  261   EEISKLCSFETLKTVEVNMTGERPDGLKNSAFFRNAK  297



>ref|XP_002303948.2| hypothetical protein POPTR_0003s19260g [Populus trichocarpa]
 gb|ABK94985.1| unknown [Populus trichocarpa]
 gb|EEE78927.2| hypothetical protein POPTR_0003s19260g [Populus trichocarpa]
Length=330

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/280 (46%), Positives = 179/280 (64%), Gaps = 12/280 (4%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SSLP+E+ W   ++Y Y+GFW   + +   +  QKHF AQ +D I+ T+PK GTTWLKAL
Sbjct  25    SSLPKEKSWRLGYLYRYQGFWCPEKQIPAVIAFQKHFIAQKTDTILVTMPKSGTTWLKAL  84

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPD---FPMNGNGFRVLSTH  573
              F++  R ++  S    PL + +P +L+   EF  Y+    PD   FP      R+ +TH
Sbjct  85    AFSIMNRAKYTPS--CSPLNSVNPHDLVPFFEFRLYANNQLPDLSTFPSP----RMFATH  138

Query  574   LPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRG  753
             +P   LP S+  S C+++C+CRN  D  +S WHF +K R E LG   +   + FD +C G
Sbjct  139   VPYPSLPDSIKNSGCRIVCLCRNPFDNFISLWHFASKARHESLG--PLSMEDCFDSFCNG  196

Query  754   ASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeegg  933
                FGPF+DHVLGYW+ESLE P +VLFL YE++KE+   +++R+A FLGCPFS EEE  G
Sbjct  197   LGGFGPFFDHVLGYWRESLERPEEVLFLTYEDMKEDINSQMKRLAEFLGCPFSLEEEADG  256

Query  934   vvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             VV GIS+LCSF ++ + E+NKTGK+     N   FR+G+V
Sbjct  257   VVEGISKLCSFSNMKDKEINKTGKSIPHFENKTLFRRGEV  296



>ref|XP_007218724.1| hypothetical protein PRUPE_ppa009048mg [Prunus persica]
 gb|EMJ19923.1| hypothetical protein PRUPE_ppa009048mg [Prunus persica]
Length=308

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/275 (45%), Positives = 170/275 (62%), Gaps = 21/275 (8%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+E+GW   H+Y ++GFW  S  +   +  QKHFQA  +DI+V ++PK GTTWLK L 
Sbjct  21    SLPKEKGWRTLHLYQFQGFWCQSAEIQSIMSFQKHFQANDTDIVVASIPKSGTTWLKTLA  80

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTHLPLEL  588
             FA++ R +F  + ++HPLL ++P +L+  +E                   +  TH+P   
Sbjct  81    FAVSNRHRFVPNSKSHPLLNSNPHDLVPFLE-------------------LFGTHIPFAS  121

Query  589   LPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFG  768
             L  S+  S  K++ +CRN  DT VS WHF+NK++ E      I   E FD YC+G   FG
Sbjct  122   LGNSIQNSDAKIVYICRNPLDTFVSSWHFLNKVKPE--SGSPISMEEAFDMYCKGIVGFG  179

Query  769   PFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvggI  948
             PFWDH+LGYWKESL  P  VLFLKYE++KE+   +L+++A FLG PF+ EEE GGVV  I
Sbjct  180   PFWDHMLGYWKESLLRPNNVLFLKYEDMKEDDAFQLKKMAKFLGFPFTLEEERGGVVENI  239

Query  949   SRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             ++LC FE++  LEVNK G +     N   FRK +V
Sbjct  240   AKLCCFENMKKLEVNKIGSSIGNFENKNLFRKAEV  274



>gb|EYU28890.1| hypothetical protein MIMGU_mgv1a009426mg [Erythranthe guttata]
Length=342

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 140/285 (49%), Positives = 181/285 (64%), Gaps = 8/285 (3%)
 Frame = +1

Query  220   ISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHF-QAQHSDIIVCTLPKCGTTWL  396
             I ++LP+E+GWL  H+Y ++GFW     L G + CQK+F +   SDI + T PK GTTWL
Sbjct  29    IIATLPKEKGWLSSHLYRFQGFWYPVRHLQGVIACQKNFVETLDSDIFLVTTPKSGTTWL  88

Query  397   KALVFALTTRKQFPVSQQT---HPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVL  564
             KA++FALT R + PV+  T   HPLL  +P +L+  +E   Y     PD        R+ 
Sbjct  89    KAIIFALTIRTKHPVATTTDKNHPLLHNNPHDLVPFLEIKLYVDNQIPDLSTFSTP-RLF  147

Query  565   STHLPLELLPKSVWESK-CKLICVCRNQKDTVVSYWHFMNKLRA-ELLGLEAIPFPETFD  738
             STHLP   LP+SV +S  CK++ +CRN KD   S WHF NKLR+ E  G       E FD
Sbjct  148   STHLPHVSLPESVKKSSACKIVYLCRNPKDVFTSLWHFTNKLRSQEKSGGATNCIDEVFD  207

Query  739   RYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSee  918
              +CRG S+FGPFWDHVL YW  S E   +V+F+K+EE+KEEP V LRR+A FLG  FS  
Sbjct  208   MFCRGVSLFGPFWDHVLEYWNLSREYSYRVMFVKFEEMKEEPGVCLRRLADFLGFGFSAA  267

Query  919   eeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             EEE GVV GI +LCSF++LS+LE+N  GK      N  +FR+G V
Sbjct  268   EEESGVVEGILKLCSFDNLSSLEINTNGKLSSGEENKAFFRRGVV  312



>ref|XP_004514095.1| PREDICTED: cytosolic sulfotransferase 15-like [Cicer arietinum]
Length=342

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/294 (42%), Positives = 188/294 (64%), Gaps = 8/294 (3%)
 Frame = +1

Query  181   QENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDII  360
             ++++  +E+++ I S  LPRE+GW  P++Y ++GFW     +      Q HFQA+ SD+ 
Sbjct  20    EQDNLSQEMKDLIFS--LPREKGWRTPYLYLFQGFWCQPAEIQAISTFQNHFQAKDSDVF  77

Query  361   VCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSY--SREISPDF  534
             V T+PK GTTWLKAL FA+  R+   +S + HPLL+ +P +L+  +E++   + E  P+F
Sbjct  78    VATVPKSGTTWLKALTFAIVNRQHHFISSKNHPLLSFNPHDLVPFIEYTVYGNHENLPNF  137

Query  535   PMNGNGFRVLSTHLPLELLPKSVWES-KCKLICVCRNQKDTVVSYWHFMNKLRAELLGLE  711
               N +  R+  TH+P + L  S+ +S  CK++ +CRN  DT +S W F NK++ +   L 
Sbjct  138   S-NFHEPRLFGTHVPFDSLSNSIKDSSNCKIVYICRNPFDTFISSWVFCNKIKQD--SLP  194

Query  712   AIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAG  891
              +   E F+ +C G   +GPFW+H+LGYWKES E P+KVLFLKYE++K++   EL+++A 
Sbjct  195   TLGLDEAFEMFCNGKIGYGPFWNHMLGYWKESQERPKKVLFLKYEDLKDDVNFELKKLAK  254

Query  892   FLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             FL CPF+ EEE  GV+  I +LCSFE +   E+NK GK      N   FRKG++
Sbjct  255   FLNCPFTLEEESEGVIENIIKLCSFEKMKEFEINKIGKFGRNFENKYLFRKGEI  308



>gb|ADX97329.1| sulfotransferase-like protein [Mangifera indica]
Length=341

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/279 (45%), Positives = 176/279 (63%), Gaps = 7/279 (3%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+++GW  P++Y ++GFW  S+ +   +  QKHF ++ SD+I+ T+PK GTTWLK LV
Sbjct  32    SLPKQKGWRTPYLYEFQGFWCQSKKIQAIISFQKHFISRESDVILATIPKSGTTWLKGLV  91

Query  409   FALTTRKQFPVSQ-QTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPL  582
             F++  RK   V   + HPLL ++P +L+   E+  YS    PD     +  R+ +TH+P 
Sbjct  92    FSIMNRKHIDVKNLKNHPLLHSNPHDLVPFFEYKLYSDNQIPDLSRLPDP-RLFATHIPF  150

Query  583   ELLPK--SVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
               L +  S+  +  K++ +CRN  DT VS WHF+N LR +   L      E F  YC G 
Sbjct  151   NSLMQQNSIKNASPKIVYLCRNPLDTFVSSWHFVNNLRPK--SLPPFQIEEAFKMYCDGI  208

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
               FGPFW+H+LGYW ESL+NP  VLFLKYE ++E+    L+ +A FLGCPFS EEE+ GV
Sbjct  209   IGFGPFWEHMLGYWNESLKNPTAVLFLKYEAMREDIVSNLKELAKFLGCPFSVEEEQEGV  268

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +  I++LC F+ + NLE NKTGK+     N   FRKG+V
Sbjct  269   IKEIAKLCCFDKMKNLEANKTGKSIKNFENKYLFRKGEV  307



>ref|XP_006399179.1| hypothetical protein EUTSA_v10015302mg [Eutrema salsugineum]
 gb|ESQ40632.1| hypothetical protein EUTSA_v10015302mg [Eutrema salsugineum]
Length=364

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 185/295 (63%), Gaps = 9/295 (3%)
 Frame = +1

Query  181   QENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDII  360
              E     E RE +   SLP+E GW   ++Y ++GFW  S+ +   +  QKHFQ   +D++
Sbjct  42    DEEGLSYEFREML--DSLPKERGWRTRYLYLFQGFWCQSKEIQAIISFQKHFQPLQNDVV  99

Query  361   VCTLPKCGTTWLKALVFALTTRKQF-PVSQQT--HPLLTTSPQELIRNMEFS-YSREISP  528
             + T+PK GTTWLKAL F L  R +F PVS     HPLLT++P +L+   E+  Y+    P
Sbjct  100   IATIPKSGTTWLKALTFTLLNRYRFDPVSSTNTDHPLLTSNPHDLVPFFEYKLYANGGVP  159

Query  529   DFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGL  708
             D     +  R  +TH+P   L  S+ +   K++ +CRN  DT +S WH++N +++E   +
Sbjct  160   DLSGLASP-RTFATHIPFGSLKGSIEKPGVKVVYLCRNPFDTFISSWHYINSIKSE--SV  216

Query  709   EAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIA  888
               +   E FD YCRG   FGPFW+H+LGYW+ESL+ P KVLFL+YE++KE+ E  L+R+A
Sbjct  217   SPVSLDEGFDLYCRGVIGFGPFWEHMLGYWRESLKRPEKVLFLRYEDLKEDIESNLKRLA  276

Query  889   GFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              FLG PF++EEE  GVV  IS LCSF++L  LEVNK+ K+     N   FRKG+V
Sbjct  277   SFLGVPFTDEEERKGVVKAISDLCSFKNLKKLEVNKSSKSIKNFENRHLFRKGEV  331



>emb|CDX81030.1| BnaC03g02840D [Brassica napus]
Length=359

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 179/278 (64%), Gaps = 7/278 (3%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
              SLP+E GW   H+Y ++GFW  ++ +H  +  QKHF+    D+I+ T+PK GTTWLKAL
Sbjct  54    DSLPKERGWRTRHLYLFQGFWCQAKEIHAIMSFQKHFKPLPKDVILATIPKSGTTWLKAL  113

Query  406   VFALTTRKQF-PVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLP  579
              F L  R +F PVS   HPLLT++P +L+  +E+  Y+    PD     +  R  +TH+P
Sbjct  114   TFTLLNRHRFDPVSD--HPLLTSNPHDLVPFLEYKLYANGEVPDLSSLASP-RTFATHVP  170

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
                L  S+ E   K++ +CRN  DT +S WHF N +++E   +  +   E FD YCRG  
Sbjct  171   FGSLKGSIEEPGVKVVYLCRNPFDTFISSWHFSNSIKSE--SVSPVSLEEGFDLYCRGVI  228

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
              FGPFW+H+LGYW+ESL+ P +VLFLKYE++KE+ E  L+++A FLG  F+EEEE  GVV
Sbjct  229   GFGPFWEHMLGYWRESLKRPEEVLFLKYEDLKEDIETNLKKLASFLGVSFTEEEEGKGVV  288

Query  940   ggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
               ++ LCSFESL  LEVNK+ K+     N   FRKG+V
Sbjct  289   KAVADLCSFESLKKLEVNKSNKSIKNFENRYLFRKGEV  326



>ref|XP_008777577.1| PREDICTED: cytosolic sulfotransferase 12-like [Phoenix dactylifera]
Length=355

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/279 (45%), Positives = 180/279 (65%), Gaps = 13/279 (5%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             S+LP EEGW    +  Y+GFW+    L G +  Q++F+A+  D+ V + PK GTTWLKAL
Sbjct  35    STLPLEEGWAPLRIRKYQGFWIPERVLQGIMDMQQNFKARPDDLFVLSYPKSGTTWLKAL  94

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTHLPLE  585
              +A+ TR Q+P+    HPLL  +P E +  M  +Y++  + +     +  R+L+THLP  
Sbjct  95    TYAIMTRTQYPLDH--HPLLRQNPHEFVPIMGITYAKGEASELEAMSSP-RILNTHLPYS  151

Query  586   LLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMF  765
             LLP ++    CKLI VCR+ KD +VS +H+ N++R +   +E IPF + F+ +C G   +
Sbjct  152   LLPHAIKSLGCKLIYVCRDPKDVLVSRFHYNNRMRPQ--AMEPIPFTKAFEMFCEGNCPY  209

Query  766   GPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvgg  945
             GP W+HVL YW+ES   P KVLFLKYEE+  +P   ++R+A F+GCPFS EEE+ GVV  
Sbjct  210   GPIWEHVLEYWEESQRRPEKVLFLKYEEMLGDPPRIVKRLAEFMGCPFSPEEEKEGVVEE  269

Query  946   ISRLCSFESLSNLEVNKTGKTYHERP-----NNVYFRKG  1047
             I +LCSF+ + +LEVNKTGK    RP     N+ +FRKG
Sbjct  270   IIKLCSFDKMKSLEVNKTGKL---RPDFVLTNDSFFRKG  305



>ref|XP_010665242.1| PREDICTED: cytosolic sulfotransferase 15-like [Vitis vinifera]
Length=343

 Score =   226 bits (577),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 129/280 (46%), Positives = 179/280 (64%), Gaps = 13/280 (5%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             +LPRE  W   ++Y Y+GFW  +  L   +  Q+HFQA+ SD++V +  K GTTWLKAL 
Sbjct  31    TLPRERNWDGTYIYQYQGFWFRARTLQSIISFQRHFQAEDSDVLVISPQKSGTTWLKALT  90

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS--YSREISP---DFPMNGNGFRVLSTH  573
             FA+  R Q   SQ   PLLT++P +L+R +EF   + ++  P   D P      R+L+TH
Sbjct  91    FAIINRNQSAFSQS--PLLTSNPHDLVRFLEFDLYFMKKEGPNLQDLPRP----RLLATH  144

Query  574   LPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRG  753
              P  +LP S+ +S+C+++ +CRN  D  VS WHF+N +  + L   ++      + +CRG
Sbjct  145   TPCSMLPSSIKDSECRIVYICRNPLDRFVSIWHFVNTIPTQPLNPTSLD--HGLEMFCRG  202

Query  754   ASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeegg  933
                FGP+WDHVL YWK S E P KVLFLKYE++KE+    ++R+A FLG PFSEEEE  G
Sbjct  203   VESFGPYWDHVLEYWKMSRERPDKVLFLKYEDLKEDISTHIKRLAHFLGFPFSEEEERVG  262

Query  934   vvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             ++  ISRLCS +SL NL VNKTGK      N+ +FRKG+V
Sbjct  263   IIEEISRLCSLQSLKNLMVNKTGKRPCGFKNSAHFRKGEV  302



>gb|KEH21570.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=336

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 128/279 (46%), Positives = 172/279 (62%), Gaps = 6/279 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+E G+   + Y ++GFW  +  +   +  Q HFQA+ SD++V T+PK GTTWLKAL 
Sbjct  26    SLPKEYGFGNQYFYFFQGFWTTAAQIQSIISFQNHFQAKDSDVVVATVPKSGTTWLKALT  85

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFP----MNGNGFRVLSTHL  576
             FA+  R  F  S   HPLLT++P EL+   E +   +IS  F     +N    R+  TH+
Sbjct  86    FAIINRHHFS-SLHNHPLLTSNPHELVPFFELNIYTDISWQFAKLDLLNMIEPRIFGTHI  144

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P   L KS+ ES CK+I +CRN  DT VSYW+FMNK+ A    L      + F++YC G 
Sbjct  145   PFHSLAKSIKESNCKIIYICRNPFDTFVSYWNFMNKI-ALNQSLPTSTLEDDFEKYCEGL  203

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
                GPFWDH+LGY KES   P K+LFLKYE++KE+    ++RIA FLGCPF++EEE  GV
Sbjct  204   CHVGPFWDHMLGYLKESKARPNKILFLKYEDLKEDINFHVKRIAEFLGCPFTQEEESNGV  263

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +  I  LCSFE +  LE NK+G          +FRKG++
Sbjct  264   IENIINLCSFEKMKGLEANKSGVLGKIYDKKYFFRKGEI  302



>ref|XP_011020447.1| PREDICTED: cytosolic sulfotransferase 15-like [Populus euphratica]
Length=329

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 128/280 (46%), Positives = 180/280 (64%), Gaps = 12/280 (4%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SSLP+E+ W   ++Y Y+GFW   + +   +  QKHF+AQ +D I+ T+PK GTTWLKAL
Sbjct  24    SSLPKEKSWRSGYVYRYQGFWCPEKQIPALIAFQKHFRAQKTDTILVTMPKSGTTWLKAL  83

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPD---FPMNGNGFRVLSTH  573
              F++  R ++  S    PL   +P +L+   E+  Y+ +  PD   FP      R+ +TH
Sbjct  84    AFSIMNRAKYTPS--CSPLNYVNPHDLVPFFEYGLYANKQIPDLSTFPSP----RMFATH  137

Query  574   LPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRG  753
             +P   LP S+  S C+L+C+CRN  D  +S WHF +K R E LG   +   + FD +C G
Sbjct  138   VPYPSLPDSIKNSGCRLVCLCRNPFDNFISLWHFASKARHESLG--PLSLEDCFDSFCDG  195

Query  754   ASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeegg  933
                FGPF+DHVLGYW+ESLE P +VLFL YE++KE+   +++R+A FLGCPFS EEE  G
Sbjct  196   LGGFGPFFDHVLGYWRESLERPEEVLFLTYEDMKEDINSQMKRLAEFLGCPFSLEEEADG  255

Query  934   vvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             V+ GIS+LCSF +L + E+NKTGK+     N   FR+G+V
Sbjct  256   VLEGISKLCSFSNLKDKEINKTGKSLLYFENKTLFRRGEV  295



>ref|XP_010672210.1| PREDICTED: cytosolic sulfotransferase 13-like [Beta vulgaris 
subsp. vulgaris]
Length=339

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 132/284 (46%), Positives = 179/284 (63%), Gaps = 16/284 (6%)
 Frame = +1

Query  220   ISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLK  399
             + S+LPR        +Y Y+GFW  S+FL   +  Q HFQA+ +DII+ T PK GTTWLK
Sbjct  32    VVSTLPRSTKHPRSPLYFYQGFWCPSDFLPNIIDFQNHFQAKDTDIIIATKPKSGTTWLK  91

Query  400   ALVFALTTRKQFPVSQQTHPLLTTSPQELI-----RNMEFSYSREISPDFPMNGNGFRVL  564
             +LV+++  R +F +S   HPL T +P ELI     +N + + S ++S     N    R++
Sbjct  92    SLVYSIVNRTRFTLSN--HPLRTKNPHELIFFVDAKNTDKNVSLDLS-----NMEPPRLM  144

Query  565   STHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIP-FPETFDR  741
             STH+P   LP SV ES+C+++C+ RN  DT VS W F+ ++  E L    I  F E F  
Sbjct  145   STHMPYSSLPTSVKESECRVVCMARNPMDTFVSMWKFLTQIHPEFLQQMTIDNFSEIF--  202

Query  742   YCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeee  921
              C G   FGP+WDHVLGYWKESLE P KVLF+KYE++KE    E++R+A FLGC FS EE
Sbjct  203   -CNGEESFGPYWDHVLGYWKESLERPNKVLFVKYEDMKENGIFEMKRLAEFLGCGFSMEE  261

Query  922   eeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             E+ GV+  I + CS  +L  +EVNKTGK      N ++FRKG+V
Sbjct  262   EKQGVIEEIVKFCSLSNLKEMEVNKTGKVVPVFENKLFFRKGEV  305



>ref|XP_009789859.1| PREDICTED: flavonol sulfotransferase-like [Nicotiana sylvestris]
Length=347

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 134/287 (47%), Positives = 183/287 (64%), Gaps = 11/287 (4%)
 Frame = +1

Query  211   ESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTT  390
             +S + ++L +E+GW+  H+Y Y+ FW     + G  R Q+ F+AQ +D I+ T PK GTT
Sbjct  22    DSDMLTTLNKEKGWITEHLYQYQSFWFTPAAIRGVKRAQQCFKAQPTDAILVTFPKSGTT  81

Query  391   WLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREIS-PDFPMNGNGFRVLS  567
             W KAL+F+L  R +F  S  +HPLLT  P + I  +E     E S  D+ ++ +   +L+
Sbjct  82    WFKALIFSLMNRDRFNFS--SHPLLTKGPHDCIPFLEAIIQDETSYQDYRISCSPCCLLA  139

Query  568   THLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYC  747
             TH+P  LLP SV  S CK++ V R  KD +VS W FM KLR +   L + P  + FD +C
Sbjct  140   THIPYSLLPASVMSSGCKIVYVFREPKDVLVSNWLFMTKLRFK--ELPSFPIKDAFDLFC  197

Query  748   RGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeee  927
             +G S +GPFWD VLGYWK S+ENP KVLFL YE++K++P + L ++A FL  PFS EEE 
Sbjct  198   KGVSHYGPFWDQVLGYWKASMENPDKVLFLTYEDMKKDPIICLTKLAKFLDKPFSLEEER  257

Query  928   ggvvggISRLCSFESLSNLEVNKTGKTYHERP-----NNVYFRKGKV  1053
              GVV  I RLCSFE+LS+LEVN+TG   H  P     N  + RKG+V
Sbjct  258   EGVVQEIVRLCSFENLSSLEVNQTG-VQHFSPQFAVANRHFLRKGQV  303



>ref|XP_007034897.1| Flavonol 3-sulfotransferase, putative, partial [Theobroma cacao]
 gb|EOY05823.1| Flavonol 3-sulfotransferase, putative, partial [Theobroma cacao]
Length=339

 Score =   226 bits (575),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 133/287 (46%), Positives = 181/287 (63%), Gaps = 22/287 (8%)
 Frame = +1

Query  226   SSLPREEGW--LYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLK  399
             ++LP+E GW  + P +  Y+GFW    FL G +  Q HFQAQ +DI++C+  K GT WLK
Sbjct  28    ATLPKENGWTPMQP-LCPYQGFWFFPMFLEGVMYTQDHFQAQSTDILLCSSMKTGTAWLK  86

Query  400   ALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHL  576
             AL F++ TR QF  +    PL TT   E I  +++  Y+    P FP+       L+TH+
Sbjct  87    ALSFSIATRTQF--NNSISPLQTTFTHECIPFLDYGEYAASQGPRFPL-------LATHV  137

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFM-----NKLRAELLGLEAIPFPETFDR  741
             P   LPKSV +S CK++ +CR+ KD  VS WHF+     N ++ EL   + I   E F+ 
Sbjct  138   PYTCLPKSVIDSGCKIVYICRDPKDNFVSLWHFVRTATRNNIK-ELKEGDLISMEEAFEL  196

Query  742   YCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeee  921
             YC+G S++GP+W+HV GYW  SLE+P K+LFLKYE++ +E E   +R+A FLGCPFS EE
Sbjct  197   YCKGISLYGPYWEHVWGYWNASLEHPEKILFLKYEDMMKETESYAKRLAEFLGCPFSLEE  256

Query  922   eeggvvggISRLCSFESLSNLEVNKTGKTYHER---PNNVYFRKGKV  1053
             E GG +  I + CSFE+LSN+EVNKTG    +     N  YFRKGKV
Sbjct  257   ERGGKIQEIIQFCSFENLSNVEVNKTGIHQAQGRLVENKAYFRKGKV  303



>ref|XP_007133673.1| hypothetical protein PHAVU_011G199400g [Phaseolus vulgaris]
 gb|ESW05667.1| hypothetical protein PHAVU_011G199400g [Phaseolus vulgaris]
Length=327

 Score =   225 bits (574),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 175/278 (63%), Gaps = 6/278 (2%)
 Frame = +1

Query  229   SLPREEGW-LYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SLP+E G    P++Y ++ FW  + ++ G  + QKHF A+ +D+ V + PK GTTWLKAL
Sbjct  18    SLPKETGLGSAPYIYLFQDFWCPTVYVEGVNKFQKHFDAKENDVFVASFPKSGTTWLKAL  77

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPM--NGNGFRVLSTHLP  579
              FA+   +QF  S   HPLL+++P EL+   EF YS ++        N +  R+L TH+P
Sbjct  78    TFAIVNHQQFS-SFDHHPLLSSNPHELVPFPEFMYSYDLHDQILSLSNMSEPRLLGTHIP  136

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
             L  LP+S+ +S CK+I +CRN  DT VS W F  K+++E   L  +   E F++YC G  
Sbjct  137   LPSLPESITKSNCKIIYICRNPFDTFVSAWEFFTKMKSE--SLPDLTLEEAFEKYCNGIM  194

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
              FGP+W HVLGYWKESL  P KVLFLKYE++KE+    ++RIA FL    ++  E   V+
Sbjct  195   GFGPWWSHVLGYWKESLTRPDKVLFLKYEDLKEDTIFHVKRIADFLDSLITQGGESTTVI  254

Query  940   ggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
               I RLC FE + +LEVNK+G+ +    N  +FRKG++
Sbjct  255   ENIIRLCGFEKMKDLEVNKSGRIFDVVENKTFFRKGEI  292



>emb|CDX99017.1| BnaC09g48180D [Brassica napus]
Length=370

 Score =   226 bits (577),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 179/278 (64%), Gaps = 6/278 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+E GW   ++Y ++GFW  S+ +   +  QKHF++  +D+++ T+PK GTTWLKAL 
Sbjct  63    SLPKERGWRTRYLYLFQGFWCQSKEIQAIMSFQKHFKSLQNDVVLATIPKSGTTWLKALT  122

Query  409   FALTTRKQF-PVSQQT-HPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLP  579
             F +  R +F PVS  T HPLLT++P +L+   E+  Y     PD     +  R  +TH+P
Sbjct  123   FTVLNRHRFDPVSSTTDHPLLTSNPHDLVPFFEYKLYENGDVPDLSGLASP-RTFATHVP  181

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
                L  S+ E   K++  CRN  DT +S WH++N +++E   +  +   E FD YCRG  
Sbjct  182   FGSLKDSIEEPGVKVVYFCRNPFDTFISSWHYINNIKSE--AVSPVSLEEGFDLYCRGVI  239

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
              FGPFW+H+LGYWKESL  P KVLFL+YE++K++ E  L+++A FL  PF+EEE++ GVV
Sbjct  240   GFGPFWEHMLGYWKESLRTPEKVLFLRYEDLKQDMESNLKKLASFLDVPFTEEEDQKGVV  299

Query  940   ggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
               IS LCSFE+L  LEVNK+ K+     N   FRKG+V
Sbjct  300   HSISDLCSFENLKKLEVNKSSKSIKNFENRHLFRKGEV  337



>ref|XP_007133678.1| hypothetical protein PHAVU_011G199900g [Phaseolus vulgaris]
 gb|ESW05672.1| hypothetical protein PHAVU_011G199900g [Phaseolus vulgaris]
Length=326

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/278 (45%), Positives = 176/278 (63%), Gaps = 6/278 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+E GW   ++Y ++ FW  S  + G    QK+FQA+ SD++V + PK GTTWLKAL 
Sbjct  18    SLPKERGWASRYLYLFQHFWCPSTHIQGVNDFQKNFQAKPSDVLVASFPKSGTTWLKALT  77

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSY---SREISPDFPMNGNGFRVLSTHLP  579
             F++  RK+F  S + HPLLT++P EL+  ++F +   + +       N +  RV  TH+P
Sbjct  78    FSIINRKRFS-SSENHPLLTSNPHELVPFLDFIFHADNLQQKLSHLSNMSEPRVFGTHVP  136

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
                L  S+ +S CK+I +CRN  DT VS W F NK++ +   L  +   E  ++YC+G  
Sbjct  137   FPSLSSSIKDSNCKIIYICRNPFDTFVSSWTFFNKIKQD--SLHEVTIEEALEKYCKGII  194

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
              FGP W+H+LGYWKES+  P KVLFLKYE++KE+    +RR+A FL CPF+EEEE  GV+
Sbjct  195   GFGPTWEHMLGYWKESMATPNKVLFLKYEDLKEDINFYVRRVAEFLECPFTEEEESDGVI  254

Query  940   ggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
               I +LCSFE + +LEVNK+G           FRKG+V
Sbjct  255   ENIIKLCSFEKMKDLEVNKSGTVGRNVEKKYLFRKGEV  292



>ref|XP_007022038.1| Sulfotransferase 2A [Theobroma cacao]
 gb|EOY13563.1| Sulfotransferase 2A [Theobroma cacao]
Length=335

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 128/287 (45%), Positives = 179/287 (62%), Gaps = 7/287 (2%)
 Frame = +1

Query  202   ELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKC  381
             +L E +I + LP+E+ W+   +Y Y+GFW         +  Q HF+A  +DI + T+PK 
Sbjct  16    KLMEELIQT-LPQEKDWVGSTLYQYQGFWYPFFAPKAVIAFQNHFKAHETDIFLITMPKS  74

Query  382   GTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGN--G  552
             GTTWLKAL+F++  RKQF ++Q   PLLTT+P EL+  ++ + Y +  +PD   NG    
Sbjct  75    GTTWLKALIFSIANRKQFSLTQS--PLLTTNPHELVPFIDINIYLKNRTPDLE-NGKFPS  131

Query  553   FRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPET  732
              R+ +TH P   LP S+ +S C+++ +CRN  D  +S WHF           +     E 
Sbjct  132   PRIFATHTPYGTLPSSILKSNCRIVYLCRNPLDQFISDWHFFVNNFPRNGDFKPFSIEEG  191

Query  733   FDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFS  912
             F+R+C+G   FGPFW+HVLGYWK SLE+P KVLFLKYE++K++    L+++A FL  PFS
Sbjct  192   FERFCKGTHAFGPFWEHVLGYWKMSLEHPEKVLFLKYEDLKKDIASNLKKVADFLSYPFS  251

Query  913   eeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             EEE   GVV  IS+LCSFE+L  LEVN TG       N+ +FR GKV
Sbjct  252   EEEIRQGVVEEISKLCSFETLKTLEVNMTGVRPVGLKNSAFFRNGKV  298



>ref|XP_011081805.1| PREDICTED: cytosolic sulfotransferase 15-like [Sesamum indicum]
Length=328

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/277 (44%), Positives = 177/277 (64%), Gaps = 7/277 (3%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             +L + + W    +  Y+  WL        L  QKHF+A+ +DII+ T+PK GTTWLKAL 
Sbjct  25    TLEQHKSWDSRPLVRYERIWLPVMLFRPILTSQKHFKAEGTDIILTTMPKSGTTWLKALT  84

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTHLPLEL  588
             F++  R  F + Q   PLL+ +P  L+  +E++  R+       N    R+ STH+P ++
Sbjct  85    FSIANRNVFSIHQS--PLLSYNPHTLVPFLEYTIYRDQDNPELENIPRPRIFSTHMPFKI  142

Query  589   LPKSVWESKCKLICVCRNQKDTVVSYWHFM--NKLRAELLGLEAIPFPETFDRYCRGASM  762
             LP S+ ES+C++I +CRN  D  VS++HFM  NK+  + + LE     E FD +C+G   
Sbjct  143   LPDSIRESECRIIYICRNPLDQFVSHYHFMLQNKIEKDAIPLE---LDEVFDMFCQGIQP  199

Query  763   FGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvg  942
             FGPFWDH+LGYW   L+NP+KVLFLKYE++K++    +++IA F+G PFS EEE  G++ 
Sbjct  200   FGPFWDHMLGYWNAHLKNPQKVLFLKYEDLKQDISSHIKKIAEFIGFPFSAEEENQGMIE  259

Query  943   gISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              ISRLCSFE+L NLEVNK+G       N+ +FRKG+V
Sbjct  260   QISRLCSFENLKNLEVNKSGYFIGSIKNSSFFRKGEV  296



>gb|EYU29209.1| hypothetical protein MIMGU_mgv1a022523mg [Erythranthe guttata]
Length=320

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/294 (44%), Positives = 181/294 (62%), Gaps = 17/294 (6%)
 Frame = +1

Query  205   LRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCG  384
             + + +  + L R+  W    +  Y GFW    F    L  Q HF A+ SD+I+ T+PK G
Sbjct  1     MEKKVDETLLERKTSWDGQQLVKYDGFWFSEMFFRQILSAQNHFVAKDSDVILSTVPKSG  60

Query  385   TTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFP------MNG  546
             TTWLKAL FA+  R   P + + +PLLT++P  L+ ++E +     +P+         + 
Sbjct  61    TTWLKALAFAVANRGIHPNTDR-NPLLTSNPHTLVHSIEINLFHRENPNLEYLSSSTSST  119

Query  547   NGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFM--NKLRAEL--LGLEA  714
                R+LSTH+P E+LP S+ ES CK+I VCRN  D   S  HF+  N+++ ++  LGL+ 
Sbjct  120   ISSRMLSTHMPFEILPDSIRESACKIIYVCRNPLDQFTSLRHFLIENRIKKDVVPLGLD-  178

Query  715   IPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGF  894
                 E+FD +C G   FGPFWDH+LGYW   LENP KVLFLKYE++KE+    +++IA F
Sbjct  179   ----ESFDMFCDGIHGFGPFWDHILGYWNAHLENPGKVLFLKYEDLKEDIGCNVKKIAEF  234

Query  895   LGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHE-RPNNVYFRKGKV  1053
             L CPFS EEE+ G V  ISRLCSFE+L N+EVNK+G        N+ +FRKG+V
Sbjct  235   LECPFSLEEEKRGAVEEISRLCSFENLKNVEVNKSGYVMDGLLKNSTFFRKGEV  288



>gb|KCW81757.1| hypothetical protein EUGRSUZ_C03121 [Eucalyptus grandis]
Length=280

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/276 (47%), Positives = 170/276 (62%), Gaps = 35/276 (13%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SSLP EE W+      Y+GFWL S   +G L CQ HFQA  SDI++ T PK GTTWLKA+
Sbjct  10    SSLPSEEDWITVSFRLYQGFWLSSRLFNGILTCQNHFQAHPSDILLVTSPKSGTTWLKAI  69

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTHLPLE  585
             +FAL  +         +P LT                  SP         R+ +TH+P  
Sbjct  70    LFALLNQ---------NPDLTAIA---------------SP---------RLFATHMPYS  96

Query  586   LLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMF  765
             LLP+SV +S CKL+ +CRN KDT VS WHF N++R E  G   IP  E  D++CRG S+ 
Sbjct  97    LLPQSVRDSNCKLVYLCRNPKDTFVSMWHFANRMRPEEKG--QIPIQEGLDKFCRGVSVC  154

Query  766   GPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvgg  945
             GP+WDHVLGY K SL+ P KVLF+ YE++K +P V +RR+A FLGCPFS+EE   G + G
Sbjct  155   GPYWDHVLGYHKASLDMPEKVLFMMYEQMKVDPHVHVRRLADFLGCPFSKEELRDGTLEG  214

Query  946   ISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             I ++CSF+++S LEVNK GK +       +FR+G+V
Sbjct  215   ILKICSFDNMSALEVNKCGKLWTGAETKWFFRRGEV  250



>ref|XP_007133555.1| hypothetical protein PHAVU_011G188800g [Phaseolus vulgaris]
 gb|ESW05549.1| hypothetical protein PHAVU_011G188800g [Phaseolus vulgaris]
Length=327

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 127/290 (44%), Positives = 180/290 (62%), Gaps = 9/290 (3%)
 Frame = +1

Query  199   KELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPK  378
             +E  E    SSLP+E GW + H+Y ++ FW  S  +      QKHF A+ SD++V + PK
Sbjct  8     QENEEDEFISSLPKERGWSFSHVYLFEQFWCPSSLIRERNIFQKHFHAKQSDVLVASFPK  67

Query  379   CGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGF-  555
              GTTWLKAL FA+   K+F  S + HPLLT++P +L+  + +++   I        N   
Sbjct  68    SGTTWLKALTFAIVNHKKFS-STENHPLLTSNPHQLVPPL-YTFRGNIHDQILQLSNMAE  125

Query  556   -RVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPET  732
              RV  TH+P   LPKSV E  C++I +CRN  DT VS W F NK++ E   L  +   E 
Sbjct  126   PRVFGTHIPFPSLPKSVIELNCRIIYICRNPFDTFVSAWAFFNKIKVE--SLSTLTKEEA  183

Query  733   FDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFS  912
             F+ +C G   FGP+W H+LGYWKES+  P  VLFLKYE++KE+ +  ++++A FLGC F+
Sbjct  184   FEMFCNGVIEFGPWWSHMLGYWKESVARPNTVLFLKYEDLKEDVDFHVKKVADFLGCSFT  243

Query  913   eeeeeggvvggISRLCSFESLSNLEVNKTGKTYHER---PNNVYFRKGKV  1053
             +EEE  GVV  I++LCSFE + +LEVNK+G    E     N ++FRK ++
Sbjct  244   QEEESDGVVESIAKLCSFEGMKDLEVNKSGTINFEIKRFENKLFFRKAEI  293



>ref|XP_009621634.1| PREDICTED: flavonol sulfotransferase-like [Nicotiana tomentosiformis]
 ref|XP_009621635.1| PREDICTED: flavonol sulfotransferase-like [Nicotiana tomentosiformis]
Length=349

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/296 (44%), Positives = 184/296 (62%), Gaps = 9/296 (3%)
 Frame = +1

Query  181   QENSWPKELR-ESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDI  357
              EN + K+ + +S + SS P+E GW+  H+Y Y+ FW     + G  R Q+ F AQ +D 
Sbjct  15    DENEYKKDDQNDSDMLSSFPKENGWMVKHLYQYESFWFSPAAIRGIKRVQECFNAQPTDF  74

Query  358   IVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREIS-PDF  534
              + T PK GTTW KAL+F++T R +F  S  +HPLL  SP + I  +E     E S  D+
Sbjct  75    FLATFPKAGTTWFKALIFSITNRARFDFS--SHPLLAKSPHDCIPFVESIIQDETSYRDY  132

Query  535   PMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEA  714
              ++ +   + +TH+P  LLP SV  S CK++ V R+ KD  VS WH+M K+R +   L +
Sbjct  133   QISCSPCCLFATHIPYSLLPASVVSSGCKIVYVFRDTKDVFVSTWHYMIKIRPK--ELPS  190

Query  715   IPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGF  894
              P  + FD +C+G S  GPFWDHVL YWK S+ENP K+LF+ YE++K++P + L ++A F
Sbjct  191   FPIEDAFDLFCKGVSHCGPFWDHVLDYWKASMENPNKILFIMYEDMKKDPILCLTKLAKF  250

Query  895   LGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHER---PNNVYFRKGKV  1053
             L  PF+ EEE  G V  I+RLC FESLS+L+VN+TG  +       N  + RKG+V
Sbjct  251   LDRPFTLEEEREGAVQEIARLCGFESLSSLKVNQTGVMHFNSIVVENRHFLRKGQV  306



>ref|XP_006347852.1| PREDICTED: cytosolic sulfotransferase 15-like [Solanum tuberosum]
Length=337

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/294 (45%), Positives = 188/294 (64%), Gaps = 12/294 (4%)
 Frame = +1

Query  181   QENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDII  360
             QE    +EL E +  +SLP+E+GW  P+++ ++GFW   + +   +  Q HF AQ +D+I
Sbjct  20    QETLSEEELDEFL--TSLPKEKGWRTPNLFLFQGFWCQPKEIRAIISIQNHFIAQDTDVI  77

Query  361   VCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREIS--PDF  534
             + T+PK GTTWLKAL FA+  R  F V    HPLLT +P EL+  +E+    + +  PD 
Sbjct  78    LATIPKSGTTWLKALTFAIVNRNNFNV-HHNHPLLTHNPHELVPFLEYKLYADSNRLPDL  136

Query  535   PMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEA  714
              +  +  R+++TH+P   LP S+  S CK+I +CRN  DT VS WH++ K+R E LG   
Sbjct  137   SLLPSP-RIVATHVPFGALPDSIKTSNCKIIYICRNPFDTFVSIWHYLCKIRPESLG--P  193

Query  715   IPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGF  894
             +P  E FD YCRG + +GP+WDH+L YW+E+   P KVLFLKYEE+K +   +L+ +  F
Sbjct  194   LPIEEAFDLYCRGVTGYGPYWDHMLSYWRETA--PNKVLFLKYEEMKVDTCNQLKILGEF  251

Query  895   LGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGK-TYHERPNNVYFRKGKV  1053
             LG PF+ EEEE GV+  IS LCSF+++ +LEVNK GK       N   FRKG++
Sbjct  252   LGFPFT-EEEEKGVIEDISNLCSFQNMKDLEVNKKGKGAISVFENRDLFRKGEI  304



>ref|XP_010496748.1| PREDICTED: cytosolic sulfotransferase 5-like [Camelina sativa]
Length=330

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/291 (45%), Positives = 182/291 (63%), Gaps = 9/291 (3%)
 Frame = +1

Query  199   KELRESI--ISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTL  372
             +EL E I  + SSLP ++      +  Y+G W     L   L  QK+F+ Q +D+IV + 
Sbjct  13    EELNEEIKTLISSLPSDKDSSGKDVSKYQGCWYTHHALQAVLSFQKNFKPQDTDVIVASF  72

Query  373   PKCGTTWLKALVFALTTRKQFPVSQQTHPLLT--TSPQELIRNMEFS-YSREISPDFPMN  543
             PKCGTTWLKAL FAL  R ++      H       +P  L+  +E + Y     PD    
Sbjct  73    PKCGTTWLKALTFALLHRSKYSSLHDHHHHPLLSDNPHVLVPYLEMNLYYYSEKPDLTKY  132

Query  544   GNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIP-  720
              +  R+ STH+PL  L + + +S CK++ +CRN KDT+VSYWHF  K +   +  E I  
Sbjct  133   SSSPRLFSTHMPLHALQEGLKDSTCKIVYMCRNVKDTLVSYWHFFCKKQ---INDEVISS  189

Query  721   FPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLG  900
             F +TF+ +CRG S+FGPFWD VL YW+ SLE+P  VLF+KYEE+K EP  +++R+A FLG
Sbjct  190   FEDTFESFCRGVSLFGPFWDQVLSYWRGSLEDPNHVLFMKYEEMKAEPREQIKRLADFLG  249

Query  901   CPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             CPF++EEEE G +  I  LCS  +LS+LE+NKTGK Y+ R N  +FRKG+V
Sbjct  250   CPFTKEEEESGSMDEIIDLCSLRNLSSLEINKTGKLYNGRDNKTFFRKGEV  300



>ref|XP_010936424.1| PREDICTED: flavonol 3-sulfotransferase-like [Elaeis guineensis]
Length=354

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/277 (46%), Positives = 184/277 (66%), Gaps = 7/277 (3%)
 Frame = +1

Query  220   ISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLK  399
             ++S+LP EEGW    +  Y+GFW   + L G++  Q++F+A+  D+ V + PK GTTWLK
Sbjct  33    LTSTLPLEEGWAI-RLRKYQGFWFPQQILPGSMAMQQNFKARPDDVFVLSHPKSGTTWLK  91

Query  400   ALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTHLP  579
             AL +A+ TR ++P  +  HPLL+ +P E +  M+ SYS     +     +  R+L++HLP
Sbjct  92    ALTYAIVTRTKYPFDR--HPLLSQNPHECVPLMDRSYSTGQDSEIEAMPSP-RILNSHLP  148

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
               LLP S+    C+LI VCR+ KD +VS W F N++R+E  G+E IPF + F+ +C G S
Sbjct  149   YSLLPHSIKSLDCQLIYVCRDPKDVLVSRWFFNNRMRSE--GMEPIPFTKAFEMFCEGNS  206

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
              +GP W+HVL YW+ES   P KVLFLKYEE+ EEP   ++R+A F+GCPF+ EEE+ GVV
Sbjct  207   PYGPLWEHVLEYWEESQRRPDKVLFLKYEEMLEEPMRIVKRLAQFVGCPFTPEEEKEGVV  266

Query  940   ggISRLCSFESLSNLEVNKTGKTYHE-RPNNVYFRKG  1047
               + +LCSF+ + +LEVN +GK   E   N+ +FRKG
Sbjct  267   EEVVKLCSFDKMKSLEVNISGKLRPEFVTNDAFFRKG  303



>ref|XP_011070306.1| PREDICTED: cytosolic sulfotransferase 15-like [Sesamum indicum]
Length=328

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 128/295 (43%), Positives = 187/295 (63%), Gaps = 15/295 (5%)
 Frame = +1

Query  184   ENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIV  363
             +NS   E +E +   +L R+  W    +  Y+GFWL   F    L  QK+F+A+ +D+I+
Sbjct  12    DNSAKDEFQELL--QTLERQTNWDGQRLVKYEGFWLLELFFRPILSAQKYFKAKGTDVIL  69

Query  364   CTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSY---SREISPDF  534
              T+PK GTTWLKAL F++  R   P+ Q   PLLT++P +++  +EF       ++ P+ 
Sbjct  70    STMPKSGTTWLKALTFSIANRNAIPIDQS--PLLTSNPHKVVPFLEFDLYWGQEDLDPER  127

Query  535   PMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFM--NKLRAELLGL  708
              ++    R+LSTH+PLE+LP S+ E+ C++I +CRN  D  +S   F+  N+   + + L
Sbjct  128   ILDP---RILSTHMPLEILPDSIREAGCRIIYLCRNPLDVFISNRLFLLENRFSEDAVLL  184

Query  709   EAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIA  888
             E     E FDR C+G    GPFWDH+LGYW   L+NP +VLF+KYE++KE+    +++IA
Sbjct  185   E---LDEAFDRLCQGIHDCGPFWDHMLGYWNAHLKNPERVLFIKYEDLKEDILSNIKKIA  241

Query  889   GFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              F+G PFS EEE+ GVV  ISRLCSFE+L NLEVNK+G       N+ +FRKG+V
Sbjct  242   EFIGSPFSPEEEKQGVVEQISRLCSFENLKNLEVNKSGNILGLVKNSSFFRKGEV  296



>ref|XP_004514767.1| PREDICTED: cytosolic sulfotransferase 15-like isoform X1 [Cicer 
arietinum]
Length=342

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/294 (41%), Positives = 187/294 (64%), Gaps = 8/294 (3%)
 Frame = +1

Query  181   QENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDII  360
             ++++  +++++ I S  LPRE+GW  P++Y ++GFW     +      Q HFQA+ SD+ 
Sbjct  20    EQDNLSQDMKDLIFS--LPREKGWRTPYLYLFQGFWCQPAEIQAISTFQNHFQAKDSDVF  77

Query  361   VCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSY--SREISPDF  534
             V T+PK GTTWLKAL FA   R+   +S + HPLL+ +P +L+  +E++   + E  P+F
Sbjct  78    VATVPKSGTTWLKALTFATVNRQHHFISSKNHPLLSYNPHDLVPFIEYTVYGNHENLPNF  137

Query  535   PMNGNGFRVLSTHLPLELLPKSVWE-SKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLE  711
               N +  R+  TH+P + L  S+ + S CK++ +CRN  DT +S W F NK++ +   L 
Sbjct  138   S-NFHEPRLFGTHVPFDSLSNSIKDFSNCKIVYICRNPFDTFISSWVFCNKIKQD--SLP  194

Query  712   AIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAG  891
              +   E F+ +C G   +GPFW+H+LGYWKES E P++VLFLKYE++K++   EL+++A 
Sbjct  195   TLGLDEAFEMFCNGKIGYGPFWNHMLGYWKESQERPKRVLFLKYEDLKDDVNFELKKLAK  254

Query  892   FLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             FL CPF+ EEE  GV+  I +LCSFE +   E+NK GK      N   FRKG++
Sbjct  255   FLNCPFTLEEESEGVIENIIKLCSFEKMKEFEINKIGKFGRNFENKYLFRKGEI  308



>ref|XP_004499637.1| PREDICTED: cytosolic sulfotransferase 15-like [Cicer arietinum]
Length=342

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/294 (41%), Positives = 187/294 (64%), Gaps = 8/294 (3%)
 Frame = +1

Query  181   QENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDII  360
             ++++  +++++ I S  LPRE+GW  P++Y ++GFW     +      Q HFQA+ SD+ 
Sbjct  20    EQDNLSQDMKDLIFS--LPREKGWRTPYLYLFQGFWCQPAEIQAISTFQNHFQAKDSDVF  77

Query  361   VCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSY--SREISPDF  534
             V T+PK GTTWLKAL FA   R+   +S + HPLL+ +P +L+  +E++   + E  P+F
Sbjct  78    VATVPKSGTTWLKALTFATVNRQHHFISSKNHPLLSFNPHDLVPFIEYTVYGNHENLPNF  137

Query  535   PMNGNGFRVLSTHLPLELLPKSVWES-KCKLICVCRNQKDTVVSYWHFMNKLRAELLGLE  711
               N +  R+  TH+P + L  S+ +S  CK++ +CRN  DT +S W F NK++ +   L 
Sbjct  138   S-NFHEPRLFGTHVPFDSLSNSIKDSSNCKIVYICRNPFDTFISSWVFCNKIKQD--SLP  194

Query  712   AIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAG  891
              +   E F+ +C G   +GPFW+H+LGYWKES E P++VLFLKYE++K++   EL+++A 
Sbjct  195   TLGLDEAFEMFCNGKIGYGPFWNHMLGYWKESQERPKRVLFLKYEDLKDDVNFELKKLAK  254

Query  892   FLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             FL CPF+ EEE  GV+  I +LCSFE +   E+NK GK      N   FRKG++
Sbjct  255   FLNCPFTLEEESEGVIENIIKLCSFEKMKEFEINKIGKFGRNFENKYLFRKGEI  308



>gb|EYU29210.1| hypothetical protein MIMGU_mgv1a010218mg [Erythranthe guttata]
Length=318

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 178/278 (64%), Gaps = 9/278 (3%)
 Frame = +1

Query  232   LPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVF  411
             L R  GW   H+ NY+GFW    FL      + +F A+++DII+ T+PK GTTWLKAL F
Sbjct  14    LERRTGWDGQHLVNYEGFWFPEMFLPSIRSSRNNFVAKNTDIILATVPKSGTTWLKALTF  73

Query  412   ALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPM-NGNGFRVLSTHLPLEL  588
             ++  R  + V Q   PLL ++P +L+  ++     E     PM N +  R+LS+H+P  +
Sbjct  74    SVANRGIYAVDQS--PLLKSNPHKLVPFIQEYIGDEHDKLLPMENVSDPRILSSHVPFVM  131

Query  589   LPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIP--FPETFDRYCRGASM  762
             LP SV +S+CK+I +CRN  D  +S  HF    + E    EA+P  F E+FD +C+G   
Sbjct  132   LPYSVAKSECKIIYLCRNPLDQFISLHHFFASNKIEK---EAVPLGFEESFDMFCQGIIG  188

Query  763   FGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvg  942
             FGPFW+H++GYW   LENP+KVLFLKYE++KE+  + +++IA F+GCPFSEEE   GVV 
Sbjct  189   FGPFWEHMIGYWNAHLENPKKVLFLKYEDLKEDIVLNVKKIAEFMGCPFSEEEVGKGVVE  248

Query  943   gISRLCSFESLSNLEVNKTGKTYHER-PNNVYFRKGKV  1053
              IS+LCSF +L NLEVNK G        NN +FRKG+V
Sbjct  249   EISKLCSFGNLKNLEVNKNGYVMDGVLKNNTFFRKGEV  286



>ref|XP_010491300.1| PREDICTED: cytosolic sulfotransferase 15-like [Camelina sativa]
Length=360

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/300 (43%), Positives = 188/300 (63%), Gaps = 8/300 (3%)
 Frame = +1

Query  163   PYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQA  342
             P H    +     E +E +   SLP+E GW   ++Y ++GFW  ++ +   +  QKHF++
Sbjct  33    PKHGGGDDEGLSYEFQEML--DSLPKERGWRTRYLYLFQGFWCQAKEIQAIMSFQKHFRS  90

Query  343   QHSDIIVCTLPKCGTTWLKALVFALTTRKQF-PVSQQT-HPLLTTSPQELIRNMEFS-YS  513
               +D+++ T+PK GTTWLKAL F +  R +F PVS  T HPLLT++P +L+   E+  Y+
Sbjct  91    LPNDVVLATIPKSGTTWLKALTFTILKRHRFDPVSSTTNHPLLTSNPHDLVPFFEYKLYA  150

Query  514   REISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRA  693
                 PD        R  +TH+P   L  S+ E   K++ +CRN  DT +S WHF+N +++
Sbjct  151   NGAVPDLSGLARP-RTFATHVPFGSLKDSIEEPGVKVVYLCRNPFDTFISSWHFINNIKS  209

Query  694   ELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeve  873
             E   +  +   E FD YCRG   FGPFW+H+LGY++ESL+ P KV FLKYE++KE+ E  
Sbjct  210   E--SVSPVLLDEGFDLYCRGVIGFGPFWEHMLGYYRESLKRPEKVFFLKYEDLKEDIETN  267

Query  874   LRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             L+++A FLG PF++EEE+ GVV  I+ LCSFE+L  LEVNK+ K+     N   FRKG+V
Sbjct  268   LKKLASFLGLPFTKEEEQKGVVKAIADLCSFENLKKLEVNKSKKSIKNFENRFLFRKGEV  327



>ref|XP_010271910.1| PREDICTED: cytosolic sulfotransferase 15-like [Nelumbo nucifera]
Length=347

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 143/314 (46%), Positives = 191/314 (61%), Gaps = 10/314 (3%)
 Frame = +1

Query  124   MAAPSDPNTSNSLPYHKFFQENSWPKELRESIISSSLPRE--EGWLYPHMYNYKGFWLDS  297
             MA  ++  T NS       +E     E +E + +SS PR   E W+   +Y ++GFW   
Sbjct  1     MAEANNLATQNSTTPSHSPEEVGLSHECQE-MHASSPPRTRVEEWIEDPLYQHQGFWFIE  59

Query  298   EFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSP  477
               L   L  Q +F++   DII+ TLPK GTTWLK+LVFA   R ++  S   +PLLT +P
Sbjct  60    RRLEAVLWFQSNFKSCDRDIILATLPKSGTTWLKSLVFATVNRTKYSFSD--NPLLTANP  117

Query  478   QELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDT  654
              EL+   E   Y+    P+   N +  RV +TH+P +LLP++   S C++I +CRN +DT
Sbjct  118   HELVPFFELKLYTDNQLPNLS-NISHPRVFATHIPYQLLPETTKNSNCRIIYLCRNPRDT  176

Query  655   VVSYWHFMNKL-RAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVL  831
              +S WHF+NK  R E LG   +   E F+ +C G   FGP+W+H+LGYW ESL  PR VL
Sbjct  177   FISSWHFVNKSSRRESLG--PLSLEEAFEWFCNGVIPFGPYWNHLLGYWNESLTRPRNVL  234

Query  832   FLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTY  1011
             FL+YEE+KE+   +LRRIA FLGCPFS EE   GV+  I RLCSFESL NLEVNKTG   
Sbjct  235   FLRYEELKEDIVSQLRRIADFLGCPFSLEEGRQGVIEEIVRLCSFESLRNLEVNKTGCFI  294

Query  1012  HERPNNVYFRKGKV  1053
                 +N  FR+G+V
Sbjct  295   PGYESNSLFRRGEV  308



>ref|XP_006385979.1| hypothetical protein POPTR_0003s19250g [Populus trichocarpa]
 gb|ERP63776.1| hypothetical protein POPTR_0003s19250g [Populus trichocarpa]
Length=329

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 126/280 (45%), Positives = 179/280 (64%), Gaps = 12/280 (4%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SSLP+E+ W   ++Y Y+GFW   + +   +  QKHF AQ +D I+ T+PK GTTWLKAL
Sbjct  24    SSLPKEKSWRSGYVYRYQGFWCPEKQIPAVIAFQKHFIAQKTDTILVTMPKSGTTWLKAL  83

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPD---FPMNGNGFRVLSTH  573
              F++  R ++  S    PL + +P +L+   EF  Y+    PD   FP      R+ +TH
Sbjct  84    AFSIMNRAKYTPS--CSPLNSVNPHDLVPFFEFGLYANNQLPDLSTFPSP----RMFATH  137

Query  574   LPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRG  753
             +P   +  S+  S C+++ +CRN  D  +S WHF++K R E  GL  +   E FD +C G
Sbjct  138   VPYPSISDSIKNSGCRIVYLCRNPFDNFISSWHFLSKTRPE--GLGPLLLEEAFDSFCNG  195

Query  754   ASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeegg  933
                FGPF+DHVLGYW+ESLE P +VLFL YE++KE+   +++R+A FLGCPFS EEE  G
Sbjct  196   HGGFGPFFDHVLGYWRESLERPEEVLFLTYEDMKEDINSQMKRLAEFLGCPFSLEEEADG  255

Query  934   vvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             VV GIS+LCSF +L + E+NKTG++     N + FR+G+V
Sbjct  256   VVEGISKLCSFSNLKDKEINKTGRSLGNLENKILFRRGEV  295



>ref|XP_010452648.1| PREDICTED: cytosolic sulfotransferase 15 [Camelina sativa]
Length=359

 Score =   224 bits (571),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 125/279 (45%), Positives = 181/279 (65%), Gaps = 6/279 (2%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
              SLP+E GW   ++Y ++GFW  ++ +   +  QKHF++  +D+++ T+PK GTTWLKAL
Sbjct  51    DSLPKERGWRTRYLYLFQGFWCQAKEIQAIMSFQKHFRSLPNDVVLATIPKSGTTWLKAL  110

Query  406   VFALTTRKQF-PVSQQT-HPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHL  576
              F +  R +F PVS  T HPLLT++P +L+   E+  Y+    PD        R  +TH+
Sbjct  111   TFTILNRHRFDPVSSTTNHPLLTSNPHDLVPFFEYKLYANGAVPDLSGLARP-RTFATHV  169

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P   L  S+ E   K++ +CRN  DT +S WHF+N +++E +    +   E FD YCRG 
Sbjct  170   PFGSLKDSIEEPGVKVVYLCRNPFDTFISSWHFINNIKSETVS--RVLLDEGFDLYCRGV  227

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
               FGPFW+H+LGY++ESL+ P KV FLKYE++KE+ E  L+++A FLG PF++EEE+ GV
Sbjct  228   IGFGPFWEHMLGYYRESLKRPEKVFFLKYEDLKEDIETNLKKLASFLGLPFTKEEEQKGV  287

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             V  I+ LCSFE+L  LEVNK+ K+     N   FRKG+V
Sbjct  288   VKAIADLCSFENLKKLEVNKSKKSIKNFENRFLFRKGEV  326



>ref|XP_003542798.1| PREDICTED: cytosolic sulfotransferase 15-like [Glycine max]
 gb|KHN37709.1| Flavonol sulfotransferase-like [Glycine soja]
Length=344

 Score =   223 bits (569),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 127/296 (43%), Positives = 177/296 (60%), Gaps = 8/296 (3%)
 Frame = +1

Query  178   FQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDI  357
              +E+   +E +E I+S  LPRE GW   ++Y ++GFW     +   +  QKHFQA+ SD+
Sbjct  23    IEEDKLSQECKELILS--LPRERGWRTRYIYLFQGFWCQPLEIQAIITFQKHFQAKDSDV  80

Query  358   IVCTLPKCGTTWLKALVFALTTRKQFPV--SQQTHPLLTTSPQELIRNMEFSYSREISPD  531
             IV T+PK GTTWLKAL FA+  R    +  S  +HPLLT++P EL+  +E++        
Sbjct  81    IVATIPKSGTTWLKALTFAIVNRHTHSITTSMSSHPLLTSNPHELVPFIEYTVYGNAPSH  140

Query  532   FP--MNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLG  705
              P   N    R+  TH+P   L KS+ ES  ++I +CRN  DT VS W F+NK++ E   
Sbjct  141   VPNLSNMTEPRLFGTHIPFHALAKSIKESNSRIIYICRNPLDTFVSTWIFLNKIKPE--H  198

Query  706   LEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRI  885
             L      E F++YC+G   FGP WD +LGYWKES+  P KVLFLKYE++K++    ++RI
Sbjct  199   LPEFELGEAFEKYCKGIIGFGPTWDQMLGYWKESIARPSKVLFLKYEDLKKDVNFHVKRI  258

Query  886   AGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             A FLG PF+ EEE  G +  I +LCSFE +  LE NK+G           FRK ++
Sbjct  259   AEFLGWPFTSEEEGDGTIESIIKLCSFEKMKELEANKSGTFARNFERKYLFRKAEM  314



>ref|XP_010554271.1| PREDICTED: cytosolic sulfotransferase 11-like [Tarenaya hassleriana]
Length=335

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 185/315 (59%), Gaps = 16/315 (5%)
 Frame = +1

Query  124   MAAPSDPNTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEF  303
             M A S    S+ +P   F  E+   +E +  I  SSLP ++ +L  ++ NY GFW  S  
Sbjct  1     MEAASQDTRSDDIP--SFMGEDKVRQECKSLI--SSLPSDKDFLGRNLCNYNGFWFYSNT  56

Query  304   LHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQE  483
             L   +  Q HF+   +D+IV + PK GTTWLKAL FA+  R ++  + + HPLL+ +P  
Sbjct  57    LQAVIDVQNHFRTLDTDVIVASFPKAGTTWLKALTFAIVNRSKYRSNPENHPLLSQNPHT  116

Query  484   LIRNMEFS-YSREISPDF---PMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKD  651
             L+  +E   YS   +PD    P  G    + +TH+P  LL +SV ES CK++ VCRN KD
Sbjct  117   LVPFLEIDLYSENKTPDLAKVPSPG----LFATHMPFLLLQESVKESSCKIVYVCRNLKD  172

Query  652   TVVSYWHFMNK-LRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKV  828
              VVS WHF    + +E+ G       E+F   CRG    GPFWDH L YWKES ENP +V
Sbjct  173   NVVSAWHFRRGYMISEMHGTTLKLMIESF---CRGVHFCGPFWDHALSYWKESSENPDRV  229

Query  829   LFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKT  1008
              F KYE++K EP  +++R+A FLGCPF+EEEE  G V  I  LCS  SL +LE+NKTGK 
Sbjct  230   FFTKYEDMKNEPRAQIKRLARFLGCPFTEEEEMNGSVDEILNLCSLRSLKDLEINKTGKA  289

Query  1009  YHERPNNVYFRKGKV  1053
                     +FRKG+V
Sbjct  290   PCSIDCKNFFRKGEV  304



>emb|CDY60367.1| BnaA09g54440D [Brassica napus]
Length=330

 Score =   223 bits (568),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 124/278 (45%), Positives = 176/278 (63%), Gaps = 6/278 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+E GW   H+Y ++GFW  S+ +   +  QKHF+   +D+++ T+PK GTTWLKAL 
Sbjct  23    SLPKERGWRTRHLYLFQGFWCQSKEIQAIMSFQKHFKPLQNDVVIATIPKSGTTWLKALT  82

Query  409   FALTTRKQF-PV-SQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLP  579
             + L  R +F PV S   HPLLT++P +L+  +E+  Y+    PD        R  +TH+P
Sbjct  83    YTLLNRHRFDPVFSTTDHPLLTSNPHDLVPFLEYKLYANGDVPDL-FGLASPRTFATHVP  141

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
                L  S+ +   K++ +CRN  DT +S WH+ N +++E   +  +   E FD YCRG  
Sbjct  142   FGSLKDSIEKPGVKVVYLCRNPFDTFISSWHYTNSIKSE--SVNPVSLDEGFDMYCRGLI  199

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
              FGPFW+H+L YWKESL+ P KVLFL+YE++K++ E  L+++A FL  PF+EEEE  G+V
Sbjct  200   GFGPFWEHMLAYWKESLKRPDKVLFLRYEDLKQDIESNLKKLASFLAVPFTEEEERKGIV  259

Query  940   ggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
               I  LCSFESL  LEVNK G++     N   FRKG+V
Sbjct  260   KAIVELCSFESLKKLEVNKAGQSIKNFENRHLFRKGEV  297



>ref|XP_002265783.1| PREDICTED: cytosolic sulfotransferase 15 [Vitis vinifera]
 emb|CBI35245.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   223 bits (569),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 175/276 (63%), Gaps = 6/276 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             +LP E  W    +Y Y+GFW  S  +      Q+HFQA  SD+I+ + PK GTTWLKAL 
Sbjct  23    TLPEERNWDGTSLYLYQGFWCPSIAIKPVFSFQQHFQALGSDLILASTPKSGTTWLKALT  82

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPLE  585
             F++  R ++ ++    PL TTSP  L+  +EF  Y +  SP+  M     R+ +TH+P  
Sbjct  83    FSILNRTRYTLNDS--PLHTTSPHGLVPFVEFDVYLKNKSPNL-MLLPSPRIFATHVPYG  139

Query  586   LLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMF  765
              LP S+ ES C+++ VCRN  D ++SYWHF  KLR     ++ +   E F+++C G   F
Sbjct  140   SLPSSIKESNCRIVYVCRNAVDQLISYWHFALKLRRG--NVKPLSLDEGFEKFCHGVHSF  197

Query  766   GPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvgg  945
             GPF +HVLGYWK +L+ P+ VLFLKYE++KE+     +R+A FLGCPFS  EE+ GV+  
Sbjct  198   GPFAEHVLGYWKANLDRPKNVLFLKYEDMKEDVFSHTKRLAEFLGCPFSAMEEKQGVIQE  257

Query  946   ISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             I  LCSFE+L +LEVNK+GK     PN+ +FR GKV
Sbjct  258   ICGLCSFENLKDLEVNKSGKRPSGVPNSAFFRNGKV  293



>ref|XP_007133664.1| hypothetical protein PHAVU_011G198600g [Phaseolus vulgaris]
 gb|ESW05658.1| hypothetical protein PHAVU_011G198600g [Phaseolus vulgaris]
Length=326

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 121/285 (42%), Positives = 180/285 (63%), Gaps = 6/285 (2%)
 Frame = +1

Query  208   RESIISSSLPREEGW-LYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCG  384
              E+ ++ SLP+E G    P++  ++ FW    ++ G  + QKHF A+ +D+ V ++PK G
Sbjct  11    EENDLTLSLPKESGLGAAPYLNLFQDFWCPPVYVKGVNKFQKHFDAKDNDVFVASIPKSG  70

Query  385   TTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPM--NGNGFR  558
             TTWLKAL FA+   ++F  S   HPLL+++P EL+   EF YS ++        N +  R
Sbjct  71    TTWLKALTFAIANHQRFS-SFDNHPLLSSNPHELVPFPEFMYSYDLHDQIISLSNMSEPR  129

Query  559   VLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFD  738
             +LSTHLP   LP+S+ +S CK+I + RN  DT VS W F  K+++  + L      E F+
Sbjct  130   LLSTHLPFPSLPQSITKSNCKIIYISRNPFDTFVSAWEFFTKIKS--VSLPEFTLEEAFE  187

Query  739   RYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSee  918
             +YC G ++FGP+W H+LGYWKES+  P KVLFLKYE++KE+    ++RIA FL  P ++ 
Sbjct  188   KYCNGITVFGPWWSHMLGYWKESITRPNKVLFLKYEDLKEDTVFHVKRIAEFLDSPITQG  247

Query  919   eeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              E   V+  I +LC FE++ NLEVNK+G  Y+   N  +FRKG++
Sbjct  248   GESTAVIENIIKLCRFETMKNLEVNKSGHIYNITENKHFFRKGEI  292



>ref|XP_006440813.1| hypothetical protein CICLE_v10020894mg [Citrus clementina]
 gb|ESR54053.1| hypothetical protein CICLE_v10020894mg [Citrus clementina]
Length=351

 Score =   223 bits (569),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 177/281 (63%), Gaps = 5/281 (2%)
 Frame = +1

Query  220   ISSSLPREEGWLYPHMYNYKGFWLDSEF-LHGALRCQKHFQAQHSDIIVCTLPKCGTTWL  396
             I ++LP+  GW   H+  Y+GFW   +  L G +  Q+ F+ + +D+ + T PK GTTWL
Sbjct  32    IMATLPKYRGWSTLHLCQYQGFWFQPKIGLEGVMWVQQRFKPRPTDVYLATNPKSGTTWL  91

Query  397   KALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTHL  576
             KA+VF++  RK++      HPLL  SP E++  ME    R      P      R+L+TH+
Sbjct  92    KAIVFSIMNRKRYNNFTTDHPLLKFSPHEVVPFMELDLFRTTPIADPEILPSPRILATHI  151

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
                +LP+S+  S C ++ +CRN KD  VS+W F  K+R +   L  + F E FD +C G 
Sbjct  152   AYNMLPESIQNSSCPIVYICRNPKDVFVSFWQFSVKMRPK--DLPELSFEEAFDLFCHGV  209

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
             +  GPFWD  LGYWK S+E P +VLFLKYE++K EP +  +RIA FLG PFS +EEE G+
Sbjct  210   TPCGPFWDQALGYWKASVEFPNRVLFLKYEDMKTEPLLCTKRIAEFLGQPFSLQEEENGI  269

Query  937   vggISRLCSFESLSNLEVNKTGKT--YHERPNNVYFRKGKV  1053
             V  I +LCSFES+SNLEVN+ GK+    E  N+V+FR+GKV
Sbjct  270   VQEIVKLCSFESMSNLEVNRNGKSRVRAEVKNDVFFRQGKV  310



>gb|KDO65656.1| hypothetical protein CISIN_1g041950mg, partial [Citrus sinensis]
Length=307

 Score =   222 bits (565),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 134/284 (47%), Positives = 186/284 (65%), Gaps = 11/284 (4%)
 Frame = +1

Query  220   ISSSLPREEGWLYPHMYNYKGFWLDS-EFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWL  396
             + +SLP+ +GW+  H+  YKG WL +   L G +  Q HF+AQ +DI + T PKCGTTWL
Sbjct  1     LVASLPKGKGWMTEHLVYYKGCWLTAYGALKGLMFIQDHFKAQPTDIFLATFPKCGTTWL  60

Query  397   KALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNG-NGFRVLSTH  573
             KAL+FA   R ++     +HPLL+ SP + +  ++ +Y  + +P   ++     R+ +TH
Sbjct  61    KALIFATMNRSRYDFP--SHPLLSASPHDCVPFLD-AYIFQNNPVSSIHSLPSPRLFATH  117

Query  574   LPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRG  753
             +P +LLP S+  S  + + +CRN KD +VS W FMNK R +   L  +   + F+ +C+G
Sbjct  118   IPYDLLPNSMISSGSRFVYICRNPKDVLVSKWVFMNKARPK--ELPPLSLEDAFELFCKG  175

Query  754   ASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeegg  933
              S +GPFWDHVLGYWK SLE+P K+LFLKYEE+  EP V L+R+A FLG PFS EEE  G
Sbjct  176   VSHYGPFWDHVLGYWKASLESPEKILFLKYEEMMREPFVLLKRLAEFLGQPFSLEEESDG  235

Query  934   vvggISRLCSFESLSNLEVNKTG-KTYHER---PNNVYFRKGKV  1053
             VV  I RLCSFE+LS+LEVNKT  K +  +    N  +FRKG+V
Sbjct  236   VVHEIIRLCSFENLSSLEVNKTKVKRFSNQLVIDNCDFFRKGRV  279



>gb|KFK25092.1| hypothetical protein AALP_AA8G065200 [Arabis alpina]
Length=353

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 127/288 (44%), Positives = 178/288 (62%), Gaps = 6/288 (2%)
 Frame = +1

Query  199   KELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPK  378
             K   E  +  SLP E GW   ++Y Y+GFW  S+ +   +  QKHFQ   +D+++ T+PK
Sbjct  36    KRQEEQEMLESLPTERGWRTRYLYLYQGFWCQSKEIQAIMSFQKHFQPLQNDVVLATIPK  95

Query  379   CGTTWLKALVFALTTRKQF-PVSQQT-HPLLTTSPQELIRNMEFS-YSREISPDFPMNGN  549
              GTTWLKAL F +  R  F PVS  T HPL T++P +L+   E+  Y+    PD     +
Sbjct  96    SGTTWLKALTFTILNRHLFDPVSSSTDHPLFTSNPHDLVPFFEYKLYANGEVPDLSGLAS  155

Query  550   GFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPE  729
               R  +TH+P   L  S+ +   K++ +CRN  DT +S WH++N +++E   +  +   E
Sbjct  156   P-RTFATHIPFGSLKDSIEKPGVKVVYLCRNPFDTFISSWHYINNIKSE--SVSPVTLEE  212

Query  730   TFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPF  909
              FD YCRG   FGPFW+H+LGYW+ SL+ P KVLFLKYE++K + E  L+++A FLG PF
Sbjct  213   GFDLYCRGVIGFGPFWEHMLGYWRASLKRPEKVLFLKYEDLKHDIESTLKKLASFLGHPF  272

Query  910   SeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             ++EEE  GVV  I  LCSFE+L  LEVNK+ K+     N   FRKG+V
Sbjct  273   TKEEEGKGVVKAIKDLCSFENLKKLEVNKSSKSIKNFENRHLFRKGEV  320



>emb|CDY14059.1| BnaC02g01760D [Brassica napus]
Length=368

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/278 (45%), Positives = 176/278 (63%), Gaps = 6/278 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+E GW   H+Y ++GFW  S+ +   +  QKHF+   +D+++ T+PK GTTWLKAL 
Sbjct  61    SLPKERGWRTRHLYLFQGFWCQSKEIQAIMSFQKHFKPLQNDVVIATIPKSGTTWLKALT  120

Query  409   FALTTRKQF-PV-SQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLP  579
             + L  R +F PV S   HPLLT++P +L+  +E+  Y+    PD        R  +TH+P
Sbjct  121   YTLLNRHRFDPVFSTTDHPLLTSNPHDLVPFLEYKLYANGDVPDL-FGLASPRTFATHVP  179

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
                L  S+ +   K++ +CRN  DT +S WH+ N +++E   +  +   E FD YCRG  
Sbjct  180   FGSLKDSIEKPGVKVVYLCRNPFDTFISSWHYTNSIKSE--SVNPVSLDEGFDMYCRGLI  237

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
              FGPFW+H+L YWKESL+ P KVLFL+YE++K++ E  L+++A FL  PF+EEEE  G+V
Sbjct  238   GFGPFWEHMLAYWKESLKRPDKVLFLRYEDLKQDIESNLKKLASFLAVPFTEEEERKGIV  297

Query  940   ggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
               I  LCSFESL  LEVNK G++     N   FRKG+V
Sbjct  298   KAIVELCSFESLKKLEVNKAGQSIKNFENRHLFRKGEV  335



>gb|AAC63112.1| steroid sulfotransferase 2 [Brassica napus]
Length=324

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 133/310 (43%), Positives = 182/310 (59%), Gaps = 26/310 (8%)
 Frame = +1

Query  145   NTSNSLPYHKFFQENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRC  324
             ++S+S+P   + ++ +  ++ ++ I  SSLP E+GWL   MY ++G W     L G L C
Sbjct  2     SSSSSVP--DYLRDENLTQKTKDLI--SSLPSEKGWLVCQMYQFQGRWHTQALLQGILTC  57

Query  325   QKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQFPVSQ-------QTHPLLTTSPQE  483
             QKHF+A+ SDII+ T PK GTTWLKALVFAL  R +FPV         Q+  L+    + 
Sbjct  58    QKHFEAKDSDIILVTNPKSGTTWLKALVFALINRHKFPVYSVIILSCYQSALLVPFLGRS  117

Query  484   LIRNMEFSYSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVS  663
             L+R+ +F +S+  SP         R+++TH+    LP+SV  S CK++  CRN KD  VS
Sbjct  118   LLRSPDFDFSQLSSP---------RLMNTHISHLSLPESVKSSSCKIVYCCRNPKDMFVS  168

Query  664   YWHFMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKY  843
              WHF  KL  E       P  +  + +C+G  + GPFWDHVL YW  SLENP KVLF+ Y
Sbjct  169   LWHFGKKLAPEETA--DYPIEKAVEAFCQGKFIGGPFWDHVLEYWYASLENPNKVLFVSY  226

Query  844   eeikeepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERP  1023
             EE K++    ++RIA FLGC           V  I +LCSFESLS+LEVN+ GK      
Sbjct  227   EEPKKKTGETIKRIAEFLGCGL----VGEEEVRAIVKLCSFESLSSLEVNREGKLPSGME  282

Query  1024  NNVYFRKGKV  1053
                +FRKG+V
Sbjct  283   TRAFFRKGEV  292



>ref|XP_008777578.1| PREDICTED: flavonol 4'-sulfotransferase-like [Phoenix dactylifera]
Length=351

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/278 (46%), Positives = 182/278 (65%), Gaps = 7/278 (3%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             S+LP EEGW       ++GFW+    L G +  Q++F+A+  D+ V + PK GTTWLKAL
Sbjct  35    SALPLEEGWAPVRTRKFQGFWIPEPVLPGIMDMQQNFKARPDDLFVLSYPKSGTTWLKAL  94

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTHLPLE  585
              +A+ TR Q+P     HPLL  +P + +  M+ +Y++  + +     +  R+L+THLP  
Sbjct  95    TYAIMTRTQYPFDH--HPLLGQNPHDCVPFMDRTYAKGQASELDAMPSP-RILNTHLPYP  151

Query  586   LLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMF  765
             LLP S+    CK+I VCR+ KD +VS W+F N++R  L  LE IPF + F+ +C G+  +
Sbjct  152   LLPDSIKSLCCKVIYVCRDPKDVLVSRWYFSNRMR--LQTLEPIPFTKAFEMFCEGSCPY  209

Query  766   GPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvgg  945
             G  W+HVL YW+ES   P KVLFLKYE+I E+P   + R+A F+GCPFS EEE+ GVV  
Sbjct  210   GSVWEHVLEYWEESQRRPEKVLFLKYEDILEDPLRSVLRLAEFMGCPFSPEEEKEGVVEE  269

Query  946   ISRLCSFESLSNLEVNKTGKTYHERP--NNVYFRKGKV  1053
             + +LCSF++L +LEVNKTGK + + P  N+ YFRKG+ 
Sbjct  270   VIKLCSFDNLKSLEVNKTGKLHPDFPLTNDSYFRKGEA  307



>gb|KCW80590.1| hypothetical protein EUGRSUZ_C01951 [Eucalyptus grandis]
Length=297

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/247 (51%), Positives = 169/247 (68%), Gaps = 5/247 (2%)
 Frame = +1

Query  322   CQKHFQAQHSDIIVCTLPKCGTTWLKALVFALTTRKQF--PVSQQTHPLLTTSPQELIRN  495
             CQKHFQA + DII+ T PK GTTWLKA++FAL    ++  P S++ HPL T +P +L+  
Sbjct  23    CQKHFQAHNFDIILVTSPKFGTTWLKAILFALLNHAKYSDPNSERCHPLQTRNPHDLVPY  82

Query  496   MEFS-YSREISPDFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWH  672
             +EF  Y ++  PD     +  R L+THLP   LP+S  +S CKL+ +CRN KD  +S WH
Sbjct  83    LEFQLYLQQEDPDHTTFASP-RFLATHLPYSSLPQSTGDSNCKLVYLCRNPKDNFISLWH  141

Query  673   FMNKLRAELLGLEAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeei  852
             F  K+  +  G    P PE  D++C+G SM+GP WDHVLGY K SLE P KVLF+KYEE+
Sbjct  142   FTKKMMLKENG-NQTPLPECLDKFCQGLSMYGPHWDHVLGYHKMSLEMPEKVLFMKYEEM  200

Query  853   keepeveLRRIAGFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNV  1032
             KE+P V +RR+A F+GCPFSEEE  GG + GI R+CSF++LS LEVNK+G  +    N  
Sbjct  201   KEDPCVHVRRLADFVGCPFSEEELRGGTLEGILRMCSFDNLSTLEVNKSGSRWTRVENKS  260

Query  1033  YFRKGKV  1053
             +FR+G+V
Sbjct  261   FFRRGEV  267



>ref|XP_011020446.1| PREDICTED: cytosolic sulfotransferase 15-like [Populus euphratica]
Length=330

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/277 (45%), Positives = 178/277 (64%), Gaps = 6/277 (2%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SSLP+E+ W   ++Y Y+GFW   + +   +  QKHF+AQ +D I+ T+PK GTTWLKAL
Sbjct  25    SSLPKEKSWQSGYVYRYQGFWCPEKQIPALIAFQKHFRAQKTDTILVTMPKSGTTWLKAL  84

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHLPL  582
              F++  R ++  S    PL + +P +L+   EF  Y+    PD     +  R+ +TH+P 
Sbjct  85    AFSIMNRAKYTPS--CSPLNSVNPHDLVPFFEFGLYANNQIPDLSTFQSP-RMFATHVPY  141

Query  583   ELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASM  762
               +  S+  S C+++ +CRN  D  +S WHF++K R E  GL  +   E FD +C G   
Sbjct  142   PSISDSIKNSGCRIVYLCRNPFDNFISSWHFLSKTRPE--GLGPLLLEEAFDSFCNGHGG  199

Query  763   FGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvg  942
             FGPF+DHVLGYW+ESLE P +VLFL YEE+KE+   +++R+A FLGCPFS EEE  G+V 
Sbjct  200   FGPFFDHVLGYWRESLERPEEVLFLTYEEMKEDINYQMKRLAEFLGCPFSLEEEADGIVE  259

Query  943   gISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             GIS+LCSF +L + E+NKTGK+     N   FR+G+V
Sbjct  260   GISKLCSFSNLKDKEINKTGKSLLYFENKTLFRRGEV  296



>ref|XP_007133677.1| hypothetical protein PHAVU_011G199800g [Phaseolus vulgaris]
 gb|ESW05671.1| hypothetical protein PHAVU_011G199800g [Phaseolus vulgaris]
Length=326

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 172/278 (62%), Gaps = 6/278 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SL RE G    ++Y ++ FW     + G    QK FQA+H D++V + PK GTTWL AL 
Sbjct  18    SLRRERGLASSYLYLFQEFWCPGIAIEGVKSFQKCFQAKHGDVVVASFPKTGTTWLIALT  77

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGF---RVLSTHLP  579
             FA   R+ F  S + HPLLT++P  L+  +EF    +   D  ++ +     R+ STH P
Sbjct  78    FATVNRQHF--SAENHPLLTSNPHTLVSCLEFKIFCDDIHDPVLHLSNMIEPRLFSTHTP  135

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
                LPKS+ ES  K+I +CRN  DT VS W + NK+R+ +  L A+   E F+ YC G  
Sbjct  136   FTSLPKSLTESNAKIIYICRNPFDTFVSAWTYFNKIRSTM-SLPALELEEAFEMYCNGVV  194

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
              FGP+W H+LG+WKESL  P+KV+FLKYE++ E     +++IA FLGCPF+ EEE  GV+
Sbjct  195   SFGPWWSHMLGFWKESLVRPKKVMFLKYEDLMENVNFHVKKIAEFLGCPFTAEEESDGVI  254

Query  940   ggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
               I +LCSFE + +LEVN +GK      N ++FRKG++
Sbjct  255   ESIIKLCSFEKMKDLEVNISGKLDKIIDNKLFFRKGEI  292



>ref|XP_002873289.1| sulfotransferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49548.1| sulfotransferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/279 (45%), Positives = 180/279 (65%), Gaps = 6/279 (2%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
              SLP+E GW   ++Y ++GFW  ++ +   +  QKHFQ+  +D+++ T+PK GTTWLKAL
Sbjct  48    DSLPKERGWRTRYLYLFQGFWCQAKEIQAIMCFQKHFQSLPNDVVLATIPKSGTTWLKAL  107

Query  406   VFALTTRKQF-PVS-QQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHL  576
              F +  R +F PVS    HPLLT++P +L+   E+  Y+    P      +  R  +TH+
Sbjct  108   TFTILNRHRFDPVSLSSDHPLLTSNPHDLVPFFEYKLYANGDVPKLSSLASP-RTFATHI  166

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P   L  S+ +   K++ +CRN  DT +S WH++N +++E   +  +   E FD YCRG 
Sbjct  167   PFGSLMDSIEKPGVKVVYLCRNPFDTFISSWHYINNIKSE--SVSPVLLDEAFDLYCRGV  224

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
               FGPFW+H+LGYW+ESL+ P KVLFLKYE++KE+ E  L+++A FLG PF+EEEE  GV
Sbjct  225   IGFGPFWEHMLGYWRESLKRPEKVLFLKYEDLKEDTETNLKKLASFLGLPFTEEEERKGV  284

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             V  I+ LCSFE+L  LEVNK+ K+     N   FRKG+V
Sbjct  285   VKAIADLCSFENLKKLEVNKSNKSIKNFENRFLFRKGEV  323



>ref|XP_010936423.1| PREDICTED: flavonol sulfotransferase-like [Elaeis guineensis]
Length=354

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/279 (46%), Positives = 183/279 (66%), Gaps = 7/279 (3%)
 Frame = +1

Query  220   ISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLK  399
             ++S+LP EEGW    +  Y+GFW   + L  ++  Q++F+A+  D+ V + PK GTTWLK
Sbjct  33    LTSTLPLEEGWAI-RLRKYQGFWFPQQILLSSMAMQQNFKARPDDVFVLSHPKSGTTWLK  91

Query  400   ALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTHLP  579
             AL +A+ TR ++P  +  HPLL+ +P E +  M  SYS     +     +  R+L++HLP
Sbjct  92    ALTYAIVTRTKYPFDR--HPLLSQNPHECVPLMGRSYSTGQDSEIEAMPSP-RILNSHLP  148

Query  580   LELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGAS  759
               LLP S+    C+LI VCR+ KD +VS W F N++R+E  G++ IPF + F+ +C G S
Sbjct  149   YSLLPHSIKSLDCQLIYVCRDPKDVLVSRWFFNNRMRSE--GMKPIPFTKAFEMFCEGNS  206

Query  760   MFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvv  939
              +GP W+HVL YW+ES   P KVLFLKYEE+ EEP   ++R+A F+GCPFS EEE+ GVV
Sbjct  207   PYGPLWEHVLEYWEESQRRPDKVLFLKYEEMLEEPMRIVKRLAQFVGCPFSPEEEKEGVV  266

Query  940   ggISRLCSFESLSNLEVNKTGKTYHE-RPNNVYFRKGKV  1053
               + +LCSF+ + +LEVN TGK   E   N+ +FRKG+ 
Sbjct  267   EEVVKLCSFDKMKSLEVNITGKLRPEFVTNDAFFRKGRA  305



>gb|KHN37661.1| Flavonol sulfotransferase-like [Glycine soja]
Length=325

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/281 (44%), Positives = 181/281 (64%), Gaps = 12/281 (4%)
 Frame = +1

Query  229   SLPREEGWLYPH-MYNYKGFWLDSEFLHGALRCQKHFQA-QHSDIIVCTLPKCGTTWLKA  402
             SLP+E+ W  P+ +Y ++ FW     +    R QK+F+A + SD++V + PK GT W+KA
Sbjct  15    SLPKEKPWAQPYDLYLFQNFWCPGIHIQAVNRFQKYFEAVKDSDVVVASFPKSGTIWIKA  74

Query  403   LVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGF--RVLSTHL  576
             L F++    +FP S + HPLLTT+P EL+  +EFS+   I        N    R+  TH 
Sbjct  75    LTFSIANHHRFP-SLENHPLLTTNPHELVPFLEFSFGGNIQDQILHLSNMTEPRIFGTHT  133

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P   LPKS+ ES CKL+ +CR+  D  VS W++ NK++   + L A+   E F++YC G 
Sbjct  134   PFTSLPKSIKESNCKLVYICRDPFDNFVSAWNYFNKVKP--MSLPALTMEEAFEKYCNGI  191

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
               +GP+W H+LGYW ES+ NP KVLFLKYE++KE+    ++RIA FLGCPF+++EE  GV
Sbjct  192   MDYGPWWSHMLGYWNESIANPNKVLFLKYEDLKEDTNFHVKRIAEFLGCPFTQKEESSGV  251

Query  937   vggISRLCSFESLSNLEVNKTGKTYH---ERPNNVYFRKGK  1050
             +  I +LCSFE++ +LEVNK+GK      E+ +  +FRKG+
Sbjct  252   IQSIIKLCSFENMKDLEVNKSGKIGRGGIEKKD--FFRKGE  290



>ref|XP_003542828.1| PREDICTED: cytosolic sulfotransferase 15-like [Glycine max]
Length=328

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 124/281 (44%), Positives = 181/281 (64%), Gaps = 12/281 (4%)
 Frame = +1

Query  229   SLPREEGWLYPH-MYNYKGFWLDSEFLHGALRCQKHFQA-QHSDIIVCTLPKCGTTWLKA  402
             SLP+E+ W  P+ +Y ++ FW     +    R QK+F+A + SD++V + PK GT W+KA
Sbjct  18    SLPKEKPWAQPYDLYLFQNFWCPGIHIQAVNRFQKYFEAVKDSDVVVASFPKSGTIWIKA  77

Query  403   LVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGF--RVLSTHL  576
             L F++    +FP S + HPLLTT+P EL+  +EFS+   I        N    R+  TH 
Sbjct  78    LTFSIANHHRFP-SLENHPLLTTNPHELVPFLEFSFGGNIQDQILHLSNMTEPRIFGTHT  136

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P   LPKS+ ES CKL+ +CR+  D  VS W++ NK++   + L A+   E F++YC G 
Sbjct  137   PFTSLPKSIKESNCKLVYICRDPFDNFVSAWNYFNKVKP--MSLPALTMEEAFEKYCNGI  194

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
               +GP+W H+LGYW ES+ NP KVLFLKYE++KE+    ++RIA FLGCPF+++EE  GV
Sbjct  195   MDYGPWWSHMLGYWNESIANPNKVLFLKYEDLKEDTNFHVKRIAEFLGCPFTQKEESSGV  254

Query  937   vggISRLCSFESLSNLEVNKTGKTYH---ERPNNVYFRKGK  1050
             +  I +LCSFE++ +LEVNK+GK      E+ +  +FRKG+
Sbjct  255   IQSIIKLCSFENMKDLEVNKSGKIGRGGIEKKD--FFRKGE  293



>ref|NP_190094.1| cytosolic sulfotransferase 6 [Arabidopsis thaliana]
 sp|Q9M1V1.1|SOT6_ARATH RecName: Full=Cytosolic sulfotransferase 6; Short=AtSOT6; AltName: 
Full=sulfotransferase 3b; Short=AtST3b [Arabidopsis thaliana]
 emb|CAB72146.1| sulfotransferase-like protein [Arabidopsis thaliana]
 gb|AAT70444.1| At3g45080 [Arabidopsis thaliana]
 gb|AAU45228.1| At3g45080 [Arabidopsis thaliana]
 gb|AEE77989.1| sulfotransferase 6 [Arabidopsis thaliana]
Length=329

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 180/278 (65%), Gaps = 4/278 (1%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SSLP ++     ++  Y+G W     L G L  QK+F+ Q +DIIV + PKCGTTWLKAL
Sbjct  24    SSLPSDKNSTGVNVCKYQGCWYTPPILQGVLNFQKNFKPQDTDIIVASFPKCGTTWLKAL  83

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNME-FSYSREISPDFPMNGNGFRVLSTHLPL  582
              FAL  R + P     HPLL+ +P  L  ++E + Y    +PD     +  R+ STH+P 
Sbjct  84    TFALVRRSKHPSHDDHHPLLSDNPHVLSPSLEMYLYLCSENPDLTKFSSSSRLFSTHMPS  143

Query  583   ELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASM  762
               L + +  S CK++ + RN KDT+VSYWHF  K + +   + ++   +TF+ +CRG + 
Sbjct  144   HTLQEGLKGSTCKIVYMSRNVKDTLVSYWHFFCKKQTDDNIISSVE--DTFEMFCRGVNF  201

Query  763   FGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvg  942
             FGPFWDHVL YW+ SLE+P  VLF+K+EE+KEEP  +++R+A FLGC F++EEEE G+V 
Sbjct  202   FGPFWDHVLSYWRGSLEDPNHVLFMKFEEMKEEPREQIKRLAEFLGCLFTKEEEESGLVD  261

Query  943   gISRLCSFESLSNLEVNKTGKTYHE-RPNNVYFRKGKV  1053
              I  LCS  +LS+LE+NKTGK +   R N  +FRKG+V
Sbjct  262   EIIDLCSLRNLSSLEINKTGKLHSTGRENKTFFRKGEV  299



>ref|XP_004307199.1| PREDICTED: cytosolic sulfotransferase 15-like [Fragaria vesca 
subsp. vesca]
Length=329

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 125/279 (45%), Positives = 176/279 (63%), Gaps = 13/279 (5%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLP+E+GW   H Y ++GFW  +  +   +  Q HFQA  SD+++ ++PK GTTWLKAL 
Sbjct  26    SLPKEKGWRTLHQYQFQGFWCQAAEIQSIMAFQNHFQASDSDVVLASIPKSGTTWLKALA  85

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPD---FPMNGNGFRVLSTHL  576
             FA+  R +F +  ++HPLLT++P  L+  +E++ Y+    PD   FP      R+  TH+
Sbjct  86    FAVVNRHRFDI--KSHPLLTSNPHHLVPFLEYNLYADNQLPDLSKFPEP----RLFGTHV  139

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P   L  ++ +S CK++ +CRN  DT VS WHF+NK + +      +   E FD YC+G 
Sbjct  140   PYPSL-GTIKKSNCKIVYICRNPFDTFVSTWHFINKGKPQ--SQAPMLLEEAFDMYCKGI  196

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
               FGPFW+H+LGYWKESL  P KVLFLKYE++KE+    L+R+A FL  PF+ EEE  GV
Sbjct  197   IGFGPFWEHMLGYWKESLNRPDKVLFLKYEDMKEDGAFHLKRLAKFLEYPFTLEEERNGV  256

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +  I +LCSFE++  LEVNK+G       N   FRK +V
Sbjct  257   IQDIEKLCSFETMKKLEVNKSGMFVKNFENKSLFRKAEV  295



>ref|XP_008807420.1| PREDICTED: flavonol sulfotransferase-like [Phoenix dactylifera]
Length=356

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 129/283 (46%), Positives = 174/283 (61%), Gaps = 11/283 (4%)
 Frame = +1

Query  214   SIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTW  393
             S + S+LP ++GW    +  Y+GFW+    L G +  Q+HF+A HSD+ + + PK GTTW
Sbjct  36    SDLISTLPLDKGWEPYLLRKYQGFWIAEYILPGIIALQQHFKACHSDLFLMSYPKSGTTW  95

Query  394   LKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTH  573
             LKAL FA   R ++  +   HPLL+ +P + I  ++  ++ +I  D P      R+L +H
Sbjct  96    LKALAFATINRNRYQFAD--HPLLSHNPHDCIPLIDIDFASKIK-DTPSP----RILQSH  148

Query  574   LPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRG  753
              P  LLP S+  S C++I V R+ KD  VS W F N+LR    GLE IPF + F+ +C G
Sbjct  149   APYSLLPDSIKASDCRIIYVFRDAKDVFVSDWFFFNRLRRSN-GLEPIPFGKAFELFCEG  207

Query  754   ASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeegg  933
                +GP WDHVL YW+ESL  P KVLFL YEE+  +P   ++R+A F+GCPFS +EE+ G
Sbjct  208   VCSYGPIWDHVLEYWEESLRRPEKVLFLNYEEMLADPAGNVKRLAKFMGCPFSTDEEKEG  267

Query  934   vvggISRLCSFESLSNLEVNKTGKTYHER---PNNVYFRKGKV  1053
             VV  I RLCSFE L NLEVNK  K         N  YFRKG+V
Sbjct  268   VVEQIVRLCSFEKLKNLEVNKRSKFVLPNVKFDNESYFRKGEV  310



>gb|AES68675.2| sulfotransferase [Medicago truncatula]
Length=340

 Score =   221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/277 (43%), Positives = 170/277 (61%), Gaps = 5/277 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLPRE+GW  P++Y ++GFW     +      QKHFQA+ SD+ V T+PK GTTWLKAL 
Sbjct  34    SLPREKGWRTPYIYLFQGFWCQPAEIQAITTFQKHFQAKESDVFVATVPKSGTTWLKALT  93

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSY--SREISPDFPMNGNGFRVLSTHLPL  582
             +A+  R+   +S + HPLL+ +P +L+  +E++     +  PD        R+  TH+P 
Sbjct  94    YAIMNRQNHFISSKNHPLLSFNPHDLVPFIEYTVYGKHDTIPDLSKIHEP-RLFGTHIPF  152

Query  583   ELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASM  762
             + L  S+  S CK++ +CRN  DT +S W F NK++     L  +   E F+ YC G   
Sbjct  153   DSLSNSIKGSNCKIVYICRNPFDTFISSWTFANKIKPP--SLPTLNLEEAFEMYCNGLVG  210

Query  763   FGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvg  942
             FGPFW+H+LGYW ES E P+ VLFLKYE++KE+ +  L+++A FL  PF+ EEE  GV+ 
Sbjct  211   FGPFWNHMLGYWNESKERPKNVLFLKYEDMKEDLKFHLKKMAEFLDRPFTLEEESEGVIE  270

Query  943   gISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              I +LCSFE +  LE+N TG       N   FRKG+V
Sbjct  271   NIIKLCSFEKMKGLEINNTGTFGRNFENKFLFRKGEV  307



>ref|XP_003598424.1| Sulfotransferase [Medicago truncatula]
Length=329

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/277 (43%), Positives = 170/277 (61%), Gaps = 5/277 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLPRE+GW  P++Y ++GFW     +      QKHFQA+ SD+ V T+PK GTTWLKAL 
Sbjct  23    SLPREKGWRTPYIYLFQGFWCQPAEIQAITTFQKHFQAKESDVFVATVPKSGTTWLKALT  82

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSY--SREISPDFPMNGNGFRVLSTHLPL  582
             +A+  R+   +S + HPLL+ +P +L+  +E++     +  PD        R+  TH+P 
Sbjct  83    YAIMNRQNHFISSKNHPLLSFNPHDLVPFIEYTVYGKHDTIPDLSKIHEP-RLFGTHIPF  141

Query  583   ELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASM  762
             + L  S+  S CK++ +CRN  DT +S W F NK++     L  +   E F+ YC G   
Sbjct  142   DSLSNSIKGSNCKIVYICRNPFDTFISSWTFANKIKPP--SLPTLNLEEAFEMYCNGLVG  199

Query  763   FGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvg  942
             FGPFW+H+LGYW ES E P+ VLFLKYE++KE+ +  L+++A FL  PF+ EEE  GV+ 
Sbjct  200   FGPFWNHMLGYWNESKERPKNVLFLKYEDMKEDLKFHLKKMAEFLDRPFTLEEESEGVIE  259

Query  943   gISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              I +LCSFE +  LE+N TG       N   FRKG+V
Sbjct  260   NIIKLCSFEKMKGLEINNTGTFGRNFENKFLFRKGEV  296



>ref|XP_006385956.1| hypothetical protein POPTR_0003s18770g [Populus trichocarpa]
 gb|ERP63753.1| hypothetical protein POPTR_0003s18770g [Populus trichocarpa]
Length=330

 Score =   220 bits (561),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 134/283 (47%), Positives = 181/283 (64%), Gaps = 12/283 (4%)
 Frame = +1

Query  220   ISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLK  399
             + +S P E+ W    +Y YKG W     + GAL  Q+HF AQ +DII+ ++PK GTTWLK
Sbjct  21    LVASFPSEKNWDGAPLYFYKGVWYPVFAIRGALSFQQHFIAQDTDIILASMPKSGTTWLK  80

Query  400   ALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHL  576
             AL F++  R  +  S +  PLLTT P EL+R  E   YS+   PD     +  R+ S+H 
Sbjct  81    ALTFSVVNRNIY--SPKESPLLTTPPHELVRFFEMDLYSKNQPPDLKQLPSP-RIFSSHS  137

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLG-LEAIPFPETFDRYCRG  753
                 LP+S+ +S CK++ +CRN  D +VSY+HF  K + E +  L +I   E FD  C G
Sbjct  138   HYGTLPQSIRDSGCKIVYICRNPLDQLVSYFHFARKFKRENVKPLSSID--EGFDNVCLG  195

Query  754   ASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeegg  933
                +GPFWD VLGYWK SLE P KVLFLKYEE+KE+    L+++A FLG PFSE+EE+ G
Sbjct  196   IQSYGPFWDSVLGYWKASLERPDKVLFLKYEELKEDITFNLKKLAEFLGLPFSEKEEKEG  255

Query  934   vvggISRLCSFESLSNLEVNKTGKTYHER---PNNVYFRKGKV  1053
             V+  IS+LCSF++L +LEVN+TG  + E    PN+ +FRK KV
Sbjct  256   VIEEISKLCSFDNLKDLEVNRTG--FFESAGAPNSTFFRKAKV  296



>ref|XP_010523511.1| PREDICTED: cytosolic sulfotransferase 5-like [Tarenaya hassleriana]
Length=326

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 188/295 (64%), Gaps = 7/295 (2%)
 Frame = +1

Query  175   FFQENSWPKELRESIISSSLPREEGWLYPH-MYNYKGFWLDSEFLHGALRCQKHFQAQHS  351
             F ++++  +E +  I  SSLP ++ +L  + + NYKGFW     L G L  + HF+ + +
Sbjct  6     FMKDDNITQECKNLI--SSLPLDKDFLGKNNLCNYKGFWYHYNTLQGILNVENHFRPRDT  63

Query  352   DIIVCTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISP  528
             DIIV + PK GTTWLKAL FAL  R ++  + + HPLL+ +P  L+  +E   Y    +P
Sbjct  64    DIIVASFPKTGTTWLKALTFALVERGKYNANPENHPLLSQNPHILVPFLEVDLYLERQNP  123

Query  529   DFPMNGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGL  708
             D   +G+  ++  TH+P  +L +SV +S CK++ V RN KD +VS W F NK       +
Sbjct  124   DLTNHGSPRKMFGTHVPFFMLQESVKDSPCKIVYVSRNLKDAIVSDWIFRNKYMKS--AM  181

Query  709   EAIPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIA  888
                 F   F  +CRG + FGPFWDHVL YWK SLENP+ V+F+KYE++K+EP V+++R+A
Sbjct  182   HGASFEVFFQSFCRGVNFFGPFWDHVLSYWKASLENPKHVIFMKYEDLKKEPRVQIKRLA  241

Query  889   GFLGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
              FL CPF+EEEEE G+V  I +LCS  +LSNLE NKTG   +    + +FRKG+V
Sbjct  242   EFLDCPFTEEEEESGLVDEILKLCSLRNLSNLEANKTGSICNLEFKD-FFRKGEV  295



>ref|XP_007133669.1| hypothetical protein PHAVU_011G199100g [Phaseolus vulgaris]
 gb|ESW05663.1| hypothetical protein PHAVU_011G199100g [Phaseolus vulgaris]
Length=332

 Score =   220 bits (561),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 119/279 (43%), Positives = 178/279 (64%), Gaps = 11/279 (4%)
 Frame = +1

Query  229   SLPREEG-WLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             SLP+E G +  P++  ++ FW  S ++ G +  QKHF A+ +D+ V + PK GTTWLKAL
Sbjct  18    SLPKEMGLFAAPYLNLFQDFWCPSLYVQGVINFQKHFDAKDNDVFVASFPKSGTTWLKAL  77

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPM---NGNGFRVLSTHL  576
              F +    +F  S   HPLL+++P +L+  +EF  S ++ PD  +   N +  RVL+TH+
Sbjct  78    AFVIVNHHRFS-SFDHHPLLSSNPHQLVSGLEFFLSHDL-PDQILSLSNMSEPRVLATHV  135

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             PL  LP+S+ +S CK+I +CRN  DT VS W F  K+ +      A+ F E F++YC G 
Sbjct  136   PLPSLPESITKSNCKIIYICRNPFDTFVSTWEFFTKVSSR-----ALTFEEAFEKYCNGI  190

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
             ++FGP+W H+LGYWKES++ P KVLFLKYE++KE+    ++RIA FL  P + E     V
Sbjct  191   TVFGPWWSHMLGYWKESIDRPNKVLFLKYEDLKEDTVFHVKRIAEFLDSPITREGVSNTV  250

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +  I +LC FE++ +LEVNK+G   +      +FRKG++
Sbjct  251   IENIIKLCRFETMKDLEVNKSGYINNIIEKKHFFRKGEI  289



>ref|XP_006385961.1| hypothetical protein POPTR_0003s18820g [Populus trichocarpa]
 gb|ERP63758.1| hypothetical protein POPTR_0003s18820g [Populus trichocarpa]
Length=330

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 135/292 (46%), Positives = 186/292 (64%), Gaps = 14/292 (5%)
 Frame = +1

Query  199   KELRESI--ISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTL  372
             +EL++ I  + +S P E+ W    +Y YKG W     + GAL  Q+HF AQ +DII+ ++
Sbjct  12    RELKDEIQGLVASFPSEKNWDGAPLYFYKGVWYPVFAIRGALSFQQHFIAQDTDIILASM  71

Query  373   PKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPMNGN  549
             PK GTTWLKAL F++  R  +  S +  PLLTT P EL+R  E   YS+   PD     +
Sbjct  72    PKSGTTWLKALTFSVVNRNIY--SPKESPLLTTPPHELVRFFEMDLYSKNQLPDLKQLPS  129

Query  550   GFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLG-LEAIPFP  726
               R+ S+H     LP+S+ +S CK++ +CRN  D +VSY+HF  K + E +  L +I   
Sbjct  130   P-RIFSSHSHYRTLPQSIRDSGCKIVYICRNPLDQLVSYFHFARKFKRENVKPLSSID--  186

Query  727   ETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCP  906
             E FD  C G   +GPFWD VLGYWK SLE P KVLFLKYE++KE+    L+++A FL  P
Sbjct  187   EGFDNVCLGIQSYGPFWDSVLGYWKASLERPDKVLFLKYEDLKEDITFSLKKLAEFLVLP  246

Query  907   FSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHER---PNNVYFRKGKV  1053
             FSE+EE+ GV+  IS+LCSF++L +LEVN+TG  + E    PN+ +FRK KV
Sbjct  247   FSEKEEKEGVIEEISKLCSFDNLKDLEVNRTG--FFESAGAPNSTFFRKAKV  296



>ref|NP_568177.1| sulfotransferase 2A [Arabidopsis thaliana]
 sp|Q8L5A7.1|SOT15_ARATH RecName: Full=Cytosolic sulfotransferase 15; Short=AtSOT15; AltName: 
Full=Sulfotransferase 2a; Short=AtST2a [Arabidopsis 
thaliana]
 gb|AAM20660.1| steroid sulfotransferase-like protein [Arabidopsis thaliana]
 gb|AAM61557.1| steroid sulfotransferase-like protein [Arabidopsis thaliana]
 gb|AAP68286.1| At5g07010 [Arabidopsis thaliana]
 gb|AED91098.1| sulfotransferase 2A [Arabidopsis thaliana]
Length=359

 Score =   221 bits (563),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 121/279 (43%), Positives = 179/279 (64%), Gaps = 6/279 (2%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
              SLP+E GW   ++Y ++GFW  ++ +   +  QKHFQ+  +D+++ T+PK GTTWLKAL
Sbjct  51    DSLPKERGWRTRYLYLFQGFWCQAKEIQAIMSFQKHFQSLENDVVLATIPKSGTTWLKAL  110

Query  406   VFALTTRKQF-PVSQQT-HPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHL  576
              F +  R +F PV+  T HPL T++P +L+   E+  Y+    PD     +  R  +THL
Sbjct  111   TFTILNRHRFDPVASSTNHPLFTSNPHDLVPFFEYKLYANGDVPDLSGLASP-RTFATHL  169

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P   L +++ +   K++ +CRN  DT +S WH+ N +++E   +  +   + FD YCRG 
Sbjct  170   PFGSLKETIEKPGVKVVYLCRNPFDTFISSWHYTNNIKSE--SVSPVLLDQAFDLYCRGV  227

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
               FGPFW+H+LGYW+ESL+ P KV FL+YE++K++ E  L+R+A FL  PF+EEEE  GV
Sbjct  228   IGFGPFWEHMLGYWRESLKRPEKVFFLRYEDLKDDIETNLKRLATFLELPFTEEEERKGV  287

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             V  I+ LCSFE+L  LEVNK+ K+     N   FRKG+V
Sbjct  288   VKAIAELCSFENLKKLEVNKSNKSIKNFENRFLFRKGEV  326



>ref|XP_008777575.1| PREDICTED: flavonol sulfotransferase-like [Phoenix dactylifera]
Length=357

 Score =   221 bits (562),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 130/277 (47%), Positives = 177/277 (64%), Gaps = 8/277 (3%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
             S+LP EEGW       Y+GFW+    L G L  Q++F+A+  D+ V + PK GTTWLKAL
Sbjct  35    STLPLEEGWAPMRNRKYQGFWIPQRALTGTLDMQQNFKARPDDLWVLSYPKSGTTWLKAL  94

Query  406   VFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTHLPLE  585
              +A+ TR Q+P     HPLL  +P E +  ++ +YSR  +P+     +  R+L+THLP  
Sbjct  95    AYAIMTRAQYPFHH--HPLLRQNPHECVPMVDRTYSRGQAPEIEAMPSP-RILNTHLPCS  151

Query  586   LLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGASMF  765
             LLP ++    CK+I VCR+ KD +VS W+F N LR  L  +E IPF + F+ +C G   +
Sbjct  152   LLPHTIKSLDCKVIYVCRDPKDVLVSLWYFNNGLR--LQSMEPIPFTKAFEMFCEGNCPY  209

Query  766   GPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggvvgg  945
             GP W+HVL YW+ES   P KVLFLKYEE+ EEP   ++R+A F+G PFS EEE+ GVV  
Sbjct  210   GPIWEHVLEYWEESQRRPEKVLFLKYEEMLEEPLRIVKRLAEFMGYPFSPEEEKEGVVEE  269

Query  946   ISRLCSFESLSNLEVNKTGKTYHER---PNNVYFRKG  1047
             +  LCSF+ L++LEVNKTGK         N+ +FRKG
Sbjct  270   VIELCSFDKLTSLEVNKTGKVLLPSIPLTNDSFFRKG  306



>ref|XP_011070271.1| PREDICTED: cytosolic sulfotransferase 5-like [Sesamum indicum]
Length=415

 Score =   223 bits (567),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 132/293 (45%), Positives = 183/293 (62%), Gaps = 11/293 (4%)
 Frame = +1

Query  184   ENSWPKELRESIISSSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIV  363
             +NS   E  E +   +L +   W    +  YKGFWL        L    +F+A+ +D+I+
Sbjct  99    DNSSKDEFLELL--QTLEQRMNWDGQRLVKYKGFWLLQLLFRPMLSAHNNFRAKATDVIL  156

Query  364   CTLPKCGTTWLKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFS-YSREISPDFPM  540
              T+PK GTTWLKAL F++  R  FP+ Q   PLLT++P  L+  +EF+ Y  + +PD   
Sbjct  157   STMPKSGTTWLKALTFSIANRNVFPIDQT--PLLTSTPHMLVPFLEFNVYWGQENPDLE-  213

Query  541   NGNGFRVLSTHLPLELLPKSVWESKCKLICVCRNQKDTVVSYWHFM--NKLRAELLGLEA  714
             N    R+ +TH+P E+LP S+ ES C++I +CRN  D  VS+ HF+  NK+  E    + 
Sbjct  214   NVPCPRIFATHMPFEILPDSIHESDCRIIYICRNPLDQFVSHRHFLLENKIEKEA---DP  270

Query  715   IPFPETFDRYCRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGF  894
             +   E FD +C+G    GPFWDH+LGYW   LENPRKVLFLKYE++KE+   ++++IA F
Sbjct  271   LDIDEAFDMFCQGIHPCGPFWDHMLGYWNAHLENPRKVLFLKYEDLKEDITSQVKKIAEF  330

Query  895   LGCPFSeeeeeggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +G PFS+EEEE G++  IS LCSFESLS L VNKTG       N  +FRKG+V
Sbjct  331   MGFPFSQEEEEQGLIDQISGLCSFESLSKLAVNKTGNINGIVKNTSFFRKGQV  383



>ref|XP_003627955.1| Flavonol sulfotransferase-like protein [Medicago truncatula]
 gb|AET02431.1| sulfotransferase [Medicago truncatula]
Length=389

 Score =   222 bits (565),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 127/279 (46%), Positives = 172/279 (62%), Gaps = 6/279 (2%)
 Frame = +1

Query  229   SLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKALV  408
             SLPRE G    + Y Y GFW  S  +      Q +F A+ SDI+V ++PK GTTWLK L 
Sbjct  37    SLPRENGCDTQYFYFYHGFWCPSTLIQSVNSFQNNFHAKDSDIVVASMPKSGTTWLKGLA  96

Query  409   FALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISP----DFPMNGNGFRVLSTHL  576
             +A+  R+ F   +  HPLL+ +P EL+ + E S +         D P N    R+  TH+
Sbjct  97    YAIVNRQHFTSLENNHPLLSFNPHELVPHFEVSGNNTDGQMPQIDVP-NMVEPRLYGTHM  155

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P   LPKS+ ES CK+I +CRN  DT VSYW F+NKLR +   L  +   E+F+RYC+G 
Sbjct  156   PFPSLPKSIQESNCKIIYICRNPFDTFVSYWTFINKLRLKK-SLTELTLEESFERYCKGI  214

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
               FGPFWD++LGY KES+E P +VLFLKYE++KE+     +RIA F+G PF+EEEE  GV
Sbjct  215   CFFGPFWDNMLGYLKESIERPDRVLFLKYEDLKEDVNFHTKRIAEFVGFPFTEEEENNGV  274

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             +  I +LCSFES+     NK+G    +     +FRKG++
Sbjct  275   IENIIKLCSFESMKESSENKSGTAALKIEREFFFRKGEI  313



>dbj|BAB11159.1| steroid sulfotransferase-like protein [Arabidopsis thaliana]
Length=354

 Score =   221 bits (562),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 121/279 (43%), Positives = 179/279 (64%), Gaps = 6/279 (2%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
              SLP+E GW   ++Y ++GFW  ++ +   +  QKHFQ+  +D+++ T+PK GTTWLKAL
Sbjct  46    DSLPKERGWRTRYLYLFQGFWCQAKEIQAIMSFQKHFQSLENDVVLATIPKSGTTWLKAL  105

Query  406   VFALTTRKQF-PVSQQT-HPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHL  576
              F +  R +F PV+  T HPL T++P +L+   E+  Y+    PD     +  R  +THL
Sbjct  106   TFTILNRHRFDPVASSTNHPLFTSNPHDLVPFFEYKLYANGDVPDLSGLASP-RTFATHL  164

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P   L +++ +   K++ +CRN  DT +S WH+ N +++E   +  +   + FD YCRG 
Sbjct  165   PFGSLKETIEKPGVKVVYLCRNPFDTFISSWHYTNNIKSE--SVSPVLLDQAFDLYCRGV  222

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
               FGPFW+H+LGYW+ESL+ P KV FL+YE++K++ E  L+R+A FL  PF+EEEE  GV
Sbjct  223   IGFGPFWEHMLGYWRESLKRPEKVFFLRYEDLKDDIETNLKRLATFLELPFTEEEERKGV  282

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             V  I+ LCSFE+L  LEVNK+ K+     N   FRKG+V
Sbjct  283   VKAIAELCSFENLKKLEVNKSNKSIKNFENRFLFRKGEV  321



>ref|XP_002519139.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
 gb|EEF43350.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
Length=339

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/283 (45%), Positives = 181/283 (64%), Gaps = 11/283 (4%)
 Frame = +1

Query  220   ISSSLPREEGWLYPHMYNYKGFWLDSEF-LHGALRCQKH-FQAQHSDIIVCTLPKCGTTW  393
             I  +LP+ +GW + H+  YKGFWL S+  + G +  Q H F ++  DI++ T PKCGTTW
Sbjct  32    ILPTLPKSKGWWFDHLLQYKGFWLSSDVAIKGLMFLQDHHFISKPDDIVLATYPKCGTTW  91

Query  394   LKALVFALTTRKQFPVSQQTHPLLTTSPQELIRNMEFSYSREISPDFPMNGNGFRVLSTH  573
             L+AL+FA   R  +  +  THPLLT++PQ+ +  +E    ++  P    N    R+LSTH
Sbjct  92    LRALIFATINRTSYDFA--THPLLTSNPQDFVPFLEGYVFQD--PSVLENLPLPRLLSTH  147

Query  574   LPLELLPKSVWE---SKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRY  744
             LP  L P+S+     S  + + +CR+ KD +VS WHF  KLR +  G       + F+ +
Sbjct  148   LPYSLFPESITAATASGSRFVYICRDPKDVLVSKWHFAQKLRPK--GHPPFSLQDAFEMF  205

Query  745   CRGASMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeee  924
             C G S +GP+WDHVL YWK SLE+PRKVLFLKYE++K EP V ++R+A +LG PFS EE+
Sbjct  206   CDGVSHYGPYWDHVLSYWKASLESPRKVLFLKYEDMKREPLVHVKRLAEYLGKPFSTEEQ  265

Query  925   eggvvggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
               GV   I  LCSF+ +SNLEVNK+  + +   N+ +FRKG++
Sbjct  266   NEGVAEEIIELCSFKKMSNLEVNKSKSSNYLIKNSDFFRKGEI  308



>ref|XP_006289894.1| hypothetical protein CARUB_v10003509mg [Capsella rubella]
 gb|EOA22792.1| hypothetical protein CARUB_v10003509mg [Capsella rubella]
Length=360

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/279 (44%), Positives = 179/279 (64%), Gaps = 6/279 (2%)
 Frame = +1

Query  226   SSLPREEGWLYPHMYNYKGFWLDSEFLHGALRCQKHFQAQHSDIIVCTLPKCGTTWLKAL  405
              SLP+E GW   ++Y ++GFW  ++ +   +  Q+HF+   +D+++ T+PK GTTWLKAL
Sbjct  52    DSLPKERGWRTRYLYLFQGFWCQAKEIQAIMSFQRHFRPFPNDVVLATIPKSGTTWLKAL  111

Query  406   VFALTTRKQF-PVSQQT-HPLLTTSPQELIRNMEFS-YSREISPDFPMNGNGFRVLSTHL  576
              F +  R +F PVS  T HPLLT++P +L+   E+  Y+    PD        R  +TH+
Sbjct  112   TFTILNRHRFDPVSSSTDHPLLTSNPHDLVPFFEYKLYADGAVPDLSGLARP-RAFATHV  170

Query  577   PLELLPKSVWESKCKLICVCRNQKDTVVSYWHFMNKLRAELLGLEAIPFPETFDRYCRGA  756
             P   L  S+ E   K++ +CRN  DT +S WHF+N +++E   +  +   E FD YCRG 
Sbjct  171   PFGSLKDSIEEPGVKVVYLCRNPFDTFISSWHFINNIKSE--SVSPVSLDEGFDLYCRGV  228

Query  757   SMFGPFWDHVLGYWKESLENPRKVLFLKYeeikeepeveLRRIAGFLGCPFSeeeeeggv  936
               FGPFW+H+LGY++ESL+ P KVLFLKYE++KE+ E  L+++A FLG PF+EEEE  GV
Sbjct  229   IGFGPFWEHMLGYYRESLKRPEKVLFLKYEDLKEDIETNLKKLANFLGLPFTEEEERKGV  288

Query  937   vggISRLCSFESLSNLEVNKTGKTYHERPNNVYFRKGKV  1053
             V  I+ LCSF ++  LEVNK+ K+     N   FRKG+V
Sbjct  289   VKAIADLCSFGNMKKLEVNKSKKSIKNFENRFLFRKGEV  327



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2481643531632