BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24932_g1_i1 len=1185 path=[7409:0-551 3287:552-575 7984:576-759
7222:760-776 10490:777-783 865:784-812 9354:813-1184]

Length=1185
                                                                      Score     E

ref|XP_004239453.1|  PREDICTED: cytosolic sulfotransferase 12-like      363   9e-120   
ref|XP_009598362.1|  PREDICTED: cytosolic sulfotransferase 12-like      362   3e-119   
ref|XP_006348794.1|  PREDICTED: cytosolic sulfotransferase 12-like      361   4e-119   
ref|XP_006348649.1|  PREDICTED: cytosolic sulfotransferase 12-like      360   2e-118   
ref|XP_002267209.1|  PREDICTED: cytosolic sulfotransferase 12           352   2e-115   Vitis vinifera
ref|XP_010023658.1|  PREDICTED: cytosolic sulfotransferase 12-like      349   2e-114   
ref|XP_009616636.1|  PREDICTED: cytosolic sulfotransferase 12-like      349   3e-114   
ref|XP_010052979.1|  PREDICTED: cytosolic sulfotransferase 12-like      348   6e-114   
ref|XP_009767933.1|  PREDICTED: cytosolic sulfotransferase 12           346   3e-113   
ref|XP_006348797.1|  PREDICTED: cytosolic sulfotransferase 12-like      345   9e-113   
ref|XP_004247253.1|  PREDICTED: cytosolic sulfotransferase 12-like      345   1e-112   
ref|XP_006348647.1|  PREDICTED: cytosolic sulfotransferase 12-like      345   1e-112   
ref|XP_011070903.1|  PREDICTED: cytosolic sulfotransferase 12-like      345   2e-112   
gb|KDO70277.1|  hypothetical protein CISIN_1g019700mg                   342   9e-112   
ref|XP_006484253.1|  PREDICTED: cytosolic sulfotransferase 12-like      342   1e-111   
ref|XP_009620813.1|  PREDICTED: cytosolic sulfotransferase 12-lik...    342   4e-111   
ref|XP_006348796.1|  PREDICTED: cytosolic sulfotransferase 12-like      341   4e-111   
ref|XP_004239020.1|  PREDICTED: cytosolic sulfotransferase 12-like      341   4e-111   
ref|XP_009620812.1|  PREDICTED: cytosolic sulfotransferase 12-lik...    342   4e-111   
ref|XP_006348798.1|  PREDICTED: cytosolic sulfotransferase 12-like      340   4e-111   
ref|XP_006437857.1|  hypothetical protein CICLE_v10031848mg             341   1e-110   
ref|XP_010039273.1|  PREDICTED: cytosolic sulfotransferase 5-like       339   2e-110   
ref|XP_008352940.1|  PREDICTED: cytosolic sulfotransferase 12-like      339   2e-110   
ref|XP_003628738.1|  Flavonol sulfotransferase-like protein             338   3e-110   
ref|XP_011102114.1|  PREDICTED: cytosolic sulfotransferase 12-like      337   7e-110   
ref|XP_011102095.1|  PREDICTED: cytosolic sulfotransferase 12-like      337   1e-109   
ref|XP_006378523.1|  sulfotransferase family protein                    336   1e-109   
ref|XP_007045763.1|  Flavonol 4'-sulfotransferase, putative             338   2e-109   
ref|XP_011009587.1|  PREDICTED: cytosolic sulfotransferase 12-like      334   1e-108   
ref|XP_006339391.1|  PREDICTED: cytosolic sulfotransferase 12-like      333   3e-108   
ref|XP_002512030.1|  Flavonol 4'-sulfotransferase, putative             333   7e-108   Ricinus communis
emb|CDP00476.1|  unnamed protein product                                332   7e-108   
ref|XP_004239455.1|  PREDICTED: cytosolic sulfotransferase 12-like      332   9e-108   
ref|XP_008339764.1|  PREDICTED: cytosolic sulfotransferase 12-like      332   1e-107   
ref|XP_010051374.1|  PREDICTED: cytosolic sulfotransferase 5-like       330   3e-107   
ref|XP_004240284.1|  PREDICTED: cytosolic sulfotransferase 12-like      330   3e-107   
ref|XP_010046610.1|  PREDICTED: cytosolic sulfotransferase 12-like      330   4e-107   
ref|XP_011009569.1|  PREDICTED: cytosolic sulfotransferase 5-like       330   7e-107   
ref|XP_010051322.1|  PREDICTED: cytosolic sulfotransferase 12-like      329   9e-107   
ref|XP_004250849.1|  PREDICTED: cytosolic sulfotransferase 12-like      329   1e-106   
ref|XP_006339394.1|  PREDICTED: cytosolic sulfotransferase 12-like      329   2e-106   
gb|KDP41358.1|  hypothetical protein JCGZ_15765                         328   2e-106   
ref|XP_010051309.1|  PREDICTED: cytosolic sulfotransferase 12-like      328   2e-106   
emb|CDP00475.1|  unnamed protein product                                328   5e-106   
ref|XP_004253506.1|  PREDICTED: cytosolic sulfotransferase 12-like      327   1e-105   
emb|CDP16517.1|  unnamed protein product                                326   3e-105   
ref|XP_010050823.1|  PREDICTED: cytosolic sulfotransferase 13-like      325   5e-105   
ref|XP_007045765.1|  P-loop containing nucleoside triphosphate hy...    324   1e-104   
ref|XP_010044374.1|  PREDICTED: cytosolic sulfotransferase 5-like       324   2e-104   
ref|XP_010050705.1|  PREDICTED: cytosolic sulfotransferase 12-like      323   3e-104   
ref|XP_008339761.1|  PREDICTED: cytosolic sulfotransferase 5-like       322   6e-104   
ref|XP_010681134.1|  PREDICTED: cytosolic sulfotransferase 12-like      320   9e-103   
gb|KEH33293.1|  P-loop nucleoside triphosphate hydrolase superfam...    319   1e-102   
ref|XP_010048649.1|  PREDICTED: cytosolic sulfotransferase 5-like       318   2e-102   
ref|XP_004297203.1|  PREDICTED: cytosolic sulfotransferase 12-like      318   4e-102   
ref|XP_010091629.1|  Flavonol sulfotransferase-like protein             317   5e-102   
ref|XP_006388018.1|  hypothetical protein POPTR_0396s00220g             315   2e-101   
ref|XP_008347825.1|  PREDICTED: cytosolic sulfotransferase 15-like      315   4e-101   
ref|XP_002265137.1|  PREDICTED: cytosolic sulfotransferase 15           315   6e-101   Vitis vinifera
ref|XP_009590910.1|  PREDICTED: cytosolic sulfotransferase 15-like      314   1e-100   
ref|XP_009779416.1|  PREDICTED: cytosolic sulfotransferase 15           314   2e-100   
ref|XP_002538120.1|  Flavonol 4'-sulfotransferase, putative             313   2e-100   Ricinus communis
ref|XP_002268667.1|  PREDICTED: flavonol 3-sulfotransferase             313   4e-100   Vitis vinifera
ref|XP_009370647.1|  PREDICTED: cytosolic sulfotransferase 15-like      313   4e-100   
gb|KEH16899.1|  P-loop nucleoside triphosphate hydrolase superfam...    313   4e-100   
ref|XP_004297202.1|  PREDICTED: cytosolic sulfotransferase 12-like      313   4e-100   
ref|XP_007010821.1|  Sulfotransferase 2A                                313   7e-100   
ref|XP_002304810.1|  sulfotransferase family protein                    311   1e-99    Populus trichocarpa [western balsam poplar]
ref|XP_003530555.2|  PREDICTED: cytosolic sulfotransferase 5-like       312   2e-99    
ref|XP_003628737.1|  Flavonol sulfotransferase-like protein             310   2e-99    
ref|XP_010048648.1|  PREDICTED: cytosolic sulfotransferase 13-like      311   2e-99    
ref|XP_010050715.1|  PREDICTED: cytosolic sulfotransferase 13-like      310   3e-99    
ref|XP_006591672.1|  PREDICTED: cytosolic sulfotransferase 15-like      310   7e-99    
ref|XP_007028479.1|  Sulfotransferase 2A, putative                      310   1e-98    
gb|KHN26485.1|  Flavonol sulfotransferase-like                          309   2e-98    
ref|XP_010523117.1|  PREDICTED: cytosolic sulfotransferase 12-like      308   2e-98    
ref|XP_008231647.1|  PREDICTED: cytosolic sulfotransferase 15-like      308   2e-98    
gb|EYU28890.1|  hypothetical protein MIMGU_mgv1a009426mg                308   4e-98    
ref|XP_010545823.1|  PREDICTED: cytosolic sulfotransferase 5-like       307   4e-98    
gb|EYU26929.1|  hypothetical protein MIMGU_mgv1a009329mg                308   4e-98    
ref|XP_002265863.1|  PREDICTED: cytosolic sulfotransferase 15           307   5e-98    Vitis vinifera
ref|XP_008807420.1|  PREDICTED: flavonol sulfotransferase-like          307   1e-97    
ref|XP_010260931.1|  PREDICTED: cytosolic sulfotransferase 5-like       306   2e-97    
gb|KCW80596.1|  hypothetical protein EUGRSUZ_C01959                     304   2e-97    
ref|XP_010523511.1|  PREDICTED: cytosolic sulfotransferase 5-like       305   3e-97    
ref|XP_010523502.1|  PREDICTED: cytosolic sulfotransferase 11           305   4e-97    
ref|XP_006347852.1|  PREDICTED: cytosolic sulfotransferase 15-like      305   4e-97    
ref|XP_010048646.1|  PREDICTED: cytosolic sulfotransferase 5-like       305   4e-97    
ref|XP_010534326.1|  PREDICTED: cytosolic sulfotransferase 15-like      305   1e-96    
ref|XP_011020444.1|  PREDICTED: cytosolic sulfotransferase 15-like      304   1e-96    
ref|XP_007156373.1|  hypothetical protein PHAVU_003G280800g             304   1e-96    
ref|XP_010044375.1|  PREDICTED: cytosolic sulfotransferase 5-like       304   1e-96    
gb|KDP40565.1|  hypothetical protein JCGZ_24564                         304   1e-96    
ref|XP_010554271.1|  PREDICTED: cytosolic sulfotransferase 11-like      303   1e-96    
ref|XP_010916164.1|  PREDICTED: cytosolic sulfotransferase 12-like      303   2e-96    
emb|CDP14958.1|  unnamed protein product                                301   8e-96    
ref|XP_010087683.1|  Flavonol sulfotransferase-like protein             301   1e-95    
ref|XP_006440813.1|  hypothetical protein CICLE_v10020894mg             301   2e-95    
ref|XP_010514146.1|  PREDICTED: cytosolic sulfotransferase 12-like      300   3e-95    
ref|XP_006440811.1|  hypothetical protein CICLE_v10023927mg             301   4e-95    
ref|XP_010523510.1|  PREDICTED: cytosolic sulfotransferase 11-like      300   5e-95    
ref|XP_007034897.1|  Flavonol 3-sulfotransferase, putative              300   6e-95    
gb|KDO65656.1|  hypothetical protein CISIN_1g041950mg                   298   8e-95    
ref|XP_010095979.1|  Flavonol sulfotransferase-like protein             299   8e-95    
ref|XP_010031022.1|  PREDICTED: cytosolic sulfotransferase 15-like      299   1e-94    
emb|CDP07173.1|  unnamed protein product                                298   1e-94    
ref|XP_011006876.1|  PREDICTED: flavonol 3-sulfotransferase-like        298   1e-94    
ref|XP_006477735.1|  PREDICTED: cytosolic sulfotransferase 16-like      300   2e-94    
ref|XP_008779205.1|  PREDICTED: flavonol sulfotransferase-like          298   2e-94    
ref|XP_009129071.1|  PREDICTED: cytosolic sulfotransferase 12-lik...    298   2e-94    
ref|XP_010523501.1|  PREDICTED: cytosolic sulfotransferase 12-like      298   2e-94    
ref|XP_009130975.1|  PREDICTED: cytosolic sulfotransferase 15-like      298   3e-94    
ref|XP_006385980.1|  hypothetical protein POPTR_0003s19280g             297   4e-94    
ref|XP_009114137.1|  PREDICTED: cytosolic sulfotransferase 12           297   4e-94    
emb|CDY22189.1|  BnaC01g39120D                                          297   4e-94    
emb|CDP19484.1|  unnamed protein product                                296   6e-94    
ref|XP_006399179.1|  hypothetical protein EUTSA_v10015302mg             298   6e-94    
ref|XP_009123345.1|  PREDICTED: cytosolic sulfotransferase 11-like      297   7e-94    
ref|XP_010670538.1|  PREDICTED: cytosolic sulfotransferase 15-like      297   8e-94    
gb|AAC63113.1|  steroid sulfotransferase 3                              296   9e-94    Brassica napus [oilseed rape]
ref|XP_010050960.1|  PREDICTED: cytosolic sulfotransferase 5-like       296   1e-93    
ref|XP_003542798.1|  PREDICTED: cytosolic sulfotransferase 15-like      296   1e-93    
ref|XP_002514611.1|  Flavonol 3-sulfotransferase, putative              296   1e-93    Ricinus communis
ref|XP_010906702.1|  PREDICTED: flavonol 3-sulfotransferase-like        296   2e-93    
ref|XP_010272754.1|  PREDICTED: flavonol sulfotransferase-like          295   3e-93    
gb|KDO65654.1|  hypothetical protein CISIN_1g018736mg                   295   3e-93    
ref|XP_006388004.1|  hypothetical protein POPTR_0412s00210g             295   3e-93    
ref|XP_011047829.1|  PREDICTED: flavonol sulfotransferase-like          295   4e-93    
gb|KCW80972.1|  hypothetical protein EUGRSUZ_C02337                     297   4e-93    
ref|XP_009336551.1|  PREDICTED: flavonol 4'-sulfotransferase-like       296   5e-93    
ref|XP_010521619.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic su...    294   5e-93    
ref|XP_004307199.1|  PREDICTED: cytosolic sulfotransferase 15-like      294   6e-93    
ref|XP_009114139.1|  PREDICTED: cytosolic sulfotransferase 12-like      294   6e-93    
emb|CDY54154.1|  BnaA09g53490D                                          294   6e-93    
ref|XP_002314916.2|  hypothetical protein POPTR_0010s14820g             294   7e-93    Populus trichocarpa [western balsam poplar]
emb|CDY49688.1|  BnaA02g27270D                                          294   7e-93    
emb|CDY05012.1|  BnaAnng01940D                                          295   8e-93    
ref|XP_009125671.1|  PREDICTED: cytosolic sulfotransferase 15-like      295   9e-93    
ref|XP_009336546.1|  PREDICTED: flavonol sulfotransferase-like          296   9e-93    
gb|KHN21542.1|  Flavonol sulfotransferase-like                          293   1e-92    
ref|XP_009129073.1|  PREDICTED: cytosolic sulfotransferase 12-lik...    293   1e-92    
ref|XP_010520091.1|  PREDICTED: cytosolic sulfotransferase 15-like      294   1e-92    
gb|AAR14296.1|  steroid sulfotransferase 4                              293   1e-92    Brassica napus [oilseed rape]
ref|XP_006385979.1|  hypothetical protein POPTR_0003s19250g             293   2e-92    
emb|CDY60367.1|  BnaA09g54440D                                          293   2e-92    
ref|XP_003599784.1|  Flavonol sulfotransferase-like protein             294   2e-92    
ref|XP_010425175.1|  PREDICTED: cytosolic sulfotransferase 12-like      293   2e-92    
gb|AFK43741.1|  unknown                                                 293   3e-92    
emb|CDY14059.1|  BnaC02g01760D                                          293   3e-92    
emb|CDY58879.1|  BnaA03g55570D                                          293   3e-92    
ref|XP_009122389.1|  PREDICTED: cytosolic sulfotransferase 15-like      293   3e-92    
ref|XP_006291483.1|  hypothetical protein CARUB_v10017618mg             292   4e-92    
ref|XP_010939140.1|  PREDICTED: flavonol 3-sulfotransferase-like        293   4e-92    
ref|NP_568177.1|  sulfotransferase 2A                                   293   4e-92    Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11159.1|  steroid sulfotransferase-like protein                  293   5e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011020446.1|  PREDICTED: cytosolic sulfotransferase 15-like      292   5e-92    
gb|KFK25092.1|  hypothetical protein AALP_AA8G065200                    292   6e-92    
gb|ADX97329.1|  sulfotransferase-like protein                           292   6e-92    
ref|XP_008777577.1|  PREDICTED: cytosolic sulfotransferase 12-like      292   7e-92    
ref|XP_007218724.1|  hypothetical protein PRUPE_ppa009048mg             290   7e-92    
gb|KDP44527.1|  hypothetical protein JCGZ_16360                         291   8e-92    
ref|XP_006465789.1|  PREDICTED: cytosolic sulfotransferase 15-like      291   9e-92    
gb|AAC63111.1|  steroid sulfotransferase 1                              291   1e-91    Brassica napus [oilseed rape]
gb|KDO44381.1|  hypothetical protein CISIN_1g019118mg                   291   1e-91    
ref|XP_009142142.1|  PREDICTED: cytosolic sulfotransferase 3            291   1e-91    
ref|XP_008243884.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic su...    290   1e-91    
ref|XP_004308399.1|  PREDICTED: cytosolic sulfotransferase 15-like      291   1e-91    
ref|XP_003598424.1|  Sulfotransferase                                   290   2e-91    
gb|AES68675.2|  sulfotransferase                                        291   2e-91    
ref|XP_002873289.1|  sulfotransferase family protein                    291   2e-91    
emb|CDP14620.1|  unnamed protein product                                293   2e-91    
gb|AAL06879.1|  AT5g07010/MOJ9_18                                       291   2e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010518598.1|  PREDICTED: cytosolic sulfotransferase 12           290   3e-91    
ref|XP_010911932.1|  PREDICTED: cytosolic sulfotransferase 7-like       290   3e-91    
emb|CDY45712.1|  BnaC02g35140D                                          290   3e-91    
ref|XP_007208898.1|  hypothetical protein PRUPE_ppa026895mg             289   3e-91    
ref|XP_002272968.2|  PREDICTED: cytosolic sulfotransferase 13-like      290   5e-91    Vitis vinifera
ref|XP_002303947.1|  hypothetical protein POPTR_0003s19270g             289   5e-91    Populus trichocarpa [western balsam poplar]
ref|XP_009339576.1|  PREDICTED: cytosolic sulfotransferase 5-like       289   6e-91    
ref|XP_010452648.1|  PREDICTED: cytosolic sulfotransferase 15           290   7e-91    
ref|XP_010514147.1|  PREDICTED: cytosolic sulfotransferase 13-like      288   7e-91    
ref|XP_006432398.1|  hypothetical protein CICLE_v10003688mg             289   8e-91    
ref|XP_008781218.1|  PREDICTED: cytosolic sulfotransferase 12-like      287   8e-91    
emb|CDX95244.1|  BnaC09g16260D                                          289   8e-91    
ref|XP_008240109.1|  PREDICTED: LOW QUALITY PROTEIN: flavonol sul...    288   8e-91    
ref|XP_008777580.1|  PREDICTED: flavonol sulfotransferase-like          290   9e-91    
ref|XP_010425174.1|  PREDICTED: cytosolic sulfotransferase 12-like      288   1e-90    
ref|NP_190094.1|  cytosolic sulfotransferase 6                          288   1e-90    Arabidopsis thaliana [mouse-ear cress]
emb|CDX81030.1|  BnaC03g02840D                                          289   1e-90    
ref|XP_008240107.1|  PREDICTED: flavonol sulfotransferase-like          288   1e-90    
ref|XP_008785781.1|  PREDICTED: cytosolic sulfotransferase 7-like       288   1e-90    
ref|XP_004514095.1|  PREDICTED: cytosolic sulfotransferase 15-like      288   1e-90    
ref|XP_009621634.1|  PREDICTED: flavonol sulfotransferase-like          288   2e-90    
gb|AAK17133.1|AF325065_1  putative steroid sulfotransferase             288   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289894.1|  hypothetical protein CARUB_v10003509mg             289   2e-90    
ref|XP_008790317.1|  PREDICTED: flavonol 4'-sulfotransferase-like       288   2e-90    
ref|XP_004292840.1|  PREDICTED: cytosolic sulfotransferase 15-like      288   2e-90    
gb|AFK33848.1|  unknown                                                 288   2e-90    
ref|XP_010491300.1|  PREDICTED: cytosolic sulfotransferase 15-like      288   2e-90    
gb|KEH21570.1|  P-loop nucleoside triphosphate hydrolase superfam...    288   2e-90    
ref|NP_565305.1|  cytosolic sulfotransferase 11                         288   4e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011020447.1|  PREDICTED: cytosolic sulfotransferase 15-like      287   4e-90    
emb|CDY55733.1|  BnaAnng13870D                                          295   5e-90    
ref|XP_010534168.1|  PREDICTED: cytosolic sulfotransferase 12-like      286   5e-90    
ref|XP_008779204.1|  PREDICTED: cytosolic sulfotransferase 12-like      285   6e-90    
ref|XP_008393378.1|  PREDICTED: cytosolic sulfotransferase 13-like      286   7e-90    
ref|XP_007037642.1|  Flavonol 4'-sulfotransferase, putative             286   1e-89    
ref|XP_006395675.1|  hypothetical protein EUTSA_v10004585mg             285   1e-89    
ref|XP_002876895.1|  hypothetical protein ARALYDRAFT_484284             285   1e-89    
gb|KFK38089.1|  hypothetical protein AALP_AA3G068100                    285   1e-89    
emb|CDX99017.1|  BnaC09g48180D                                          287   1e-89    
ref|XP_002519139.1|  Flavonol 4'-sulfotransferase, putative             285   2e-89    Ricinus communis
ref|XP_006377316.1|  hypothetical protein POPTR_0011s04810g             285   2e-89    
ref|XP_004514767.1|  PREDICTED: cytosolic sulfotransferase 15-lik...    285   2e-89    
ref|XP_009789859.1|  PREDICTED: flavonol sulfotransferase-like          286   2e-89    
ref|XP_004499637.1|  PREDICTED: cytosolic sulfotransferase 15-like      285   2e-89    
ref|NP_190093.1|  sulfotransferase 5                                    285   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006418637.1|  hypothetical protein EUTSA_v10002851mg             285   3e-89    
ref|XP_010502398.1|  PREDICTED: cytosolic sulfotransferase 12-like      284   3e-89    
gb|KFK33526.1|  hypothetical protein AALP_AA5G024400                    285   4e-89    
ref|XP_002514612.1|  Flavonol 4'-sulfotransferase, putative             285   4e-89    Ricinus communis
ref|XP_003575593.1|  PREDICTED: cytosolic sulfotransferase 5-like       284   5e-89    
ref|XP_002303948.2|  hypothetical protein POPTR_0003s19260g             284   5e-89    Populus trichocarpa [western balsam poplar]
ref|NP_178471.1|  sulphotransferase 12                                  284   6e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004973902.1|  PREDICTED: cytosolic sulfotransferase 5-like       283   6e-89    
ref|XP_010423267.1|  PREDICTED: cytosolic sulfotransferase 15-like      287   6e-89    
gb|KCW80592.1|  hypothetical protein EUGRSUZ_C01953                     282   6e-89    
emb|CDY04166.1|  BnaA09g19440D                                          283   6e-89    
ref|XP_003542828.1|  PREDICTED: cytosolic sulfotransferase 15-like      283   7e-89    
ref|XP_010677191.1|  PREDICTED: flavonol sulfotransferase-like          283   7e-89    
gb|KHN37661.1|  Flavonol sulfotransferase-like                          283   8e-89    
ref|XP_006377321.1|  hypothetical protein POPTR_0011s04870g             283   8e-89    
ref|XP_004291155.1|  PREDICTED: cytosolic sulfotransferase 15-lik...    283   1e-88    
ref|XP_009148006.1|  PREDICTED: cytosolic sulfotransferase 11-like      283   2e-88    
emb|CDY42798.1|  BnaC01g22680D                                          283   2e-88    
ref|XP_009129074.1|  PREDICTED: cytosolic sulfotransferase 12-like      283   2e-88    
ref|XP_008785639.1|  PREDICTED: flavonol sulfotransferase-like          283   2e-88    
ref|XP_009130913.1|  PREDICTED: cytosolic sulfotransferase 1-like...    282   2e-88    
ref|XP_010665242.1|  PREDICTED: cytosolic sulfotransferase 15-like      283   3e-88    
gb|EYU36903.1|  hypothetical protein MIMGU_mgv1a024755mg                282   3e-88    
ref|XP_002317223.1|  sulfotransferase family protein                    282   3e-88    Populus trichocarpa [western balsam poplar]
ref|XP_010430710.1|  PREDICTED: cytosolic sulfotransferase 13           282   3e-88    
ref|XP_011006878.1|  PREDICTED: flavonol sulfotransferase-like          282   3e-88    
ref|XP_011011419.1|  PREDICTED: flavonol sulfotransferase-like          282   3e-88    
emb|CDY42346.1|  BnaA09g15810D                                          282   3e-88    
ref|XP_009113421.1|  PREDICTED: cytosolic sulfotransferase 11-like      282   4e-88    
gb|KCW81757.1|  hypothetical protein EUGRSUZ_C03121                     280   4e-88    
ref|XP_010450178.1|  PREDICTED: cytosolic sulfotransferase 1-like       281   5e-88    
ref|XP_002463161.1|  hypothetical protein SORBIDRAFT_02g038840          282   5e-88    Sorghum bicolor [broomcorn]
ref|XP_009114140.1|  PREDICTED: cytosolic sulfotransferase 12-like      281   6e-88    
gb|EMT06790.1|  Sulfotransferase 17                                     282   7e-88    
ref|XP_006395674.1|  hypothetical protein EUTSA_v10005340mg             280   1e-87    
gb|KEH21569.1|  P-loop nucleoside triphosphate hydrolase superfam...    282   1e-87    
ref|XP_002876896.1|  hypothetical protein ARALYDRAFT_484285             280   1e-87    
ref|XP_002876897.1|  sulfotransferase family protein                    280   1e-87    
ref|XP_003541597.1|  PREDICTED: cytosolic sulfotransferase 15-like      280   2e-87    
ref|XP_008777578.1|  PREDICTED: flavonol 4'-sulfotransferase-like       281   2e-87    
ref|XP_006408668.1|  hypothetical protein EUTSA_v10002041mg             280   2e-87    
emb|CDX89350.1|  BnaA01g15430D                                          279   2e-87    
gb|ADB85371.1|  putative flavonol 3-sulfotransferase                    280   2e-87    Phyllostachys edulis [kikko-chiku]
ref|XP_002264512.1|  PREDICTED: flavonol sulfotransferase-like          280   2e-87    Vitis vinifera
ref|XP_009124814.1|  PREDICTED: cytosolic sulfotransferase 3-like       280   2e-87    
ref|XP_010496748.1|  PREDICTED: cytosolic sulfotransferase 5-like       280   2e-87    
ref|XP_002265783.1|  PREDICTED: cytosolic sulfotransferase 15           280   2e-87    Vitis vinifera
ref|XP_003627983.1|  Flavonol sulfotransferase-like protein             280   2e-87    
ref|XP_004298345.1|  PREDICTED: cytosolic sulfotransferase 5-like       278   2e-87    
emb|CDY58630.1|  BnaC09g52480D                                          290   3e-87    
ref|XP_007133678.1|  hypothetical protein PHAVU_011G199900g             279   3e-87    
ref|XP_009789857.1|  PREDICTED: flavonol sulfotransferase-like          280   4e-87    
ref|XP_006292192.1|  hypothetical protein CARUB_v10018398mg             279   4e-87    
gb|KFK36076.1|  hypothetical protein AALP_AA4G074200                    279   4e-87    
ref|XP_010495506.1|  PREDICTED: cytosolic sulfotransferase 1-like       278   6e-87    
ref|XP_008777575.1|  PREDICTED: flavonol sulfotransferase-like          280   6e-87    
ref|XP_006377315.1|  hypothetical protein POPTR_0011s04790g             279   7e-87    
ref|XP_010476383.1|  PREDICTED: cytosolic sulfotransferase 1-like       278   8e-87    
ref|XP_009130914.1|  PREDICTED: cytosolic sulfotransferase 1-like...    278   9e-87    
ref|XP_002527846.1|  Flavonol 3-sulfotransferase, putative              278   9e-87    Ricinus communis
ref|XP_002525538.1|  Flavonol 4'-sulfotransferase, putative             278   1e-86    Ricinus communis
ref|XP_002264929.1|  PREDICTED: flavonol sulfotransferase-like          278   1e-86    Vitis vinifera
ref|XP_011006879.1|  PREDICTED: cytosolic sulfotransferase 16-like      278   1e-86    
ref|XP_002317222.2|  hypothetical protein POPTR_0011s04820g             278   1e-86    
ref|XP_004514768.1|  PREDICTED: cytosolic sulfotransferase 15-lik...    278   1e-86    
ref|XP_008778400.1|  PREDICTED: flavonol sulfotransferase-like          278   1e-86    
ref|XP_010271910.1|  PREDICTED: cytosolic sulfotransferase 15-like      278   1e-86    
dbj|BAB11158.1|  steroid sulfotransferase-like protein                  278   1e-86    
ref|XP_009397578.1|  PREDICTED: cytosolic sulfotransferase 8-like       278   1e-86    
ref|NP_196317.2|  sulfotransferase 2B                                   278   1e-86    
ref|XP_009123352.1|  PREDICTED: cytosolic sulfotransferase 11-like      277   2e-86    
ref|XP_010499321.1|  PREDICTED: cytosolic sulfotransferase 7-like       277   2e-86    
gb|KCW80603.1|  hypothetical protein EUGRSUZ_C01969                     276   2e-86    
ref|XP_008811045.1|  PREDICTED: flavonol 3-sulfotransferase-like        278   2e-86    
ref|XP_006399077.1|  hypothetical protein EUTSA_v10014078mg             277   3e-86    
ref|XP_010939220.1|  PREDICTED: cytosolic sulfotransferase 8-like...    278   3e-86    
ref|XP_011006877.1|  PREDICTED: flavonol sulfotransferase-like          277   3e-86    
ref|XP_011070271.1|  PREDICTED: cytosolic sulfotransferase 5-like       280   3e-86    
ref|XP_004298346.1|  PREDICTED: cytosolic sulfotransferase 5-like       275   4e-86    
ref|XP_008777579.1|  PREDICTED: flavonol 4'-sulfotransferase-like       277   4e-86    
ref|XP_011012787.1|  PREDICTED: flavonol sulfotransferase-like          276   5e-86    
ref|XP_002529982.1|  Flavonol 4'-sulfotransferase, putative             276   5e-86    
ref|XP_006292601.1|  hypothetical protein CARUB_v10018842mg             276   6e-86    
gb|KHN37710.1|  Flavonol sulfotransferase-like                          276   8e-86    
gb|KCW80590.1|  hypothetical protein EUGRSUZ_C01951                     275   9e-86    
gb|KCW81180.1|  hypothetical protein EUGRSUZ_C02547                     275   9e-86    
ref|XP_011006882.1|  PREDICTED: flavonol sulfotransferase-like          276   1e-85    
ref|XP_002305642.2|  hypothetical protein POPTR_0004s03150g             276   1e-85    
dbj|BAK00292.1|  predicted protein                                      275   1e-85    
ref|XP_003542799.1|  PREDICTED: cytosolic sulfotransferase 15-like      276   1e-85    
ref|XP_006292654.1|  hypothetical protein CARUB_v10018897mg             275   1e-85    
ref|XP_011003416.1|  PREDICTED: cytosolic sulfotransferase 8-like       276   1e-85    
ref|XP_003627955.1|  Flavonol sulfotransferase-like protein             277   1e-85    
ref|XP_004962267.1|  PREDICTED: cytosolic sulfotransferase 18-like      274   3e-85    
ref|XP_002459152.1|  hypothetical protein SORBIDRAFT_03g046780          274   3e-85    
ref|XP_008785019.1|  PREDICTED: flavonol 4'-sulfotransferase-like       275   3e-85    
gb|EYU29209.1|  hypothetical protein MIMGU_mgv1a022523mg                274   4e-85    
ref|XP_007225044.1|  hypothetical protein PRUPE_ppa019825mg             271   4e-85    
ref|XP_003627666.1|  Steroid sulfotransferase-like protein              276   4e-85    
ref|NP_178472.1|  cytosolic sulfotransferase 13                         273   4e-85    
ref|XP_010677194.1|  PREDICTED: flavonol sulfotransferase-like          274   5e-85    
ref|XP_010435235.1|  PREDICTED: cytosolic sulfotransferase 1-like       273   5e-85    
ref|XP_006292772.1|  hypothetical protein CARUB_v10019022mg             273   6e-85    
ref|XP_007133673.1|  hypothetical protein PHAVU_011G199400g             273   6e-85    
ref|XP_010272734.1|  PREDICTED: cytosolic sulfotransferase 8-like       274   6e-85    
ref|XP_002514613.1|  Flavonol 4'-sulfotransferase, putative             273   7e-85    
gb|AET02142.2|  sulfotransferase                                        276   7e-85    
ref|XP_006407689.1|  hypothetical protein EUTSA_v10021105mg             273   8e-85    
ref|XP_011070341.1|  PREDICTED: cytosolic sulfotransferase 15-like      273   9e-85    
ref|XP_009397577.1|  PREDICTED: flavonol 4'-sulfotransferase-like       273   1e-84    
ref|XP_010672352.1|  PREDICTED: cytosolic sulfotransferase 8-like       273   1e-84    
ref|XP_003562722.2|  PREDICTED: flavonol 3-sulfotransferase-like        274   1e-84    
dbj|BAJ86339.1|  predicted protein                                      273   1e-84    
dbj|BAJ92757.1|  predicted protein                                      273   1e-84    
ref|XP_008782346.1|  PREDICTED: cytosolic sulfotransferase 8-like       270   1e-84    
gb|KCW80599.1|  hypothetical protein EUGRSUZ_C01964                     271   1e-84    
ref|XP_007045764.1|  P-loop containing nucleoside triphosphate hy...    271   2e-84    
dbj|BAJ84859.1|  predicted protein                                      273   2e-84    
ref|XP_010663822.1|  PREDICTED: uncharacterized protein LOC100261498    282   2e-84    
ref|XP_010051030.1|  PREDICTED: cytosolic sulfotransferase 12-like      274   3e-84    
emb|CBI24935.3|  unnamed protein product                                272   3e-84    
ref|XP_004973903.1|  PREDICTED: cytosolic sulfotransferase 5-like       271   3e-84    
ref|XP_002890763.1|  hypothetical protein ARALYDRAFT_890352             271   3e-84    
ref|XP_006391838.1|  hypothetical protein EUTSA_v10024127mg             271   3e-84    
ref|XP_010440548.1|  PREDICTED: cytosolic sulfotransferase 1-like       271   4e-84    
ref|XP_011070306.1|  PREDICTED: cytosolic sulfotransferase 15-like      271   4e-84    
ref|XP_006303793.1|  hypothetical protein CARUB_v10012096mg             271   5e-84    
ref|XP_006385956.1|  hypothetical protein POPTR_0003s18770g             271   5e-84    
dbj|BAJ92404.1|  predicted protein                                      271   5e-84    
ref|XP_008779555.1|  PREDICTED: LOW QUALITY PROTEIN: cytosolic su...    270   5e-84    
ref|XP_010936424.1|  PREDICTED: flavonol 3-sulfotransferase-like        272   5e-84    
ref|XP_007133555.1|  hypothetical protein PHAVU_011G188800g             271   5e-84    
ref|NP_172799.1|  sulfotransferase 4B                                   271   6e-84    
gb|EMT24568.1|  Flavonol 4'-sulfotransferase                            271   6e-84    
emb|CDY42747.1|  BnaA03g47920D                                          270   7e-84    
ref|XP_007133771.1|  hypothetical protein PHAVU_011G207500g             271   7e-84    
emb|CDX94351.1|  BnaC01g18330D                                          270   9e-84    
ref|XP_010458821.1|  PREDICTED: cytosolic sulfotransferase 1-like       270   9e-84    
gb|KFK43386.1|  hypothetical protein AALP_AA1G119300                    270   1e-83    
ref|XP_004972363.1|  PREDICTED: cytosolic sulfotransferase 18-like      270   1e-83    
ref|XP_010458819.1|  PREDICTED: cytosolic sulfotransferase 1-like       270   1e-83    
ref|XP_010051056.1|  PREDICTED: cytosolic sulfotransferase 12-like      275   1e-83    
gb|EYU38464.1|  hypothetical protein MIMGU_mgv1a010211mg                270   1e-83    
gb|EMT03994.1|  Sulfotransferase 17                                     273   2e-83    
ref|XP_004306829.1|  PREDICTED: cytosolic sulfotransferase 15-like      270   2e-83    
ref|XP_009130910.1|  PREDICTED: cytosolic sulfotransferase 1-like       270   2e-83    
ref|XP_009110577.1|  PREDICTED: cytosolic sulfotransferase 1-like       270   2e-83    
ref|XP_003627950.1|  Flavonol sulfotransferase-like protein             270   2e-83    
ref|XP_008674535.1|  PREDICTED: cytosolic sulfotransferase 8-like...    270   2e-83    
dbj|BAJ99453.1|  predicted protein                                      270   2e-83    
ref|XP_010495501.1|  PREDICTED: cytosolic sulfotransferase 6-like       269   2e-83    
ref|XP_008674534.1|  PREDICTED: cytosolic sulfotransferase 8-like...    270   2e-83    
ref|XP_010478181.1|  PREDICTED: cytosolic sulfotransferase 7-like       269   3e-83    
gb|KFK43385.1|  hypothetical protein AALP_AA1G119200                    269   3e-83    
ref|XP_011081805.1|  PREDICTED: cytosolic sulfotransferase 15-like      269   3e-83    
ref|XP_010936423.1|  PREDICTED: flavonol sulfotransferase-like          270   3e-83    
ref|XP_010478184.1|  PREDICTED: cytosolic sulfotransferase 7-like       269   3e-83    
ref|XP_004972362.1|  PREDICTED: cytosolic sulfotransferase 18-like      268   3e-83    
ref|XP_008785638.1|  PREDICTED: cytosolic sulfotransferase 8-like       270   4e-83    
ref|XP_007022038.1|  Sulfotransferase 2A                                269   5e-83    
ref|XP_010458820.1|  PREDICTED: cytosolic sulfotransferase 1-like       268   5e-83    
ref|XP_010499316.1|  PREDICTED: cytosolic sulfotransferase 7-like       268   5e-83    
gb|EMT31724.1|  Sulfotransferase 16                                     268   5e-83    
ref|XP_006399078.1|  hypothetical protein EUTSA_v10014092mg             268   5e-83    
ref|XP_011070365.1|  PREDICTED: cytosolic sulfotransferase 15-like      268   5e-83    
gb|AAM62638.1|  steroid sulfotransferase, putative                      268   5e-83    
ref|XP_011081693.1|  PREDICTED: cytosolic sulfotransferase 15-like      268   6e-83    
ref|NP_174139.1|  sulfotransferase 7                                    268   6e-83    
ref|XP_006285014.1|  hypothetical protein CARUB_v10006321mg             268   7e-83    
ref|NP_001149633.1|  flavonol sulfotransferase-like                     269   8e-83    
gb|EMS63801.1|  Sulfotransferase 16                                     268   1e-82    
ref|XP_002533884.1|  Flavonol 3-sulfotransferase, putative              268   1e-82    
ref|XP_008674533.1|  PREDICTED: cytosolic sulfotransferase 8-like...    270   1e-82    
ref|XP_002264574.2|  PREDICTED: cytosolic sulfotransferase 15-like      268   1e-82    
sp|P52837.1|F4ST_FLACH  RecName: Full=Flavonol 4'-sulfotransferas...    267   2e-82    
ref|XP_004490050.1|  PREDICTED: cytosolic sulfotransferase 15-like      268   2e-82    
ref|XP_007210773.1|  hypothetical protein PRUPE_ppa019757mg             268   2e-82    
ref|XP_010476380.1|  PREDICTED: cytosolic sulfotransferase 1-like       267   2e-82    
gb|EAY87095.1|  hypothetical protein OsI_08492                          268   2e-82    
ref|XP_010041349.1|  PREDICTED: cytosolic sulfotransferase 15-like      266   2e-82    
ref|XP_009105059.1|  PREDICTED: cytosolic sulfotransferase 1-like       266   2e-82    
ref|XP_006385961.1|  hypothetical protein POPTR_0003s18820g             267   2e-82    
gb|KCW81101.1|  hypothetical protein EUGRSUZ_C02479                     266   3e-82    
ref|XP_008811048.1|  PREDICTED: flavonol 3-sulfotransferase-like        267   3e-82    
gb|ABK95273.1|  unknown                                                 266   3e-82    
dbj|BAJ93300.1|  predicted protein                                      267   3e-82    
ref|NP_001146492.1|  flavonol 4-sulfotransferase                        267   3e-82    
ref|XP_002318367.2|  hypothetical protein POPTR_0012s01280g             267   4e-82    
ref|XP_010939222.1|  PREDICTED: cytosolic sulfotransferase 12-like      267   4e-82    
ref|XP_011001965.1|  PREDICTED: flavonol sulfotransferase-like          266   4e-82    
ref|XP_007022041.1|  Sulfotransferase 2A, putative                      266   4e-82    
gb|EYU27148.1|  hypothetical protein MIMGU_mgv1a010017mg                266   5e-82    
ref|XP_006304016.1|  hypothetical protein CARUB_v10009741mg             266   5e-82    
ref|NP_001140941.1|  uncharacterized protein LOC100273019               266   5e-82    
gb|EYU29210.1|  hypothetical protein MIMGU_mgv1a010218mg                265   5e-82    
ref|XP_006391844.1|  hypothetical protein EUTSA_v10024068mg             266   6e-82    
ref|XP_002452746.1|  hypothetical protein SORBIDRAFT_04g031660          266   7e-82    
ref|XP_007029974.1|  Sulfotransferase 2A, putative                      266   8e-82    
ref|XP_011020519.1|  PREDICTED: cytosolic sulfotransferase 15-like      265   8e-82    
ref|XP_002524376.1|  Flavonol 3-sulfotransferase, putative              267   9e-82    
ref|XP_006417123.1|  hypothetical protein EUTSA_v10009721mg             266   9e-82    
ref|XP_011070292.1|  PREDICTED: cytosolic sulfotransferase 15-like      265   9e-82    
ref|NP_179098.1|  sulfotransferase 4A                                   265   9e-82    
emb|CDP11652.1|  unnamed protein product                                266   9e-82    
ref|NP_001140649.1|  uncharacterized protein LOC100272724               266   9e-82    
gb|AAC63112.1|  steroid sulfotransferase 2                              265   1e-81    
ref|XP_002887526.1|  predicted protein                                  265   1e-81    
ref|XP_003572076.1|  PREDICTED: cytosolic sulfotransferase 5-like       265   1e-81    
emb|CDY11350.1|  BnaA03g01860D                                          265   1e-81    
ref|XP_008240108.1|  PREDICTED: flavonol 4'-sulfotransferase-like       266   1e-81    
gb|KDP44529.1|  hypothetical protein JCGZ_16362                         263   2e-81    
gb|EYU36904.1|  hypothetical protein MIMGU_mgv1a009066mg                265   2e-81    
gb|KDP31403.1|  hypothetical protein JCGZ_11779                         264   2e-81    
gb|EYU27151.1|  hypothetical protein MIMGU_mgv1a010018mg                263   3e-81    
dbj|BAJ86730.1|  predicted protein                                      265   3e-81    
ref|XP_004979028.1|  PREDICTED: cytosolic sulfotransferase 5-like       263   4e-81    
ref|XP_010672210.1|  PREDICTED: cytosolic sulfotransferase 13-like      264   4e-81    
ref|NP_001047758.2|  Os02g0684100                                       265   4e-81    
emb|CDX73052.1|  BnaC06g35000D                                          264   4e-81    
ref|XP_002524372.1|  Flavonol 4'-sulfotransferase, putative             265   4e-81    
gb|EYU24756.1|  hypothetical protein MIMGU_mgv1a010113mg                263   5e-81    
ref|XP_009762002.1|  PREDICTED: flavonol sulfotransferase-like          264   5e-81    
ref|XP_009387001.1|  PREDICTED: cytosolic sulfotransferase 11-like      261   6e-81    
dbj|BAE99564.1|  steroid sulfotransferase-like                          263   6e-81    
ref|XP_009764805.1|  PREDICTED: flavonol 3-sulfotransferase-like        264   7e-81    
ref|XP_002890004.1|  sulfotransferase family protein                    263   7e-81    
ref|XP_002276423.2|  PREDICTED: cytosolic sulfotransferase 8-like       263   8e-81    
ref|XP_006291422.1|  hypothetical protein CARUB_v10017560mg             263   9e-81    
ref|XP_010499319.1|  PREDICTED: cytosolic sulfotransferase 7-like       262   1e-80    
ref|XP_009615435.1|  PREDICTED: flavonol 3-sulfotransferase-like        265   1e-80    
emb|CDP16991.1|  unnamed protein product                                263   1e-80    
ref|XP_008672387.1|  PREDICTED: uncharacterized protein LOC100273...    266   1e-80    
ref|XP_006417102.1|  hypothetical protein EUTSA_v10008182mg             262   1e-80    
dbj|BAK03878.1|  predicted protein                                      263   2e-80    
ref|XP_009396440.1|  PREDICTED: flavonol sulfotransferase-like          262   2e-80    
ref|XP_006442533.1|  hypothetical protein CICLE_v10021050mg             262   2e-80    
ref|XP_002444757.1|  hypothetical protein SORBIDRAFT_07g027380          262   2e-80    
ref|NP_194358.1|  sulfotransferase 3                                    261   2e-80    
ref|XP_007133669.1|  hypothetical protein PHAVU_011G199100g             262   2e-80    
emb|CDX96515.1|  BnaA07g31260D                                          262   2e-80    
ref|NP_001150618.1|  flavonol 4-sulfotransferase                        262   2e-80    
ref|XP_008777576.1|  PREDICTED: flavonol sulfotransferase-like          263   3e-80    
ref|NP_199182.1|  sulfotransferase 1                                    261   3e-80    
ref|XP_009106067.1|  PREDICTED: cytosolic sulfotransferase 16           261   3e-80    
ref|XP_010418264.1|  PREDICTED: cytosolic sulfotransferase 5-like       261   3e-80    
ref|XP_010425370.1|  PREDICTED: cytosolic sulfotransferase 18-like      262   3e-80    
ref|XP_007010840.1|  Sulfotransferase 2A, putative                      261   3e-80    
ref|XP_002867572.1|  predicted protein                                  261   3e-80    
ref|XP_010048481.1|  PREDICTED: cytosolic sulfotransferase 12-like      261   3e-80    
ref|XP_009613185.1|  PREDICTED: flavonol sulfotransferase-like          261   3e-80    
ref|XP_002524377.1|  Flavonol 3-sulfotransferase, putative              261   4e-80    
gb|EMT21913.1|  Sulfotransferase 16                                     261   4e-80    
ref|XP_010495498.1|  PREDICTED: cytosolic sulfotransferase 1-like       261   4e-80    
ref|XP_010460594.1|  PREDICTED: cytosolic sulfotransferase 7-like       261   4e-80    
gb|KCW50290.1|  hypothetical protein EUGRSUZ_J00075                     261   4e-80    
ref|XP_007133677.1|  hypothetical protein PHAVU_011G199800g             261   5e-80    
ref|XP_002524373.1|  Flavonol 3-sulfotransferase, putative              261   5e-80    
ref|XP_006442535.1|  hypothetical protein CICLE_v10024230mg             261   6e-80    
ref|XP_010231940.1|  PREDICTED: LOW QUALITY PROTEIN: flavonol sul...    264   6e-80    
emb|CAA86850.1|  Flavonol sulfotransferase                              259   6e-80    
emb|CDX92759.1|  BnaC07g40170D                                          259   7e-80    
ref|XP_007010477.1|  Flavonol 4'-sulfotransferase, putative             260   7e-80    
gb|EYU29211.1|  hypothetical protein MIMGU_mgv1a010290mg                260   7e-80    
ref|XP_010031026.1|  PREDICTED: cytosolic sulfotransferase 15-like      260   7e-80    
gb|ACR10265.1|  sulfotransferase 5a                                     261   7e-80    
dbj|BAK00174.1|  predicted protein                                      260   8e-80    
ref|XP_004953468.1|  PREDICTED: cytosolic sulfotransferase 15-like      261   9e-80    
ref|XP_004958268.1|  PREDICTED: cytosolic sulfotransferase 18-like      261   9e-80    
ref|XP_007029964.1|  Sulfotransferase 2A, putative                      262   1e-79    
gb|EYU27103.1|  hypothetical protein MIMGU_mgv1a022913mg                259   1e-79    
ref|XP_006392096.1|  hypothetical protein EUTSA_v10023824mg             260   1e-79    
gb|EMT33201.1|  Sulfotransferase 17                                     258   1e-79    
ref|XP_006302485.1|  hypothetical protein CARUB_v10020580mg             260   1e-79    
ref|XP_006662952.1|  PREDICTED: cytosolic sulfotransferase 8-like       260   1e-79    
emb|CDY34679.1|  BnaC04g20040D                                          259   1e-79    
ref|XP_009130912.1|  PREDICTED: cytosolic sulfotransferase 1-like       259   1e-79    
ref|XP_002890005.1|  sulfotransferase family protein                    260   2e-79    
ref|XP_010672209.1|  PREDICTED: cytosolic sulfotransferase 15-like      259   2e-79    
sp|P52836.2|F3ST_FLACH  RecName: Full=Flavonol 3-sulfotransferase...    258   2e-79    
ref|XP_009398836.1|  PREDICTED: cytosolic sulfotransferase 6-like       264   2e-79    
dbj|BAC56777.1|  putative flavonol 4'-sulfotransferase                  259   3e-79    
emb|CDY11353.1|  BnaA03g01890D                                          258   3e-79    
gb|EMS57315.1|  Sulfotransferase 17                                     259   3e-79    



>ref|XP_004239453.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum lycopersicum]
Length=332

 Score =   363 bits (931),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 174/321 (54%), Positives = 232/321 (72%), Gaps = 4/321 (1%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++L+E+S +EE ++ L+ LPKE GW+   +YNY+GFW+ P  LQGA+   Q FQ QDSDI
Sbjct  10    RYLKEDSLSEECKKLLSILPKEKGWIGSYIYNYQGFWISPRLLQGAIACQQQFQAQDSDI  69

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
              L T PKSGT+WLK+L FAL+ R +    +  HPL   NPHDL+PFLEL+ Y   + PDF
Sbjct  70    FLVTNPKSGTIWLKSLIFALVNRMKHPMFEPNHPLLIKNPHDLVPFLELTLYVDGQVPDF  129

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +     RLL++HLP + LPKSV +SK K+VYLCRNPKDT +S WHF N LR  L   +  
Sbjct  130   SSFTTPRLLSSHLPFASLPKSVQDSKTKLVYLCRNPKDTFISVWHFANSLR--LHHKDTN  187

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E FD +C+G+   GPFWDH+ +YWK+S+ENP KVLFL YEE+K++P++HL+R+A FL
Sbjct  188   SLEEMFDLFCKGMSVYGPFWDHMLDYWKKSIENPNKVLFLMYEEIKEQPKMHLKRLAEFL  247

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHM  963
              CPFS +EE CG+V  ILR+CSF+SLSNLEVN T      G EN V FR+G++GDW N+ 
Sbjct  248   ECPFSIKEENCGIVDEILRMCSFKSLSNLEVNTTG-KLSTGEENKVFFRRGEIGDWKNYF  306

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             T EM+ +L+ I+++KF G+GL
Sbjct  307   TREMSEKLNNIIEQKFQGSGL  327



>ref|XP_009598362.1| PREDICTED: cytosolic sulfotransferase 12-like [Nicotiana tomentosiformis]
Length=333

 Score =   362 bits (928),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/322 (55%), Positives = 228/322 (71%), Gaps = 4/322 (1%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++L+E+   EE ++ L +LPKE GWL   +YNY+GFW+ P  LQG +   Q FQ QDSDI
Sbjct  13    KYLREDELNEESKKLLLTLPKERGWLASHIYNYQGFWIAPRHLQGVIACQQQFQAQDSDI  72

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL T PKSGT WLKAL FAL+ R +F   ++ HPL  NNPHDL+PFLEL  Y   + P+F
Sbjct  73    ILVTSPKSGTTWLKALVFALVNRIRFPFSEQNHPLLVNNPHDLVPFLELKLYIDGQVPNF  132

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +     RLL+THLP   LPKSV  SK K+VYLCRNP+D  +S +HF N LR E  G  ++
Sbjct  133   SSFTSPRLLSTHLPYGSLPKSVQHSKNKLVYLCRNPRDIFISLFHFTNNLRIENMGTNSI  192

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E  D +C+GV   GPFW+HV +YWK+S+ENP KVLFL YEEMK++PE+ L+R+A FL
Sbjct  193   --EEMLDLFCKGVSLYGPFWNHVLDYWKKSIENPKKVLFLMYEEMKEQPEIQLKRLAEFL  250

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHM  963
             GC FS EEE+ GVV  IL++CSFE+LSNLEVNK       G EN V FR+GKVGDW N+ 
Sbjct  251   GCSFSIEEEKSGVVDEILKMCSFENLSNLEVNKNE-KLSTGEENKVFFRRGKVGDWKNYF  309

Query  964   TEEMARRLDQIVQEKFTGTGLM  1029
             T EM  +L+ I+++KF G+GL+
Sbjct  310   TLEMTEKLNHIIEQKFQGSGLL  331



>ref|XP_006348794.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=332

 Score =   361 bits (927),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 175/323 (54%), Positives = 232/323 (72%), Gaps = 8/323 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++L+E+S +EE ++ L+ LPKE GW+   +YNY+GFW+ P  LQG +   + FQ QDSDI
Sbjct  10    KYLKEDSLSEECKKLLSILPKEKGWIGSYIYNYQGFWISPRLLQGVIACQKQFQAQDSDI  69

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
              L T PKSGT+WLK+L FAL+ R +    ++ HPL   NPHDL+PFLEL+ Y   + PDF
Sbjct  70    FLVTNPKSGTIWLKSLLFALVNRMKHPMFEQNHPLLNKNPHDLVPFLELTLYVDGQVPDF  129

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +     RLL+THLP + LPKS  +SK K+VYLCRNPKDT +S WHF N LR  L   +  
Sbjct  130   SSFTTPRLLSTHLPFASLPKSAQDSKTKLVYLCRNPKDTFISMWHFSNNLR--LHHKDTN  187

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E FD YC+G+   GPFWDHV +YWK+S+ENP KVLFL YEE+K++P++HL+R+A FL
Sbjct  188   SIEEMFDLYCKGMSVYGPFWDHVLDYWKQSIENPNKVLFLMYEEIKEQPKMHLKRLAEFL  247

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
              CPFS +EE CGVV  ILR+CSF++LSNLEVN T   G L  G EN V FR+G++GDW N
Sbjct  248   ECPFSIKEENCGVVDEILRMCSFKNLSNLEVNTT---GKLSTGEENKVFFRRGEIGDWKN  304

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             + T EM+ + + I+++KF G+GL
Sbjct  305   YFTTEMSEKFNYIIEQKFQGSGL  327



>ref|XP_006348649.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=335

 Score =   360 bits (923),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 175/323 (54%), Positives = 230/323 (71%), Gaps = 8/323 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE+  ++E ++ L +LPKE GWL   +YNY+GFW+ P F+QG +   Q FQ QDSDI
Sbjct  13    KYLQEDEISDECKKLLLTLPKERGWLASHIYNYQGFWVAPRFIQGVIACQQQFQAQDSDI  72

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL T PKSGT WLK+L F L+ R ++   ++ HPL   NPHDLIPFLE+  Y     P+F
Sbjct  73    ILVTTPKSGTTWLKSLLFVLVNRMKYPVFEQNHPLLVKNPHDLIPFLEIKLYVDGLVPNF  132

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             A     RLL+TH+P + LPKSV +SK K+VYLCRNPKDT +S WHF N LR  L   +  
Sbjct  133   ASFTSPRLLSTHMPFASLPKSVQDSKTKLVYLCRNPKDTFISLWHFTNNLR--LHHKDIH  190

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
             P  E F+S+C+GV   GPFW+HV +YWK+S+E P KVLFL YEE+K +P++ L+R+A FL
Sbjct  191   PIEEKFESFCKGVSLYGPFWNHVLDYWKQSIEKPNKVLFLMYEEIKVQPKLQLKRLAEFL  250

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
              CPFS EEE CGV+  ILR+CSFE+LSNLEVN    +G L  G EN   FRKG+VGDW N
Sbjct  251   ECPFSIEEENCGVMDEILRMCSFENLSNLEVN---ADGKLSTGEENNAFFRKGEVGDWKN  307

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             + T EM+ +L+ I+++KF G+G+
Sbjct  308   YFTIEMSEKLNHIIEQKFQGSGI  330



>ref|XP_002267209.1| PREDICTED: cytosolic sulfotransferase 12 [Vitis vinifera]
Length=333

 Score =   352 bits (902),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 183/323 (57%), Positives = 224/323 (69%), Gaps = 9/323 (3%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE+  T+E R+ L+SLP+E GW+T  L+ Y+GFW     L+G +   QHFQ  D+DI
Sbjct  12    EYLQEDEVTQEHRDLLSSLPREKGWVTSHLFQYQGFWHTSRHLKGVVACQQHFQAHDTDI  71

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             +L T PKSGT WLKA+AFAL+ R +F  +   HPL TNNPH+L+PFLE+  YA  + PD 
Sbjct  72    LLVTTPKSGTTWLKAMAFALLKRVRF-PDTRHHPLLTNNPHELVPFLEIKLYAESKVPDL  130

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
                   RL +THLP + LP+SV  S  K+VYLCRNP+DT VSFW F NKLR E  G    
Sbjct  131   TSFTAPRLFSTHLPFTSLPESVNTSGCKLVYLCRNPRDTFVSFWQFTNKLRLENMG--TN  188

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
             P  E FD +C GV  +GPFWDHV  YWKESLE P K+LFLKYEEMK +P V LRR+A FL
Sbjct  189   PLEEVFDKFCWGVSLSGPFWDHVLGYWKESLEKPEKILFLKYEEMKAQPHVQLRRLAEFL  248

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
             GCPF  EEE   VV  IL+LCSFE+LSNLEVNK   NG L  G E+   FR+G+VGDW N
Sbjct  249   GCPFCPEEETRCVVDEILQLCSFENLSNLEVNK---NGKLSSGEEHSAFFRRGEVGDWVN  305

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             ++T EM  RLD I +EK  G+GL
Sbjct  306   YLTAEMLDRLDHITEEKLHGSGL  328



>ref|XP_010023658.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 gb|KCW59960.1| hypothetical protein EUGRSUZ_H02685 [Eucalyptus grandis]
Length=329

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/323 (53%), Positives = 220/323 (68%), Gaps = 4/323 (1%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQEN  +++ R+ L SLP E GW+TP LY Y+GFW+ P  L G L    +F+ Q++DI
Sbjct  10    KYLQENDISQKCRDLLPSLPHEKGWITPSLYQYQGFWVAPKLLNGVLACQDNFRVQETDI  69

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             +L T PK GT WLKA+ F L TR ++    + HPL T +PHDL+PFLEL  Y  +E P+ 
Sbjct  70    LLITAPKCGTTWLKAILFCLSTRGRYSGSMQQHPLLTQSPHDLVPFLELKLYFGQEIPNL  129

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
                   RL ATHLP   LP+SV +S  K+VYLCRNPKDT VS WHF NKLRS+  G   M
Sbjct  130   TSLPSPRLFATHLPYQSLPQSVKDSGCKLVYLCRNPKDTFVSLWHFANKLRSKETG--GM  187

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
             P  E  D++C+GV   GP+WDHV  Y+K SLE P + LFL+YE+MK++P  H++R+A FL
Sbjct  188   PLGECLDAFCQGVSPFGPYWDHVQGYYKVSLEMPDRALFLRYEDMKEDPHAHVKRLADFL  247

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHM  963
             GCPF E+E   G V GI+R+CSF+SLS LEVNK+      G E    FRKG VGDW NHM
Sbjct  248   GCPFGEQELRDGTVDGIVRMCSFDSLSMLEVNKSG-RLSTGQETKSYFRKGDVGDWVNHM  306

Query  964   TEEMARRLDQIVQEKFTGTGLML  1032
             T EM  R+D+++QEK  G+GL L
Sbjct  307   TVEMGERVDRVMQEKMHGSGLKL  329



>ref|XP_009616636.1| PREDICTED: cytosolic sulfotransferase 12-like [Nicotiana tomentosiformis]
Length=335

 Score =   349 bits (895),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 171/321 (53%), Positives = 226/321 (70%), Gaps = 4/321 (1%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE+  +EE ++ L++LPKE G +   +YNY+GFW+ P  +QG +   + FQ Q+SDI
Sbjct  13    KYLQEDGLSEECKKLLSTLPKEKGLIGSYIYNYQGFWVSPRIIQGVIACQKQFQAQESDI  72

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL T PKSGT WLKAL F L+ R +F    + HPL   NPH L+PFLEL  Y   + PDF
Sbjct  73    ILVTTPKSGTTWLKALVFTLVNRIRFPLSAQNHPLLVKNPHSLVPFLELKLYIDGQVPDF  132

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +     RLLATHLP + LPKSV +SK K++YLCRNP+DT +S WHF NKLRS    ++  
Sbjct  133   SSFTTHRLLATHLPFASLPKSVQDSKSKLIYLCRNPRDTFISMWHFTNKLRSHY--IDTN  190

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E FD +C+GV   GPFWDHV +YWK+SLE P +VLFL YEE+K++PE+ L+R+A FL
Sbjct  191   SIEEMFDLFCKGVSLFGPFWDHVLDYWKKSLEKPKRVLFLMYEEIKEKPEIQLKRLAEFL  250

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHM  963
              C FSEEEE  GVV+ IL++CSFE+LSNLEVNK       G E+ + FR+G+VGDW N+ 
Sbjct  251   ECSFSEEEETSGVVNEILKMCSFENLSNLEVNKNE-KWPTGEEHKLFFRRGEVGDWKNYF  309

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             T  M  +LD I+++KF G+GL
Sbjct  310   TTVMVEKLDHIIEQKFVGSGL  330



>ref|XP_010052979.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 gb|KCW77152.1| hypothetical protein EUGRSUZ_D01498 [Eucalyptus grandis]
Length=329

 Score =   348 bits (892),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 171/323 (53%), Positives = 221/323 (68%), Gaps = 4/323 (1%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE+  +++ R+ L SLP E GW+TP LY Y+GFW+ P  L G L    +F+ Q++DI
Sbjct  10    KYLQEDDISQKCRDLLPSLPHEKGWITPSLYQYQGFWVAPKLLNGVLACQDNFRAQETDI  69

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             +L T PKSGT WLKA+ F L  R ++ A  + HPL T +PHDL+PFLEL  Y  +E P+ 
Sbjct  70    LLITGPKSGTTWLKAILFCLSNRAKYPASMQQHPLLTQSPHDLVPFLELKLYFGQEIPNL  129

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
                   RL  THLP   LP+SV +S  K+VYLCRNPKDT VS WHF NKLRS+  G   M
Sbjct  130   NSLPPPRLFTTHLPYQSLPQSVKDSGCKLVYLCRNPKDTFVSLWHFANKLRSKETG--GM  187

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
             P  E  D++C+GV   GP+WDHV  Y+K SLE P + LFL+YE+MKK+P VH++R+A FL
Sbjct  188   PLGECLDAFCQGVSPFGPYWDHVQGYYKVSLEMPDRALFLRYEDMKKDPHVHVKRLADFL  247

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHM  963
             GCPF E+E   G V GI+R+CSF+SLS LEVNK+      G E    FRKG VGDW NHM
Sbjct  248   GCPFGEQELRDGTVDGIVRMCSFDSLSMLEVNKSG-RLSTGQETKSYFRKGDVGDWVNHM  306

Query  964   TEEMARRLDQIVQEKFTGTGLML  1032
             + EM  R+D+++QEK  G+GL L
Sbjct  307   SVEMGERVDRVMQEKMHGSGLKL  329



>ref|XP_009767933.1| PREDICTED: cytosolic sulfotransferase 12 [Nicotiana sylvestris]
Length=335

 Score =   346 bits (888),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/321 (54%), Positives = 226/321 (70%), Gaps = 4/321 (1%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE+   EE ++ L++LPKE G +   +YNY+GFW+ P  +QG +   + F  QDSDI
Sbjct  13    KYLQEDGLGEECKKLLSTLPKEKGLIGSYIYNYQGFWVSPRIIQGVIACQKQFHAQDSDI  72

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL T PKSGT WLKAL FAL+ R +F    + HPL   NPH L+PFLEL  Y   + PDF
Sbjct  73    ILVTIPKSGTTWLKALVFALVNRIRFPLSGQNHPLLVKNPHALVPFLELKLYVDGQVPDF  132

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +     RLLATHLP + LPKSV +S+ K++YLCRNP+DT VS WHF NKLRS    ++  
Sbjct  133   SSFTTPRLLATHLPYASLPKSVQDSESKLIYLCRNPRDTFVSMWHFTNKLRSHY--MDTN  190

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E FD + +GV   GPFWDHV +YWK+SLE P +VLFL YEE+K++PE+ ++R+A FL
Sbjct  191   SIEEMFDLFYKGVSLFGPFWDHVLDYWKKSLEKPTRVLFLMYEEIKEKPEIQVKRLAEFL  250

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHM  963
              CPFSEEEE  GVV+ IL+LCSFE+LSNLEVNK       G ++ + FR+G+VGDW N+ 
Sbjct  251   ECPFSEEEETSGVVNEILKLCSFENLSNLEVNKNE-KWPTGEDHKLFFRRGEVGDWKNYF  309

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             T EM  +LD I+++KF G+GL
Sbjct  310   TVEMVEKLDHIIEQKFLGSGL  330



>ref|XP_006348797.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=332

 Score =   345 bits (885),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 174/325 (54%), Positives = 225/325 (69%), Gaps = 12/325 (4%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE+  +EE ++FL++LPKE GW+   +YNY+GFW     +QG +   Q FQ QDSDI
Sbjct  10    KYLQEDQ-SEECKKFLSTLPKEKGWMESTIYNYQGFWSSSRAIQGVIACQQQFQAQDSDI  68

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL T PKSGTVWLK+L FAL+ R      ++ HPL   NPHDL+ FLEL  YA  + PDF
Sbjct  69    ILVTSPKSGTVWLKSLLFALVNRNNHPIFEKDHPLLLKNPHDLVLFLELDLYADGQVPDF  128

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLR----SELRG  591
             +     RLLATH+P + LPKSV  S+ K+VYLCRNP+DT +S W+F N LR     ++  
Sbjct  129   SSFTSPRLLATHVPFASLPKSVKNSRTKLVYLCRNPRDTFISMWNFANNLRLDNHKDINS  188

Query  592   LEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRM  771
             +E M     FD +C+GV   GPFW+ V +YWKES+ENP KV FL YEE+KK+P++ L+R+
Sbjct  189   IEEM-----FDHFCKGVSLYGPFWNQVLDYWKESIENPDKVFFLMYEEIKKQPKIQLKRL  243

Query  772   AAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDW  951
             A FL CPFS EEE CGVV  ILR+CSFE+L NLEVN T      GV N   FR+GKVGDW
Sbjct  244   AEFLECPFSIEEENCGVVDEILRMCSFENLRNLEVN-THGKMSAGVANKNFFRRGKVGDW  302

Query  952   SNHMTEEMARRLDQIVQEKFTGTGL  1026
              N+ T EM  +L+ I+++KF G+GL
Sbjct  303   KNYFTVEMNDKLNHIIEQKFQGSGL  327



>ref|XP_004247253.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum lycopersicum]
Length=332

 Score =   345 bits (884),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/323 (53%), Positives = 226/323 (70%), Gaps = 8/323 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE S +EE+++FL++LPKE GW+   +YNY+GFW      QG +   + FQ QD DI
Sbjct  10    KYLQEFS-SEEWKKFLSTLPKEKGWMESTIYNYQGFWSSSRATQGVMACQKQFQAQDDDI  68

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL T PKSGTVWLK+L FAL+ RK     ++ HPL   NPHDL+ FLEL  Y   + PDF
Sbjct  69    ILVTTPKSGTVWLKSLLFALVNRKSNPIFEQDHPLLVKNPHDLVLFLELDLYVDGQVPDF  128

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +L    RL+ATH+P + LPKSV  S+ K+VYLCRNP+DT +S W F N LR +    +  
Sbjct  129   SLFTSPRLMATHVPFASLPKSVRNSRTKIVYLCRNPRDTFISMWQFANNLRLD-NYKDTN  187

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E FD +C+G+   GPFW+HV +YW+ESLENP KV+FL YEE+KK+P++ L+R+A FL
Sbjct  188   SIEEMFDHFCKGMSLYGPFWNHVLDYWRESLENPDKVIFLMYEEIKKQPKIQLKRLAEFL  247

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
              CPFS EEE CGVV  ILR+CSFE+L NLEVN    NG L  GV N   FR+G++GDW N
Sbjct  248   ECPFSNEEENCGVVDEILRVCSFENLRNLEVN---TNGKLSAGVANKNFFRRGEIGDWKN  304

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             + T EM  +L++I+++K  G+GL
Sbjct  305   YFTVEMKDKLNEIIEQKLQGSGL  327



>ref|XP_006348647.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=330

 Score =   345 bits (884),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/324 (52%), Positives = 228/324 (70%), Gaps = 9/324 (3%)
 Frame = +1

Query  67    QFLQEN-SYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSD  243
             ++LQ+    +EE + F + LPKE GW+   +YNY+GFW  P  +QGA+   Q FQ QDSD
Sbjct  7     KYLQDQEGLSEECKNFFSVLPKEKGWMGSYIYNYQGFWASPRTIQGAIACQQQFQAQDSD  66

Query  244   IILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPD  420
             IIL T PKSGT WLK+L F L+ R +    ++ HPL   NPHDLIPF+EL+ Y     P+
Sbjct  67    IILVTPPKSGTTWLKSLLFVLVNRMKHPVFEQNHPLLDKNPHDLIPFMELTLYVDGHVPN  126

Query  421   FALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEA  600
             F+     RLL+TH+P + LPKS+ +SK K+VYLCRNPKDT +S WHF N LR   + + +
Sbjct  127   FSAFTSPRLLSTHVPFASLPKSIKDSKTKLVYLCRNPKDTFISMWHFTNNLRLHHKDIHS  186

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAF  780
             +   E F+S+C+GV   GPFW+H+ +YWK+S+E P KVLFL YEE+K +P++ L+R+A +
Sbjct  187   IE--EIFESFCKGVSPYGPFWNHILDYWKQSIEKPNKVLFLMYEEIKVQPKLQLKRLAEY  244

Query  781   LGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWS  954
             L CPFS EEE CGV+  ILR+CSFE+LSNLEVN    NG L  G EN V FRKG+VGDW 
Sbjct  245   LECPFSIEEENCGVMDEILRMCSFENLSNLEVN---TNGKLSTGAENKVFFRKGEVGDWK  301

Query  955   NHMTEEMARRLDQIVQEKFTGTGL  1026
             N+ T EM+ +L+ I+++KF  +G+
Sbjct  302   NYFTIEMSEKLNHIIEQKFQESGI  325



>ref|XP_011070903.1| PREDICTED: cytosolic sulfotransferase 12-like [Sesamum indicum]
Length=356

 Score =   345 bits (884),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/323 (54%), Positives = 223/323 (69%), Gaps = 10/323 (3%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             QE +  EE +  +++LPKE GWL   LY Y+GFW     LQG ++  +HFQ QDSDI L 
Sbjct  40    QEETLAEECKNLISTLPKEKGWLASHLYQYQGFWYAARHLQGVISCQKHFQAQDSDIFLV  99

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALT  432
             T PKSGT WLKA+ F L+ RK++   +  HPL ++NPHDL+PFLE+  YA  + PD   +
Sbjct  100   TIPKSGTTWLKAIIFTLVNRKRYPVVK-NHPLISHNPHDLVPFLEIKLYADNQIPDIVSS  158

Query  433   NGSRLLATHLPVSLLPKSVW-ESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
                RL +THLP   LP+S    SK K+VYLCRNPKDT VS WHF NKLR +  G  +M  
Sbjct  159   PSPRLFSTHLPYVSLPESAKNSSKSKLVYLCRNPKDTFVSLWHFTNKLRLQEMGSNSMG-  217

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
              E F+ Y +GV   GPFWDHV EYWK+SLENP ++LFLK+E+MK+ P VHLRR+A FLGC
Sbjct  218   -EVFELYSKGVSLFGPFWDHVQEYWKQSLENPDRILFLKFEDMKERPAVHLRRLAEFLGC  276

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHM  963
             PF   EEE G+V  IL+LCSF++LS LEVNKT   G L  G EN   FR+G++GDW N++
Sbjct  277   PFEGYEEESGLVEEILKLCSFDNLSGLEVNKT---GKLSSGEENNAFFRRGEIGDWKNYL  333

Query  964   TEEMARRLDQIVQEKFTGTGLML  1032
                M  +LD+I +EKF G+GL++
Sbjct  334   DAVMIEKLDRITEEKFRGSGLVM  356



>gb|KDO70277.1| hypothetical protein CISIN_1g019700mg [Citrus sinensis]
Length=337

 Score =   342 bits (878),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 171/325 (53%), Positives = 219/325 (67%), Gaps = 10/325 (3%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE+  T+E RE ++SLP ETGW+   LY Y+GFW     LQG L   +HFQ QDSDI
Sbjct  16    KYLQEDELTQECRELISSLPAETGWVVDHLYQYQGFWHTSRELQGVLACQKHFQAQDSDI  75

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             +L T PK+GT WLKA+ FA++ R +++     HPL TNNPH+L+PF+EL  Y   + PD 
Sbjct  76    LLVTTPKAGTTWLKAITFAIVNRLRYVDNPCNHPLLTNNPHELVPFIELKLYVDNQVPDL  135

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKG--KVVYLCRNPKDTVVSFWHFMNKLRSELRGLE  597
                   RL ATHLP   LP SV +S    K+VYLCRNPKD  VS WHF NKLR E +G  
Sbjct  136   TTLTSPRLFATHLPFVSLPASVKDSSSACKLVYLCRNPKDIFVSLWHFTNKLRPEEKGTN  195

Query  598   AMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAA  777
             ++   E FD +CRGV   GPFWDH+  YWK S+E P +V FLKYEE+K++P + L+ +A 
Sbjct  196   SL--EETFDKFCRGVSLYGPFWDHILGYWKASMEKPDRVFFLKYEELKEQPSLRLKMLAE  253

Query  778   FLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENG--VLFRKGKVGDW  951
             FLGCPFS  EE  G+V  IL+LCSF++LSNLEVN+   NG +    G    FR+G VGDW
Sbjct  254   FLGCPFSPAEEANGLVDDILKLCSFDNLSNLEVNR---NGKMSSGEGYNAFFRRGVVGDW  310

Query  952   SNHMTEEMARRLDQIVQEKFTGTGL  1026
              N++T EM  RLDQI+++K  G GL
Sbjct  311   MNYLTPEMVGRLDQIIEQKLHGFGL  335



>ref|XP_006484253.1| PREDICTED: cytosolic sulfotransferase 12-like [Citrus sinensis]
Length=337

 Score =   342 bits (878),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/325 (53%), Positives = 219/325 (67%), Gaps = 10/325 (3%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE+  T+E RE ++SLP ETGW+   LY Y+GFW     LQG L   +HFQ QDSDI
Sbjct  16    KYLQEDELTQECRELISSLPAETGWVVDHLYQYQGFWHTSRELQGVLACQKHFQAQDSDI  75

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             +L T PK+GT WLKA+ FA++ R +++     HPL TNNPH+L+PF+EL  Y   + PD 
Sbjct  76    LLVTTPKAGTTWLKAITFAIVNRLRYVDNPCNHPLLTNNPHELVPFIELKLYVDNQVPDL  135

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKG--KVVYLCRNPKDTVVSFWHFMNKLRSELRGLE  597
                   RL ATHLP   LP SV +S    K+VYLCRNPKD  VS WHF NKLR E +G  
Sbjct  136   TTLTSPRLFATHLPFVSLPASVKDSSSACKLVYLCRNPKDIFVSLWHFTNKLRPEEKGTN  195

Query  598   AMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAA  777
             ++   E FD +CRGV   GPFWDH+  YWK S+E P +V FLKYEE+K++P + L+ +A 
Sbjct  196   SL--EETFDKFCRGVSLYGPFWDHILGYWKASMEKPDRVFFLKYEELKEQPSLRLKMLAE  253

Query  778   FLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENG--VLFRKGKVGDW  951
             FLGCPFS  EE  G+V  IL+LCSF++LSNLEVN+   NG +    G    FR+G VGDW
Sbjct  254   FLGCPFSPAEEANGLVDDILKLCSFDNLSNLEVNR---NGKMSSGEGYNTFFRRGVVGDW  310

Query  952   SNHMTEEMARRLDQIVQEKFTGTGL  1026
              N++T EM  RLDQI+++K  G GL
Sbjct  311   MNYLTPEMVGRLDQIIEQKLHGFGL  335



>ref|XP_009620813.1| PREDICTED: cytosolic sulfotransferase 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=369

 Score =   342 bits (878),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 172/319 (54%), Positives = 229/319 (72%), Gaps = 7/319 (2%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             L+EN +++ F++ L+SLPK  GWL+P LY Y+GFWL    L G L+    FQ QDSDI+L
Sbjct  48    LEENGFSQTFKDLLSSLPKAKGWLSPHLYKYQGFWLTALHLHGTLSFQHCFQAQDSDILL  107

Query  253   STFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKER---PDF  423
              T PKSGT+WLKA+ F LI R       + HPL T NPHDL+PFLEL+YA ++    P+ 
Sbjct  108   ITSPKSGTIWLKAMVFTLINRMSHPILSQEHPLLTINPHDLVPFLELNYAQEKNPISPNS  167

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +LT+   L +THLP   LP+SV  +K K++Y+CRNP+DT VS WH+++KLRS+    + +
Sbjct  168   SLTSPG-LYSTHLPYVSLPESVKNTKCKIIYMCRNPRDTFVSLWHYISKLRSQ--DSKMI  224

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
             PF EAFD +C G+   GPFWDHV  YW++SLE P KV FLKYEE+K++P +HL+ +A FL
Sbjct  225   PFEEAFDMFCNGLTMAGPFWDHVLSYWEKSLEMPQKVFFLKYEEVKEQPCLHLKCLAEFL  284

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHM  963
               PFS EEEE G+++ I++LCSFE+LSNLEVNK S     G +N V FRKG+VGDW NH+
Sbjct  285   ERPFSLEEEESGLMNEIIKLCSFENLSNLEVNK-SGKTVFGNDNRVFFRKGEVGDWKNHL  343

Query  964   TEEMARRLDQIVQEKFTGT  1020
             T EM  RL+QI ++KF G+
Sbjct  344   TTEMVDRLNQITEDKFNGS  362



>ref|XP_006348796.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=335

 Score =   341 bits (874),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 228/323 (71%), Gaps = 8/323 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE+  +E+ ++ L++LPKE GW+   +YNY+GFW  P  +QG +   Q FQ Q+SDI
Sbjct  13    KYLQEDGVSEDCKKLLSTLPKEKGWIGSYIYNYQGFWTSPRLIQGVIACQQQFQAQNSDI  72

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL T PKSGT WLKAL F+L+ RK++   ++ HPL   NPHDL+PFLEL  Y   + PDF
Sbjct  73    ILVTTPKSGTTWLKALLFSLVNRKKYPIFEQNHPLLVKNPHDLVPFLELKLYVDGQVPDF  132

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +     R+++THLP   LPKSV +S+ K+VYLCRNP+DT +S WHF N LR  L  ++  
Sbjct  133   SSFTPPRIMSTHLPYDSLPKSVQDSRTKLVYLCRNPRDTFISMWHFTNNLR--LDYIDTN  190

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E FD +C+GV   GPFW+HV +YW + +E P KV+FL YEE+K++P + L+R+A FL
Sbjct  191   SIEEMFDHFCKGVSLYGPFWNHVLDYWGKRIEKPKKVIFLMYEEIKEKPTIQLKRLAEFL  250

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
               PFS EEE CGV+  ILR+CSF++LSNL+VN   +NG L  G E  + FR+G+VGDW +
Sbjct  251   EFPFSIEEENCGVIDEILRMCSFDNLSNLDVN---INGKLSTGEETKMFFRRGEVGDWKH  307

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             + T EM+ +L+ I+++KF G+GL
Sbjct  308   YFTLEMSEKLNHIIKQKFHGSGL  330



>ref|XP_004239020.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum lycopersicum]
Length=336

 Score =   341 bits (874),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 167/323 (52%), Positives = 225/323 (70%), Gaps = 7/323 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE+  +E+ ++ L++LPKE GW+   +YNY+GFW  P  +QG +   + +Q QD+DI
Sbjct  13    KYLQEDDVSEDCKKLLSTLPKERGWVGSYVYNYQGFWALPRLIQGVIACQRQYQAQDNDI  72

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL T PKSGT WLKAL F+L+ RK++   ++ HPL   NPHDL+P LE   Y   + PDF
Sbjct  73    ILVTAPKSGTTWLKALLFSLVNRKKYPVFEKNHPLLVKNPHDLVPLLEQDLYVDGQVPDF  132

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +L     L+ATH+P + LPKSV  S+ K+VYLCRNP+DT +S W F N LR +    +  
Sbjct  133   SLFTSPTLIATHVPFASLPKSVQNSRTKLVYLCRNPRDTFISMWQFTNNLRLD-SHRDTN  191

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E FD +C+GV   GPFWDHV  YWKES+EN  KVLFL YEE+KK+P++ L+R+A FL
Sbjct  192   SIEEMFDHFCKGVGLYGPFWDHVLGYWKESIENSDKVLFLMYEEIKKQPKIQLKRLAEFL  251

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
              CPFS EEE+C VV  ILR+CSF +L NLEVN   VNG++  G+ N   FR+G+VGDW N
Sbjct  252   DCPFSIEEEDCRVVDEILRMCSFGNLRNLEVN---VNGNMSAGMANKNFFRRGEVGDWKN  308

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             + T EM  RL+ I+++KF G+GL
Sbjct  309   YFTVEMNDRLNHIIEQKFHGSGL  331



>ref|XP_009620812.1| PREDICTED: cytosolic sulfotransferase 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=378

 Score =   342 bits (878),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 172/319 (54%), Positives = 229/319 (72%), Gaps = 7/319 (2%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             L+EN +++ F++ L+SLPK  GWL+P LY Y+GFWL    L G L+    FQ QDSDI+L
Sbjct  48    LEENGFSQTFKDLLSSLPKAKGWLSPHLYKYQGFWLTALHLHGTLSFQHCFQAQDSDILL  107

Query  253   STFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKER---PDF  423
              T PKSGT+WLKA+ F LI R       + HPL T NPHDL+PFLEL+YA ++    P+ 
Sbjct  108   ITSPKSGTIWLKAMVFTLINRMSHPILSQEHPLLTINPHDLVPFLELNYAQEKNPISPNS  167

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +LT+   L +THLP   LP+SV  +K K++Y+CRNP+DT VS WH+++KLRS+    + +
Sbjct  168   SLTSPG-LYSTHLPYVSLPESVKNTKCKIIYMCRNPRDTFVSLWHYISKLRSQ--DSKMI  224

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
             PF EAFD +C G+   GPFWDHV  YW++SLE P KV FLKYEE+K++P +HL+ +A FL
Sbjct  225   PFEEAFDMFCNGLTMAGPFWDHVLSYWEKSLEMPQKVFFLKYEEVKEQPCLHLKCLAEFL  284

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHM  963
               PFS EEEE G+++ I++LCSFE+LSNLEVNK S     G +N V FRKG+VGDW NH+
Sbjct  285   ERPFSLEEEESGLMNEIIKLCSFENLSNLEVNK-SGKTVFGNDNRVFFRKGEVGDWKNHL  343

Query  964   TEEMARRLDQIVQEKFTGT  1020
             T EM  RL+QI ++KF G+
Sbjct  344   TTEMVDRLNQITEDKFNGS  362



>ref|XP_006348798.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=329

 Score =   340 bits (873),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 167/323 (52%), Positives = 226/323 (70%), Gaps = 8/323 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE+S +EE ++ L+ LPKE GW+   +YNY+G W  P  LQG +   Q FQ +DSD+
Sbjct  7     KYLQEDSLSEECKKLLSILPKEKGWVGSYIYNYQGCWTPPRLLQGVIACQQQFQAEDSDV  66

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL T PKSGT WLK+L FAL+ R +    +  HPL  NNPH L+PFLE + Y   + PDF
Sbjct  67    ILVTTPKSGTTWLKSLLFALMNRVKHPMFEPNHPLLVNNPHVLVPFLEHTLYVDGQVPDF  126

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +     RLLATH+P + LPKS+ +S+ K++YLCRNPKDT +S WHF N LR  L   +  
Sbjct  127   STFTSPRLLATHVPFASLPKSIMDSRTKLIYLCRNPKDTFISMWHFANNLR--LHHKDTN  184

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E FD +C G+   GPFW+HV +YWK+S+ENP K+ FL YEE+K++P++ L+R+A +L
Sbjct  185   SIHEMFDLFCEGLSLYGPFWNHVLDYWKQSIENPNKMFFLMYEEIKEKPKIQLKRLAEYL  244

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
              CPFS EEE CGV++ ILR+CSFE+L NLEVN    NG L  G  N V FR+G++GDW N
Sbjct  245   ECPFSMEEENCGVLNEILRMCSFENLRNLEVN---TNGKLSTGEGNKVFFRRGEIGDWRN  301

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             + T EM+ +L+ I++EKF G+GL
Sbjct  302   YFTTEMSDKLNHIIEEKFQGSGL  324



>ref|XP_006437857.1| hypothetical protein CICLE_v10031848mg [Citrus clementina]
 gb|ESR51097.1| hypothetical protein CICLE_v10031848mg [Citrus clementina]
Length=377

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 218/325 (67%), Gaps = 10/325 (3%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE+  T+E RE ++SLP ETGW+   LY Y+GFW     LQG L   +HFQ QDSDI
Sbjct  56    KYLQEDELTQECRELISSLPAETGWVVDHLYQYQGFWHTSRELQGVLACQKHFQAQDSDI  115

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             +L T PK+GT WLKA+ FA++ R +++     HPL TNNPH+L+PF+EL  Y   + PD 
Sbjct  116   LLVTTPKAGTTWLKAITFAIVNRLRYVDNPCNHPLLTNNPHELVPFIELKLYVDNQVPDL  175

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKG--KVVYLCRNPKDTVVSFWHFMNKLRSELRGLE  597
                   RL ATHLP   LP SV +S    K+VYLCRNPKD  VS WHF NKLR E +G  
Sbjct  176   TTLTSPRLFATHLPFVSLPASVKDSSSACKLVYLCRNPKDIFVSLWHFTNKLRPEEKGTN  235

Query  598   AMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAA  777
             ++   E FD +CRGV   GPFWDH+  YWK S+E P +V FLKYEE+K++P + L+ +A 
Sbjct  236   SL--EETFDKFCRGVSLYGPFWDHILGYWKASMEKPDRVFFLKYEELKEQPSLRLKMLAE  293

Query  778   FLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENG--VLFRKGKVGDW  951
             F GCPFS  EE  G+V  IL+LCSF++LSNLEVN+   NG +    G    FR+G VGDW
Sbjct  294   FWGCPFSPAEEANGLVDDILKLCSFDNLSNLEVNR---NGKMSSGEGYNTFFRRGVVGDW  350

Query  952   SNHMTEEMARRLDQIVQEKFTGTGL  1026
              N++T EM  RLDQI+++K  G GL
Sbjct  351   MNYLTPEMVGRLDQIIEQKLHGFGL  375



>ref|XP_010039273.1| PREDICTED: cytosolic sulfotransferase 5-like [Eucalyptus grandis]
 gb|KCW49987.1| hypothetical protein EUGRSUZ_K03444 [Eucalyptus grandis]
Length=331

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/320 (53%), Positives = 222/320 (69%), Gaps = 6/320 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             ++   ++  ++ L SLP E  WL P L  Y+GFW     L+G L    HFQ Q SDI+L 
Sbjct  13    RDEETSQACKDLLISLPLEEDWLVPTLCLYQGFWFPSHLLKGVLAFQNHFQAQPSDILLV  72

Query  256   TFPKSGTVWLKALAFALITRKQF--LAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA  426
             T PKSGT WLKA+ F+L+ R ++  L  Q+ HPL T NPHDL+PFL++  Y  +E PD A
Sbjct  73    TSPKSGTTWLKAVLFSLLNRAKYSDLDSQQPHPLLTQNPHDLVPFLDVKLYLEQENPDLA  132

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
                  RL ATHLP S LP+SV +S  K+VYLCRNPKD +VS WHF NK++++ +G   +P
Sbjct  133   AFASPRLFATHLPFSSLPRSVRDSTCKLVYLCRNPKDVLVSLWHFTNKVKAKEKG--QIP  190

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
              PE  D + RG+   GP+W+HV +Y K S E PGKVLFL YEEM ++P V LRR+A FLG
Sbjct  191   LPECLDKFSRGLSLYGPYWEHVLDYHKASSEMPGKVLFLMYEEMTEDPHVQLRRLADFLG  250

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMT  966
             CPFSEEE + G V GILR+CSF++LS LEVNK S  G LGVEN   FR+G+VGDW N+M+
Sbjct  251   CPFSEEELKDGTVEGILRMCSFDNLSALEVNK-SEKGSLGVENKWFFRRGEVGDWGNYMS  309

Query  967   EEMARRLDQIVQEKFTGTGL  1026
              +M +R+D +++EKF G+GL
Sbjct  310   ADMGKRIDSVMEEKFHGSGL  329



>ref|XP_008352940.1| PREDICTED: cytosolic sulfotransferase 12-like [Malus domestica]
Length=332

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/322 (54%), Positives = 215/322 (67%), Gaps = 6/322 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE   ++E ++ + SLP E  W+   L+ Y GFWL    +QG L   +HFQ  DSDI
Sbjct  13    RYLQEKELSQEDKDDIFSLPTEKAWVAHGLHKYHGFWLSTKQMQGVLACQKHFQAVDSDI  72

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKER--PD  420
             +L T PKSGT WL+AL FAL+ R  +L  Q  HPL T NPH L+P LE       +  PD
Sbjct  73    VLVTTPKSGTTWLQALLFALVKRAHYLDPQR-HPLLTENPHVLVPNLEFDIYTDRQVLPD  131

Query  421   FALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEA  600
              +     RL++THLP   LP SV  S  KVVY+CR+PKD  VS WHF NKLR    G   
Sbjct  132   LSSLARPRLISTHLPYVCLPDSVKHSGCKVVYVCRDPKDVFVSLWHFSNKLRPVGSG--T  189

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAF  780
             M   EAFD +CRGV  +GPFWDHV  +WKESL+ P    F+K+EEMK+EP +HLRR+A F
Sbjct  190   MSLDEAFDKFCRGVNTSGPFWDHVLGFWKESLKRPESAFFIKFEEMKQEPALHLRRLAKF  249

Query  781   LGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNH  960
             LGCPFS EEE  GVV GILRLCSFE+LSNL+VNK+ +    G+E    FRKG+VGDW N+
Sbjct  250   LGCPFSPEEETHGVVDGILRLCSFENLSNLDVNKSGILSS-GMEKSAFFRKGEVGDWMNY  308

Query  961   MTEEMARRLDQIVQEKFTGTGL  1026
             +T EM ++LD I QEKF G+GL
Sbjct  309   LTTEMVKKLDSITQEKFHGSGL  330



>ref|XP_003628738.1| Flavonol sulfotransferase-like protein [Medicago truncatula]
 gb|AET03214.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=333

 Score =   338 bits (868),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 174/324 (54%), Positives = 221/324 (68%), Gaps = 9/324 (3%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++L+E+   +E ++ + +LP   GW+ P  + Y+GFW  P  LQGAL+  +HFQ  D+DI
Sbjct  13    KYLKEDDLGQECKDLIQTLPLVEGWIDPTFHEYQGFWFAPKILQGALSFQKHFQAIDTDI  72

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS--YAAKERPD  420
             IL T PKSGT WLKAL FALI R ++    + HPL T+NPH L+PF+E++  Y     P+
Sbjct  73    ILVTNPKSGTTWLKALTFALINRNKYPNIHKNHPLLTSNPHVLVPFMEINLYYETDIVPE  132

Query  421   FALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEA  600
                 +  R+ +TH P  LLPKS+ ES  KVVYLCR+PKDT VS WHF NKLR + RG   
Sbjct  133   LNSLSPPRIFSTHNPYVLLPKSLKESNCKVVYLCRDPKDTFVSLWHFSNKLREQSRG--T  190

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAF  780
             +P  EAF+S+CRG  + GPFWDHV  YWKESLE P KV+FLKYEEMK +P   L+ +A F
Sbjct  191   LPLEEAFESFCRGTTSYGPFWDHVLGYWKESLERPEKVMFLKYEEMKMKPNFVLKEIAKF  250

Query  781   LGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLG--VENGVLFRKGKVGDWS  954
             LGCPFSEEEE  GVV  IL LCSFE LSNLE+NK   NG +   +EN   FR GKVGDW 
Sbjct  251   LGCPFSEEEESNGVVDDILHLCSFEKLSNLEINK---NGKISSEIENKNFFRLGKVGDWK  307

Query  955   NHMTEEMARRLDQIVQEKFTGTGL  1026
             N +T +M  +L+ +V+EKF   GL
Sbjct  308   NLLTTKMVEQLNIVVEEKFGKHGL  331



>ref|XP_011102114.1| PREDICTED: cytosolic sulfotransferase 12-like [Sesamum indicum]
Length=329

 Score =   337 bits (865),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 169/323 (52%), Positives = 223/323 (69%), Gaps = 9/323 (3%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             QE + T+E + F+++LPKE GWL   LY Y+GFW     LQG ++  +HFQ Q+SDI L 
Sbjct  12    QEETLTQECKNFISTLPKERGWLASHLYQYQGFWYPVRHLQGVISCQKHFQAQNSDIFLV  71

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALT  432
             T PKSGT WLKA+ F L+ R ++    + HPL +NNPHDL+PFLE+  Y   + PDF+  
Sbjct  72    TTPKSGTTWLKAIIFTLVNRTRYPPVAKNHPLLSNNPHDLVPFLEIKLYVDNQIPDFSSF  131

Query  433   NGSRLLATHLPVSLLPKSVWE-SKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
                RL +TH P   LP+S+ + S  K+VYLCRNPKD  VS WHF N+LR +  G  ++  
Sbjct  132   PSLRLFSTHSPHVSLPESIKQNSACKIVYLCRNPKDIFVSLWHFTNELRPQETGTNSI--  189

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
              E FD +CRGV   GPFW+H  EYWK S+ENP +VLFLK+E+MK +P  HLRR+A FLG 
Sbjct  190   SEVFDLFCRGVTLFGPFWEHALEYWKLSIENPDRVLFLKFEDMKNQPGTHLRRLAEFLGS  249

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHM  963
             PFS  EEE G+V  IL+LCSF++LS L++N+   NG L  G EN V FR+G VGDW N++
Sbjct  250   PFSAGEEESGLVEEILKLCSFDNLSALDINR---NGKLTSGEENKVFFRRGVVGDWKNYL  306

Query  964   TEEMARRLDQIVQEKFTGTGLML  1032
               EM  R+D+I QEKF+G+GL++
Sbjct  307   GSEMVERIDRITQEKFSGSGLVI  329



>ref|XP_011102095.1| PREDICTED: cytosolic sulfotransferase 12-like [Sesamum indicum]
Length=329

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 169/323 (52%), Positives = 223/323 (69%), Gaps = 9/323 (3%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             QE + T+E + F+++LPKE GWL   LY Y+GFW     LQG ++  +HFQ Q+SDI L 
Sbjct  12    QEETLTQECKIFISTLPKERGWLASHLYQYQGFWYPVRHLQGVISCQKHFQAQNSDIFLV  71

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALT  432
             T PKSGT WLKA+ F L+ R ++    + HPL +NNPHDL+PFLE+  Y   + PDF+  
Sbjct  72    TTPKSGTTWLKAIIFTLVNRTRYPPVAKNHPLLSNNPHDLVPFLEIKLYVDNQIPDFSSF  131

Query  433   NGSRLLATHLPVSLLPKSVWE-SKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
                RL +TH P   LP+S+ + S  K+VYLCRNPKD  VS WHF N+LR +  G  ++  
Sbjct  132   PSLRLFSTHSPHVSLPESIKQNSACKIVYLCRNPKDIFVSLWHFTNELRPQETGTNSI--  189

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
              E FD +CRGV   GPFW+H  EYWK S+ENP +VLFLK+E+MK +P  HLRR+A FLG 
Sbjct  190   SEVFDLFCRGVTLFGPFWEHALEYWKLSIENPDRVLFLKFEDMKNQPGTHLRRLAEFLGS  249

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHM  963
             PFS  EEE G+V  IL+LCSF++LS L++N+   NG L  G EN V FR+G VGDW N++
Sbjct  250   PFSAGEEESGLVEEILKLCSFDNLSALDINR---NGKLTSGEENKVFFRRGVVGDWKNYL  306

Query  964   TEEMARRLDQIVQEKFTGTGLML  1032
               EM  R+D+I QEKF+G+GL++
Sbjct  307   GSEMVERIDRITQEKFSGSGLVI  329



>ref|XP_006378523.1| sulfotransferase family protein [Populus trichocarpa]
 gb|ERP56320.1| sulfotransferase family protein [Populus trichocarpa]
Length=316

 Score =   336 bits (862),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/320 (54%), Positives = 214/320 (67%), Gaps = 8/320 (3%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             +QEN  ++EF++ + S+P E GW+   L+ Y+GFW     LQG L   +HFQ QD DI L
Sbjct  1     MQENETSQEFKDLIASMPTEKGWMAKHLHRYQGFWHSTRQLQGVLVCQKHFQAQDGDIFL  60

Query  253   STFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALT  432
              T PKSG+ WLKA+ F+L+ R  F  + + HPL TNNPH L+PFLE+ Y  KE  DF   
Sbjct  61    VTTPKSGSTWLKAVMFSLVNRVSF-PDTKQHPLLTNNPHALVPFLEMEYIGKENLDFTNF  119

Query  433   NGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFP  612
                RL +THLP+  LP+SV +S  K+VYLCRNPKDT VSFWHF NKLR       A    
Sbjct  120   TFPRLFSTHLPLLSLPRSVEDSDCKLVYLCRNPKDTFVSFWHFTNKLRP--IDWSATSLE  177

Query  613   EAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCP  792
             E FD +CRGV   GPFWDHV  YWKESLE P +V F+KYEEMK EP + LRR++ FLGCP
Sbjct  178   ETFDKFCRGVSLYGPFWDHVLGYWKESLERPQRVFFMKYEEMKNEPRIQLRRLSEFLGCP  237

Query  793   FSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHMT  966
             FS EEE  GV+  IL LCSFE+LSNLEVNK    G L  G E+ V FR+G+VGD  N++T
Sbjct  238   FSLEEENSGVLDEILELCSFENLSNLEVNKI---GKLHSGQEHQVFFRRGEVGDSMNYLT  294

Query  967   EEMARRLDQIVQEKFTGTGL  1026
              EM  ++D I ++K    GL
Sbjct  295   AEMVGKIDMITEQKLHCHGL  314



>ref|XP_007045763.1| Flavonol 4'-sulfotransferase, putative [Theobroma cacao]
 gb|EOY01595.1| Flavonol 4'-sulfotransferase, putative [Theobroma cacao]
Length=395

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 216/324 (67%), Gaps = 8/324 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE   T+E R+ + SLP E GW+   L+ Y+GFW     L   LT    FQ QD+DI
Sbjct  76    KYLQEECLTQERRQLIASLPTEKGWVANHLHQYQGFWHTTRQLLAVLTCQNQFQAQDTDI  135

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             +L T PKSGT WLKA+ FAL+ R Q+   +  HPL   NPH L+PFLEL  Y      DF
Sbjct  136   LLVTTPKSGTTWLKAIVFALMNRVQYPNPEVKHPLLAENPHVLVPFLELELYIDNRVADF  195

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
                   RL  THLP+  LP SV  S  K+VYLCRNPKDT VS WHF NKLR++  G  ++
Sbjct  196   TTFTSPRLFGTHLPLVSLPDSVKNSACKLVYLCRNPKDTFVSLWHFTNKLRTKDMGENSL  255

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E FD +CRGVC  GPFWDHV EYWKESL+ P +VLFLKYEE+K++P+V L R+A FL
Sbjct  256   E--ETFDKFCRGVCLYGPFWDHVLEYWKESLKKPERVLFLKYEEIKEQPKVQLVRLAQFL  313

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
             GCPFS +EE  GVV  IL+LCSF++LSNLEVNKT   G L  G E    FR+G+VGD  N
Sbjct  314   GCPFSAQEETNGVVDEILKLCSFDTLSNLEVNKT---GKLVSGEEYKAFFRRGEVGDAKN  370

Query  958   HMTEEMARRLDQIVQEKFTGTGLM  1029
             H+T +M  +LDQI Q+K   +GL+
Sbjct  371   HLTPQMMEKLDQITQDKLHDSGLI  394



>ref|XP_011009587.1| PREDICTED: cytosolic sulfotransferase 12-like [Populus euphratica]
Length=329

 Score =   334 bits (857),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 173/321 (54%), Positives = 214/321 (67%), Gaps = 8/321 (2%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             +LQEN  ++EF++ + SLP E GW+   L+ Y+GFW     L G L   +HFQ QD DI 
Sbjct  13    YLQENETSQEFKDLIVSLPTEKGWMAKHLHQYQGFWHTTRQLTGVLACQKHFQAQDGDIF  72

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFAL  429
             L T PKSG+ WLKA+ F+L+ R  F  + + HPL TNNPH L+PFLE+ Y  KE  DF  
Sbjct  73    LVTNPKSGSTWLKAVMFSLVNRVSF-PDTKQHPLLTNNPHALMPFLEMEYVGKENLDFTS  131

Query  430   TNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
                 RL +THLP+  LP+SV +S  K+VYLCRNPKDT VS WHF NKLR    G  +   
Sbjct  132   FTFPRLFSTHLPLLSLPRSVEDSDCKLVYLCRNPKDTFVSLWHFTNKLRPIDWG--STSL  189

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
              E FD +CRGVC  GPFWDHV  YWKESLE P +V FLKYEEMK EP + LRR++ FLGC
Sbjct  190   EETFDKFCRGVCLYGPFWDHVLGYWKESLERPQRVFFLKYEEMKNEPRMQLRRLSEFLGC  249

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHM  963
             PF+ EEE  GV+  IL LCSFE+LSNLEVNK    G L  G E+   FR+G+VGD  N++
Sbjct  250   PFTLEEENSGVLDEILELCSFENLSNLEVNKI---GRLHSGQEHQAFFRRGEVGDSMNYL  306

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             T EM  ++D I ++K    GL
Sbjct  307   TAEMVEKIDMITEQKLHCHGL  327



>ref|XP_006339391.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=329

 Score =   333 bits (854),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 225/323 (70%), Gaps = 8/323 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++L+E++ +EE ++ L++LPKE GWL    YNY+GFW+   FLQ  +   Q FQ QDSDI
Sbjct  7     KYLEEDNLSEETKKLLSTLPKEKGWLGSYAYNYQGFWVPQKFLQAVIAFQQQFQVQDSDI  66

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL T PKSGT WLK+L FAL+ R +    +  HPL   NPH L+PFLE + Y      D 
Sbjct  67    ILVTTPKSGTTWLKSLLFALVNRVKHPIFESNHPLLVENPHVLVPFLEHTLYFDGRTVDI  126

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +     RLLATH+P + LPKSV  SK K+VYLCRNP+DT +S WHF N L  + +  +++
Sbjct  127   STFTSPRLLATHVPFASLPKSVQVSKSKLVYLCRNPRDTFISMWHFTNNLLPDHKDTDSI  186

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E F+ +C+GV   GPFW+HV +YWK+S+ENP K+LFL YEE+KK+P++ L+R+A FL
Sbjct  187   E--EMFNLFCKGVSLYGPFWNHVLDYWKQSIENPNKILFLMYEEIKKKPKIQLKRLAEFL  244

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
              CPFS EEE  GVV  IL++CSFE+LSNLEVN+   NG    G    V FR+G++GDW+N
Sbjct  245   ECPFSIEEENSGVVDDILKMCSFENLSNLEVNR---NGKFSTGEAYKVFFRRGEIGDWNN  301

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             + T EM+ +L+ I++EKF G+GL
Sbjct  302   YFTIEMSDKLNHIIEEKFQGSGL  324



>ref|XP_002512030.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
 gb|EEF50699.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
Length=354

 Score =   333 bits (854),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 170/323 (53%), Positives = 217/323 (67%), Gaps = 7/323 (2%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             +LQE   ++E R+ + SLP E GW+   L+ Y+GFW     L+G +    HFQ Q+SDI 
Sbjct  37    YLQEKDLSQECRDLIVSLPAEKGWVANYLHQYQGFWHTTRQLKGVIACQNHFQAQESDIF  96

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFAL  429
             L T PKSGT WLKA+ FAL+ RK F   ++ HPL TNNPH L+PFLE  Y   + PDF  
Sbjct  97    LVTTPKSGTTWLKAIMFALVNRKHFSDTKQQHPLLTNNPHVLVPFLEHQYIDTQLPDFTS  156

Query  430   TNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
                 RL +THLP + LPKSV +   K+VYLCRNPKDT VS WHF NKLR + +G  ++  
Sbjct  157   FTSPRLFSTHLPFASLPKSVEDWGCKLVYLCRNPKDTFVSLWHFTNKLRPKEKGENSL--  214

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
              E FD +CRGV   GPFWDHV  YWK+SLE P +VLFLKYE+ K+EP+ HL +++ FL C
Sbjct  215   EETFDKFCRGVSLYGPFWDHVLGYWKQSLEKPERVLFLKYEDFKEEPKGHLMKLSEFLNC  274

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHM  963
             PFS+EEE  G +  IL LCSF+ LSNLEVNKT   G L  G EN   FR+G+VGD  +H+
Sbjct  275   PFSQEEESSGAMDEILNLCSFDYLSNLEVNKT---GKLPSGEENSAFFRRGQVGDSKSHL  331

Query  964   TEEMARRLDQIVQEKFTGTGLML  1032
             + EM+ ++D I +EK   +GL L
Sbjct  332   SAEMSEKMDHITKEKLQVSGLNL  354



>emb|CDP00476.1| unnamed protein product [Coffea canephora]
Length=333

 Score =   332 bits (852),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 221/325 (68%), Gaps = 9/325 (3%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQ++  T+E  E L SLPKE GW++  LY Y+GFW     LQG +   +HF+ QDSDI
Sbjct  15    KYLQDDKLTQECEELLPSLPKEKGWVSSYLYQYRGFWHSARQLQGVVACQKHFEAQDSDI  74

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
              L T PKSGT WLKAL FAL+ R QF +  E HPL  ++PH+L+P+L+ + Y   + PD 
Sbjct  75    FLVTTPKSGTTWLKALLFALVNRMQF-SFMEQHPLLMHSPHELVPYLDSNIYVENQTPDL  133

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +     RL ATHLP+  LP+SV E   K+VYLCR+PKDT VS WHF NKLR  L  +E+ 
Sbjct  134   SSFTSPRLFATHLPLVSLPQSVHECPCKIVYLCRDPKDTFVSLWHFANKLR--LENMESN  191

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                + FD +C+GV   GPFWDHV  YWKESLENP KVLFLKYE++K++P   L++++ FL
Sbjct  192   SLEDVFDRFCKGVSVYGPFWDHVLGYWKESLENPDKVLFLKYEDLKEKPTSQLKKISDFL  251

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
             G PFS EEE  G++ GI+ LCSF+ LSNLEVNK+   G L  G EN   FR+G+VGDW  
Sbjct  252   GYPFSSEEEASGLLEGIIDLCSFDKLSNLEVNKS---GKLSSGEENKAFFRRGEVGDWMK  308

Query  958   HMTEEMARRLDQIVQEKFTGTGLML  1032
              +  +M  RL+ I Q+KF  +GL L
Sbjct  309   FLNAKMVARLNSITQQKFDASGLKL  333



>ref|XP_004239455.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum lycopersicum]
Length=332

 Score =   332 bits (852),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 174/323 (54%), Positives = 223/323 (69%), Gaps = 8/323 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE   +EE+++F ++LPKE GW+   +YNY+GFW     +QG +   Q FQ QDSDI
Sbjct  10    KYLQEEP-SEEWKKFFSTLPKEKGWIESTIYNYQGFWSSSRSIQGVIAFQQQFQAQDSDI  68

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL T PKSG+VWLK+L FAL+ RK     Q+ HPL   NPHDL+ FLEL  YA  + PDF
Sbjct  69    ILVTSPKSGSVWLKSLLFALVNRKNNPISQQDHPLLVKNPHDLVLFLELDLYADDQVPDF  128

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +L    RL+ATH+P + LPKSV  S+ K+VYLCRNPKD  +S W F N LR +    +  
Sbjct  129   SLFTSPRLMATHVPFASLPKSVQNSRTKLVYLCRNPKDAFISMWQFANNLRLD-NHKDTN  187

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E FD +C+GV   GPFWDHV  YWKES ENP KV FL YEE+KK+P+++L+R+A FL
Sbjct  188   SIEEMFDHFCKGVSIYGPFWDHVLGYWKESKENPDKVFFLMYEEIKKQPKIYLKRLAEFL  247

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
              CPFS+EEE CGVV  ILRLCSF +L NLEVN   VNG +  G+ N   FR+G+VGDW N
Sbjct  248   KCPFSKEEENCGVVDEILRLCSFGNLRNLEVN---VNGKMLTGIANKNFFRQGEVGDWKN  304

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             + T EM  +L+ I+++KF   GL
Sbjct  305   YFTVEMNDKLNHIIEQKFQRCGL  327



>ref|XP_008339764.1| PREDICTED: cytosolic sulfotransferase 12-like [Malus domestica]
Length=332

 Score =   332 bits (851),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 215/324 (66%), Gaps = 10/324 (3%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE   ++E ++F+ SLP E GW+   L+ Y GFWL    + G L   +HFQ  DSDI
Sbjct  13    RYLQEKEXSQEDKDFIFSLPTEKGWVADGLHKYHGFWLSTKQMHGVLACQKHFQAVDSDI  72

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKER--PD  420
             +L T  KSGT WLKAL FAL+ R  +L  Q  HPL T NPH L+P LE      ++  PD
Sbjct  73    VLVTTVKSGTTWLKALMFALVKRAHYLDPQR-HPLLTENPHVLVPCLEFDVYTDKQVLPD  131

Query  421   FALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEA  600
              +  +  RL++THLP   LP SV  S  KVVY  R+PKD  VS WHF NKLR    G   
Sbjct  132   LSSLSRPRLISTHLPYVCLPDSVKHSGCKVVYAWRDPKDVFVSLWHFSNKLRPVGSG--T  189

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAF  780
             M   EAFD +CRGV  +GPFWDHV  +WKESL+ P    F+KYEEMK+EP +HLRR+A F
Sbjct  190   MSLDEAFDKFCRGVNTSGPFWDHVLGFWKESLKRPESXFFIKYEEMKEEPALHLRRLAEF  249

Query  781   LGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWS  954
             LGCPFS EEE  GVV GILRLCSF++LSNL VNK+   G L  G+EN   FRKG+VGDW 
Sbjct  250   LGCPFSPEEETHGVVDGILRLCSFDNLSNLVVNKS---GKLPAGIENSAFFRKGEVGDWM  306

Query  955   NHMTEEMARRLDQIVQEKFTGTGL  1026
             N++T EM ++LD I QEK  G+GL
Sbjct  307   NNLTPEMVKKLDSITQEKLHGSGL  330



>ref|XP_010051374.1| PREDICTED: cytosolic sulfotransferase 5-like [Eucalyptus grandis]
 gb|KCW81880.1| hypothetical protein EUGRSUZ_C03239 [Eucalyptus grandis]
Length=315

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 166/318 (52%), Positives = 213/318 (67%), Gaps = 10/318 (3%)
 Frame = +1

Query  94    EEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSG  273
             + F++  +SLP E  W+T     Y+GFWL P   +G LT   HFQ   SDI+L T PKSG
Sbjct  3     QAFKDLFSSLPSEEDWITASFRLYQGFWLSPRLFKGILTCQNHFQAHPSDILLVTSPKSG  62

Query  274   TVWLKALAFALITRKQFLAE--QETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSR  444
             T WLKA+ FAL+ R ++     Q+ HPL T N HDL+PFLEL+ Y  +E PD       R
Sbjct  63    TTWLKAILFALLNRAKYSDSDSQQRHPLLTQNSHDLVPFLELNLYLGQENPDLTAIASPR  122

Query  445   LLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFD  624
             L ATH+P SLLP+SV +S  K+VYLCRNPKDT VS WHF N++R E +G   +P  E  D
Sbjct  123   LFATHMPYSLLPQSVRDSNCKLVYLCRNPKDTFVSTWHFANRMRPEEKG--QIPIQEGLD  180

Query  625   SYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSee  804
              +CRGV   GP+WDHV  Y K SL+ P KVLF+ YE+MK +P VH+RR+A FLGCPFS+E
Sbjct  181   KFCRGVSVCGPYWDHVLGYHKASLDMPEKVLFMMYEQMKVDPHVHVRRLADFLGCPFSKE  240

Query  805   eeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHMTEEMA  978
             E   G V GIL++CSF+++S LEVNK    G L  G E    FR+G+VGDW N+M+ EM 
Sbjct  241   ELRDGTVEGILKMCSFDNMSALEVNKC---GKLWTGAETKWFFRRGEVGDWVNYMSSEMG  297

Query  979   RRLDQIVQEKFTGTGLML  1032
              R+D +++EK  G+GL L
Sbjct  298   ERIDGVMEEKLHGSGLKL  315



>ref|XP_004240284.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum lycopersicum]
Length=329

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 169/323 (52%), Positives = 219/323 (68%), Gaps = 8/323 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE++ +EE ++ L  LPKE GW+   +YNY+G W+ P  LQG +   Q FQ +DSDI
Sbjct  7     RYLQEDNLSEECKKLLRILPKEKGWIGSYIYNYQGCWIPPRLLQGMIACQQRFQAEDSDI  66

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL T PKSGT WLK+L FALI R +    +  HPL   +PH L+PFLE + Y   + PDF
Sbjct  67    ILVTTPKSGTTWLKSLLFALIYRVKHPIFEPNHPLLVKSPHVLVPFLEHTLYVDGQVPDF  126

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +     RL ATH+P + LPKSV  SK K+VYLCRNPKDT VS WHF N LR  L   +  
Sbjct  127   STFTSPRLFATHVPFASLPKSVLVSKTKLVYLCRNPKDTFVSMWHFANNLR--LHHKDTS  184

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E FD +C G+   GPFW+HV +YWK+S+ENP KV FL YEE+K++P++ L+R+A FL
Sbjct  185   SIHEMFDLFCEGLSIYGPFWNHVLDYWKQSIENPNKVFFLMYEEIKEKPKIQLKRLAEFL  244

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
               PFS EEE CGVV  ILR+CSFE+L +LEVN    NG L  G  N   FR+G++GDW N
Sbjct  245   KIPFSIEEENCGVVDEILRVCSFENLRSLEVN---TNGKLSTGEGNKAFFRRGEIGDWRN  301

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             + T EM  +L+ I++EKF G+GL
Sbjct  302   YFTTEMNYKLNHIIEEKFQGSGL  324



>ref|XP_010046610.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 gb|KCW86457.1| hypothetical protein EUGRSUZ_B03124 [Eucalyptus grandis]
Length=330

 Score =   330 bits (847),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/325 (52%), Positives = 223/325 (69%), Gaps = 6/325 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQ++  ++E R+ L SLP E GW+   L+ Y+GFW+ P  L+G L   +HF+ QD+DI
Sbjct  9     KYLQDDDVSQECRDLLPSLPSEQGWVGTTLHLYQGFWVGPRHLKGVLACQRHFRAQDTDI  68

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAE--QETHPLHTNNPHDLIPFLELS-YAAKERP  417
             +L T PKSGT WLKA+ FAL+ R ++     Q  HPL  +NPHDL+PFLEL  Y  ++ P
Sbjct  69    LLVTTPKSGTTWLKAILFALLNRTKYSGSGSQGQHPLLNHNPHDLVPFLELKLYVEQDTP  128

Query  418   DFALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLE  597
             D A     RL ATHLP   LP+ V +SK K+VYLCRNPKDT VS WHF NKLR + RG  
Sbjct  129   DLASLPPPRLFATHLPYQSLPQPVRDSKCKLVYLCRNPKDTCVSLWHFTNKLRPKERGEN  188

Query  598   AMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAA  777
             ++   E+ D +CRGV   GP+WDHV  Y K S E P KVLFLKYE+MK++P  +LRR+A 
Sbjct  189   SLQ--ESLDRFCRGVSLFGPYWDHVLGYHKASSETPEKVLFLKYEDMKEDPYANLRRLAG  246

Query  778   FLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSN  957
             FL CPFS+EE   G+V  ILRLCSF++LS LEVNK       G EN   FR+G+VGDW N
Sbjct  247   FLECPFSQEELREGMVDEILRLCSFDNLSGLEVNKRGKLAS-GEENKAFFRRGEVGDWVN  305

Query  958   HMTEEMARRLDQIVQEKFTGTGLML  1032
             +++ ++A ++D++ +EK  G+GL L
Sbjct  306   YLSVDIAEKIDRVGEEKLHGSGLKL  330



>ref|XP_011009569.1| PREDICTED: cytosolic sulfotransferase 5-like [Populus euphratica]
 ref|XP_011009576.1| PREDICTED: cytosolic sulfotransferase 5-like [Populus euphratica]
Length=329

 Score =   330 bits (845),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 173/323 (54%), Positives = 214/323 (66%), Gaps = 12/323 (4%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             +LQEN  ++EF++ + SLP E GW+   L+ Y+GFW     LQG L   +HFQ QD DI 
Sbjct  13    YLQENETSQEFKDLIVSLPTEKGWMAKHLHQYQGFWHTTRQLQGVLACQKHFQAQDGDIF  72

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFAL  429
             L T PKSG+ WLKA+ FAL+ R  F  + + HPL TNNPH L+PFLE+ Y  KE  DF  
Sbjct  73    LVTTPKSGSTWLKAVMFALVNRVSF-PDTKQHPLLTNNPHALMPFLEMEYIGKETLDFTN  131

Query  430   TNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP-  606
                 RL +THLP+  LP+SV +S  K+VYLCRNPKD  VS WHF NKLR     ++ +P 
Sbjct  132   FTFPRLFSTHLPLLSLPRSVEDSDCKLVYLCRNPKDIFVSLWHFTNKLRP----IDWVPS  187

Query  607   -FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E FD +CRGV   GPFWDHV  YWKESLE P +V FLKYEEMK EP + LRR++ FL
Sbjct  188   SLEETFDKFCRGVSLYGPFWDHVLGYWKESLERPRRVFFLKYEEMKNEPRIQLRRLSEFL  247

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
             GCPFS EEE  GV+  IL LCSFE+LSNLEVN     G L  G E+   FR+G+VGD  N
Sbjct  248   GCPFSLEEENSGVLDEILELCSFENLSNLEVNNI---GRLHSGEEHQAFFRRGEVGDSMN  304

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             ++T EM  ++D I ++K    GL
Sbjct  305   YLTAEMVEKIDMITEQKLHCHGL  327



>ref|XP_010051322.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 gb|KCW81764.1| hypothetical protein EUGRSUZ_C03130 [Eucalyptus grandis]
Length=315

 Score =   329 bits (843),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 164/318 (52%), Positives = 212/318 (67%), Gaps = 10/318 (3%)
 Frame = +1

Query  94    EEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSG  273
             + F++  +SLP E  W+T     Y+GFWL P   +G LT   HFQ   SDI+L T PKSG
Sbjct  3     QAFKDLFSSLPSEEDWITASFRLYQGFWLSPRLFKGILTCQNHFQAHPSDILLVTSPKSG  62

Query  274   TVWLKALAFALITRKQFL--AEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSR  444
             T WLKA+ FAL+ R ++     Q+ HPL T N HDL+PFLEL+ Y  +E PD       R
Sbjct  63    TTWLKAILFALLNRAKYSDSVSQQRHPLLTQNSHDLVPFLELNLYLGQENPDLTAIASPR  122

Query  445   LLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFD  624
             L ATH+P SLLP+SV +S  K+VYLCRNPKDT VS WHF N++R E +G   +P  E  D
Sbjct  123   LFATHMPYSLLPQSVRDSNCKLVYLCRNPKDTFVSTWHFANRMRPEEKG--QIPIQEGLD  180

Query  625   SYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSee  804
              +CRGV   GP+WDHV  Y K SL+ P KVLF+ YE+M+ +P VH+RR+A FLGCPFS+E
Sbjct  181   KFCRGVSVCGPYWDHVLGYHKASLDMPEKVLFMMYEQMRVDPHVHVRRLADFLGCPFSKE  240

Query  805   eeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHMTEEMA  978
             E   G V GIL++CSF+++S LEVNK    G L  G E    FR+G+ GDW N+M+ EM 
Sbjct  241   ELRDGTVEGILKMCSFDNMSALEVNK---RGKLWTGAETKWFFRRGEAGDWVNYMSSEMG  297

Query  979   RRLDQIVQEKFTGTGLML  1032
              R+D +++EK  G+GL L
Sbjct  298   ERIDGVMEEKLRGSGLKL  315



>ref|XP_004250849.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum lycopersicum]
Length=329

 Score =   329 bits (843),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 165/321 (51%), Positives = 218/321 (68%), Gaps = 4/321 (1%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE++ +EE ++ L+ LPK+ GW+   +YNY+GFW  P FLQG +   Q FQ +DSDI
Sbjct  7     KYLQEDNLSEECKKLLSILPKDKGWVGSYIYNYQGFWTPPRFLQGVIAFQQQFQAEDSDI  66

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL T PKSGT WLK+L FALI R +    +  HPL  NNPH L+PFLE   Y      DF
Sbjct  67    ILVTTPKSGTTWLKSLLFALINRVKHPIFEPNHPLLVNNPHVLVPFLEHDLYIDGRVHDF  126

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +     +LLATH+P + LPKSV +SK K+VYLCRNP+DT +S WHF N L   L   +  
Sbjct  127   STFTSPKLLATHVPFASLPKSVQDSKTKLVYLCRNPRDTFISMWHFTNNLL--LHHNDTN  184

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E FD +C GV   GPFW+HV +YWK+S+E P K+LFL YEE+KK+P+V L+R+A FL
Sbjct  185   SIEEKFDLFCEGVSLYGPFWNHVLDYWKKSIEMPTKILFLMYEEIKKKPKVQLKRLAKFL  244

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHM  963
              CP S EEE CGVV  IL++CSF++L NLEVN T+     G    + FRKG++GDW N+ 
Sbjct  245   ECPISTEEENCGVVDEILKMCSFKNLRNLEVN-TNGRFSTGEAYNLFFRKGEIGDWKNYF  303

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             T  M+ +L+  ++EKF G+GL
Sbjct  304   TTNMSDKLNHTIEEKFQGSGL  324



>ref|XP_006339394.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum tuberosum]
Length=328

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/321 (52%), Positives = 221/321 (69%), Gaps = 5/321 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++L+E++ +EE ++ L+ LPKE GW+   +YNY+GFW    FLQG +   Q FQ QDSDI
Sbjct  7     EYLEEDNLSEECKKLLSILPKEKGWVR-SVYNYQGFWTSLKFLQGVIACQQQFQAQDSDI  65

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL T PKSG+ WLK+L FAL+ R +    + +HPL   NPH L+PFLE + Y      DF
Sbjct  66    ILVTTPKSGSTWLKSLLFALVNRVKHPIFEPSHPLLVENPHVLVPFLEHTLYIDGRVIDF  125

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +     RLLATH+P + LPKSV +SK K+VYLCRNP+DT +S WHF N L   L   +  
Sbjct  126   STFTSPRLLATHVPFASLPKSVQDSKTKLVYLCRNPRDTFISMWHFANNLL--LHHKDTN  183

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E FD +C+GV   GPFW+HV +YWK+SLENP K+LFL YEE+KK+P++ L+R+A FL
Sbjct  184   SIEEMFDLFCKGVSLYGPFWNHVLDYWKQSLENPNKILFLMYEEIKKKPKIQLKRLAEFL  243

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHM  963
              CPFS EEE  GVV  IL++CSFE+L NLEVN T+     G    V FR+G++GDW N+ 
Sbjct  244   ECPFSIEEENSGVVDEILKMCSFENLRNLEVN-TNGKFSTGEPYKVFFRRGEIGDWKNYF  302

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             T EM  +L+ I++EKF G+GL
Sbjct  303   TIEMIDKLNHIIEEKFQGSGL  323



>gb|KDP41358.1| hypothetical protein JCGZ_15765 [Jatropha curcas]
Length=310

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/309 (53%), Positives = 217/309 (70%), Gaps = 7/309 (2%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKS  270
             +++FR+F+ SLP E GW+   L+ Y+GFW     L+G +    HFQ Q++DI L T PKS
Sbjct  2     SQDFRDFIVSLPTEKGWVANHLHQYQGFWHPTRQLKGVIACQNHFQAQENDIFLITTPKS  61

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGSRLL  450
             GT WLKAL FAL+ R +F   +E HPL TNNPH L+PFL+++Y   + PDF+     RL 
Sbjct  62    GTTWLKALTFALVNRVRFPNPKENHPLLTNNPHVLVPFLDMAYIDTDSPDFSSFTSPRLF  121

Query  451   ATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSY  630
             +THLP   LPKSV +   K+VYLCRNPKDT VS +HF N+LR + +G  ++   E FD +
Sbjct  122   STHLPFVSLPKSVEDLGCKIVYLCRNPKDTFVSLYHFTNRLRHKEKGENSL--EEVFDKF  179

Query  631   CRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeee  810
             CRGV   GPFWDHV  YWK+SLENP +VLFLKYE+ K+EP++HL++++ FL CPFSEEEE
Sbjct  180   CRGVSLYGPFWDHVLGYWKQSLENPKRVLFLKYEDFKEEPKLHLKKLSEFLECPFSEEEE  239

Query  811   eCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHMTEEMARR  984
                V+  IL LCSF++LSNLEVNKT   G L  G EN   FR+G++GD+ N +T+EM  +
Sbjct  240   NHTVIDQILNLCSFDNLSNLEVNKT---GKLPSGEENCAFFRRGEIGDYKNFLTKEMLEK  296

Query  985   LDQIVQEKF  1011
             LD + +EK 
Sbjct  297   LDHLTKEKL  305



>ref|XP_010051309.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 gb|KCW81745.1| hypothetical protein EUGRSUZ_C03104 [Eucalyptus grandis]
Length=314

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/317 (52%), Positives = 212/317 (67%), Gaps = 9/317 (3%)
 Frame = +1

Query  94    EEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSG  273
             + F++  +SLP E  W+T     Y+GFWL     +G LT   HFQ   SDI+L T PKSG
Sbjct  3     QAFKDLFSSLPSEEDWITASFRLYQGFWLSSRLFKGILTCQNHFQAHPSDILLVTSPKSG  62

Query  274   TVWLKALAFALITRKQFLA-EQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRL  447
             T WLKA+ FAL+ R ++ A  Q  HPL T N HDL+PFLEL+ Y  +E PD       RL
Sbjct  63    TTWLKAILFALLNRAKYSANSQRRHPLLTQNSHDLVPFLELNLYLGQENPDLTAIASPRL  122

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
              ATH+P SLLP+SV +S  K+VYLCRNPKDT VS WHF N++R E +G   +P  E  + 
Sbjct  123   FATHMPYSLLPQSVRDSNCKLVYLCRNPKDTFVSMWHFANRMRPEEKG--QIPIQEGLNK  180

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             +CRGV   GP+WDHV  Y K SL+ P KVLF+ YE+MK +P VH+RR+A FLGCPFS+EE
Sbjct  181   FCRGVSVCGPYWDHVLGYHKASLDMPEKVLFMMYEQMKVDPHVHVRRLADFLGCPFSKEE  240

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHMTEEMAR  981
                G V GIL++CSF+++S LEVNK    G L  G E    FR+G+VGDW N+M+ EM  
Sbjct  241   LRDGTVEGILKMCSFDNMSALEVNKC---GKLWTGAETKWFFRRGEVGDWVNYMSSEMGE  297

Query  982   RLDQIVQEKFTGTGLML  1032
             R+D +++EK  G+GL L
Sbjct  298   RIDGVMEEKLHGSGLKL  314



>emb|CDP00475.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   328 bits (841),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 218/325 (67%), Gaps = 10/325 (3%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE+    E ++ L++LPKE GW  P LY Y+GFW   +  QG L   QHFQ QD+DI
Sbjct  24    KYLQEDEIVPECKDLLSTLPKEKGWAEPHLYKYQGFWYPAWQFQGVLECQQHFQAQDTDI  83

Query  247   ILSTFPKSGTVWLKALAFALITRKQF-LAEQETHPLHTNNPHDLIPFLELSYAAKERPDF  423
             +L + PK GT WLKALAF +I R    + +   HPL  NNPHDL+  +EL  +  + P F
Sbjct  84    LLVSAPKCGTTWLKALAFTIINRNSHSIDDPGKHPLFYNNPHDLVHQIELE-SHIDNPIF  142

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
                +  RL ATHLP   LPK    S+ K+VY+CRNPKDT +S WHFMN+LR  L  L ++
Sbjct  143   N-PSSPRLFATHLPYISLPKCAKNSECKLVYICRNPKDTFISLWHFMNELR--LNHLASI  199

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                 AFD +CRGV   GPFWDHVS+YW+ES + P KVLFLKYE+MK++P +H++R+A F 
Sbjct  200   SLEVAFDKFCRGVSIFGPFWDHVSDYWEESRKRPNKVLFLKYEDMKEDPNLHVKRLAEFF  259

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
             G PFS EE   GVV GI++LCSFE+LS L+VNK   +G L  GVEN   FR+G VGDW N
Sbjct  260   GVPFSIEEATSGVVDGIIKLCSFENLSKLKVNK---DGKLPSGVENKTFFRRGGVGDWKN  316

Query  958   HMTEEMARRLDQIVQEKFTGTGLML  1032
             ++   M  RLD + +EKF G+GL L
Sbjct  317   YLWPVMVERLDYLTEEKFQGSGLHL  341



>ref|XP_004253506.1| PREDICTED: cytosolic sulfotransferase 12-like [Solanum lycopersicum]
Length=329

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/321 (51%), Positives = 219/321 (68%), Gaps = 4/321 (1%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE++ +EE ++FL+ LPK+ GW+   +YNY+GFW  P FLQG +   Q FQ +DSDI
Sbjct  7     KYLQEDNLSEECKKFLSILPKDKGWVGSYIYNYQGFWTPPRFLQGVIAFQQQFQAEDSDI  66

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL T PKSGT WLK+L FAL+ R +    +  HPL   NPH L+PFLE   Y     PDF
Sbjct  67    ILVTTPKSGTTWLKSLLFALVNRVKHPIFEPNHPLLVINPHVLVPFLEHELYIDGRVPDF  126

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +     +LLATH+P + LPKSV  SK K+VYLCRNP+DT +S WHF N L   L   +  
Sbjct  127   STFTSPKLLATHVPFASLPKSVQHSKTKLVYLCRNPRDTFISMWHFTNNLL--LHHNDTN  184

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E FD +C GV   GPFW+HV +YW++S+ENP K+LFL YEE+KK+P+V L+R+A FL
Sbjct  185   SIEEMFDLFCEGVSLYGPFWNHVLDYWEKSIENPTKILFLMYEEIKKKPKVQLKRLAEFL  244

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHM  963
              C  S EEE  GVV  IL++CSFE+L NLEVN T+     G E  + FRKG++GDW N+ 
Sbjct  245   ECLISPEEENSGVVDEILKMCSFENLRNLEVN-TNGKFSTGEEYNLFFRKGEIGDWKNYF  303

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             T +M+ +L+  ++EKF G+GL
Sbjct  304   TTKMSDKLNHTIEEKFQGSGL  324



>emb|CDP16517.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   326 bits (835),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 216/322 (67%), Gaps = 10/322 (3%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             ++   +EE +E LN+LPKE GW T  LY ++GFW +P  +Q  +++ ++F  QDSD++L+
Sbjct  18    EQQQLSEECQELLNTLPKERGWRTQHLYLFQGFWCQPKEIQAIMSVQRNFIAQDSDVVLA  77

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALT  432
             T PKSGT WLKA+AF ++ RK    + + HPL T NPH+L+PFLE   YA    PDF+  
Sbjct  78    TIPKSGTTWLKAIAFTIVNRKNIPVQNDHHPLLTANPHELVPFLEYKLYADNCIPDFSTI  137

Query  433   NGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFP  612
                +LLATH+P S LP+SV ES  +VVYL RNP DT VS WHFM KLR E  G   + F 
Sbjct  138   PCPKLLATHMPFSALPQSVKESGCRVVYLARNPFDTFVSIWHFMEKLRPESFG--CLSFE  195

Query  613   EAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCP  792
             EAFD YC GV   GP+WDH+  YW ESL+   KVLFLKYEEMK++    L+++A FLG P
Sbjct  196   EAFDMYCSGVVGFGPYWDHLLGYWNESLQRTQKVLFLKYEEMKEDTNSQLKKLAEFLGLP  255

Query  793   FSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGV----ENGVLFRKGKVGDWSNH  960
             FS EEE+ GVV  I RLCSF++L ++EVNK   NG   +    EN  LFRKG VGDW NH
Sbjct  256   FSIEEEKGGVVDEISRLCSFQTLKDMEVNK---NGKGAIFADSENKDLFRKGVVGDWINH  312

Query  961   MTEEMARRLDQIVQEKFTGTGL  1026
             MT  M  RL  I+ +K +G+ L
Sbjct  313   MTPSMVDRLRNIMDKKLSGSNL  334



>ref|XP_010050823.1| PREDICTED: cytosolic sulfotransferase 13-like [Eucalyptus grandis]
 gb|KCW80587.1| hypothetical protein EUGRSUZ_C01948 [Eucalyptus grandis]
Length=321

 Score =   325 bits (832),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 164/323 (51%), Positives = 214/323 (66%), Gaps = 9/323 (3%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             +Q +  ++   + ++SLP + GW  P L  Y+GFW   +   G L   +HFQ  +SDIIL
Sbjct  1     MQSSQPSQACTDLISSLPSDKGWDNPSLILYQGFWFPSWLFDGVLACQKHFQAHNSDIIL  60

Query  253   STFPKSGTVWLKALAFALITRKQFLA--EQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
              T PKSGT WLKA+ FAL+ R ++     +  HPL T NPHDL+P+LE   Y  +E PD 
Sbjct  61    VTSPKSGTTWLKAILFALLNRAEYSDPNSERCHPLQTRNPHDLVPYLEFQLYLQQEDPDH  120

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             A     RLLATHLP S LP+SV +SK K+VYLCRNPKD  +S WHF  K+  +  G +  
Sbjct  121   ATFASPRLLATHLPYSSLPQSVRDSKCKLVYLCRNPKDNFISLWHFTKKMMLKENG-DQT  179

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
             P PE  D +C+G+   GP+WDHV  Y K S E P KVLF+K+EEMK++P VH+RR+A F+
Sbjct  180   PLPECLDKFCQGLSMYGPYWDHVLGYHKMSSEMPEKVLFMKFEEMKEDPCVHVRRLADFV  239

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
             GCPFSEEE   G V GILR+CSF++LS LEVNK    G L  G EN   FR+G+VGDW N
Sbjct  240   GCPFSEEELRGGTVEGILRMCSFDNLSTLEVNK---GGSLWTGAENKSFFRRGEVGDWVN  296

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             +M+ EM  R+D +++EK  G+GL
Sbjct  297   YMSAEMGERIDSVMEEKLHGSGL  319



>ref|XP_007045765.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOY01597.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=331

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 177/328 (54%), Positives = 224/328 (68%), Gaps = 18/328 (5%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE   TEE +E ++SLP E GW+ P LY ++GFW     L   LT  ++FQ QDSDI
Sbjct  12    KYLQEEELTEECKELISSLPTEKGWIGPPLYQFQGFWHSSKILSTILTCQKNFQAQDSDI  71

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFA  426
              L+T PKSGT WLKA+ FAL+ R+++  +   HPL TNNPH L+ +LEL    + R D+ 
Sbjct  72    FLTTTPKSGTTWLKAIVFALVNRRKY-PDPINHPLVTNNPHALVRYLEL----EPRIDYQ  126

Query  427   LTNGS------RLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELR  588
               + S      RL+ATHLP   LP+SV  S  K+VYLCRNPKD  VSFW F N +  +  
Sbjct  127   AYDTSTTIASPRLIATHLPFVSLPESVKNSACKLVYLCRNPKDNFVSFWQFANAVIPKEM  186

Query  589   GLEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRR  768
             G  ++   E  D +CRG    GPFWDHV  YWKESLENP K+LFLKYEEMK+ PE+HLRR
Sbjct  187   GTNSLE--ETLDKFCRGGNIYGPFWDHVLGYWKESLENPQKLLFLKYEEMKEHPEIHLRR  244

Query  769   MAAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKV  942
             +A F+GCP S EEE  GVV  IL+LCSF++LSNLEVNK+   G L  G +  V FR+G+V
Sbjct  245   IAEFIGCPLSLEEESKGVVDDILKLCSFDTLSNLEVNKS---GKLSSGHDTSVFFRRGEV  301

Query  943   GDWSNHMTEEMARRLDQIVQEKFTGTGL  1026
             GDW NH+T EM R+LDQI +EK+ G+GL
Sbjct  302   GDWKNHLTPEMIRKLDQITEEKWRGSGL  329



>ref|XP_010044374.1| PREDICTED: cytosolic sulfotransferase 5-like [Eucalyptus grandis]
 gb|KCW86456.1| hypothetical protein EUGRSUZ_B03123 [Eucalyptus grandis]
Length=337

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/324 (49%), Positives = 219/324 (68%), Gaps = 10/324 (3%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             + +++  ++  ++ ++SLP E GW+      Y+GFW   +   G L    HFQ Q SDI+
Sbjct  14    YRRDDHLSQACKDLVSSLPSEEGWVATSFCLYQGFWFPTWLFNGVLACQNHFQAQPSDIL  73

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAE--QETHPLHTNNPHDLIPFLELS-YAAKERPD  420
             L T PKSGT WLKA+ FAL+ R ++     ++ HPL T NPHDL+PFLE+  Y  +E PD
Sbjct  74    LVTNPKSGTTWLKAILFALLNRAKYSDSDSKQRHPLLTQNPHDLVPFLEVKLYLQQENPD  133

Query  421   FALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEA  600
                    RL ATHLP S LP SV +S+ K+VYLCRNPKD  +S WH++NK R+E +G   
Sbjct  134   LTTFESPRLFATHLPYSSLPGSVRDSRCKLVYLCRNPKDMFISLWHYVNKRRAEEKG--Q  191

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAF  780
             +P P+  D +CRG+   GP+WDHV  Y K SLE P +VLFL YEE+K++P VH+ R+A F
Sbjct  192   IPLPKCLDKFCRGLSPYGPYWDHVMGYHKASLEMPEQVLFLMYEELKEDPRVHVSRLADF  251

Query  781   LGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWS  954
             LGCPFS+EE   G V GI+R+CSF++LS+LEVNK+   G L  G EN   FR+GKVGDW 
Sbjct  252   LGCPFSDEELRDGTVEGIMRMCSFDNLSSLEVNKS---GKLWTGQENQWFFRRGKVGDWV  308

Query  955   NHMTEEMARRLDQIVQEKFTGTGL  1026
             N+++ EMA ++DQ+++EK   +GL
Sbjct  309   NYLSAEMADKIDQVMEEKLRDSGL  332



>ref|XP_010050705.1| PREDICTED: cytosolic sulfotransferase 12-like [Eucalyptus grandis]
 gb|KCW80289.1| hypothetical protein EUGRSUZ_C01647 [Eucalyptus grandis]
Length=321

 Score =   323 bits (827),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 214/323 (66%), Gaps = 9/323 (3%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             +Q +  ++     ++S+P + GW  P L  Y+GFW   +   G L   +HFQ  +SDIIL
Sbjct  1     MQSSQPSQACTYLISSVPSDKGWDNPSLILYQGFWFPSWLFNGVLACQKHFQAHNSDIIL  60

Query  253   STFPKSGTVWLKALAFALITRKQFLA--EQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
              T PKSGT WLKA+ FAL+   ++     ++ HPL T NPHDL+P+LE   Y  +E PD 
Sbjct  61    VTSPKSGTTWLKAILFALLNLAKYSDPNSEQCHPLQTRNPHDLVPYLEFQLYLQQEDPDH  120

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             A     RLLATHLP S LP+SV +SK K+VYLCRNPKD  +S WHF  K+  +  G +  
Sbjct  121   ATFASPRLLATHLPYSSLPQSVRDSKCKLVYLCRNPKDNFISLWHFTKKMMLKENG-DQT  179

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
             P PE  D +C+G+   GP+WDHV  Y K S E P KVLF+KYEEMK++P VH+RR+A F+
Sbjct  180   PLPECLDKFCQGLSMYGPYWDHVLGYHKMSSEMPEKVLFMKYEEMKEDPCVHVRRLATFV  239

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
             GCPFSEEE   G V GILR+CSF++LS LEVNK+   G L  G EN   FR+G+VGDW N
Sbjct  240   GCPFSEEELRGGTVEGILRMCSFDNLSTLEVNKS---GSLWTGAENKSFFRRGEVGDWVN  296

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             +M+ EM  R+D +++EK  G+GL
Sbjct  297   YMSAEMGERIDSVMEEKLHGSGL  319



>ref|XP_008339761.1| PREDICTED: cytosolic sulfotransferase 5-like [Malus domestica]
Length=331

 Score =   322 bits (826),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 169/324 (52%), Positives = 216/324 (67%), Gaps = 10/324 (3%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQEN  ++E ++ ++SLP E GW+   L+ Y+GFW     +QG L   +HF+  +SDI
Sbjct  12    RYLQENEPSQEDKDLISSLPTEKGWIGNSLHKYQGFWQATAHMQGVLACQKHFRALESDI  71

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKER--PD  420
             IL T PKSGT WL A+ FAL+ R  +L +   HPL T NPH L+P LEL     ++  PD
Sbjct  72    ILVTTPKSGTTWLMAILFALVKRAHYL-DLRRHPLLTENPHVLVPCLELDVYTDKQVLPD  130

Query  421   FALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEA  600
              +     RL +THLP   LP SV  S  KVVYL R+PKD  VS WHF+NKLR    G   
Sbjct  131   LSSLAPPRLFSTHLPYVSLPDSVKHSGCKVVYLSRDPKDAFVSLWHFVNKLRPVGSG--T  188

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAF  780
             M   EAFD +CRGV + GPFWDHV  +W ESL+ P    F+K+EEMK+EP + LRR+A F
Sbjct  189   MSLHEAFDKFCRGVSSFGPFWDHVLGFWNESLKRPESAFFIKFEEMKQEPALQLRRLAEF  248

Query  781   LGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWS  954
             LGCPFS EEE  G+V GILRLCSF++LSNL VNK+   G L  G+EN   FRKG+VGD +
Sbjct  249   LGCPFSPEEETHGIVDGILRLCSFDNLSNLVVNKS---GKLPAGMENSAFFRKGEVGDST  305

Query  955   NHMTEEMARRLDQIVQEKFTGTGL  1026
             N++T EM ++LD I QEK  G+GL
Sbjct  306   NYLTTEMVKKLDSITQEKLYGSGL  329



>ref|XP_010681134.1| PREDICTED: cytosolic sulfotransferase 12-like [Beta vulgaris 
subsp. vulgaris]
Length=336

 Score =   320 bits (819),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 160/323 (50%), Positives = 220/323 (68%), Gaps = 8/323 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE+  +++ +  +++LPK+ GWL  ++Y Y+GFW     LQG LT  +HFQ +D+D+
Sbjct  17    KYLQEDDISQDCKALISTLPKDQGWLICNVYQYQGFWHPIRQLQGVLTCQRHFQARDTDL  76

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL+T PK GT WLKALA+ ++ RK      + HP+  NNPH+L+PFLEL  +   + PD 
Sbjct  77    ILTTSPKCGTTWLKALAYVVVNRKTNPLGCDNHPILINNPHELVPFLELKVFVDNQVPDL  136

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
                   R+ +THLPV  LP S+ E+  KVVYL R+PKD  +S WHF NKLR +  G   +
Sbjct  137   TNLPSPRVFSTHLPVESLPLSIKETGCKVVYLARDPKDAFISLWHFANKLRPKDGG--EI  194

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                EAFD +C+GV   GPFWDHV  YWK SL+NP KV FL YE++K++P++HL+++A F 
Sbjct  195   SLAEAFDKFCKGVSLCGPFWDHVLSYWKYSLDNPQKVYFLTYEDLKRQPKLHLKKLAEFW  254

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
             GCPFS EEE  G+V  IL+LCSF++LSNLEVNK   NG L  G EN   FRKG+VGDW  
Sbjct  255   GCPFSVEEENEGLVEDILKLCSFDNLSNLEVNK---NGKLSSGEENRAFFRKGEVGDWVT  311

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             + T+EM  + ++I ++KF   GL
Sbjct  312   YFTKEMIEQFNEISEKKFHLCGL  334



>gb|KEH33293.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=334

 Score =   319 bits (818),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/323 (51%), Positives = 215/323 (67%), Gaps = 6/323 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE+   +E +E + +LP E GW++   + Y+GFW+    LQG L+  +HFQ  ++DI
Sbjct  13    KYLQEDELGKECKELIQTLPLEKGWISTHFHQYQGFWIGTRILQGVLSCQKHFQALNTDI  72

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQE-THPLHTNNPHDLIPFLE--LSYAAKERP  417
             +L T PKSGT WLKAL FALI RK++       HPL T+NPH L+PFLE  L Y     P
Sbjct  73    LLVTTPKSGTTWLKALTFALINRKKYQNIHNFNHPLLTSNPHVLVPFLEVDLYYDKDYVP  132

Query  418   DFALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLE  597
             +    +  RL ATH+P  LLPKSV ES  KVVYLCR+PKDT  S WHF NK+RS+  G  
Sbjct  133   NLNSLSPPRLFATHIPYELLPKSVKESSCKVVYLCRDPKDTFASLWHFSNKVRSQSSG--  190

Query  598   AMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAA  777
              +P  E+F ++ RGV   GPFW+HV  YWKESLE   KV+FL++EEMK +P+ HL+++A 
Sbjct  191   TLPLEESFHNFTRGVTLFGPFWEHVLGYWKESLERSNKVMFLRFEEMKMKPDFHLKKLAE  250

Query  778   FLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSN  957
             FL CPF+++EE  GVV  IL LCSFE LSNLEVNKT      GVEN   FR+G+VGD   
Sbjct  251   FLECPFTKDEESKGVVDDILNLCSFEKLSNLEVNKTG-KVSFGVENKAFFRRGQVGDGEK  309

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
              +T EM  +L+ +++EK    G 
Sbjct  310   LLTTEMIEQLNTVIEEKLVKHGF  332



>ref|XP_010048649.1| PREDICTED: cytosolic sulfotransferase 5-like [Eucalyptus grandis]
 gb|KCW80980.1| hypothetical protein EUGRSUZ_C02348 [Eucalyptus grandis]
Length=333

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 164/325 (50%), Positives = 212/325 (65%), Gaps = 10/325 (3%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++L+++  + E  + L+SL  E  W+   L  Y+GFW   + L   +    HFQ   SDI
Sbjct  12    KYLRDDVKSLECEDLLSSLRSEEDWVPTSLRLYQGFWFPSWLLNSVVACQNHFQAHPSDI  71

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAE--QETHPLHTNNPHDLIPFLELS-YAAKERP  417
             +L T PK GT WLKA+ FAL+ R ++     Q+ HPL T NPHDL+PFLE   Y   + P
Sbjct  72    LLVTSPKCGTTWLKAILFALLNRAKYSDSYSQQRHPLLTQNPHDLVPFLEFRLYLQNKNP  131

Query  418   DFALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLE  597
             D       RLLATHLP S LP+SV +S  K+VYLCRNPKDT +S WH  NK+R E +G  
Sbjct  132   DLTAFTSPRLLATHLPYSSLPRSVRDSNCKLVYLCRNPKDTFISMWHHFNKMRPEEKG--  189

Query  598   AMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAA  777
              +P  E  D +CRGV   GP+WDHV  Y K S E P KVLF+KYEEMK +P V +RR+A 
Sbjct  190   QLPLSEGLDKFCRGVSRCGPYWDHVLGYHKASSEMPEKVLFMKYEEMKADPSVQVRRLAD  249

Query  778   FLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDW  951
             F+GCPFSEEE   G V GILR+CSF++LS LEVN++   G L  G+EN   FRKG+VGDW
Sbjct  250   FMGCPFSEEELRNGTVEGILRMCSFDNLSALEVNRS---GKLPTGLENKWFFRKGEVGDW  306

Query  952   SNHMTEEMARRLDQIVQEKFTGTGL  1026
              N+M+ EM  R+D +++EK  G+GL
Sbjct  307   VNYMSAEMGGRIDGVMEEKLHGSGL  331



>ref|XP_004297203.1| PREDICTED: cytosolic sulfotransferase 12-like [Fragaria vesca 
subsp. vesca]
Length=334

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 171/326 (52%), Positives = 222/326 (68%), Gaps = 11/326 (3%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             Q+LQEN  ++E R+ +++LP++ GW+   LY Y+GFW     ++G L   ++F+ QDSDI
Sbjct  12    QYLQENEISQETRDMISTLPRDQGWVVSHLYQYQGFWHSTRQIEGVLACQENFRAQDSDI  71

Query  247   ILSTFPKSGTVWLKALAFALITRKQFL-AEQETHPLHTNNPHDLIPFLELS-YAAKERPD  420
             +L T PKSGT WLKA+ F+L+ R ++   + + HP  T NPH L+PFLEL  Y  K  PD
Sbjct  72    LLVTTPKSGTTWLKAILFSLVKRGEYYHPDPKDHPFLTKNPHVLVPFLELGLYLQKPVPD  131

Query  421   FALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEA  600
              A     RL +THLP+  LP+SV +S  KVVYLCRNPKDT VS WHF N+LR E RG  +
Sbjct  132   LASYAPPRLFSTHLPLVSLPESVKDSACKVVYLCRNPKDTFVSLWHFANRLRPESRG--S  189

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEV--HLRRMA  774
             +   EA + +CRGV   GPFWDHV  YW ESL+ P  V F+KYEEMK+E E   HLR++A
Sbjct  190   ISLEEALELFCRGVSLYGPFWDHVLGYWNESLKRPQSVFFIKYEEMKEEEEAGSHLRKLA  249

Query  775   AFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGD  948
              FLGCPFS EEE  GVV  IL+ CSFE+LSNL+VNK    G L  G E+   FR+G+ GD
Sbjct  250   EFLGCPFSPEEEAQGVVGNILKHCSFETLSNLDVNK---RGKLSSGEEHSAFFRRGEAGD  306

Query  949   WSNHMTEEMARRLDQIVQEKFTGTGL  1026
             W N +T EMA ++D+I +EK  G+GL
Sbjct  307   WRNQLTAEMAEQIDRITEEKLQGSGL  332



>ref|XP_010091629.1| Flavonol sulfotransferase-like protein [Morus notabilis]
 gb|EXB44895.1| Flavonol sulfotransferase-like protein [Morus notabilis]
Length=332

 Score =   317 bits (813),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 217/323 (67%), Gaps = 9/323 (3%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE   ++EF++ + SL +E GW+   L+ Y+GFW     LQG L   +HFQ QD+D+
Sbjct  14    KYLQETQVSQEFKDLILSLRREKGWVASHLHQYQGFWHTTRQLQGVLACQKHFQSQDTDV  73

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             +L T PKSGT WLK++ F+LI R  F  + + HPL T NPH L+PFLEL  Y    RP+ 
Sbjct  74    LLVTNPKSGTTWLKSILFSLINRSVF-TDPKKHPLLTTNPHVLVPFLELDLYVENRRPNI  132

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             + ++  RL +THLP   LP+SV  S  K+VYLCR+PKD  VS WHF N+LR E  G  +M
Sbjct  133   SYSSSPRLFSTHLPYVSLPESVKSSACKLVYLCRSPKDAFVSHWHFANRLRPESLGENSM  192

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E F+ +C+GV   GPFWDH   YW ES + P KVLFL +EEMK+EP  H+RR+A F+
Sbjct  193   E--EIFEKFCKGVSLCGPFWDHSLGYWNESFKRPEKVLFLSFEEMKREPVFHVRRLAEFI  250

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
             GCPFSEEEE    V  +L +CSF+SLSNLEVNK    G L  G ++   FR+G+VGDW N
Sbjct  251   GCPFSEEEEAKSEVEDVLEMCSFDSLSNLEVNKI---GKLPSGEDHKAFFRRGEVGDWVN  307

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             ++T +MA +LD IV++   G+GL
Sbjct  308   YLTPQMAEKLDSIVEQNLHGSGL  330



>ref|XP_006388018.1| hypothetical protein POPTR_0396s00220g [Populus trichocarpa]
 gb|ERP46932.1| hypothetical protein POPTR_0396s00220g [Populus trichocarpa]
Length=304

 Score =   315 bits (807),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 167/307 (54%), Positives = 201/307 (65%), Gaps = 8/307 (3%)
 Frame = +1

Query  142   LTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGTVWLKALAFALITRKQ  321
             +   L+ Y+GFW     LQG L   +HFQ QD DI L T PKSG+ WLKA+ F+L+ R  
Sbjct  1     MAKHLHRYQGFWHSTRQLQGVLACQKHFQAQDGDIFLVTTPKSGSTWLKAVMFSLVNRVS  60

Query  322   FLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGSRLLATHLPVSLLPKSVWESK  501
             F  + + HPL TNNPH L+PFLE+ Y  KE  DF      RL +THLP+  LP+SV +S 
Sbjct  61    F-PDTKQHPLLTNNPHALVPFLEMEYIGKENLDFTNFTFPRLFSTHLPLLSLPRSVEDSD  119

Query  502   GKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCRGVCNTGPFWDHVSEY  681
              K+VYLCRNPKDT VSFWHF NKL     G  A    E FD +CRGV   GPFWDHV  Y
Sbjct  120   CKLVYLCRNPKDTFVSFWHFTNKLTP--IGWSATSLEETFDKFCRGVSLYGPFWDHVLGY  177

Query  682   WKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeCGVVSGILRLCSFESL  861
             WKESLE P +V FLKYEEMK+EP + LRR++ FLGCPFS EEE  GV+  IL LCSFE+L
Sbjct  178   WKESLERPHRVFFLKYEEMKREPRIQLRRLSEFLGCPFSLEEENSGVLDEILELCSFENL  237

Query  862   SNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHMTEEMARRLDQIVQEKFTGTGLML*  1035
             SNLEVNK    G L  G E+ V FR+G+VGD  N++T EM  ++D I ++K    GL   
Sbjct  238   SNLEVNKI---GKLHSGQEHRVFFRRGEVGDSMNYLTAEMVEKIDMITEQKLHCHGLKSI  294

Query  1036  SDPIFNV  1056
             S P   V
Sbjct  295   SRPFIKV  301



>ref|XP_008347825.1| PREDICTED: cytosolic sulfotransferase 15-like [Malus domestica]
 ref|XP_008344564.1| PREDICTED: cytosolic sulfotransferase 15-like [Malus domestica]
Length=329

 Score =   315 bits (807),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/322 (48%), Positives = 213/322 (66%), Gaps = 8/322 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             +E    +E ++ L SLPKE GW T  LY ++GFW +   +Q  +T  +HFQ  D+DI+L+
Sbjct  5     EEEKIGDECKQMLLSLPKERGWRTLHLYQFQGFWCQAAEIQSIITFQKHFQATDTDIVLA  64

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALT  432
             T PKSGT WLKALAFA + R +F    ++HPL  +NPHDL+PF E   YA  + PD   T
Sbjct  65    TIPKSGTTWLKALAFATVNRHRFTTNSKSHPLLXSNPHDLVPFFEYKLYANNQIPDLTTT  124

Query  433   N----GSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEA  600
             N      RL  TH+P + L  S+ +S  K+VY+CRNP DT VS WHF+NK++ E +   +
Sbjct  125   NLPDDQPRLFGTHIPFASLANSIRKSNSKIVYICRNPFDTFVSSWHFLNKVKPESKAQLS  184

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAF  780
             M   EAFD YC+G+   GPFWDH+  YW ESL  P KVLFLKYE++K++    L+++A F
Sbjct  185   M--EEAFDMYCKGIVGFGPFWDHMLGYWNESLLRPQKVLFLKYEDLKEDGVFQLKKLAKF  242

Query  781   LGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNH  960
             LGCPF+  EE+ GV+  I +LC FE++  LEVNKT  +     EN  LFRK +VGDW N+
Sbjct  243   LGCPFTLVEEKNGVIESISKLCCFENMKKLEVNKTGTSIK-NFENKNLFRKAEVGDWVNY  301

Query  961   MTEEMARRLDQIVQEKFTGTGL  1026
             ++ +M  RL +++++K +G+GL
Sbjct  302   LSPKMVERLSRVIEDKLSGSGL  323



>ref|XP_002265137.1| PREDICTED: cytosolic sulfotransferase 15 [Vitis vinifera]
Length=332

 Score =   315 bits (806),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 167/318 (53%), Positives = 212/318 (67%), Gaps = 7/318 (2%)
 Frame = +1

Query  79    ENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILST  258
             E   ++EF+E L SLPKE GW T  +Y Y+ FW +P  +Q  +   QHFQ +DSD+IL T
Sbjct  15    EEELSDEFKELLLSLPKERGWRTSHIYLYQEFWCQPKEIQAIINFQQHFQARDSDLILVT  74

Query  259   FPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTN  435
              PKSGT WLKA+AFA++ RK F +  + HPL T+NPHDL+PFLE   YA  + PD ++  
Sbjct  75    MPKSGTTWLKAMAFAVLNRKSF-SISKNHPLLTSNPHDLVPFLEYKLYANNQLPDLSMLP  133

Query  436   GSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPE  615
               RLLATH+P S LP S+  S  ++VY CRNP DT VS WHF+ K+R E  G   +   E
Sbjct  134   QPRLLATHVPFSSLPASIKNSDCRIVYWCRNPLDTFVSSWHFLMKVRPETLG--PISIEE  191

Query  616   AFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPF  795
              F+ YCRG    GPFW H+ EYW ESLE P K+LF+KYE+ K++P   L+R+A FLG PF
Sbjct  192   GFEMYCRGAMAFGPFWKHMLEYWNESLEPPNKMLFMKYEDAKEDPVFQLKRLANFLGVPF  251

Query  796   SeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLG-VENGVLFRKGKVGDWSNHMTEE  972
             S EEE  GV   I RLCSFE+L NLEVN+T     +G  EN  LFR G VGDW NH+T  
Sbjct  252   SFEEEREGVAEEISRLCSFENLKNLEVNQTG--RSIGYFENKNLFRTGVVGDWVNHLTPS  309

Query  973   MARRLDQIVQEKFTGTGL  1026
             MA ++ QI++ K  G+GL
Sbjct  310   MAGQIFQIMKGKLAGSGL  327



>ref|XP_009590910.1| PREDICTED: cytosolic sulfotransferase 15-like [Nicotiana tomentosiformis]
Length=339

 Score =   314 bits (805),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/331 (47%), Positives = 221/331 (67%), Gaps = 12/331 (4%)
 Frame = +1

Query  79    ENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILST  258
             + + +E+  EF  SLPKE GW TP+L+ ++GFW +P  ++  ++  QHF+ Q+SD+I+++
Sbjct  17    QETLSEDLDEFFTSLPKEKGWRTPNLFFFQGFWCQPKEIRAIISTQQHFKAQNSDLIVAS  76

Query  259   FPKSGTVWLKALAFALITRKQFLAEQET--HPLHTNNPHDLIPFLELSYAAKER--PDFA  426
              PKSGT WLKAL F+++ RK+F  +Q+   HPL T+NPH+L+PFLE    A+    PD +
Sbjct  77    IPKSGTTWLKALTFSIVNRKKFNVQQKNINHPLLTHNPHELVPFLEYKLYAEYNSPPDLS  136

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
             L    RL+ATH+P   LP SV  +K K+VY+CRNP DT VS WH++ K+R E   L    
Sbjct  137   LLPSPRLIATHVPFGALPNSVKTTKCKIVYICRNPFDTFVSVWHYIVKIRPE--SLGPFT  194

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               EAFD YCRG+   GP+W+H+  YW+ESLE+P KVLFLKYE+MK +    L+R+A F+G
Sbjct  195   LEEAFDLYCRGITGFGPYWEHMLGYWRESLESPNKVLFLKYEDMKVDMCNQLKRLAEFMG  254

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMT  966
              PF++EEE+ G++  +  LCSF++L +L+VNK         EN  LFRKG++GDW N+ T
Sbjct  255   FPFTKEEEKGGIIKDVSNLCSFQNLRDLQVNKKGKGAISDFENRNLFRKGEIGDWVNYFT  314

Query  967   EEMARRLDQIVQEKFTGTGLML*SDPIFNVC  1059
               M  RL  I++EK  G+GL       F VC
Sbjct  315   PSMFERLSNIMEEKLGGSGL------TFTVC  339



>ref|XP_009779416.1| PREDICTED: cytosolic sulfotransferase 15 [Nicotiana sylvestris]
Length=344

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/320 (48%), Positives = 216/320 (68%), Gaps = 6/320 (2%)
 Frame = +1

Query  79    ENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILST  258
             + + T++  EF NSLPKE GW TP+L+ ++ FW +P  ++  ++  +HF+ QD+D+IL++
Sbjct  17    QETLTDDLDEFFNSLPKEKGWRTPNLFLFQNFWCQPKEIRAIISTQKHFKAQDNDLILAS  76

Query  259   FPKSGTVWLKALAFALITRKQFLAEQET--HPLHTNNPHDLIPFLELSYAA--KERPDFA  426
              PKSGT WLKAL F+++ R +F  +Q+   HPL T+NPH+L+PFLE    A     PD +
Sbjct  77    IPKSGTTWLKALTFSIVNRNKFNVQQKNINHPLLTHNPHELVPFLEYKLYADFNSLPDLS  136

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
             L    RL+ATH+P   LP SV  SK K+VY+CRNP D  VS WH++ K+R E   L    
Sbjct  137   LLPSPRLVATHVPFGALPNSVKTSKCKIVYICRNPFDAFVSVWHYLVKIRPE--SLGPFT  194

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               EAFD YCRGV   GP+W+H+  YW+ESLENP KVLFLKYE+MK +    L+R+A FLG
Sbjct  195   LEEAFDLYCRGVIGFGPYWEHMLGYWRESLENPNKVLFLKYEDMKLDVCNQLKRLADFLG  254

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMT  966
              PF++EEE+ G++  +  LCSF++L +L+VNK         EN  LFRKG++GDW N+ T
Sbjct  255   FPFTKEEEKGGIIKDVSSLCSFQNLRDLQVNKKGKGAISDFENRNLFRKGEIGDWVNYFT  314

Query  967   EEMARRLDQIVQEKFTGTGL  1026
               M  RL ++++EK  G+GL
Sbjct  315   PSMFERLSKVMEEKLGGSGL  334



>ref|XP_002538120.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
 gb|EEF24263.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
Length=326

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/318 (49%), Positives = 214/318 (67%), Gaps = 4/318 (1%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             +E + T E +E L SLP+  GW TP +Y ++GFW +P  +Q  L+  +HFQ +++D++++
Sbjct  6     EEENVTHECKELLLSLPRHRGWRTPYIYQFQGFWCQPKEIQSILSFQKHFQARNNDVVIA  65

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALT  432
             T PKSGT WLKAL F+++ RK F    + HPL  +NPHDL+PF E   YA  + PD +  
Sbjct  66    TIPKSGTTWLKALTFSILNRKSFPLSSKAHPLLNSNPHDLVPFFEYKVYANGQVPDVSKL  125

Query  433   NGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFP  612
                RL ATHLP S L +S+ +S  K+VY+CRNP DT +S W ++NKLRS+ R    +   
Sbjct  126   PDPRLFATHLPFSSLQESIKKSSCKIVYICRNPFDTFISSWIYINKLRSDTR--PPLSLD  183

Query  613   EAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCP  792
             + F+ YC+G+   GPFWDH+  YW ES E P KVLFLKYE+MK++   HL+++A FLGCP
Sbjct  184   DCFNMYCKGIVGFGPFWDHMLGYWNESKERPDKVLFLKYEDMKEDISFHLKKLAEFLGCP  243

Query  793   FSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEE  972
             FS EEE+ G V  + +LCS E L +LEVNK+     L  EN  LFRKG+VGDW NH++  
Sbjct  244   FSMEEEKAGEVEEVAKLCSLEKLKDLEVNKSG-KSILNFENRHLFRKGEVGDWVNHLSPS  302

Query  973   MARRLDQIVQEKFTGTGL  1026
             M  RL Q+++EK  G+GL
Sbjct  303   MVERLTQVMEEKLGGSGL  320



>ref|XP_002268667.1| PREDICTED: flavonol 3-sulfotransferase [Vitis vinifera]
 emb|CAN73997.1| hypothetical protein VITISV_043371 [Vitis vinifera]
 emb|CAN75262.1| hypothetical protein VITISV_041145 [Vitis vinifera]
 emb|CBI18154.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 210/316 (66%), Gaps = 11/316 (3%)
 Frame = +1

Query  97    EFREFLNSLPKETGW-LTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSG  273
             +++E +++LPK  GW +  D Y+Y+GFW   FFL+G +   QHFQ Q  DIILS+ PK+G
Sbjct  18    KYKEKISTLPKHHGWRVNADFYHYQGFWCYSFFLEGIMKSQQHFQAQSGDIILSSAPKTG  77

Query  274   TVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGSRLLA  453
             T WLKAL FA++TR  F  +  T+PL T  PH+ +P LE+         F  +    LLA
Sbjct  78    TTWLKALTFAIVTRHHF--DDSTNPLLTTVPHECVPLLEVDAVEDA---FHRSPKLPLLA  132

Query  454   THLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYC  633
             THLP + LP S+  S  K+VY+CR PKD  +S WHF+ KL  +    E +P   A D +C
Sbjct  133   THLPYTSLPNSIMSSHCKIVYICREPKDAFISLWHFICKLAPQEE--EHVPLEAALDMFC  190

Query  634   RGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeee  813
             +G+   GP+WDHV  YWK SLE P +VLFLKYE++K +   +++ +A F+GCPFS EEE 
Sbjct  191   KGISQYGPYWDHVLGYWKASLECPERVLFLKYEDLKSDTLHYIKTLADFMGCPFSLEEES  250

Query  814   CGVVSGILRLCSFESLSNLEVNKTSVNGD---LGVENGVLFRKGKVGDWSNHMTEEMARR  984
              GVV  I+ LCSFE+LSNL+VNKT ++     L  +N V FRKG VGDW NH+T+EM  R
Sbjct  251   EGVVQKIMNLCSFETLSNLKVNKTGMHRSTTPLATKNDVYFRKGNVGDWKNHLTDEMVHR  310

Query  985   LDQIVQEKFTGTGLML  1032
             +DQI ++KF+GTGLM 
Sbjct  311   VDQITEQKFSGTGLMF  326



>ref|XP_009370647.1| PREDICTED: cytosolic sulfotransferase 15-like [Pyrus x bretschneideri]
Length=329

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 151/322 (47%), Positives = 214/322 (66%), Gaps = 8/322 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             +E   ++E ++ L SLPKE GW T  LY ++GFW +   +Q  +T  +HFQ  D+DI+L+
Sbjct  5     EEEKISDECKQMLLSLPKERGWRTLHLYQFQGFWCQAAEIQSIITFQKHFQATDTDIVLA  64

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALT  432
             T PKSGT WLKALAFA + R +F    ++HPL T+NPHDL+PF E   YA  + PD   T
Sbjct  65    TIPKSGTTWLKALAFATVNRHRFTTNSKSHPLLTSNPHDLVPFFEYKLYANNQIPDLTTT  124

Query  433   N----GSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEA  600
             N      RL  TH+P + L  S+ +S  K+VY+CRNP DT VS WHF++K++ E +   +
Sbjct  125   NLPDDQPRLFGTHIPFASLANSIRKSNSKIVYICRNPFDTFVSSWHFLDKVKPESKAPLS  184

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAF  780
             M   +AFD YC+G+   GPFWDH+  YW ESL  P KVLFLKYE++K++    L+++A F
Sbjct  185   M--EDAFDMYCKGIVGFGPFWDHMLGYWNESLLRPQKVLFLKYEDLKEDGVFQLKKLAKF  242

Query  781   LGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNH  960
             LGCPF+  EE+ GV+  I +LC F+++  LEVNKT  +     EN  LFRK +VGDW N+
Sbjct  243   LGCPFTLVEEKNGVIESISKLCCFDNMKKLEVNKTG-SSIKNFENKNLFRKAEVGDWVNY  301

Query  961   MTEEMARRLDQIVQEKFTGTGL  1026
             ++ +M  RL +++++K  G+GL
Sbjct  302   LSPKMVERLSKVIEDKLCGSGL  323



>gb|KEH16899.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
 gb|AES70035.2| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=333

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 166/325 (51%), Positives = 215/325 (66%), Gaps = 10/325 (3%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE+  T E +E + +LP E GW++  L+ Y+GFW     LQG L+  +HFQ  D+DI
Sbjct  12    KYLQEDDITLECKELIQTLPMEKGWVSTHLHQYQGFWQTKKHLQGVLSFQKHFQAHDTDI  71

Query  247   ILSTFPKSGTVWLKALAFALITRKQFL-AEQETHPLHTNNPHDLIPFLELS-YAAKE-RP  417
             IL+T PK+GT WLKAL FAL+ RK++       HPL T NPH L+PFLELS Y  K+  P
Sbjct  72    ILATSPKAGTTWLKALIFALLNRKRYPNIHDNNHPLLTTNPHVLVPFLELSLYIEKDILP  131

Query  418   DFALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLE  597
             D    +  RL +TH+P   LPKS+ +S  KVVYLCR+PKDT  S WHF NK+R + R  E
Sbjct  132   DINSFSAPRLFSTHVPYKSLPKSIKDSTCKVVYLCRDPKDTFASMWHFTNKIRPQNR--E  189

Query  598   AMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAA  777
              +   E+F+ + RGV   GPFW+H+  YWKESLE   KV+FL+YEEMK +P  +L+ +A 
Sbjct  190   TLQLEESFEKFSRGVSLFGPFWEHLLGYWKESLERQEKVMFLRYEEMKMKPCFYLKEVAE  249

Query  778   FLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDW  951
             FLGCPFS+EEE  GVV  IL LCSFE LSNLEVNK    G L  G EN   FR GKVGDW
Sbjct  250   FLGCPFSKEEESKGVVDDILNLCSFEKLSNLEVNKF---GKLPSGEENKAFFRSGKVGDW  306

Query  952   SNHMTEEMARRLDQIVQEKFTGTGL  1026
                ++ EM  RL+ ++++     G+
Sbjct  307   KTLLSIEMIERLNTVIEQNLGKHGM  331



>ref|XP_004297202.1| PREDICTED: cytosolic sulfotransferase 12-like [Fragaria vesca 
subsp. vesca]
Length=335

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 169/327 (52%), Positives = 223/327 (68%), Gaps = 12/327 (4%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             Q+LQEN  ++E R+ +++LP++ GW+   +Y Y+GFW     ++G L   ++F+ QDSDI
Sbjct  12    QYLQENEISQETRDMISTLPRDQGWIASHIYQYQGFWHSTRQIEGVLACQENFRAQDSDI  71

Query  247   ILSTFPKSGTVWLKALAFALITRKQFL-AEQETHPLHTNNPHDLIPFLELS-YAAKERPD  420
             +L T PKSGT WLKA+ F+L+ R ++   E + HPL T NPH L+P LE+  Y  K  PD
Sbjct  72    LLVTTPKSGTTWLKAILFSLVKRGEYYHPEPQDHPLLTKNPHVLVPHLEIGLYLQKPVPD  131

Query  421   FALTNG-SRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLE  597
                +    RL ++HLP+  LP+SV E+  KVVYLCRNPKDT VS WHF NKLR E  G  
Sbjct  132   LMTSYAPPRLFSSHLPLVSLPESVKETACKVVYLCRNPKDTFVSLWHFANKLRPESWG--  189

Query  598   AMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEV--HLRRM  771
             ++   EA + +CRGV   GPFWDHV  YW ESL+ P  V F+KYEEMK+E E   HLR++
Sbjct  190   SISLEEALELFCRGVSMCGPFWDHVLGYWNESLKRPQSVFFIKYEEMKEEEEAGSHLRKL  249

Query  772   AAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVG  945
             A FLGCPFS EEE  GVV  IL+ CSFE+LSNL+VNK    G L  G E+   FR+G+ G
Sbjct  250   AEFLGCPFSPEEEAQGVVGNILKQCSFETLSNLDVNK---RGKLSSGEEHSAFFRRGEAG  306

Query  946   DWSNHMTEEMARRLDQIVQEKFTGTGL  1026
             DW NH+T EMA ++D+I +EK+ G+GL
Sbjct  307   DWRNHLTAEMAEQIDRITEEKWQGSGL  333



>ref|XP_007010821.1| Sulfotransferase 2A [Theobroma cacao]
 gb|EOY19631.1| Sulfotransferase 2A [Theobroma cacao]
Length=349

 Score =   313 bits (801),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/318 (48%), Positives = 214/318 (67%), Gaps = 4/318 (1%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             +E + + E +  ++SLPKE GW TP +Y ++GFW +P  +Q  ++  +HFQ +DSD+IL+
Sbjct  29    EEENLSNECKGLIHSLPKEKGWRTPFIYLFQGFWCQPKEIQAIISFQKHFQARDSDVILA  88

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALT  432
             T PKSGT W+KAL FA++ RK+F    + HPL T+NPHDL+PF E   YA  + PD +  
Sbjct  89    TIPKSGTTWIKALTFAIMNRKRFTTSSKNHPLLTSNPHDLVPFFEYKLYANNQIPDLSNL  148

Query  433   NGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFP  612
                RL  TH+P + L +S+  S  +++Y+CRNP DT +S WH++NK+R E   L   P  
Sbjct  149   PKPRLFGTHVPFASLQESIKSSSCRIIYVCRNPFDTFISSWHYINKVRPE--SLPPFPLE  206

Query  613   EAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCP  792
             EAF+ YC+GV   GPFW+H+  YWKES E P KVLF+KYE+MK++   HL+ +A FLG P
Sbjct  207   EAFNLYCKGVVGFGPFWEHMLGYWKESTERPEKVLFMKYEDMKEDTVSHLKMLANFLGVP  266

Query  793   FSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEE  972
             FS EEEE G++  I +LCSFE+L +LEVNK         EN  LFRKG VGDW N+++  
Sbjct  267   FSIEEEEEGMIKDIAKLCSFENLKDLEVNKCG-KSIKNFENKHLFRKGAVGDWVNYLSPS  325

Query  973   MARRLDQIVQEKFTGTGL  1026
             M  +L ++++EK   +GL
Sbjct  326   MVEQLSKVIEEKLGDSGL  343



>ref|XP_002304810.1| sulfotransferase family protein [Populus trichocarpa]
 gb|EEE79789.1| sulfotransferase family protein [Populus trichocarpa]
Length=337

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/313 (50%), Positives = 209/313 (67%), Gaps = 4/313 (1%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKS  270
             T E +E L SLP+E GW T  LY YKGFW +P  +Q  ++  +HF+P+D+D+IL++ PKS
Sbjct  22    TNECKELLLSLPREKGWRTACLYKYKGFWCQPKEIQAIISFQKHFEPRDTDVILASIPKS  81

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRL  447
             GT WLKAL+FA++ RK+F      HPL  +NPHDL PF E   YA K+ PD +     RL
Sbjct  82    GTTWLKALSFAILNRKKFAISSNDHPLLVSNPHDLAPFFEYKLYADKQVPDLSKLPDPRL  141

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
              ATH+P + L  S+ +S  +++Y+CRNP DT +S W F NKLRSE   +  +   E F  
Sbjct  142   FATHIPFASLQDSIKKSNCRIIYICRNPFDTFISSWTFSNKLRSE--TVPPLLLEETFKM  199

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             YC GV   GPFWDH+  YWKESLE   KVLFLKYE+MK +   +L+++A FLGCPFS EE
Sbjct  200   YCEGVVGFGPFWDHMLGYWKESLERQDKVLFLKYEDMKADVTFYLKKIAKFLGCPFSMEE  259

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRL  987
             E+ GVV  I  LCSFE + NLEVNK+        EN  LFRK +VGDW N+++  M ++L
Sbjct  260   EKEGVVEKIASLCSFEKMKNLEVNKSG-RSITNFENKHLFRKAEVGDWVNYLSPSMVKQL  318

Query  988   DQIVQEKFTGTGL  1026
              Q+++EK  G+G+
Sbjct  319   SQLIEEKLGGSGI  331



>ref|XP_003530555.2| PREDICTED: cytosolic sulfotransferase 5-like [Glycine max]
Length=361

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/327 (49%), Positives = 220/327 (67%), Gaps = 12/327 (4%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQEN  ++E +E +++LP E GW+   L+ Y+GFW     LQG L+  +HF+  D+D+
Sbjct  38    KYLQENELSQECKEVISTLPMERGWVASHLHQYQGFWHTTRQLQGVLSCQKHFKALDTDV  97

Query  247   ILSTFPKSGTVWLKALAFALITRKQFL--AEQETHPLHTNNPHDLIPFLELSYAAKER--  414
             ++ + PKSGT WLKA  F+L+ R Q     + + HPL  NNPH L+PFLEL     +   
Sbjct  98    LIVSTPKSGTTWLKAWTFSLLHRNQHDPNTQNQNHPLLFNNPHFLVPFLELDLYIDDNTL  157

Query  415   PDF-ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRG  591
             PD  +L    RL +THLP   LPKSV ES  K++YLCR+PKD  +S WHF N LR + RG
Sbjct  158   PDLTSLITSPRLFSTHLPYVSLPKSVQESACKIIYLCRDPKDAFISLWHFTNMLRPKSRG  217

Query  592   LEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRM  771
             + ++   EAFD +CRGV   GPFW HV +YW++SL  P K++F+++EEMK +P + L+ +
Sbjct  218   MNSLQ--EAFDKFCRGVSLYGPFWAHVLDYWQKSLSEPNKIMFMRFEEMKMKPRLVLQEL  275

Query  772   AAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVG  945
             A F+GCPFS+EEEE GVV  IL+LCSF++LSNL+VNK   NG L  G E+   FR G++G
Sbjct  276   ATFVGCPFSKEEEEAGVVDHILKLCSFDNLSNLQVNK---NGKLSSGEEHKAFFRCGQIG  332

Query  946   DWSNHMTEEMARRLDQIVQEKFTGTGL  1026
             D  NH+T EM ++L+ I QEK    GL
Sbjct  333   DCKNHLTAEMIQQLNTITQEKLAEHGL  359



>ref|XP_003628737.1| Flavonol sulfotransferase-like protein [Medicago truncatula]
 gb|AET03213.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=318

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 211/322 (66%), Gaps = 20/322 (6%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQ++  ++E +E + +LP E  W+    Y Y+GFW+     QG L+  +HFQ  DSDI
Sbjct  13    KYLQDDDLSQECKELIPTLPSEKAWILTHTYQYQGFWIATKKFQGVLSCQKHFQALDSDI  72

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKER-PD  420
             IL T PKSGT WLKAL FAL+ R ++      HPL  +NPH L+PFLE+  Y+ K+  P+
Sbjct  73    ILVTAPKSGTTWLKALTFALLNRNKYPIIHNNHPLLISNPHSLVPFLEIDLYSDKDYVPN  132

Query  421   FALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEA  600
                 +  RL +TH+P +LLPKSV ES  KVVYLCR+PKD  VS +               
Sbjct  133   LNSLSHPRLFSTHIPCALLPKSVKESTCKVVYLCRDPKDMFVSLY---------------  177

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAF  780
               F EAF+S+CRGV + GPFW+HV  YWKE+LE P KV+F+K+EEMK +P  +L+++A F
Sbjct  178   --FEEAFESFCRGVSSYGPFWEHVLGYWKENLERPEKVMFIKFEEMKMKPSFYLKKIAEF  235

Query  781   LGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNH  960
             LGCPF  EEE  G++  IL LCSFE+LSNLEVNKT V    GVEN   FR+G+VGDW N 
Sbjct  236   LGCPFFNEEESKGMIDDILNLCSFENLSNLEVNKT-VRVATGVENKAFFRRGQVGDWKNL  294

Query  961   MTEEMARRLDQIVQEKFTGTGL  1026
             +T EM ++L+ I + K    GL
Sbjct  295   LTAEMIKQLNTITENKLGKHGL  316



>ref|XP_010048648.1| PREDICTED: cytosolic sulfotransferase 13-like [Eucalyptus grandis]
 gb|KCW80976.1| hypothetical protein EUGRSUZ_C02341 [Eucalyptus grandis]
Length=344

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 165/336 (49%), Positives = 214/336 (64%), Gaps = 21/336 (6%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYN-----------YKGFWLEPFFLQGALTI  213
              +L+++  + E  + L+SLP E  W+   L +           Y+GFW     L   +  
Sbjct  12    NYLRDDVKSPECEDLLSSLPSEEDWIPTSLSSEEDCSPSSLHLYQGFWFPSGLLNSVVAC  71

Query  214   HQHFQPQDSDIILSTFPKSGTVWLKALAFALITRKQFLAE--QETHPLHTNNPHDLIPFL  387
               HFQ   SDI+L T PK GT WLKA+ FAL  R ++     Q+ HPL T NPHDL+PFL
Sbjct  72    QNHFQAHPSDILLVTSPKCGTTWLKAILFALSNRAEYSDSNPQQRHPLLTQNPHDLVPFL  131

Query  388   ELSYAAKER-PDFALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFM  564
             ELS+  + + PD       RLLATHLP S LP+SV +S  K+VYLCRNPKDT +S WH +
Sbjct  132   ELSFNLQNKNPDLTTFTSPRLLATHLPYSSLPRSVRDSNCKLVYLCRNPKDTFISMWHHI  191

Query  565   NKLRSELRGLEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKK  744
             NKLR E +G   +P PE  D +CRG+   GP+WDHV  Y K S E P KVLF+KYEEMK 
Sbjct  192   NKLRPEEKG--QLPLPEGLDKFCRGMSWCGPYWDHVLGYHKASSEMPEKVLFMKYEEMKA  249

Query  745   EPEVHLRRMAAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENG  918
             +P V +RR+A F+G PFSEEE   G V GILR+CSF++LS LEVN++   G L  G+E  
Sbjct  250   DPSVQVRRLADFMGRPFSEEELRNGTVEGILRMCSFDNLSALEVNRS---GKLLIGLEKK  306

Query  919   VLFRKGKVGDWSNHMTEEMARRLDQIVQEKFTGTGL  1026
               FRKG+VGDW N+M+ EM  R+D +++EK  G+GL
Sbjct  307   WFFRKGEVGDWVNYMSAEMGERIDGVMEEKLHGSGL  342



>ref|XP_010050715.1| PREDICTED: cytosolic sulfotransferase 13-like [Eucalyptus grandis]
 gb|KCW80300.1| hypothetical protein EUGRSUZ_C01660 [Eucalyptus grandis]
Length=321

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/321 (49%), Positives = 208/321 (65%), Gaps = 5/321 (2%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             +Q +  ++     ++SLP + GW    L  Y+GFW   +   G L   +HFQ  + DIIL
Sbjct  1     MQSSQPSQACTNLISSLPSDKGWDNFSLILYQGFWFPSWLFDGVLACQKHFQAHNYDIIL  60

Query  253   STFPKSGTVWLKALAFALITRKQFLA--EQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
              T PKSGT WLK + FAL+ R ++     +  HPL T NPHDL+P+LE   Y  +E PD 
Sbjct  61    VTSPKSGTTWLKVILFALLNRAKYSDPHSERCHPLLTRNPHDLVPYLEFQLYLQQEDPDH  120

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             A     RLLATHLP S LP+S+ +SK K+V+LC+NPKD  +S WHF  K+  +    +  
Sbjct  121   ATFASPRLLATHLPYSSLPQSMRDSKCKLVHLCKNPKDNFISLWHFTKKMMLKENSGQT-  179

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
             P PE  D +C+G+   GP+WDHV  Y K SLE P KV F+KYEEMK++P VH+RR+A F+
Sbjct  180   PLPECLDKFCQGLSMYGPYWDHVLGYHKMSLEMPEKVFFMKYEEMKEDPCVHVRRLADFV  239

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHM  963
             GCPFSEEE   G V GILR+CSF++LS LEVNK+  +   G EN   FR+G+VGDW N+M
Sbjct  240   GCPFSEEELRGGTVEGILRMCSFDNLSTLEVNKSGSHWT-GAENKSFFRRGEVGDWVNYM  298

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             + EM  R+D + +EK  G+GL
Sbjct  299   SAEMGERIDSVTEEKLHGSGL  319



>ref|XP_006591672.1| PREDICTED: cytosolic sulfotransferase 15-like [Glycine max]
Length=342

 Score =   310 bits (793),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 147/320 (46%), Positives = 215/320 (67%), Gaps = 5/320 (2%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             ++++  +++  E + SLP+E GW TP +Y ++GFW +P  +Q  +T  +HFQ +DSD+++
Sbjct  20    IEDDKISQQSTELILSLPREKGWRTPYVYLFQGFWCQPHEIQAIITFQKHFQAKDSDVLV  79

Query  253   STFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAK--ERPDFA  426
             +T PKSGT WLKAL FA ++R  F +  + HPL   NPHDL+PF E +   K  + PD +
Sbjct  80    ATVPKSGTTWLKALTFATVSRHNFSSFNKNHPLLNFNPHDLVPFFEYTVYDKHDKVPDLS  139

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
               +  RL  TH+P + L KS+ ES  KV+Y+CRNP DT +S W F NK++     L  + 
Sbjct  140   NMHEPRLFGTHVPFASLSKSIKESNCKVIYICRNPFDTFISSWFFANKIKP--GSLPTLA  197

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               EAF+ YC+GV   GPFW H+  YWKES+E P KVLFL YE++K +   HL+R+A FLG
Sbjct  198   LDEAFEMYCKGVVGFGPFWTHMLGYWKESIEKPNKVLFLMYEDLKGDINFHLKRVAEFLG  257

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMT  966
             CPF+ EEE  GV+  I++LCSF+ +  LEVNK+   G    EN  LFRKG++GDW N+++
Sbjct  258   CPFTLEEENRGVIENIIKLCSFQKMKELEVNKSGTFGR-NFENKFLFRKGEIGDWVNYLS  316

Query  967   EEMARRLDQIVQEKFTGTGL  1026
               MA++L +++++K  G+GL
Sbjct  317   PSMAQKLTKVMEDKLGGSGL  336



>ref|XP_007028479.1| Sulfotransferase 2A, putative [Theobroma cacao]
 gb|EOY08981.1| Sulfotransferase 2A, putative [Theobroma cacao]
Length=377

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/319 (50%), Positives = 211/319 (66%), Gaps = 6/319 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             Q+    +E  E + SLPKE GW TP LY ++GFW +P  +Q  ++  +HFQ + +D+IL+
Sbjct  61    QQEKMDKECEELVLSLPKEKGWRTPYLYKFQGFWCQPKEIQAIISFQKHFQARATDVILA  120

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALT  432
             T PKSGT W+KAL FA + R++F      HPL T+NPHDL+PFLE   YA  E PD +  
Sbjct  121   TIPKSGTTWIKALVFATMNRQRF-GISNCHPLLTSNPHDLVPFLEYKLYADNEIPDLSDL  179

Query  433   NGSRLLATHLPVSLLPKSVWE-SKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
                RL ATH+P + L  S+   S  ++VYLCRNP DT +S WHF+NK+RS+   L  +P 
Sbjct  180   PNPRLFATHVPFASLQNSIKNNSDRRIVYLCRNPFDTFISSWHFINKVRSD--SLPPLPL  237

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
              EAFD YC GV   GPFW+H+  YWK+SLE P  VLFLKY++MKK+   HL  +A FLG 
Sbjct  238   EEAFDMYCNGVVGFGPFWEHMLGYWKQSLERPKNVLFLKYDDMKKDIISHLMVLAKFLGL  297

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTE  969
             PFS  EE+ GV+  I +LCSF++L +LEVN  S       EN  LFRKG+VGDW N+++ 
Sbjct  298   PFSVAEEKEGVIEEIAKLCSFDNLKDLEVN-NSGKAIKNFENKHLFRKGEVGDWVNYLSP  356

Query  970   EMARRLDQIVQEKFTGTGL  1026
              M  RL ++++EKF  +GL
Sbjct  357   LMVERLSKVIEEKFGASGL  375



>gb|KHN26485.1| Flavonol sulfotransferase-like [Glycine soja]
Length=342

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/320 (46%), Positives = 215/320 (67%), Gaps = 5/320 (2%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             ++++  +++  E + SLP+E GW TP +Y ++GFW +P  +Q  +T  +HFQ +DSD+++
Sbjct  20    IEDDKISQQTTELILSLPREKGWRTPYVYLFQGFWCQPHEIQAIITFQKHFQAKDSDVLV  79

Query  253   STFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAK--ERPDFA  426
             +T PKSGT WLKAL FA ++R  F +  + HPL   NPHDL+PF E +   K  + PD +
Sbjct  80    ATVPKSGTTWLKALTFATVSRHNFSSFNKNHPLLNFNPHDLVPFFEYTVYDKHDKVPDLS  139

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
               +  RL  TH+P + L KS+ +S  KV+Y+CRNP DT +S W F NK++     L  + 
Sbjct  140   NMHEPRLFGTHVPFASLSKSIKDSNCKVIYICRNPFDTFISSWFFANKIKP--GSLPTLA  197

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               EAF+ YC+GV   GPFW H+  YWKES+E P KVLFL YE++K +   HL+R+A FLG
Sbjct  198   LDEAFEMYCKGVVGFGPFWTHMLGYWKESIEKPNKVLFLMYEDLKGDINFHLKRVAEFLG  257

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMT  966
             CPF+ EEE  GV+  I++LCSF+ +  LEVNK+   G    EN  LFRKG++GDW N+++
Sbjct  258   CPFTLEEENRGVIENIIKLCSFQKMKELEVNKSGTFGR-NFENKFLFRKGEIGDWVNYLS  316

Query  967   EEMARRLDQIVQEKFTGTGL  1026
               MA++L +++++K  G+GL
Sbjct  317   PSMAQKLTKVMEDKLGGSGL  336



>ref|XP_010523117.1| PREDICTED: cytosolic sulfotransferase 12-like [Tarenaya hassleriana]
Length=326

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 161/320 (50%), Positives = 201/320 (63%), Gaps = 7/320 (2%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             FL  +S ++E RE ++ LP+E GW+   LY Y+GFW  P  LQ  +   +HFQ QDSDII
Sbjct  11    FLDLDSISQECREMMSRLPRERGWMNLFLYQYQGFWHPPRQLQATINCQRHFQAQDSDII  70

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA  426
             L T+PKSGT WLKAL F+L+ R      ++ HPL TN+PH L+PFLEL  Y     PD +
Sbjct  71    LVTYPKSGTTWLKALVFSLMNRHNL---RDHHPLLTNSPHLLVPFLELDLYFDAHAPDLS  127

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
                  RL ATHLP   LP+ +  S  K+VY  RNPKDT VS WHF  KLR   + L ++P
Sbjct  128   QMTSPRLFATHLPFVSLPEPIRRSSCKIVYCYRNPKDTFVSLWHFSKKLRP--KELPSLP  185

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
                 FD +C GV   GPFWDHV  YW+   E PGK  F+ YEEMK EP   L+R+A FL 
Sbjct  186   MELLFDRFCSGVSAYGPFWDHVLGYWENPRETPGKTFFITYEEMKAEPRAQLKRLAEFLE  245

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMT  966
             CPFS EEE+ G V  I RLCSF+SLS LE NK      +GV++   FRKG+VG W + +T
Sbjct  246   CPFSREEEDKGTVDDIARLCSFDSLSGLEPNKIG-KLPIGVDSNSFFRKGEVGGWRDALT  304

Query  967   EEMARRLDQIVQEKFTGTGL  1026
               MA  LD+I + KF G+G 
Sbjct  305   PSMAEELDRISEHKFRGSGF  324



>ref|XP_008231647.1| PREDICTED: cytosolic sulfotransferase 15-like [Prunus mume]
Length=326

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/319 (48%), Positives = 211/319 (66%), Gaps = 4/319 (1%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             L+E   T+E  E   SLPKE GW T  LY ++GFW +   +Q  ++  +HFQ  D+DI++
Sbjct  5     LEEQKLTDECTELPLSLPKERGWRTLHLYQFQGFWCQSAEIQSIMSFQKHFQANDTDIVV  64

Query  253   STFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFAL  429
             ++ PKSGT WLKALAFA+  R +F+   ++HPL  +NPHDL+PFLE   YA  + PD   
Sbjct  65    ASIPKSGTTWLKALAFAVSNRHRFIPNSKSHPLLNSNPHDLVPFLEYKLYANNQLPDLTN  124

Query  430   TNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
              +  RL  TH+P + L  S+  S  K+V++CRNP DT VS WHF+NK++ E     +M  
Sbjct  125   ISEPRLFGTHIPFASLGNSIKNSDAKIVFICRNPLDTFVSSWHFLNKVKPESGSPISM--  182

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
              EAFD YC+G+   GPFWDH+  YWKESL  P KVLFLKYE+MK++    L+++A FLG 
Sbjct  183   EEAFDMYCKGIVGFGPFWDHMLGYWKESLLRPNKVLFLKYEDMKEDGAFQLKKLAKFLGF  242

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTE  969
             PF+ EEE  GVV  I +LC FE++  LEVNK   + +   EN  LFRK +VGDW N+++ 
Sbjct  243   PFTLEEERGGVVENIAKLCCFENMKKLEVNKIGSSIE-NFENKNLFRKAEVGDWVNYLSP  301

Query  970   EMARRLDQIVQEKFTGTGL  1026
             +M  RL ++++E+  G+GL
Sbjct  302   KMVERLSKVIEERLGGSGL  320



>gb|EYU28890.1| hypothetical protein MIMGU_mgv1a009426mg [Erythranthe guttata]
Length=342

 Score =   308 bits (788),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 167/319 (52%), Positives = 210/319 (66%), Gaps = 12/319 (4%)
 Frame = +1

Query  103   REFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHF-QPQDSDIILSTFPKSGTV  279
             +  + +LPKE GWL+  LY ++GFW     LQG +   ++F +  DSDI L T PKSGT 
Sbjct  27    KRIIATLPKEKGWLSSHLYRFQGFWYPVRHLQGVIACQKNFVETLDSDIFLVTTPKSGTT  86

Query  280   WLKALAFALITRKQFLAEQET---HPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRL  447
             WLKA+ FAL  R +      T   HPL  NNPHDL+PFLE+  Y   + PD +  +  RL
Sbjct  87    WLKAIIFALTIRTKHPVATTTDKNHPLLHNNPHDLVPFLEIKLYVDNQIPDLSTFSTPRL  146

Query  448   LATHLPVSLLPKSVWESKG-KVVYLCRNPKDTVVSFWHFMNKLRS-ELRGLEAMPFPEAF  621
              +THLP   LP+SV +S   K+VYLCRNPKD   S WHF NKLRS E  G       E F
Sbjct  147   FSTHLPHVSLPESVKKSSACKIVYLCRNPKDVFTSLWHFTNKLRSQEKSGGATNCIDEVF  206

Query  622   DSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSe  801
             D +CRGV   GPFWDHV EYW  S E   +V+F+K+EEMK+EP V LRR+A FLG  FS 
Sbjct  207   DMFCRGVSLFGPFWDHVLEYWNLSREYSYRVMFVKFEEMKEEPGVCLRRLADFLGFGFSA  266

Query  802   eeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHMTEEM  975
              EEE GVV GIL+LCSF++LS+LE+N    NG L  G EN   FR+G VGDW N+M++EM
Sbjct  267   AEEESGVVEGILKLCSFDNLSSLEIN---TNGKLSSGEENKAFFRRGVVGDWKNYMSDEM  323

Query  976   ARRLDQIVQEKFTGTGLML  1032
               +LD+I +EKF+G+GLM+
Sbjct  324   VEKLDRITREKFSGSGLMM  342



>ref|XP_010545823.1| PREDICTED: cytosolic sulfotransferase 5-like [Tarenaya hassleriana]
Length=321

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 162/321 (50%), Positives = 213/321 (66%), Gaps = 8/321 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             +FL+++  +EE +  ++ L K+  +   D+ NYKG W     LQG L    HF PQDSD+
Sbjct  5     EFLRDDKLSEESKNLISRLAKDKNFQGTDICNYKGCWYFFNALQGILHAQTHFHPQDSDV  64

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
              LS+FPKSGT WLKAL FALI R         HPL   NPHDL+PFLEL  Y   + PD 
Sbjct  65    FLSSFPKSGTTWLKALVFALIHRHN-HHHHHHHPLLARNPHDLVPFLELRLYFKNQIPDL  123

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +     RL ATH+P  +L +++  S  K+VY+CR+PKDT+VS WHF  KL+ +   LE +
Sbjct  124   SGFPSPRLFATHMPFPMLRETIKGSPSKIVYICRDPKDTLVSAWHFYGKLQRQEIRLETV  183

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                  FDSYCRGV   GPFWDHV  YWKES++NP  V F++YEE++ +P V L+R+A FL
Sbjct  184   -----FDSYCRGVHAWGPFWDHVLSYWKESVKNPKHVFFMRYEELQADPTVQLKRLAGFL  238

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHM  963
              CPF+EEEE+ G V  IL+LCSF SLS LEVNKT       ++   LFRKG+VGDW+N++
Sbjct  239   ECPFTEEEEKSGAVDQILKLCSFSSLSGLEVNKTGKTPS-DIDFKTLFRKGEVGDWANYL  297

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             T EM +R+D IV++K  G+GL
Sbjct  298   TPEMGKRIDDIVEDKLRGSGL  318



>gb|EYU26929.1| hypothetical protein MIMGU_mgv1a009329mg [Erythranthe guttata]
Length=345

 Score =   308 bits (788),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 161/320 (50%), Positives = 213/320 (67%), Gaps = 5/320 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             Q+   + E +E L SLPKE GW TP+LY Y+ FW +P  +Q  +++  H+  +++D+I++
Sbjct  17    QQELISPECKELLISLPKERGWRTPNLYLYQHFWCQPKEIQAIISVQNHYNAENTDLIVA  76

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAA--KERPDFAL  429
             T PKSGT WLKAL+FA++ R+ F   Q+ HPL T+N H+L+PFLE    A  +  PD + 
Sbjct  77    TIPKSGTTWLKALSFAIVNRRNFAHNQKNHPLLTSNSHELVPFLEYKLFADYENIPDMSR  136

Query  430   TNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
                  LL TH+P++ LP SV + K K+VY+ RNP DT VS WHFMNKLR E  G   +  
Sbjct  137   FPRPLLLGTHMPINALPDSVMDLKCKIVYMVRNPFDTFVSIWHFMNKLRPEYLG--PLSL  194

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
              EAFD YCRG    GP+WDH+  YW ESL  P KVLFLKYEE+K+    HL+++A FLG 
Sbjct  195   EEAFDMYCRGAIGFGPYWDHMLGYWYESLRAPQKVLFLKYEEVKENTCFHLKKLAEFLGF  254

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNG-DLGVENGVLFRKGKVGDWSNHMT  966
             PFS EEEE G V GI +LCSF+ + +L+VNKT       G EN  LFRKG+VGDW+N +T
Sbjct  255   PFSLEEEEGGAVEGIAKLCSFDKMKDLDVNKTGKGAITAGFENRDLFRKGEVGDWANLLT  314

Query  967   EEMARRLDQIVQEKFTGTGL  1026
               M  RL  I++EK  G+GL
Sbjct  315   PLMVERLTDIMEEKLAGSGL  334



>ref|XP_002265863.1| PREDICTED: cytosolic sulfotransferase 15 [Vitis vinifera]
 emb|CAN66204.1| hypothetical protein VITISV_041148 [Vitis vinifera]
 emb|CBI35072.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   307 bits (787),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 160/314 (51%), Positives = 207/314 (66%), Gaps = 7/314 (2%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKS  270
             + E +E L SLPKE GW TP +Y Y+GFW +P  +Q       HFQ +D+D+IL+T PK+
Sbjct  20    SHECKELLLSLPKERGWRTPHIYLYQGFWCQPKEIQAITNFQHHFQARDTDLILATMPKA  79

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRL  447
             GT WLKA+AFA++ RK  +    THPLHT+NPHDL+PFLE   YA    PD +     RL
Sbjct  80    GTTWLKAMAFAILNRKP-IPVSTTHPLHTSNPHDLVPFLEYKLYANNNFPDLSKLPQPRL  138

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
              ATH+P + LP+S+ +S  +VVY+CRNP D   S WHF+ K R E   L  +   E F  
Sbjct  139   FATHVPFASLPESITKSNSRVVYMCRNPLDAFASSWHFLMKARPE--SLGPISIEEGFQM  196

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             YC+G    GPFW H+  YWKES+E P KVLFLKYE+ K++    L+R+A FLG PFS EE
Sbjct  197   YCKGSMAFGPFWKHMLGYWKESIERPHKVLFLKYEDTKEDIIFQLKRLAKFLGVPFSLEE  256

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSVNGDLG-VENGVLFRKGKVGDWSNHMTEEMARR  984
             E  GV+  I RLCSFE+L NLEVN++     +G  EN  LFRKG VGDW N +T  MA++
Sbjct  257   ERKGVIEEIARLCSFENLKNLEVNQS--GKSIGYFENKDLFRKGVVGDWVNLLTPLMAKQ  314

Query  985   LDQIVQEKFTGTGL  1026
             L Q+++EK  G+ L
Sbjct  315   LVQVMEEKLEGSDL  328



>ref|XP_008807420.1| PREDICTED: flavonol sulfotransferase-like [Phoenix dactylifera]
Length=356

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/312 (49%), Positives = 211/312 (68%), Gaps = 9/312 (3%)
 Frame = +1

Query  97    EFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             E+ + +++LP + GW    L  Y+GFW+  + L G + + QHF+   SD+ L ++PKSGT
Sbjct  34    EYSDLISTLPLDKGWEPYLLRKYQGFWIAEYILPGIIALQQHFKACHSDLFLMSYPKSGT  93

Query  277   VWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGSRLLAT  456
              WLKALAFA I R ++  +   HPL ++NPHD IP +++ +A+K +     T   R+L +
Sbjct  94    TWLKALAFATINRNRY--QFADHPLLSHNPHDCIPLIDIDFASKIKD----TPSPRILQS  147

Query  457   HLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCR  636
             H P SLLP S+  S  +++Y+ R+ KD  VS W F N+LR    GLE +PF +AF+ +C 
Sbjct  148   HAPYSLLPDSIKASDCRIIYVFRDAKDVFVSDWFFFNRLRRS-NGLEPIPFGKAFELFCE  206

Query  637   GVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeC  816
             GVC+ GP WDHV EYW+ESL  P KVLFL YEEM  +P  +++R+A F+GCPFS +EE+ 
Sbjct  207   GVCSYGPIWDHVLEYWEESLRRPEKVLFLNYEEMLADPAGNVKRLAKFMGCPFSTDEEKE  266

Query  817   GVVSGILRLCSFESLSNLEVNKTS--VNGDLGVENGVLFRKGKVGDWSNHMTEEMARRLD  990
             GVV  I+RLCSFE L NLEVNK S  V  ++  +N   FRKG+VGDW NHM+ EMA RLD
Sbjct  267   GVVEQIVRLCSFEKLKNLEVNKRSKFVLPNVKFDNESYFRKGEVGDWRNHMSLEMALRLD  326

Query  991   QIVQEKFTGTGL  1026
             +I+QEK  GT L
Sbjct  327   RIIQEKMRGTSL  338



>ref|XP_010260931.1| PREDICTED: cytosolic sulfotransferase 5-like [Nelumbo nucifera]
Length=338

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 166/325 (51%), Positives = 209/325 (64%), Gaps = 12/325 (4%)
 Frame = +1

Query  67    QFLQEN--SYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDS  240
             ++LQE       E +  L SLP+  GW+   LY Y+GFW     L GA+    HF+ QD+
Sbjct  19    KYLQEEVEELKGEGKHLLPSLPRGVGWICNHLYQYQGFWYTARKLLGAINCQGHFKAQDT  78

Query  241   DIILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERP  417
             D++L T PKSGT WLKA+AFA++ RK++      HPL T NPH+L+PFLE+  Y     P
Sbjct  79    DLLLVTNPKSGTTWLKAIAFAIVNRKRYSFSH--HPLLTTNPHELVPFLEIKLYVDDHVP  136

Query  418   DFALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLE  597
             D A     RL +THLP   LP SV  SK KVV+LCR+PKDT +S WHF +KLR+   G E
Sbjct  137   DLATFTSPRLFSTHLPYLSLPDSVKHSKCKVVFLCRDPKDTFISLWHFTSKLRTS--GQE  194

Query  598   AMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAA  777
              +   EAF  +CRGV   GPFWDHV  YW ES E P +V F KYEEMK++P VH+RR+A 
Sbjct  195   PISLEEAFHRFCRGVSLYGPFWDHVLGYWNESQERPDRVCFFKYEEMKEQPAVHIRRLAK  254

Query  778   FLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDW  951
             FLG PFS EEEE G V  I RLCSF++LSNL+VNK   NG +  G E    FR+G VGDW
Sbjct  255   FLGYPFSPEEEEEGTVEEIFRLCSFDTLSNLDVNK---NGKMESGEEYRTFFRRGVVGDW  311

Query  952   SNHMTEEMARRLDQIVQEKFTGTGL  1026
              N++T EM    ++I  +K  G+GL
Sbjct  312   VNYLTPEMVDEFNRITDQKLGGSGL  336



>gb|KCW80596.1| hypothetical protein EUGRSUZ_C01959 [Eucalyptus grandis]
Length=302

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/322 (49%), Positives = 207/322 (64%), Gaps = 26/322 (8%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             +Q +  ++   + ++SLP + GW  P L  Y+GFW   +   G L   +HFQ  +SDIIL
Sbjct  1     MQSSQPSQACTDLISSLPSDKGWDNPSLILYQGFWFPSWLFDGVLACQKHFQAHNSDIIL  60

Query  253   STFPKSGTVWLKALAFALITRKQFLA--EQETHPLHTNNPHDLIPFLELSYAAKERPDFA  426
              T PKSGT WLKA+ FAL+ R ++     ++ HPL T NPHDL+P+LEL           
Sbjct  61    VTSPKSGTTWLKAILFALLNRAKYSDPNSEQCHPLQTRNPHDLVPYLEL-----------  109

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
                    LATHLP S LP+SV +SK K+VYLCRNPKD  +S WHF  K+  +  G +  P
Sbjct  110   -------LATHLPYSSLPQSVRDSKCKLVYLCRNPKDNFISLWHFTKKMMLKENG-DQTP  161

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
              PE  D +C+G+   GP+WDHV  Y K S E P KVLF+KYEEMK++P VH+RR+A F+G
Sbjct  162   LPECLDKFCQGLSMYGPYWDHVLGYHKMSSEMPEKVLFMKYEEMKEDPCVHVRRLATFVG  221

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNH  960
             CPFSEEE   G V GILR+CSF++LS LEVNK+   G L  G EN   FR+G+VGD  N+
Sbjct  222   CPFSEEELRGGTVEGILRMCSFDNLSTLEVNKS---GSLWTGAENKSFFRRGEVGDRVNY  278

Query  961   MTEEMARRLDQIVQEKFTGTGL  1026
             M+ EM   +D +++EK  G+GL
Sbjct  279   MSAEMGEIIDSVMEEKLHGSGL  300



>ref|XP_010523511.1| PREDICTED: cytosolic sulfotransferase 5-like [Tarenaya hassleriana]
Length=326

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 161/326 (49%), Positives = 226/326 (69%), Gaps = 13/326 (4%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPD-LYNYKGFWLEPFFLQGALTIHQHFQPQDSD  243
              F+++++ T+E +  ++SLP +  +L  + L NYKGFW     LQG L +  HF+P+D+D
Sbjct  5     NFMKDDNITQECKNLISSLPLDKDFLGKNNLCNYKGFWYHYNTLQGILNVENHFRPRDTD  64

Query  244   IILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPD  420
             II+++FPK+GT WLKAL FAL+ R ++ A  E HPL + NPH L+PFLE+  Y  ++ PD
Sbjct  65    IIVASFPKTGTTWLKALTFALVERGKYNANPENHPLLSQNPHILVPFLEVDLYLERQNPD  124

Query  421   FALTN-GS--RLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNK-LRSELR  588
               LTN GS  ++  TH+P  +L +SV +S  K+VY+ RN KD +VS W F NK ++S + 
Sbjct  125   --LTNHGSPRKMFGTHVPFFMLQESVKDSPCKIVYVSRNLKDAIVSDWIFRNKYMKSAMH  182

Query  589   GLEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRR  768
             G     F   F S+CRGV   GPFWDHV  YWK SLENP  V+F+KYE++KKEP V ++R
Sbjct  183   G---ASFEVFFQSFCRGVNFFGPFWDHVLSYWKASLENPKHVIFMKYEDLKKEPRVQIKR  239

Query  769   MAAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGD  948
             +A FL CPF+EEEEE G+V  IL+LCS  +LSNLE NKT    +L  ++   FRKG+VGD
Sbjct  240   LAEFLDCPFTEEEEESGLVDEILKLCSLRNLSNLEANKTGSICNLEFKD--FFRKGEVGD  297

Query  949   WSNHMTEEMARRLDQIVQEKFTGTGL  1026
             W NH+T +MA+++D +++EK  G+GL
Sbjct  298   WKNHLTSDMAKKIDDVMEEKLRGSGL  323



>ref|XP_010523502.1| PREDICTED: cytosolic sulfotransferase 11 [Tarenaya hassleriana]
Length=332

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 158/322 (49%), Positives = 211/322 (66%), Gaps = 7/322 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
              +++++  T+E +  ++SLP +  +L  +L NYKGFW  P   Q  L    HFQP+D+DI
Sbjct  13    NYMRDDKVTQECKNLISSLPLDKDFLGKNLCNYKGFWYYPNTFQAILDAKNHFQPRDTDI  72

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKER-PDF  423
             ILS+FPK+GT WLKAL FAL+ R ++ A  E HPL + NPH LIPFLE+   A+ R PD 
Sbjct  73    ILSSFPKAGTTWLKALVFALVERGKYRANPEIHPLLSQNPHSLIPFLEIDLYAESRIPDL  132

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             A     RL  TH+P   L ++V ++  KVVY+CRN KD +VS WHF  +   E+ G    
Sbjct  133   AGLASPRLFGTHMPFLQLQETVKDTPCKVVYMCRNLKDVLVSGWHFRKRFLREMDGTTIE  192

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                EAF    RGV   GPFWDH   YWKESL+NP  V F+KYE+M  EP V ++R+A FL
Sbjct  193   SMAEAF---VRGVNLFGPFWDHALSYWKESLDNPKLVHFMKYEDMINEPRVQIKRLAEFL  249

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKT-SVNGDLGVENGVLFRKGKVGDWSNH  960
               PF+EEEEE G+V  IL+LCS  +LSNLEVNK      D+  +N   FRKG+VGDW NH
Sbjct  250   DRPFTEEEEESGLVDEILKLCSLRNLSNLEVNKKGKAPCDIDFKN--FFRKGEVGDWKNH  307

Query  961   MTEEMARRLDQIVQEKFTGTGL  1026
             +T +MA+++D +++EK  G+GL
Sbjct  308   LTPDMAKKIDDVMEEKLQGSGL  329



>ref|XP_006347852.1| PREDICTED: cytosolic sulfotransferase 15-like [Solanum tuberosum]
Length=337

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 158/319 (50%), Positives = 208/319 (65%), Gaps = 8/319 (3%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             QE    EE  EFL SLPKE GW TP+L+ ++GFW +P  ++  ++I  HF  QD+D+IL+
Sbjct  20    QETLSEEELDEFLTSLPKEKGWRTPNLFLFQGFWCQPKEIRAIISIQNHFIAQDTDVILA  79

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKER-PDFAL  429
             T PKSGT WLKAL FA++ R  F      HPL T+NPH+L+PFLE   YA   R PD +L
Sbjct  80    TIPKSGTTWLKALTFAIVNRNNFNV-HHNHPLLTHNPHELVPFLEYKLYADSNRLPDLSL  138

Query  430   TNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
                 R++ATH+P   LP S+  S  K++Y+CRNP DT VS WH++ K+R E   L  +P 
Sbjct  139   LPSPRIVATHVPFGALPDSIKTSNCKIIYICRNPFDTFVSIWHYLCKIRPE--SLGPLPI  196

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
              EAFD YCRGV   GP+WDH+  YW+E+   P KVLFLKYEEMK +    L+ +  FLG 
Sbjct  197   EEAFDLYCRGVTGYGPYWDHMLSYWRETA--PNKVLFLKYEEMKVDTCNQLKILGEFLGF  254

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTE  969
             PF+EEEE+ GV+  I  LCSF+++ +LEVNK         EN  LFRKG++GDW N+ T 
Sbjct  255   PFTEEEEK-GVIEDISNLCSFQNMKDLEVNKKGKGAISVFENRDLFRKGEIGDWMNYFTP  313

Query  970   EMARRLDQIVQEKFTGTGL  1026
              M  RL  ++ EK  G+G+
Sbjct  314   SMFERLSNVMDEKLEGSGI  332



>ref|XP_010048646.1| PREDICTED: cytosolic sulfotransferase 5-like [Eucalyptus grandis]
 gb|KCW80974.1| hypothetical protein EUGRSUZ_C02339 [Eucalyptus grandis]
Length=344

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 162/335 (48%), Positives = 212/335 (63%), Gaps = 21/335 (6%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYN-----------YKGFWLEPFFLQGALTIH  216
             +L+++  ++E  +  +SLP E  W+   L +           Y+GFW   + L   +   
Sbjct  13    YLRDDVKSQECEDLHSSLPSEEDWVPTSLPSEEDCVPSTLRLYQGFWFPSWVLNSVVACQ  72

Query  217   QHFQPQDSDIILSTFPKSGTVWLKALAFALITRKQFLAE--QETHPLHTNNPHDLIPFLE  390
              HFQ   SDI+L T PK GT WLKA+ FAL+ R ++     Q+ HPL T NPHDL+PFLE
Sbjct  73    NHFQAHPSDILLVTSPKCGTTWLKAILFALLNRAKYSDSNSQKRHPLLTQNPHDLVPFLE  132

Query  391   LS-YAAKERPDFALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMN  567
                Y   + PD       RLLATHLP S LP+SV +S  K+VYLCRNPKDT +S WH+ N
Sbjct  133   FRLYLQNKNPDLTAFASPRLLATHLPYSSLPRSVRDSNCKLVYLCRNPKDTFISMWHYFN  192

Query  568   KLRSELRGLEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKE  747
             K R E +G   +P PE  D +CRGV   GP+WDHV  Y K S E P KVLF+KYEEMK +
Sbjct  193   KFRPEEKG--QLPLPEGLDKFCRGVNWCGPYWDHVLGYHKASSEMPEKVLFVKYEEMKAD  250

Query  748   PEVHLRRMAAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGV  921
             P V +RR+A F+G PFSEEE   G V GILR+CSF++LS LEVN++   G L  G+E   
Sbjct  251   PSVQVRRLADFMGRPFSEEELRNGTVEGILRMCSFDNLSALEVNRS---GKLPSGLEKKW  307

Query  922   LFRKGKVGDWSNHMTEEMARRLDQIVQEKFTGTGL  1026
              FRKG+VGDW N+M+ EM  ++D +++EK  G+GL
Sbjct  308   FFRKGEVGDWVNYMSAEMGEQIDGVMEEKLHGSGL  342



>ref|XP_010534326.1| PREDICTED: cytosolic sulfotransferase 15-like [Tarenaya hassleriana]
Length=367

 Score =   305 bits (781),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/312 (49%), Positives = 206/312 (66%), Gaps = 5/312 (2%)
 Frame = +1

Query  97    EFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             E R+ L+SLP+E GW T  LY Y+GFW +   +Q  ++  +HF+  ++DIIL+T PKSGT
Sbjct  54    ECRDLLDSLPREKGWRTRYLYQYQGFWCQAKEIQSIISFQKHFKSVNNDIILATIPKSGT  113

Query  277   VWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKER--PDFALTNGSRLL  450
              WLKAL FAL+ R QF      HPL T+NPHDL+PF E    A +   PD +     R  
Sbjct  114   TWLKALTFALVNRHQFPVSSSDHPLLTSNPHDLVPFFEYKLYANDSDIPDLSHIPSPRTF  173

Query  451   ATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSY  630
             ATH+P   L  S+  S  KVVYLCRNP DT VS WH++N ++SE   +  +   E FD Y
Sbjct  174   ATHVPFGSLKDSIKSSNVKVVYLCRNPFDTFVSSWHYVNNIKSE--SMSPVSLDEGFDLY  231

Query  631   CRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeee  810
             CRGV   GPFW+H+  YWKESLE P ++LFL+YE+MK++   +L ++A FLG PFS+EE+
Sbjct  232   CRGVIGFGPFWEHMLGYWKESLERPDRMLFLQYEDMKEDIVSNLTKLANFLGFPFSKEEQ  291

Query  811   eCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRLD  990
             + GV+  I +LCSF+SL +LEVNK+S +     EN  LFRKG+V DW N++    A RL 
Sbjct  292   QQGVIQRIAKLCSFDSLKSLEVNKSSKSIK-NFENRFLFRKGQVSDWRNYLRPSQAERLS  350

Query  991   QIVQEKFTGTGL  1026
             +++ EK  G+GL
Sbjct  351   KLMDEKLAGSGL  362



>ref|XP_011020444.1| PREDICTED: cytosolic sulfotransferase 15-like [Populus euphratica]
 ref|XP_011015958.1| PREDICTED: cytosolic sulfotransferase 15-like [Populus euphratica]
Length=337

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/313 (49%), Positives = 208/313 (66%), Gaps = 4/313 (1%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKS  270
             T E +E L SLP+E GW T  LY YKGFW +P  +Q  ++  ++FQP+D+D+IL++ PKS
Sbjct  22    TNECKELLLSLPREKGWRTACLYKYKGFWCQPKEIQAIISFQKNFQPRDTDVILASIPKS  81

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRL  447
             GT WLKAL+FA++ RK+F      HPL  +NPHDL PF E   YA K+ PD +     RL
Sbjct  82    GTTWLKALSFAIMNRKKFAISSNDHPLLVSNPHDLAPFFEYKLYADKQVPDLSKLPDPRL  141

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
              ATH+P + L  S+ +S  +++Y+CRNP DT +S W F NKLRSE   +  +   E F  
Sbjct  142   FATHIPFASLQDSIKKSNCRIIYICRNPFDTFISSWTFSNKLRSE--TVPPLLLEETFKM  199

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             +C GV   GPFWDH+  YWKESLE   KVLFLKYE+MK +   +L+++A F+GCPFS EE
Sbjct  200   FCEGVVGFGPFWDHMLGYWKESLERQDKVLFLKYEDMKADVTFYLKKIAKFVGCPFSMEE  259

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRL  987
             E+ GVV  I  LCSFE +  LEVNK+  +     EN  LFRK +VGDW N+++  M ++L
Sbjct  260   EKEGVVEKIASLCSFEKMKTLEVNKSGSSIK-NFENKHLFRKAEVGDWVNYLSPSMVKQL  318

Query  988   DQIVQEKFTGTGL  1026
              Q+ +EK  G+G+
Sbjct  319   SQLTEEKLGGSGI  331



>ref|XP_007156373.1| hypothetical protein PHAVU_003G280800g [Phaseolus vulgaris]
 gb|ESW28367.1| hypothetical protein PHAVU_003G280800g [Phaseolus vulgaris]
Length=332

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 214/325 (66%), Gaps = 10/325 (3%)
 Frame = +1

Query  67    QFLQEN-SYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSD  243
             ++L+EN   ++E +E + +LP E GW+   L+ Y+GFW     LQG L+   HFQ   +D
Sbjct  11    KYLEENRELSQECKELIPTLPLEKGWVASHLHQYQGFWHTTRQLQGLLSCQNHFQAHHTD  70

Query  244   IILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKER--P  417
             +++ T PKSGT WLKA  ++L+ R +     + HPL T+NPH L+PFLEL         P
Sbjct  71    LLIVTTPKSGTTWLKAWTYSLLHRHKHHPTNQNHPLLTHNPHFLVPFLELDLYIDNSSVP  130

Query  418   DFALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLE  597
             D +     RL +THLP   LPKSV ++  K+VYLCR+PKD  +S WHF N LR  L+ + 
Sbjct  131   DLSSLPSPRLFSTHLPFVSLPKSVTQTSCKIVYLCRDPKDAFISLWHFTNSLR--LQSMG  188

Query  598   AMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAA  777
             A    EAF  +CRGV   GPFW+HV EYW++SLE+P K++F+++EEMK +PE  L+ +A 
Sbjct  189   ANSLHEAFHKFCRGVSLYGPFWEHVLEYWQKSLEHPSKIMFMRFEEMKLKPEFVLKELAT  248

Query  778   FLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDW  951
             F+GCP S EEEE GVV  IL+LCSF++LSNL+VNK   NG L  G  +   FR+G++GDW
Sbjct  249   FVGCPVSREEEEAGVVQEILKLCSFDNLSNLQVNK---NGKLSSGEAHQAFFRRGEIGDW  305

Query  952   SNHMTEEMARRLDQIVQEKFTGTGL  1026
              NH+T EM ++LD I +EK    GL
Sbjct  306   KNHLTVEMIQQLDGITEEKLGQHGL  330



>ref|XP_010044375.1| PREDICTED: cytosolic sulfotransferase 5-like [Eucalyptus grandis]
Length=337

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 210/324 (65%), Gaps = 10/324 (3%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             + +++   +  ++ ++SLP E  W+   L  Y+GF    +  +G L    HFQ Q SDI+
Sbjct  14    YWRDDDMPQACKDLVSSLPSEEDWIATSLCLYQGFRFPTWLFKGVLACQNHFQAQPSDIL  73

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAE--QETHPLHTNNPHDLIPFLELS-YAAKERPD  420
             L T  KS T WLKA+ FAL+ R ++     Q  HPL T NPHDL+PFLEL  Y  +E P+
Sbjct  74    LVTKLKSDTTWLKAILFALLNRAKYSDSDSQRCHPLLTQNPHDLVPFLELKLYLEQENPN  133

Query  421   FALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEA  600
                    RL ATHLP S LP+SV + + K+VYLCRNPKD  +S WHF+NKLR E +G   
Sbjct  134   LTAFESPRLFATHLPYSSLPRSVRDFRCKLVYLCRNPKDMFISLWHFVNKLRPEGKG--Q  191

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAF  780
              P P+  D +C+G+   GP+WDHV  + K SLE P +V FL YEEMK++P VH+ R+A F
Sbjct  192   TPLPKCLDKFCQGLSPYGPYWDHVLGFHKASLEMPEQVFFLMYEEMKEDPRVHVSRLADF  251

Query  781   LGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWS  954
             LGCPFS+EE     V GILR+CSF +LS+LEVNK+   G L  G EN   FR+G+VGDW 
Sbjct  252   LGCPFSDEELRDETVDGILRMCSFNNLSSLEVNKS---GKLWTGQENKWFFRRGEVGDWV  308

Query  955   NHMTEEMARRLDQIVQEKFTGTGL  1026
             N+++ EMA R+DQ++ EK   +GL
Sbjct  309   NYLSAEMADRIDQVMDEKLHDSGL  332



>gb|KDP40565.1| hypothetical protein JCGZ_24564 [Jatropha curcas]
Length=346

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/313 (47%), Positives = 209/313 (67%), Gaps = 4/313 (1%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKS  270
             T E +E L SLPKE GW TP +Y ++GFW +P  +Q  L+  +HFQ ++ D++L+T PKS
Sbjct  31    THECKELLLSLPKERGWRTPYIYRFQGFWCQPKEIQAILSFRKHFQARNGDVVLATVPKS  90

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRL  447
             GT WLKAL FA++ R  +     +HPL  +NPHDL+PFLE   YA  + PD +      +
Sbjct  91    GTTWLKALVFAILNRNLYPLNSNSHPLLVSNPHDLVPFLEYKIYANNQIPDLSKFPEPGI  150

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
              ATH+P + + +S+ +S  K+VY+CRNP DT +S W F +K+ +E     ++   EAF+ 
Sbjct  151   FATHVPFAAVKESINKSSCKIVYICRNPFDTFISSWIFCSKIGAE--NFPSLSIEEAFNM  208

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             YC G    GPFW+H+  YWKES E P KVLFLKYE++K +   HL ++A FLGCPFS EE
Sbjct  209   YCNGTIGFGPFWEHMLGYWKESQERPEKVLFLKYEDLKGDITFHLNKLAKFLGCPFSMEE  268

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRL  987
             ++ G+V  + +LCSFE+L NLEVNKT     +  EN  LFRKG++GDW N+++  M  +L
Sbjct  269   QKQGIVEEVAKLCSFENLKNLEVNKTG-KAIMNFENRHLFRKGEIGDWVNYLSPSMVEQL  327

Query  988   DQIVQEKFTGTGL  1026
              Q+++EK  G+GL
Sbjct  328   KQVMEEKLGGSGL  340



>ref|XP_010554271.1| PREDICTED: cytosolic sulfotransferase 11-like [Tarenaya hassleriana]
Length=335

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/325 (47%), Positives = 209/325 (64%), Gaps = 10/325 (3%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             F+ E+   +E +  ++SLP +  +L  +L NY GFW     LQ  + +  HF+  D+D+I
Sbjct  16    FMGEDKVRQECKSLISSLPSDKDFLGRNLCNYNGFWFYSNTLQAVIDVQNHFRTLDTDVI  75

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA  426
             +++FPK+GT WLKAL FA++ R ++ +  E HPL + NPH L+PFLE+  Y+  + PD A
Sbjct  76    VASFPKAGTTWLKALTFAIVNRSKYRSNPENHPLLSQNPHTLVPFLEIDLYSENKTPDLA  135

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNK-LRSELRG--LE  597
                   L ATH+P  LL +SV ES  K+VY+CRN KD VVS WHF    + SE+ G  L+
Sbjct  136   KVPSPGLFATHMPFLLLQESVKESSCKIVYVCRNLKDNVVSAWHFRRGYMISEMHGTTLK  195

Query  598   AMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAA  777
              M      +S+CRGV   GPFWDH   YWKES ENP +V F KYE+MK EP   ++R+A 
Sbjct  196   LM-----IESFCRGVHFCGPFWDHALSYWKESSENPDRVFFTKYEDMKNEPRAQIKRLAR  250

Query  778   FLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSN  957
             FLGCPF+EEEE  G V  IL LCS  SL +LE+NKT       ++    FRKG+VGDW N
Sbjct  251   FLGCPFTEEEEMNGSVDEILNLCSLRSLKDLEINKTG-KAPCSIDCKNFFRKGEVGDWKN  309

Query  958   HMTEEMARRLDQIVQEKFTGTGLML  1032
             H+T EMA+++D+IV  K  G+GL+ 
Sbjct  310   HLTGEMAKKMDEIVGMKLQGSGLVF  334



>ref|XP_010916164.1| PREDICTED: cytosolic sulfotransferase 12-like [Elaeis guineensis]
Length=339

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/314 (48%), Positives = 203/314 (65%), Gaps = 10/314 (3%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKS  270
              +E    ++SLPK  GW+   L  Y+GFW+    +   + I  HF+P+ +D+IL T PK+
Sbjct  29    VQEQSNLISSLPKREGWMRV-LRRYQGFWISDVAIPRLMAIQAHFKPRPTDVILVTQPKA  87

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGSRLL  450
             GT WLKALAFA++ R  +   Q  HPL + NPH+ +PF++L Y      D+      RLL
Sbjct  88    GTTWLKALAFAIVNRSNYSFSQ--HPLLSRNPHECVPFIDLPYVGGHAADYKSLAQPRLL  145

Query  451   ATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSY  630
             ATH+P SLLP SV +S  ++VYLCR+PKD +VS WHFM  ++ E+     M    AF+ +
Sbjct  146   ATHIPYSLLPASVADSDCRLVYLCRDPKDVLVSLWHFMKAMKPEI-----MELSPAFEMF  200

Query  631   CRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeee  810
             C G    GP W+H  EYW+ESL  P KVLFLKYEE+  EP   ++ +A F+GCPFSEEEE
Sbjct  201   CDGATPYGPVWEHNLEYWRESLRRPEKVLFLKYEEIVAEPMRSVKSLAEFMGCPFSEEEE  260

Query  811   eCGVVSGILRLCSFESLSNLEVNKTSVN--GDLGVENGVLFRKGKVGDWSNHMTEEMARR  984
               G V  ++RLCSFE LS++EVNK  V   G + ++    FRKGKVGDW NH++ +MA R
Sbjct  261   RDGAVEEVVRLCSFEKLSSMEVNKRGVGLMGGVTIQQANFFRKGKVGDWVNHLSRDMAER  320

Query  985   LDQIVQEKFTGTGL  1026
             LD++V EK  G+GL
Sbjct  321   LDRLVHEKLNGSGL  334



>emb|CDP14958.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   301 bits (771),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 162/320 (51%), Positives = 204/320 (64%), Gaps = 11/320 (3%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             QE    E  +  L++LPKE    +  LY Y GFWL    L G +    HFQ QD+D++L 
Sbjct  16    QEELMQEYCKNLLSTLPKERWLGSSYLYKYNGFWLIHKVLPGLIACQNHFQAQDTDVLLI  75

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYA-AKERPDFALT  432
             T PKSGT WLKAL FAL  RK +   Q  HPL   NPH L+PF+E  ++  K  PDF+  
Sbjct  76    TTPKSGTTWLKALMFALANRKIYPINQ-NHPLLKQNPHSLVPFMEFFFSPEKMNPDFSCP  134

Query  433   NGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFP  612
              G RL +TH P++LLP+SV  S  K+VYLCRN KDT VS+WHF  KL +E          
Sbjct  135   LG-RLYSTHYPLTLLPESVLNSGCKIVYLCRNIKDTFVSYWHFSKKLGAE------ASLE  187

Query  613   EAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCP  792
             E FD +C GV  +GP WDHV  YW+ESLE P KVLFLK+E ++++P  HL+ +A F+GCP
Sbjct  188   EFFDMFCEGVSLSGPVWDHVLGYWRESLEKPEKVLFLKFEALQEKPSFHLKLLAEFMGCP  247

Query  793   FSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEE  972
              S EEE CG V  +L LCSF++LSNLEVNK+         N + FRKGKVGDW N++T E
Sbjct  248   ISPEEETCGFVDEVLGLCSFDNLSNLEVNKSGTWR--AARNEMFFRKGKVGDWKNYLTSE  305

Query  973   MARRLDQIVQEKFTGTGLML  1032
             M  R+D I  +KF G+GL L
Sbjct  306   MEERIDHITAQKFFGSGLSL  325



>ref|XP_010087683.1| Flavonol sulfotransferase-like protein [Morus notabilis]
 gb|EXC35772.1| Flavonol sulfotransferase-like protein [Morus notabilis]
Length=329

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 158/324 (49%), Positives = 204/324 (63%), Gaps = 15/324 (5%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             +E   TEE ++ L+SLPKE GW T  LY Y+GFW +P  +Q  ++   HFQ  D+DIIL+
Sbjct  7     EEEQLTEECKQLLSSLPKERGWRTSHLYQYQGFWCQPAEIQAIVSFQNHFQAYDNDIILA  66

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALT  432
             T PKSGT WLKALAFA++ R  F  + + HPL T+NPHDL+PFLE   YA  + PD +  
Sbjct  67    TMPKSGTTWLKALAFAVVNRDHFPVDSDKHPLLTSNPHDLVPFLEYKLYANNQIPDLSKL  126

Query  433   NGS-----RLLATHLPVSLLPKSVWESKG-KVVYLCRNPKDTVVSFWHFMNKLRSELRGL  594
             +       RL  TH+P   L  SV +S   +VVYLCRNP DT +S WHF+         +
Sbjct  127   SADDQDRPRLFGTHIPFPSLANSVKKSNSCRVVYLCRNPFDTFISSWHFIG-------SM  179

Query  595   EAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMA  774
                   EAF+  CRGV   GPFWDH+  YWKESL  P  VLFL YE++K++   HL+R+A
Sbjct  180   SPFTLEEAFEMCCRGVIGFGPFWDHMLGYWKESLARPENVLFLTYEDLKEDAVFHLKRLA  239

Query  775   AFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWS  954
              FLG PFS EEE  GVV  I +LCSFE+L  LEVNK   +     EN  LFRKG+VGDW 
Sbjct  240   KFLGRPFSFEEETSGVVEKIAKLCSFENLKGLEVNKKGKSIK-NFENDKLFRKGEVGDWV  298

Query  955   NHMTEEMARRLDQIVQEKFTGTGL  1026
             N+++  M  ++  I++EK   +GL
Sbjct  299   NYLSSLMVEKMSTIMEEKLGDSGL  322



>ref|XP_006440813.1| hypothetical protein CICLE_v10020894mg [Citrus clementina]
 gb|ESR54053.1| hypothetical protein CICLE_v10020894mg [Citrus clementina]
Length=351

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 212/316 (67%), Gaps = 9/316 (3%)
 Frame = +1

Query  100   FREFLNSLPKETGWLTPDLYNYKGFWLEP-FFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             +R+ + +LPK  GW T  L  Y+GFW +P   L+G + + Q F+P+ +D+ L+T PKSGT
Sbjct  29    YRDIMATLPKYRGWSTLHLCQYQGFWFQPKIGLEGVMWVQQRFKPRPTDVYLATNPKSGT  88

Query  277   VWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRLLA  453
              WLKA+ F+++ RK++      HPL   +PH+++PF+EL  +      D  +    R+LA
Sbjct  89    TWLKAIVFSIMNRKRYNNFTTDHPLLKFSPHEVVPFMELDLFRTTPIADPEILPSPRILA  148

Query  454   THLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYC  633
             TH+  ++LP+S+  S   +VY+CRNPKD  VSFW F  K+R   + L  + F EAFD +C
Sbjct  149   THIAYNMLPESIQNSSCPIVYICRNPKDVFVSFWQFSVKMRP--KDLPELSFEEAFDLFC  206

Query  634   RGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeee  813
              GV   GPFWD    YWK S+E P +VLFLKYE+MK EP +  +R+A FLG PFS +EEE
Sbjct  207   HGVTPCGPFWDQALGYWKASVEFPNRVLFLKYEDMKTEPLLCTKRIAEFLGQPFSLQEEE  266

Query  814   CGVVSGILRLCSFESLSNLEVN---KTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARR  984
              G+V  I++LCSFES+SNLEVN   K+ V  +  V+N V FR+GKVGDW NH+T+EM  R
Sbjct  267   NGIVQEIVKLCSFESMSNLEVNRNGKSRVRAE--VKNDVFFRQGKVGDWKNHLTDEMIER  324

Query  985   LDQIVQEKFTGTGLML  1032
             LDQI + KF GTGL++
Sbjct  325   LDQITKHKFDGTGLIV  340



>ref|XP_010514146.1| PREDICTED: cytosolic sulfotransferase 12-like [Camelina sativa]
Length=330

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/324 (48%), Positives = 207/324 (64%), Gaps = 6/324 (2%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             FL +   T+E R+ ++SLPKE GWL  +LY ++G+W     LQG LT  + F+ +DSDII
Sbjct  8     FLGDKLLTQETRDLISSLPKEKGWLGSELYQFQGYWHTQALLQGLLTCQKRFEAKDSDII  67

Query  250   LSTFPKSGTVWLKALAFALITRKQF-LAEQETHPLHTNNPHDLIPFLELSYAAKERPDFA  426
             L T PKSGT WLKAL F+L+ R +F +     HPL   NPH L+PFLE  Y      DF 
Sbjct  68    LITSPKSGTTWLKALVFSLVNRHKFPVPSSGNHPLLFTNPHLLLPFLEGVYYVSPEFDFT  127

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
              +   RL+ TH+    LP+SV  S  K+VY CRNPKD  VSFWHF   L  E       P
Sbjct  128   GSLFPRLMNTHISHRSLPESVKSSSCKIVYCCRNPKDMFVSFWHFGKTLTREETTDTEYP  187

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               +A +++C G   +GPFWDH+ EYW  S ENP KV F+ YEE+KK+P + +RR+A FLG
Sbjct  188   IEKAVEAFCNGKSMSGPFWDHILEYWYASRENPNKVFFVTYEELKKQPGLVIRRIAEFLG  247

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNH  960
             C F++EE+  G V  I+ LCSFESLSNLEVN+    G L  G E+   FRKG++G W   
Sbjct  248   CGFTDEEKVQGKVEEIVNLCSFESLSNLEVNR---QGKLPNGTESKAFFRKGEIGGWRGS  304

Query  961   MTEEMARRLDQIVQEKFTGTGLML  1032
             ++E +A ++D+ ++EKF G+GL+ 
Sbjct  305   LSESLAAQIDRTIEEKFHGSGLIF  328



>ref|XP_006440811.1| hypothetical protein CICLE_v10023927mg [Citrus clementina]
 gb|ESR54051.1| hypothetical protein CICLE_v10023927mg [Citrus clementina]
Length=377

 Score =   301 bits (771),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 160/312 (51%), Positives = 210/312 (67%), Gaps = 11/312 (4%)
 Frame = +1

Query  94    EEFREFLNSLPKETGWLTPDLYNYKGFWLEPF-FLQGALTIHQHFQPQDSDIILSTFPKS  270
             + F E + SLPK  GW+T  L  YKG WL  +  L+G + I  HF+ Q +DI L+TFPK 
Sbjct  66    KRFEELVASLPKGKGWMTEHLVYYKGCWLTAYGALKGLMFIQDHFKAQPTDIFLATFPKC  125

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTN--GSR  444
             GT WLKAL FA + R ++  +  +HPL + +PHD +PFL+ +Y  +  P  ++ +    R
Sbjct  126   GTTWLKALIFATMNRSRY--DFPSHPLLSASPHDCVPFLD-AYIFQNNPVSSIHSLPSPR  182

Query  445   LLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFD  624
             L ATH+P  LLP S+  S  + VY+CRNPKD +VS W FMNK R   + L  +   +AF+
Sbjct  183   LFATHIPYDLLPNSMISSGSRFVYICRNPKDVLVSKWVFMNKARP--KELPPLSLEDAFE  240

Query  625   SYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSee  804
              +C+GV + GPFWDHV  YWK SLE+P K+LFLKYEEM +EP V L+R+  FLG PFS E
Sbjct  241   LFCKGVSHYGPFWDHVLGYWKASLESPEKILFLKYEEMMREPFVLLKRLTEFLGQPFSLE  300

Query  805   eeeCGVVSGILRLCSFESLSNLEVNKTSV---NGDLGVENGVLFRKGKVGDWSNHMTEEM  975
             EE  GVV  I+RLCSFE+LS+LEVNKT V   +  L ++N   FRKG+VGDW NH+T+EM
Sbjct  301   EESDGVVHEIIRLCSFENLSSLEVNKTKVKRFSNQLVIDNCDFFRKGRVGDWENHLTKEM  360

Query  976   ARRLDQIVQEKF  1011
               RLDQI +EK 
Sbjct  361   IERLDQITEEKL  372



>ref|XP_010523510.1| PREDICTED: cytosolic sulfotransferase 11-like [Tarenaya hassleriana]
Length=331

 Score =   300 bits (767),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 153/323 (47%), Positives = 214/323 (66%), Gaps = 9/323 (3%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             ++++++ +EE +  ++SLPK+   +   L NYKGFW  P  LQ  L + ++F+P+D+DII
Sbjct  12    YIRDDNLSEECKNLISSLPKDKDLMGITLCNYKGFWYYPNTLQAILDVEKNFRPRDTDII  71

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA  426
             +++FPKSGT WLKAL FAL+ R ++ A  + HPL   NPHDL+PF+++  Y   + PD  
Sbjct  72    VASFPKSGTTWLKALVFALVQRGKYRANPKGHPLLHENPHDLVPFVDIDLYYNGQIPDLT  131

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLR-SELRG--LE  597
                   L  TH+P+SLL ++V     K+VY+CRN KD +VS W F   L   ++ G  L+
Sbjct  132   KFPNHSLFGTHMPMSLLLETVKGVSCKIVYICRNMKDVMVSNWRFRGMLHHKDMHGDTLD  191

Query  598   AMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAA  777
             AM     FDSY RGV   GPFWD+V  YWK+SLENP +VLF++YEE+K+ P+  L+R+A 
Sbjct  192   AM-----FDSYRRGVHFYGPFWDNVLGYWKQSLENPKQVLFMRYEEIKENPKAQLKRLAE  246

Query  778   FLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSN  957
             FLGCPFSEEEEE G +  IL LCS  +L +LE N+         +  V FRKG+ GDW N
Sbjct  247   FLGCPFSEEEEESGTMDEILELCSLRNLRDLEANRHGKKTRFDADCSVFFRKGEAGDWKN  306

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             H+T +M R LD+IV+EK  G+GL
Sbjct  307   HLTHDMGRELDEIVKEKLQGSGL  329



>ref|XP_007034897.1| Flavonol 3-sulfotransferase, putative, partial [Theobroma cacao]
 gb|EOY05823.1| Flavonol 3-sulfotransferase, putative, partial [Theobroma cacao]
Length=339

 Score =   300 bits (767),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 158/327 (48%), Positives = 215/327 (66%), Gaps = 20/327 (6%)
 Frame = +1

Query  94    EEFREFLNSLPKETGWLTP--DLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPK  267
             E++++ + +LPKE GW TP   L  Y+GFW  P FL+G +    HFQ Q +DI+L +  K
Sbjct  21    EKYQKLIATLPKENGW-TPMQPLCPYQGFWFFPMFLEGVMYTQDHFQAQSTDILLCSSMK  79

Query  268   SGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSR  444
             +GT WLKAL+F++ TR QF       PL T   H+ IPFL+   YAA + P F L     
Sbjct  80    TGTAWLKALSFSIATRTQF--NNSISPLQTTFTHECIPFLDYGEYAASQGPRFPL-----  132

Query  445   LLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFM-----NKLRSELRGLEAMPF  609
              LATH+P + LPKSV +S  K+VY+CR+PKD  VS WHF+     N ++ EL+  + +  
Sbjct  133   -LATHVPYTCLPKSVIDSGCKIVYICRDPKDNFVSLWHFVRTATRNNIK-ELKEGDLISM  190

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
              EAF+ YC+G+   GP+W+HV  YW  SLE+P K+LFLKYE+M KE E + +R+A FLGC
Sbjct  191   EEAFELYCKGISLYGPYWEHVWGYWNASLEHPEKILFLKYEDMMKETESYAKRLAEFLGC  250

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLG--VENGVLFRKGKVGDWSNHM  963
             PFS EEE  G +  I++ CSFE+LSN+EVNKT ++   G  VEN   FRKGKVGDW N++
Sbjct  251   PFSLEEERGGKIQEIIQFCSFENLSNVEVNKTGIHQAQGRLVENKAYFRKGKVGDWRNYL  310

Query  964   TEEMARRLDQIVQEKFTGTGLML*SDP  1044
             T EM   LD+I+++K +G+GL     P
Sbjct  311   TAEMGEHLDKIMEQKLSGSGLTFSVSP  337



>gb|KDO65656.1| hypothetical protein CISIN_1g041950mg, partial [Citrus sinensis]
Length=307

 Score =   298 bits (763),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 159/307 (52%), Positives = 208/307 (68%), Gaps = 11/307 (4%)
 Frame = +1

Query  109   FLNSLPKETGWLTPDLYNYKGFWLEPF-FLQGALTIHQHFQPQDSDIILSTFPKSGTVWL  285
              + SLPK  GW+T  L  YKG WL  +  L+G + I  HF+ Q +DI L+TFPK GT WL
Sbjct  1     LVASLPKGKGWMTEHLVYYKGCWLTAYGALKGLMFIQDHFKAQPTDIFLATFPKCGTTWL  60

Query  286   KALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTN--GSRLLATH  459
             KAL FA + R ++  +  +HPL + +PHD +PFL+ +Y  +  P  ++ +    RL ATH
Sbjct  61    KALIFATMNRSRY--DFPSHPLLSASPHDCVPFLD-AYIFQNNPVSSIHSLPSPRLFATH  117

Query  460   LPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCRG  639
             +P  LLP S+  S  + VY+CRNPKD +VS W FMNK R   + L  +   +AF+ +C+G
Sbjct  118   IPYDLLPNSMISSGSRFVYICRNPKDVLVSKWVFMNKARP--KELPPLSLEDAFELFCKG  175

Query  640   VCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeCG  819
             V + GPFWDHV  YWK SLE+P K+LFLKYEEM +EP V L+R+A FLG PFS EEE  G
Sbjct  176   VSHYGPFWDHVLGYWKASLESPEKILFLKYEEMMREPFVLLKRLAEFLGQPFSLEEESDG  235

Query  820   VVSGILRLCSFESLSNLEVNKTSV---NGDLGVENGVLFRKGKVGDWSNHMTEEMARRLD  990
             VV  I+RLCSFE+LS+LEVNKT V   +  L ++N   FRKG+VGDW NH+T+EM  RLD
Sbjct  236   VVHEIIRLCSFENLSSLEVNKTKVKRFSNQLVIDNCDFFRKGRVGDWENHLTKEMTERLD  295

Query  991   QIVQEKF  1011
             QI +EK 
Sbjct  296   QITEEKL  302



>ref|XP_010095979.1| Flavonol sulfotransferase-like protein [Morus notabilis]
 gb|EXB62672.1| Flavonol sulfotransferase-like protein [Morus notabilis]
Length=329

 Score =   299 bits (765),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 204/324 (63%), Gaps = 15/324 (5%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             +E   TEE ++ L+SLPKE GW T  LY Y+GFW +P  +Q  ++   HFQ  D+DIIL+
Sbjct  7     EEEQLTEECKQLLSSLPKERGWRTSHLYQYQGFWCQPAEIQAIVSFQNHFQAYDNDIILA  66

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALT  432
             T PKSGT WLKALAFA++ R  F  + + HPL T+NPHDL+PFLE   YA  + PD +  
Sbjct  67    TMPKSGTTWLKALAFAVVNRDHFPVDSDKHPLLTSNPHDLVPFLEYKIYANNQIPDLSKL  126

Query  433   NGS-----RLLATHLPVSLLPKSVWESKG-KVVYLCRNPKDTVVSFWHFMNKLRSELRGL  594
             +       RL  TH+P   L  SV +S   +VVYLCRNP DT +S WHF+         +
Sbjct  127   SADDQDRPRLFGTHIPFPSLANSVKKSNSCRVVYLCRNPFDTFISSWHFIG-------SM  179

Query  595   EAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMA  774
                   EAF+  CRGV   GPFWDH+  YWKESL  P  VLFL YE++K++   HL+R+A
Sbjct  180   SPFTLEEAFEMCCRGVIGFGPFWDHMLGYWKESLARPENVLFLTYEDLKEDAVFHLKRLA  239

Query  775   AFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWS  954
              FLG PFS EEE  G+V  I +LCSFE+L  LEVNK   +     EN  LFRKG+VGDW 
Sbjct  240   KFLGRPFSFEEETSGLVEKIAKLCSFENLKGLEVNKKGKSIK-NFENNKLFRKGEVGDWV  298

Query  955   NHMTEEMARRLDQIVQEKFTGTGL  1026
             N+++  M  ++  I++EK   +GL
Sbjct  299   NYLSPLMVEKMSTIMEEKLGDSGL  322



>ref|XP_010031022.1| PREDICTED: cytosolic sulfotransferase 15-like [Eucalyptus grandis]
 gb|KCW50285.1| hypothetical protein EUGRSUZ_J00069 [Eucalyptus grandis]
Length=341

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/318 (45%), Positives = 214/318 (67%), Gaps = 5/318 (2%)
 Frame = +1

Query  79    ENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILST  258
             +   + E ++ L SLPKE GW T  +Y ++GFW +P  +Q  L+  +HFQ QDSDI+LST
Sbjct  19    DQGLSNECKDLLLSLPKEKGWRTKHIYLFQGFWCQPKEIQSILSFQRHFQAQDSDIVLST  78

Query  259   FPKSGTVWLKALAFALITRKQF-LAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALT  432
              PKSGT WLKALAFA+  R+++ ++++++HPL T+NPHDL+PF E   YA+ + PD +  
Sbjct  79    IPKSGTTWLKALAFAIANREKYPISKKKSHPLLTSNPHDLVPFFEYKVYASSDLPDLSKF  138

Query  433   NGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFP  612
                R+  TH+P   L + +  S+ K+VY+CRNP DT VS W ++NK++ +   +  +   
Sbjct  139   PEPRIFGTHIPFPALAEPIKNSQCKIVYICRNPFDTFVSSWMYLNKVKPD--SMPMVQLE  196

Query  613   EAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCP  792
             EAF+ YC G    GPFW+H+  YW ESL+ P KVLFLKYEEMK++   H++++A FLG P
Sbjct  197   EAFEMYCNGTMGYGPFWNHMLGYWNESLKRPDKVLFLKYEEMKEDIVSHVKKLAIFLGYP  256

Query  793   FSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEE  972
             FS +EE  GVV  +  LCSFE + +LEVN++     +  EN  LFRK ++GDW N+++  
Sbjct  257   FSVQEERDGVVEDLSELCSFEKMKDLEVNRSG-KSIMNFENKNLFRKAEIGDWVNYLSPP  315

Query  973   MARRLDQIVQEKFTGTGL  1026
             M  +L ++++EK + +GL
Sbjct  316   MEEQLSKVLEEKLSASGL  333



>emb|CDP07173.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 159/320 (50%), Positives = 203/320 (63%), Gaps = 11/320 (3%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             QE    E  +  L++LP++  + +  LY Y GFWL P  + G +    HFQ +D+D +L 
Sbjct  16    QEELMQEYCKNLLSTLPRKRWYGSSYLYKYNGFWLGPKGMPGLIACQNHFQARDTDFLLI  75

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLEL-SYAAKERPDFALT  432
             T PKSGT WLKAL F L  RK +   Q  HPL   NPH L+PF+E      K  PDF+  
Sbjct  76    TTPKSGTTWLKALMFTLANRKIYPINQ-NHPLLKQNPHSLVPFMEFFCSPEKMNPDFSCP  134

Query  433   NGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFP  612
              G RL +TH P++LLP+SV  S  K+VYLCRN KDT VS+WHF  KL +E          
Sbjct  135   LG-RLYSTHCPLTLLPESVLNSGCKIVYLCRNIKDTFVSYWHFSKKLGAEAS------LE  187

Query  613   EAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCP  792
             E FD +C GV  +GP WDHV  YW+ESLE P KVLFLKYE ++++P  HL+ +A F+GCP
Sbjct  188   EFFDMFCEGVSLSGPVWDHVLGYWRESLEKPEKVLFLKYEALQEKPSFHLKLLAEFMGCP  247

Query  793   FSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEE  972
              S EEE CG V  +L LCSF++LSNLE NK+     +G  N + FRKGKVGDW N++T E
Sbjct  248   ISPEEETCGFVDEVLGLCSFDNLSNLEANKSGTFKTVG--NEMFFRKGKVGDWKNYLTGE  305

Query  973   MARRLDQIVQEKFTGTGLML  1032
             M  R+D I  +KF G+GL L
Sbjct  306   MEERIDHITAQKFFGSGLSL  325



>ref|XP_011006876.1| PREDICTED: flavonol 3-sulfotransferase-like [Populus euphratica]
Length=336

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/318 (45%), Positives = 209/318 (66%), Gaps = 10/318 (3%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKS  270
              + + E +++LPK       D Y Y+GFW  PFFL+G +++ +HF PQ +DI +++FPK+
Sbjct  23    AKNYNEVMSTLPKVKSLNGYDYYLYQGFWYAPFFLEGLMSVQEHFNPQSTDIFVASFPKT  82

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAK-ERPDFALTNGSRL  447
             GT WLKAL FA++TR + L+   T  L +  PHD +PFLE   A      D A+     L
Sbjct  83    GTTWLKALTFAILTRSR-LSGSTTSALLSKLPHDCVPFLEYDLAQNPSNRDLAIP----L  137

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
             ++TH+P S LPKS+  +  K++Y+CR+ KD  VS W+F+ K R     +E +P  ++F+ 
Sbjct  138   VSTHVPYSCLPKSIISASCKIIYICRDAKDAFVSLWYFLAKQRRS-ENVEPLPLEKSFEL  196

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             +C G+ N GP+WDH+  YW+ SLE P K+LFL YEEMKK+   H++++A F+GC F+ EE
Sbjct  197   FCNGIANYGPYWDHLLGYWRASLEFPEKILFLTYEEMKKDTAAHVKKLAEFMGCSFTLEE  256

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSV---NGDLGVENGVLFRKGKVGDWSNHMTEEMA  978
             EE G V  I+ LCSFE LSNLEVNK      +  + ++N + FRKG++GDW+NH+T EM 
Sbjct  257   EEGGEVQMIISLCSFEKLSNLEVNKNGKHRPDTSIAIQNSIYFRKGEIGDWANHLTPEMG  316

Query  979   RRLDQIVQEKFTGTGLML  1032
              RLD I+ +K  G+GL L
Sbjct  317   ARLDDIMDQKLKGSGLKL  334



>ref|XP_006477735.1| PREDICTED: cytosolic sulfotransferase 16-like [Citrus sinensis]
Length=377

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 160/312 (51%), Positives = 210/312 (67%), Gaps = 11/312 (4%)
 Frame = +1

Query  94    EEFREFLNSLPKETGWLTPDLYNYKGFWLEPF-FLQGALTIHQHFQPQDSDIILSTFPKS  270
             + F E + SLPK  GW+T  L  YKG WL  +  L+G + I  HF+ Q +DI L+TFPK 
Sbjct  66    KRFEELVASLPKGKGWMTEHLVYYKGCWLTAYGALKGLMFIQDHFKAQPTDIFLATFPKC  125

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTN--GSR  444
             GT WLKAL FA + R ++  +  +HPL + + HD +PFL+ +Y  +  P  ++ +    R
Sbjct  126   GTTWLKALIFATMNRSRY--DFPSHPLLSASRHDCVPFLD-AYIFQNNPVSSIHSLPSPR  182

Query  445   LLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFD  624
             L ATH+P  LLP S+  S  + VY+CRNPKD +VS W FMNK R   + L  +   +AF+
Sbjct  183   LFATHIPYDLLPNSMISSGSRFVYICRNPKDVLVSKWVFMNKARP--KELPPLSLEDAFE  240

Query  625   SYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSee  804
              +C+GV + GPFWDHV  YWK SLE+P K+LFLKYEEM +EP V L+R+A FLG PFS E
Sbjct  241   LFCKGVSHYGPFWDHVLGYWKASLESPEKILFLKYEEMMREPFVLLKRLAEFLGQPFSLE  300

Query  805   eeeCGVVSGILRLCSFESLSNLEVNKTSV---NGDLGVENGVLFRKGKVGDWSNHMTEEM  975
             EE  GVV  I+RLCSFE+LS+LEVNKT V   +  L ++N   FRKG+VGDW NH+T+EM
Sbjct  301   EESDGVVHEIIRLCSFENLSSLEVNKTKVKRFSNQLVIDNCDFFRKGRVGDWENHLTKEM  360

Query  976   ARRLDQIVQEKF  1011
               RLDQI +EK 
Sbjct  361   IERLDQITEEKL  372



>ref|XP_008779205.1| PREDICTED: flavonol sulfotransferase-like [Phoenix dactylifera]
Length=330

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 157/314 (50%), Positives = 209/314 (67%), Gaps = 12/314 (4%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKS  270
             T+E  + L+SLP++ G+L P +  YKGFW+    L   L +  HF+P+ SD+IL T PKS
Sbjct  22    TKEHNDHLSSLPRQRGFLRP-IRMYKGFWVTESLLPRVLALQDHFKPRPSDLILVTQPKS  80

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGSRLL  450
             GT WLKAL FA++ R  +   Q  HPL T NPH+ +PFLE+ +  +   D       RLL
Sbjct  81    GTTWLKALLFAIMNRTNYTFAQ--HPLLTRNPHECVPFLEIPFRNR-FSDLEAIPPPRLL  137

Query  451   ATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSY  630
             ATHLP S+L  SV +   ++VYLCR+PKD VVS WHF  K R ++R        EAF+S+
Sbjct  138   ATHLPYSILASSVADCGCRLVYLCRDPKDVVVSLWHFARKDRPDMR------LSEAFESF  191

Query  631   CRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeee  810
             C GV  +GP WDH+ EYW+ESL    KVLFLKYEEM  EP  ++RR+A F+G PFSEEEE
Sbjct  192   CEGVSLSGPIWDHILEYWRESLRRSEKVLFLKYEEMMAEPVGNVRRLAEFVGRPFSEEEE  251

Query  811   eCGVVSGILRLCSFESLSNLEVNKTSV--NGDLGVENGVLFRKGKVGDWSNHMTEEMARR  984
             + GV   I++LC FE LS+ EVNK  +   G++ + +   FRKG+VGDW+NH++ EM  +
Sbjct  252   KDGVAEEIVQLCRFEKLSSSEVNKKGIYEAGEITLPHESFFRKGQVGDWTNHLSREMGEK  311

Query  985   LDQIVQEKFTGTGL  1026
             LD+IVQEK  G+GL
Sbjct  312   LDRIVQEKLAGSGL  325



>ref|XP_009129071.1| PREDICTED: cytosolic sulfotransferase 12-like isoform X1 [Brassica 
rapa]
 ref|XP_009129072.1| PREDICTED: cytosolic sulfotransferase 12-like isoform X2 [Brassica 
rapa]
Length=326

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 159/326 (49%), Positives = 209/326 (64%), Gaps = 15/326 (5%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
              +L +   T+E R+ ++SLP+E GWL   +Y ++G W     LQG +   + F+ +DSDI
Sbjct  10    DYLGDEDLTQETRDLISSLPREKGWLVSQMYQFQGRWHTQALLQGLMECQKRFEAKDSDI  69

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFA  426
             IL T PKSGT WLKAL FALITR +F      HPL   NPH L+PFLE  Y   E PDF 
Sbjct  70    ILVTNPKSGTTWLKALVFALITRHKFPVSSGDHPLLVTNPHLLVPFLEGVYY--ESPDFD  127

Query  427   LTNGS--RLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEA  600
              +  S  RL+ TH+P+  LP++V  S  K+VY CRNPKD  VS WHF  KL  E      
Sbjct  128   FSKLSFPRLMNTHIPLLSLPETVKSSSCKIVYCCRNPKDMFVSLWHFGKKLAPEETA--D  185

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAF  780
              P  +A +++C+G    GPFWDHV EYW  SLENP KVLF+ YEE+KK+    ++R+A F
Sbjct  186   YPIEKAVEAFCQGKFIGGPFWDHVLEYWYASLENPNKVLFVTYEELKKQTGDTIKRIAEF  245

Query  781   LGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWS  954
             LGC F  EEE    VSGI++LCSFESLS+LEVN+    G L  G+E    FRKG VG W 
Sbjct  246   LGCGFIGEEE----VSGIVKLCSFESLSSLEVNR---EGKLPNGMETKAFFRKGDVGGWG  298

Query  955   NHMTEEMARRLDQIVQEKFTGTGLML  1032
             + ++E +A ++D+ ++EKF G+GL+ 
Sbjct  299   DTLSESLAEKIDRTIEEKFQGSGLIF  324



>ref|XP_010523501.1| PREDICTED: cytosolic sulfotransferase 12-like [Tarenaya hassleriana]
Length=335

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/328 (47%), Positives = 208/328 (63%), Gaps = 16/328 (5%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             FL +   TEE ++ ++SLP++ GW+   +Y ++GFWL P  LQG +   +HFQ QDSD+I
Sbjct  11    FLGDEGITEEIKDMMSSLPRQKGWMVKYMYQFQGFWLPPSLLQGTINCQKHFQAQDSDVI  70

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSY-----AAKER  414
             L T PKSGT WLKAL FALI RK+F   Q  HPL T+NPH L+PFLE  Y        + 
Sbjct  71    LVTNPKSGTTWLKALIFALINRKKFHDSQHQHPLLTHNPHALVPFLEEVYYKYPQVLPDD  130

Query  415   PDFALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGL  594
                + ++  R    H+    LP S+  S  K+VY CRNPKD  VSFWHF  K+ S+    
Sbjct  131   VVSSSSSCPRFFGAHMAHVSLPDSIKGSSCKIVYCCRNPKDMFVSFWHFGQKMASK----  186

Query  595   EAM--PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRR  768
             E++  P  EA   +C G   +G FWDHV  YW+ S +NP KV F+ YEEMK+ P  HL++
Sbjct  187   ESLFCPIEEAVKLFCEGSFLSGSFWDHVLGYWEASQKNPDKVFFITYEEMKERPRTHLKQ  246

Query  769   MAAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKV  942
             MA FLGC F++EEEE G+V  I+RLCSFESLS+ EVN+    G L  G+E    FRKGK+
Sbjct  247   MADFLGCSFTKEEEEKGMVDEIIRLCSFESLSSFEVNR---KGKLPNGIETNTFFRKGKI  303

Query  943   GDWSNHMTEEMARRLDQIVQEKFTGTGL  1026
             G W + +T+ +A  +D+  ++KF G+G 
Sbjct  304   GGWRDTLTDSLAEEIDRTSEQKFHGSGF  331



>ref|XP_009130975.1| PREDICTED: cytosolic sulfotransferase 15-like [Brassica rapa]
Length=360

 Score =   298 bits (764),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 203/318 (64%), Gaps = 4/318 (1%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             +E   + EF + L SLPKE GW T  LY ++GFW +   +   ++  +HF+    D+IL+
Sbjct  41    EEEGLSHEFLDMLESLPKERGWRTRHLYQFQGFWCQAKEIHAIMSFQKHFKTLPKDVILA  100

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALT  432
             T PKSGT WLKAL F L+ R +F      HPL T+NPHDL+PFLE   YA  E PD +  
Sbjct  101   TIPKSGTTWLKALTFTLLNRHRFDPVVSDHPLLTSNPHDLVPFLEYKLYANGEVPDLSGL  160

Query  433   NGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFP  612
                R  ATH+P   L  S+ E   KVVYLCRNP DT +S WHF N ++SE   +  +   
Sbjct  161   ASPRTFATHVPFGSLKGSIEEPGAKVVYLCRNPFDTFISSWHFSNSIKSE--SVSPVSLE  218

Query  613   EAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCP  792
             E FD YCRGV   GPFW+H+  YW+ESLE P KVLFLKYE++K++ E +L+++A+FLG  
Sbjct  219   EGFDLYCRGVIGFGPFWEHMLGYWRESLERPEKVLFLKYEDLKEDIETNLKKLASFLGVS  278

Query  793   FSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEE  972
             F+EEEE  GVV  +  LCSFESL  LEVNK++ +     EN  LFRKG+V DW N+++  
Sbjct  279   FTEEEEVKGVVKAVADLCSFESLKKLEVNKSNKSIK-NFENRYLFRKGEVSDWRNYLSPV  337

Query  973   MARRLDQIVQEKFTGTGL  1026
                RL  +V +K  G+GL
Sbjct  338   QVERLSALVDDKLGGSGL  355



>ref|XP_006385980.1| hypothetical protein POPTR_0003s19280g [Populus trichocarpa]
 gb|ERP63777.1| hypothetical protein POPTR_0003s19280g [Populus trichocarpa]
Length=333

 Score =   297 bits (761),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/319 (46%), Positives = 211/319 (66%), Gaps = 6/319 (2%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             + E   +++ R+ ++SLPKE GW++  +Y Y+GFW  P  +   ++   +FQ  ++D IL
Sbjct  13    VSETGESDQCRDIISSLPKEEGWVSGYMYLYQGFWCPPKEIHAVVSFQNNFQACNTDTIL  72

Query  253   STFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFAL  429
              + PKSGT WLKAL F++I R+++   +   PL++ NPHDL+PF E   YA  + PD + 
Sbjct  73    VSMPKSGTTWLKALVFSIINREKYQTAES--PLNSFNPHDLVPFFEYRLYANNQVPDLSA  130

Query  430   TNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
                 R+ +TH+P   LP+S+  S  +VVY+CRNP D  +SFWHF++K R E RG   +  
Sbjct  131   FPSPRIFSTHVPYPSLPESIRNSTCRVVYICRNPLDNFISFWHFLSKARPERRG--PLLL  188

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
              EAFDS+C GV   GPF+DHV  YWKESLE P KVLFLK+E++K++    ++ +A FLGC
Sbjct  189   EEAFDSFCNGVVGFGPFFDHVLGYWKESLERPEKVLFLKFEDLKEDINSQMKSLAVFLGC  248

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTE  969
             PFS EEE  GV+  I +LCS +SL ++E NK   +     EN  LFR+G+VGDW N++T 
Sbjct  249   PFSLEEERDGVIEDISKLCSLDSLKDIEANKRGKSIPY-FENNTLFRRGEVGDWINYLTP  307

Query  970   EMARRLDQIVQEKFTGTGL  1026
             EM  RL++I ++K  G+GL
Sbjct  308   EMVDRLNKITEQKLAGSGL  326



>ref|XP_009114137.1| PREDICTED: cytosolic sulfotransferase 12 [Brassica rapa]
Length=331

 Score =   297 bits (760),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 205/322 (64%), Gaps = 11/322 (3%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
              +L++   T+E R+ ++SLP E GWL   +Y ++G W     LQG LT  +HF+ +DSDI
Sbjct  15    DYLRDEKLTQETRDLISSLPSEKGWLVSQIYQFQGRWHTEALLQGILTCQKHFKAKDSDI  74

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFA  426
             IL T PKSGT WLK+L FALI R +F      HPL   NPH L+PF+E  Y      DF+
Sbjct  75    ILVTNPKSGTTWLKSLVFALINRHKFPVSSGDHPLLVTNPHLLVPFMEGVYYESPDFDFS  134

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
             L    RL+ TH+    LP+SV  S  K+VY CRNPKD  VS WHF  KL  +       P
Sbjct  135   LLPFPRLMNTHISHLSLPESVKSSSCKIVYCCRNPKDMFVSLWHFGKKLAPQETA--DYP  192

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               +A +++C+G    GPFWDHV EYW  SLENP KVLF+ YEE+KK+ EV ++R+A F+G
Sbjct  193   IEKAVEAFCQGKFIAGPFWDHVLEYWYASLENPNKVLFVTYEELKKQTEVEVKRIAEFIG  252

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNH  960
             C F+ EEE    VS I++LCSFESLS+LEVNK    G L  G+E    FRKG+ G W + 
Sbjct  253   CGFTAEEE----VSEIVKLCSFESLSSLEVNK---QGKLPNGIETNAFFRKGETGGWRDT  305

Query  961   MTEEMARRLDQIVQEKFTGTGL  1026
             ++E +A  +D+  +EKF G+GL
Sbjct  306   LSESLADAIDRTTEEKFGGSGL  327



>emb|CDY22189.1| BnaC01g39120D [Brassica napus]
Length=334

 Score =   297 bits (760),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 153/322 (48%), Positives = 212/322 (66%), Gaps = 5/322 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
              F++ +S ++E    ++SLP E  ++  +LY+Y+G W  P  LQ  L   +HF+ +DSDI
Sbjct  13    NFMKVDSLSQECENLISSLPSEKDFMGKNLYSYQGSWYYPSTLQAILNFQKHFRARDSDI  72

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL++FPKSGT WLKAL FA++ R ++     +HPL ++NPH+L+ F+EL  Y   +RPD 
Sbjct  73    ILASFPKSGTTWLKALVFAVVHRNKYAPNLVSHPLLSDNPHNLVRFIELDLYVKNQRPDL  132

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFM-NKLRSELRGLEA  600
                   RL ATH+P   L  S+ +S  KVVY+CRN KD +VS WHF  N +R EL    +
Sbjct  133   EELPSPRLFATHMPFQTLHDSLRDSPCKVVYMCRNIKDVLVSRWHFRSNVVRKELYSNYS  192

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAF  780
             +   +  D + +GV + GPF D V  YWKESL N   VLF++YEEM ++PEV + R+A F
Sbjct  193   L--EDMVDDFIKGVYSLGPFDDQVLRYWKESLVNSNPVLFMRYEEMIEKPEVQVMRLADF  250

Query  781   LGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNH  960
             LGC F+EEE++ G V  IL LCSF +LSNLE NKT  +   GV     FR+G VGDW NH
Sbjct  251   LGCSFTEEEKQSGTVEKILELCSFGNLSNLETNKTGTSV-CGVAPHAFFRRGGVGDWKNH  309

Query  961   MTEEMARRLDQIVQEKFTGTGL  1026
             +T EMAR+LD++V++K  G+GL
Sbjct  310   LTHEMARKLDEMVEKKLGGSGL  331



>emb|CDP19484.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   296 bits (759),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 160/320 (50%), Positives = 208/320 (65%), Gaps = 11/320 (3%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             QE    E  +  L++LPKE  + +  LY Y GFWL P  L G +    +FQ QD+D++L 
Sbjct  16    QEELKQEYCKTLLSTLPKERWFGSSYLYKYNGFWLSPEMLPGLIACQNNFQAQDTDVLLI  75

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAA-KERPDFALT  432
             + PKSGT WLKAL F L  RK +   Q  HPL   NPH L+P +E  ++  K  PD +  
Sbjct  76    STPKSGTTWLKALTFTLANRKIYPINQ-NHPLLKQNPHSLMPIMEFFFSPEKLNPDLSCP  134

Query  433   NGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFP  612
              G RL ++H P++LLP+SV +S  K+VYLCRN KDT VS+WHF  KL +E   LE     
Sbjct  135   LG-RLYSSHCPLALLPESVLKSGCKIVYLCRNIKDTFVSYWHFSKKLGAE-ASLE-----  187

Query  613   EAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCP  792
             E F  +C G+  +GP WDH+  YW+ESLENP KVLFLKYE ++++P  HL+ +A F+GCP
Sbjct  188   EFFYMFCEGMSLSGPVWDHLLGYWRESLENPEKVLFLKYEALQEKPSFHLKLLAEFMGCP  247

Query  793   FSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEE  972
              S EEE CG V  +L LCSF++LSNLEVNK+       V N + FRKGKVGDW N++T E
Sbjct  248   ISPEEETCGFVDEVLGLCSFDNLSNLEVNKSGTFWT--VRNEMFFRKGKVGDWKNYLTSE  305

Query  973   MARRLDQIVQEKFTGTGLML  1032
             MA R+D I  +KF G+GL L
Sbjct  306   MAERIDHITAQKFFGSGLSL  325



>ref|XP_006399179.1| hypothetical protein EUTSA_v10015302mg [Eutrema salsugineum]
 gb|ESQ40632.1| hypothetical protein EUTSA_v10015302mg [Eutrema salsugineum]
Length=364

 Score =   298 bits (762),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 155/321 (48%), Positives = 209/321 (65%), Gaps = 7/321 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
              E   + EFRE L+SLPKE GW T  LY ++GFW +   +Q  ++  +HFQP  +D++++
Sbjct  42    DEEGLSYEFREMLDSLPKERGWRTRYLYLFQGFWCQSKEIQAIISFQKHFQPLQNDVVIA  101

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQET---HPLHTNNPHDLIPFLELS-YAAKERPDF  423
             T PKSGT WLKAL F L+ R +F     T   HPL T+NPHDL+PF E   YA    PD 
Sbjct  102   TIPKSGTTWLKALTFTLLNRYRFDPVSSTNTDHPLLTSNPHDLVPFFEYKLYANGGVPDL  161

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +     R  ATH+P   L  S+ +   KVVYLCRNP DT +S WH++N ++SE   +  +
Sbjct  162   SGLASPRTFATHIPFGSLKGSIEKPGVKVVYLCRNPFDTFISSWHYINSIKSE--SVSPV  219

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E FD YCRGV   GPFW+H+  YW+ESL+ P KVLFL+YE++K++ E +L+R+A+FL
Sbjct  220   SLDEGFDLYCRGVIGFGPFWEHMLGYWRESLKRPEKVLFLRYEDLKEDIESNLKRLASFL  279

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHM  963
             G PF++EEE  GVV  I  LCSF++L  LEVNK+S +     EN  LFRKG+V DW N++
Sbjct  280   GVPFTDEEERKGVVKAISDLCSFKNLKKLEVNKSSKSIK-NFENRHLFRKGEVSDWVNYL  338

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             +   A RL  +V +K  GTGL
Sbjct  339   SPSQAERLLALVDDKLGGTGL  359



>ref|XP_009123345.1| PREDICTED: cytosolic sulfotransferase 11-like [Brassica rapa]
Length=351

 Score =   297 bits (761),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 153/321 (48%), Positives = 212/321 (66%), Gaps = 5/321 (2%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             F++ +S ++E    ++SLP E  ++  +LY+Y+G W  P  LQ  L   +HF+ +DSDII
Sbjct  31    FMKVDSLSQECENLISSLPSEKDFMGKNLYSYQGSWYYPSTLQAILNFQKHFRARDSDII  90

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA  426
             L++FPKSGT WLKAL FA++ R ++     +HPL ++NPH+L+ F+EL  Y   +RPD  
Sbjct  91    LASFPKSGTTWLKALVFAVVHRNKYAPNLVSHPLLSDNPHNLVRFIELDLYVKNQRPDLE  150

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFM-NKLRSELRGLEAM  603
                  RL ATH+P   L  S+ +S  KVVY+CRN KD +VS WHF  N +R EL    ++
Sbjct  151   ELPSPRLFATHMPFQTLHDSLRDSPCKVVYMCRNIKDVLVSRWHFRSNVVRKELYSNYSL  210

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                +  D + +GV + GPF D V  YWKESL N   VLF++YEEM ++PEV + R+A FL
Sbjct  211   --EDMVDDFIKGVYSLGPFDDQVLRYWKESLVNSNPVLFMRYEEMIEKPEVQVMRLADFL  268

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHM  963
             GC F+EEE++ G V  IL LCSF +LSNLE NKT  +   GV     FR+G VGDW NH+
Sbjct  269   GCSFTEEEKQSGTVEKILELCSFGNLSNLETNKTGTSV-CGVAPHAFFRRGGVGDWKNHL  327

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             T EMAR+LD++V++K  G+GL
Sbjct  328   THEMARKLDEMVEKKLGGSGL  348



>ref|XP_010670538.1| PREDICTED: cytosolic sulfotransferase 15-like [Beta vulgaris 
subsp. vulgaris]
Length=342

 Score =   297 bits (760),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 156/320 (49%), Positives = 215/320 (67%), Gaps = 10/320 (3%)
 Frame = +1

Query  82    NSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTF  261
             N  T+E ++ L SLPK  GW T +LY ++ FW +P  +Q  ++  +HF  QDSD+I++T 
Sbjct  20    NGITKECKQLLISLPKVKGWRTQNLYLFQSFWCQPKEIQAIISSQKHFAAQDSDVIIATV  79

Query  262   PKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNG  438
             PKSGT WLKAL FA+I+R +F    + HPL  +NPHDL+PFLE   YA ++ P  +  + 
Sbjct  80    PKSGTTWLKALVFAIISRHRFDVNSKDHPLLRSNPHDLVPFLEYKVYANQQIPTLSNLDS  139

Query  439   SRLLATHLPVSLLPKSVWE--SKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFP  612
              R  A+H+P   LPK++ +  S  K+VY+CRNP DT  S WHFM K+R +  G    PF 
Sbjct  140   PRFFASHVPYHSLPKTMTKNNSNCKIVYICRNPFDTFASIWHFMKKIRPKYLG----PFS  195

Query  613   --EAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               EAFD YC+G    GP+WDH+  YW+ESL++P KV+FLKYE++K +  V +R++  F G
Sbjct  196   LEEAFDMYCKGEIGYGPYWDHMLGYWEESLKSPEKVMFLKYEDLKGDVLVQMRKIGEFFG  255

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMT  966
              PFS EEEE GVV  I +LCSF+SLS+LE+NK      L  +N  LFRKG+VGDW N ++
Sbjct  256   HPFSPEEEENGVVEEIAKLCSFKSLSDLEINKNG-KSILDFDNKGLFRKGEVGDWVNLLS  314

Query  967   EEMARRLDQIVQEKFTGTGL  1026
             +EM  RL +I++EK  G+GL
Sbjct  315   KEMVERLGKIMEEKLHGSGL  334



>gb|AAC63113.1| steroid sulfotransferase 3 [Brassica napus]
Length=325

 Score =   296 bits (758),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 154/321 (48%), Positives = 205/321 (64%), Gaps = 11/321 (3%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             +L++   T+E R+ ++SLP E GWL   +Y ++G W     LQG LT  +HF+ +DSDII
Sbjct  10    YLRDEKLTQETRDLISSLPSEKGWLVSQIYQFQGRWHTEALLQGILTCQKHFKAKDSDII  69

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFAL  429
             L T PKSGT WLK+L FALI R +F      HPL   NPH L+PF+E  Y      DF+L
Sbjct  70    LVTNPKSGTTWLKSLVFALINRHKFPVSSGDHPLLVTNPHLLVPFMEGVYYESPDFDFSL  129

Query  430   TNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
                 RL+ TH+    LP+SV  S  ++VY CRNPKD  VS WHF  KL  +       P 
Sbjct  130   LPFPRLMNTHISHLSLPESVKSSSCQIVYCCRNPKDMFVSLWHFGKKLAPQETA--DYPL  187

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
              +A +++C+G    GPFWDHV EYW  SLENP KVLF+ YEE+KK+ EV ++R+A F+GC
Sbjct  188   EKAVEAFCQGKFIAGPFWDHVLEYWYASLENPNKVLFVTYEELKKQTEVEVKRIAEFIGC  247

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHM  963
              F+ EEE    VS I++LCSFESLS LEVN+    G L  G+E    FRKG++G W + +
Sbjct  248   GFTAEEE----VSEIVKLCSFESLSRLEVNR---QGKLPNGIETNAFFRKGEIGGWRDTL  300

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             +E +A  +D+  +EKF G+GL
Sbjct  301   SESLADAIDRTTEEKFGGSGL  321



>ref|XP_010050960.1| PREDICTED: cytosolic sulfotransferase 5-like [Eucalyptus grandis]
Length=329

 Score =   296 bits (758),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 159/328 (48%), Positives = 203/328 (62%), Gaps = 21/328 (6%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLT-----------PDLYNYKGFWLEPFFLQGALTIHQHFQPQD  237
             + E  + L+SLP E  W+              L  Y+GFW   + L   +    HFQ   
Sbjct  5     SPECEDLLSSLPSEEDWVPTSLPFEEDCVPSSLRLYQGFWFPSWLLNSVVACQNHFQAHP  64

Query  238   SDIILSTFPKSGTVWLKALAFALITRKQFLAE--QETHPLHTNNPHDLIPFLELS-YAAK  408
             SDI+L T PK GT WLKA+ FAL+ R ++     Q  HPL T NPHDL+ FLE   Y   
Sbjct  65    SDILLVTSPKCGTTWLKAILFALLNRAKYSDSYSQPRHPLLTQNPHDLVSFLEFGLYLQN  124

Query  409   ERPDFALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELR  588
             + PD       RLLA+HLP SLLP+SV  S  K+VYLCRNPKDT +S WH+ NK R E +
Sbjct  125   KNPDLTAFTSPRLLASHLPYSLLPRSVRHSNCKLVYLCRNPKDTFISMWHYFNKFRPEEK  184

Query  589   GLEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRR  768
             G   +P  E  D +CRG+   GP+WDHV  Y K S E P KVLF+KYEEMK +P V +RR
Sbjct  185   G--QLPLLEGLDKFCRGMSAYGPYWDHVLGYHKASSEMPEKVLFVKYEEMKADPSVQVRR  242

Query  769   MAAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKV  942
             +A F+G PF+EEE   G + GILR+CSF++LS LEVN++   G L  GVE    FRKG+V
Sbjct  243   LADFIGRPFNEEELRNGTMEGILRMCSFDNLSALEVNRS---GKLPGGVEKKWFFRKGEV  299

Query  943   GDWSNHMTEEMARRLDQIVQEKFTGTGL  1026
             GDW N+M+ EM  R+D +++EK  G+GL
Sbjct  300   GDWVNYMSAEMGERIDGVMEEKLHGSGL  327



>ref|XP_003542798.1| PREDICTED: cytosolic sulfotransferase 15-like [Glycine max]
 gb|KHN37709.1| Flavonol sulfotransferase-like [Glycine soja]
Length=344

 Score =   296 bits (759),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/323 (44%), Positives = 208/323 (64%), Gaps = 8/323 (2%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             ++E+  ++E +E + SLP+E GW T  +Y ++GFW +P  +Q  +T  +HFQ +DSD+I+
Sbjct  23    IEEDKLSQECKELILSLPRERGWRTRYIYLFQGFWCQPLEIQAIITFQKHFQAKDSDVIV  82

Query  253   STFPKSGTVWLKALAFALITRK--QFLAEQETHPLHTNNPHDLIPFLELSY---AAKERP  417
             +T PKSGT WLKAL FA++ R          +HPL T+NPH+L+PF+E +    A    P
Sbjct  83    ATIPKSGTTWLKALTFAIVNRHTHSITTSMSSHPLLTSNPHELVPFIEYTVYGNAPSHVP  142

Query  418   DFALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLE  597
             + +     RL  TH+P   L KS+ ES  +++Y+CRNP DT VS W F+NK++ E   L 
Sbjct  143   NLSNMTEPRLFGTHIPFHALAKSIKESNSRIIYICRNPLDTFVSTWIFLNKIKPE--HLP  200

Query  598   AMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAA  777
                  EAF+ YC+G+   GP WD +  YWKES+  P KVLFLKYE++KK+   H++R+A 
Sbjct  201   EFELGEAFEKYCKGIIGFGPTWDQMLGYWKESIARPSKVLFLKYEDLKKDVNFHVKRIAE  260

Query  778   FLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSN  957
             FLG PF+ EEE  G +  I++LCSFE +  LE NK+        E   LFRK ++GDW N
Sbjct  261   FLGWPFTSEEEGDGTIESIIKLCSFEKMKELEANKSGTFAR-NFERKYLFRKAEMGDWVN  319

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             +++ EM  +L QI++EK +G+GL
Sbjct  320   YLSPEMGEKLSQIMEEKLSGSGL  342



>ref|XP_002514611.1| Flavonol 3-sulfotransferase, putative [Ricinus communis]
 gb|EEF47717.1| Flavonol 3-sulfotransferase, putative [Ricinus communis]
Length=330

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/329 (46%), Positives = 218/329 (66%), Gaps = 12/329 (4%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPD-LYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             L  +    +++  ++S PKE GW T + +Y Y+GFW    F +G ++  +HF+ Q +DII
Sbjct  5     LPNDGCINKYKAIISSFPKEKGWDTRNYMYKYQGFWYYESFAEGVMSAQEHFKAQPNDII  64

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERP-DFA  426
             +++ PK+GT WLKAL FA++TR  F  +  T+PL    PH+ +PFLEL  A   R  D A
Sbjct  65    VASCPKTGTTWLKALTFAIVTRGVF--DDSTNPLLKKVPHECVPFLELDLAKDSRDRDSA  122

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
             +     L+ATH+P   LPK++ +S  K+VY+CR+PKD  VS W+F+ K     + +E +P
Sbjct  123   IP----LVATHVPYISLPKTILDSGCKIVYVCRDPKDVFVSLWYFVAKQLIS-KNIEPIP  177

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               +AF+ +C+G  + GP+WDHV  YWK S+E P KVLFLKYEEMKK+P  +++++A F+G
Sbjct  178   KEDAFELFCKGTAHYGPYWDHVLGYWKASVEYPDKVLFLKYEEMKKDPSFYVKKLAQFMG  237

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTS---VNGDLGVENGVLFRKGKVGDWSN  957
              PFS EEEE GV+  +  +CSFE+LSNLEVNK+     N  L + N V FR G+ GDW N
Sbjct  238   YPFSLEEEEKGVMQKVTNMCSFENLSNLEVNKSGGHRENTTLAIPNHVYFRNGQAGDWVN  297

Query  958   HMTEEMARRLDQIVQEKFTGTGLML*SDP  1044
             H+T EM  R+D+I ++K +G+GL L S P
Sbjct  298   HLTPEMGARIDRIFEQKLSGSGLTLTSLP  326



>ref|XP_010906702.1| PREDICTED: flavonol 3-sulfotransferase-like [Elaeis guineensis]
Length=350

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/321 (48%), Positives = 199/321 (62%), Gaps = 7/321 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             QE    +E  +F+++LP+  GW       Y+GFW+    L   +TI ++F+P+  D+ + 
Sbjct  17    QEAQEDQECSDFISTLPR-GGWGPIRTRKYQGFWVLEIALPSVMTIQKNFKPRPDDLFVV  75

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTN  435
             ++PKSGT WLKA+ FA  TR Q+      HPL + NPHD +  LE  +   +        
Sbjct  76    SYPKSGTTWLKAITFATKTRTQYPLSH--HPLLSLNPHDCVLNLEECFHKGQASKIEALP  133

Query  436   GSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPE  615
               R+LA H+P SLLP S+  S  + VY+CR+PKDT+VS WHF  K R   + +E  PF E
Sbjct  134   SPRILAIHMPYSLLPDSMTSSSCRFVYICRDPKDTLVSMWHFREKTRP--KTMEPTPFIE  191

Query  616   AFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPF  795
             AF+++C G    GP WDHV EYW+ES   P KVLFLKYEEM  EP   +RR+A F+GCPF
Sbjct  192   AFEAFCEGTSAVGPMWDHVLEYWRESQRRPEKVLFLKYEEMMDEPVGKVRRLAEFIGCPF  251

Query  796   SeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLG--VENGVLFRKGKVGDWSNHMTE  969
             SE EE+ GVV  I++LCSFE L NLE NKT   G  G  V N   FRKG  GDW NHM+ 
Sbjct  252   SEAEEKGGVVQEIVKLCSFEKLKNLEANKTGTQGGPGMVVTNDSFFRKGGAGDWKNHMSP  311

Query  970   EMARRLDQIVQEKFTGTGLML  1032
             EMA+RLD I Q+K   +GL L
Sbjct  312   EMAQRLDGIAQQKLRESGLTL  332



>ref|XP_010272754.1| PREDICTED: flavonol sulfotransferase-like [Nelumbo nucifera]
Length=341

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 150/313 (48%), Positives = 211/313 (67%), Gaps = 6/313 (2%)
 Frame = +1

Query  100   FREFLNSLPKETGWLTPDLYNYKGFW-LEPFFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             +R+ ++SLP E GW++  L  Y+GFW +    LQGA+ + QHF+ + +DI+L++ PKSGT
Sbjct  29    YRDLISSLPNEKGWISESLVLYQGFWYVSTISLQGAMAVQQHFKARPTDILLTSTPKSGT  88

Query  277   VWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRLLA  453
              W KAL FA+I R  +  +  THPL  +NPHD +P LE + Y     P+  +    RL +
Sbjct  89    TWTKALIFAIINRTNY--DFTTHPLLIHNPHDCVPTLETNLYRTTPIPNPDVLPSPRLFS  146

Query  454   THLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSEL-RGLEAMPFPEAFDSY  630
             TH+P S LP+S+  S  +++++CRNPKD ++SFW F NKL+++L +    +P  EAF  +
Sbjct  147   THIPYSSLPESITASNCRIIHICRNPKDVLISFWFFANKLQAKLNKDHPLLPLEEAFQLF  206

Query  631   CRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeee  810
             C+G    GP+WD V  YWK SLE P ++LFLKYE +K  P   L+++A  LG PFS EEE
Sbjct  207   CKGASPYGPYWDQVLGYWKASLEWPERILFLKYEGLKGNPFSCLKKLAEHLGYPFSLEEE  266

Query  811   eCGVVSGILRLCSFESLSNLEVNKTSVN-GDLGVENGVLFRKGKVGDWSNHMTEEMARRL  987
             E GVV  IL LCSFE+LS+L+VNK     G+LGVEN   +RKG+VGDW NH+T EM   +
Sbjct  267   EQGVVEKILNLCSFENLSSLDVNKNPEKVGNLGVENSAFYRKGQVGDWENHLTAEMVEHI  326

Query  988   DQIVQEKFTGTGL  1026
             D+I ++KF G+GL
Sbjct  327   DRITEQKFHGSGL  339



>gb|KDO65654.1| hypothetical protein CISIN_1g018736mg [Citrus sinensis]
Length=351

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 151/316 (48%), Positives = 211/316 (67%), Gaps = 9/316 (3%)
 Frame = +1

Query  100   FREFLNSLPKETGWLTPDLYNYKGFWLEP-FFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             +R+ + +LPK  GW T  L  Y+GFW +P   L+G + + Q F+P+ +D+ L+T PKSGT
Sbjct  29    YRDKMATLPKYRGWSTLHLCQYQGFWFQPKIGLEGVMWVQQRFKPRPTDVYLATNPKSGT  88

Query  277   VWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRLLA  453
              WLKA+ F+++ RK++      HPL   +PH+++PF+EL  +      D  +    R+LA
Sbjct  89    TWLKAIVFSIMNRKRYNNFTTDHPLLKFSPHEVVPFMELDLFRTTPIADPEILPSPRILA  148

Query  454   THLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYC  633
             TH+  ++LP+S+  S   +VY+CRNPKD  VSFW F  K+R   + L  +   EAFD +C
Sbjct  149   THIAYNMLPESIQNSSCPIVYICRNPKDVFVSFWQFSVKMRP--KDLPELSSEEAFDLFC  206

Query  634   RGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeee  813
              GV   GPFWD    YWK S+E P +VLFLKYE+MK EP +  +R+A FLG PFS +EEE
Sbjct  207   HGVTPCGPFWDQALGYWKASVEFPNRVLFLKYEDMKTEPLLCTKRIAEFLGQPFSLQEEE  266

Query  814   CGVVSGILRLCSFESLSNLEVN---KTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARR  984
              G+V  I++LCSFE++SNLEVN   K+ V  +  V+N V FR+GKVGDW NH+T+EM  R
Sbjct  267   NGIVQEIVKLCSFENMSNLEVNRNGKSRVRAE--VKNDVFFRQGKVGDWKNHLTDEMIER  324

Query  985   LDQIVQEKFTGTGLML  1032
             LDQI + KF GTGL++
Sbjct  325   LDQITKHKFDGTGLIV  340



>ref|XP_006388004.1| hypothetical protein POPTR_0412s00210g, partial [Populus trichocarpa]
 gb|ERP46918.1| hypothetical protein POPTR_0412s00210g, partial [Populus trichocarpa]
Length=331

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/318 (45%), Positives = 209/318 (66%), Gaps = 10/318 (3%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKS  270
              + + E +++LPK  G    D + Y+GFW   FFL+G +++H+HF PQ +DI +++ PK+
Sbjct  7     AKNYNEVMDALPKVKGLRGNDYFLYQGFWYSAFFLEGLMSVHEHFNPQSTDIFVASSPKT  66

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAK-ERPDFALTNGSRL  447
             GT WLKAL FA++TR + L+   T  L T  PHD +PFLE   A      D A+     L
Sbjct  67    GTTWLKALTFAILTRSR-LSGSTTSSLLTKMPHDCVPFLEYHLARNPSNRDLAIP----L  121

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
             L+TH+P S LPKS+  S  K++Y+CR+ KD  VS W F++  +   + +E +P  EAF+ 
Sbjct  122   LSTHVPYSCLPKSIISSCCKIIYICRDAKDAFVSLWCFVSAHQMS-KNVEPLPLEEAFEM  180

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             +C G+   GP+WDHV  YW+ SLE P K+LFL YEEMKK+   H++++A F+GC F+ +E
Sbjct  181   FCNGISILGPYWDHVLGYWRASLEFPEKILFLTYEEMKKDTAAHVKKLAEFMGCSFTLDE  240

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTS---VNGDLGVENGVLFRKGKVGDWSNHMTEEMA  978
             EE G V  I+ +CSFE LSNLEVNK     ++  + ++N + FRKG++GDW+NH+T EM 
Sbjct  241   EEEGEVQKIISMCSFEKLSNLEVNKNGKHRLDTSIAIQNSLYFRKGEIGDWANHLTPEMG  300

Query  979   RRLDQIVQEKFTGTGLML  1032
              RLD I++ K  G+GL L
Sbjct  301   ARLDDIMERKLKGSGLKL  318



>ref|XP_011047829.1| PREDICTED: flavonol sulfotransferase-like [Populus euphratica]
Length=336

 Score =   295 bits (754),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 148/318 (47%), Positives = 209/318 (66%), Gaps = 10/318 (3%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKS  270
              E + E +++LPK  G    D Y Y+GFW   FFL+G +++ +HF PQ +DI +++FPK+
Sbjct  23    AENYNEVMSTLPKVKGLRGDDYYLYQGFWYSAFFLEGLMSVQEHFTPQSTDIFVASFPKT  82

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAK-ERPDFALTNGSRL  447
             GT WLKAL FA++TR + L+   T  L T  PHD +PFL+ + A      D A+     L
Sbjct  83    GTTWLKALTFAILTRFR-LSGSTTSSLLTKMPHDCVPFLKYNLAQNPSNRDLAIP----L  137

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
             L+TH+P S LPKS+  S  K++Y+CR+ KD  VS W+F   L+   + +E +P  EAF+ 
Sbjct  138   LSTHVPYSSLPKSIISSCCKIIYICRDAKDAFVSLWYFHANLQRS-KNVEHLPLEEAFEL  196

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             +C G+ N GP+WDHV  YW+ SLE P K+LFL YEEMKK+   H++++A F+GC F+ EE
Sbjct  197   FCNGIANHGPYWDHVLGYWRASLEFPEKILFLTYEEMKKDTAAHVKKLAEFMGCSFTLEE  256

Query  808   eeCGVVSGILRLCSFESLSNLEVNKT---SVNGDLGVENGVLFRKGKVGDWSNHMTEEMA  978
             EE G V  I+ +CSFE LSNLEVNK      +  + + N + FRKG++GDW NH+T EM 
Sbjct  257   EEEGEVQKIISMCSFEKLSNLEVNKNLKCLQDISIPIPNSIYFRKGEIGDWENHLTPEMG  316

Query  979   RRLDQIVQEKFTGTGLML  1032
              RLD I+++K  G+GL L
Sbjct  317   ARLDDIMEQKLKGSGLKL  334



>gb|KCW80972.1| hypothetical protein EUGRSUZ_C02337 [Eucalyptus grandis]
Length=398

 Score =   297 bits (760),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 156/308 (51%), Positives = 197/308 (64%), Gaps = 10/308 (3%)
 Frame = +1

Query  118   SLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGTVWLKALA  297
             SLP E   +   L  Y+GFW   + L   +    HFQ   SDI+L T PK GT WLKA+ 
Sbjct  94    SLPFEEDCVPSSLRLYQGFWFPSWLLNSVVACQNHFQAHPSDILLVTSPKCGTTWLKAIL  153

Query  298   FALITRKQFLAE--QETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRLLATHLPV  468
             FAL+ R ++     Q  HPL T NPHDL+ FLE   Y   + PD       RLLA+HLP 
Sbjct  154   FALLNRAKYSDSYSQPRHPLLTQNPHDLVSFLEFGLYLQNKNPDLTAFTSPRLLASHLPY  213

Query  469   SLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCRGVCN  648
             SLLP+SV  S  K+VYLCRNPKDT +S WH+ NK R E +G   +P  E  D +CRG+  
Sbjct  214   SLLPRSVRHSNCKLVYLCRNPKDTFISMWHYFNKFRPEEKG--QLPLLEGLDKFCRGMSA  271

Query  649   TGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeCGVVS  828
              GP+WDHV  Y K S E P KVLF+KYEEMK +P V +RR+A F+G PF+EEE   G + 
Sbjct  272   YGPYWDHVLGYHKASSEMPEKVLFVKYEEMKADPSVQVRRLADFIGRPFNEEELRNGTME  331

Query  829   GILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHMTEEMARRLDQIVQ  1002
             GILR+CSF++LS LEVN++   G L  GVE    FRKG+VGDW N+M+ EM  R+D +++
Sbjct  332   GILRMCSFDNLSALEVNRS---GKLPGGVEKKWFFRKGEVGDWVNYMSAEMGERIDGVME  388

Query  1003  EKFTGTGL  1026
             EK  G+GL
Sbjct  389   EKLHGSGL  396



>ref|XP_009336551.1| PREDICTED: flavonol 4'-sulfotransferase-like [Pyrus x bretschneideri]
Length=395

 Score =   296 bits (759),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 164/356 (46%), Positives = 210/356 (59%), Gaps = 48/356 (13%)
 Frame = +1

Query  103   REFLNSLPKETGWLTPDLYNYKGFWLEP-FFLQGALTIHQHF---QPQDSDI--------  246
             RE L +LPKE GW+   L  YKG WL P + L+ A+ +  HF   Q   S          
Sbjct  35    REMLPNLPKEKGWIAEQLVQYKGVWLTPTYALKAAVQLQHHFNLFQTTGSSTSAARGSLP  94

Query  247   --ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS--------  396
                L+T PKSGT WL+AL FA + R  + A    HPL T  PHD  PFLE+         
Sbjct  95    MYFLATLPKSGTTWLRALMFATLNRSLYDAASPHHPLLTTGPHDCFPFLEMDKMLGNHDH  154

Query  397   ---------------YAAKERPDFALTNGSRLLATHLPVSLLPKSVWESKG-----KVVY  516
                                   D   T+ S+L ATHLP SL PKSV  S       K VY
Sbjct  155   SRSVTLLDHDHHDDRDIGDAMIDNYPTSTSQLFATHLPYSLFPKSVTTSSSTCGVLKFVY  214

Query  517   LCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESL  696
             +CRNPKD  +S W F +K+++   GL      EAFD +CRG+C  GP+WDHV  +WK SL
Sbjct  215   VCRNPKDVFISLWKFGSKVKAVNTGLTPFSLEEAFDLFCRGICPYGPYWDHVLGFWKASL  274

Query  697   ENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEV  876
             E P +VLFLKYE+++KEP  +++R+A FLG PFSEEEE  GVV  I++LCSFE+LS+LE+
Sbjct  275   EMPEQVLFLKYEDLRKEPSANVKRLAEFLGQPFSEEEESKGVVQQIIKLCSFENLSSLEI  334

Query  877   NKTS------VNGDLGVENGVLFRKGKVGDWSNHMTEEMARRLDQIVQEKFTGTGL  1026
             NKTS      V  +L VEN   FRKG+VGDW N  T++MA+R+DQI+ E+F+G+GL
Sbjct  335   NKTSRTQQYFVKANLVVENSDFFRKGQVGDWKNFFTDDMAKRMDQIIDERFSGSGL  390



>ref|XP_010521619.1| PREDICTED: LOW QUALITY PROTEIN: cytosolic sulfotransferase 1-like 
[Tarenaya hassleriana]
Length=329

 Score =   294 bits (753),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 153/325 (47%), Positives = 211/325 (65%), Gaps = 13/325 (4%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             + + ++  +EE R  ++SLP +  +   +L NY+G W     LQ  + +  HF+P D+D+
Sbjct  10    KIMGDDELSEECRSLISSLPTDKDFEGINLCNYQGHWYYYNSLQAVINVRDHFRPLDTDV  69

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAE-QETHPLHTNNPHDLIPFLELS-YAAKERPD  420
             IL++FPKSGT W KAL FA++ RK+   +  +THPL T NPH L+PFLEL  YA    PD
Sbjct  70    ILASFPKSGTTWXKALIFAIVERKKHRPDPDQTHPLLTRNPHSLVPFLELVLYADNRVPD  129

Query  421   FALTNGSRLLATHLPVSLLPKSVWE-SKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLE  597
                    RL +TH+P   L ++V + S  KVVY+CRNPKD VVS WHF ++L +    +E
Sbjct  130   LTEYPSPRLFSTHMPFHTLSEAVIKASPCKVVYVCRNPKDVVVSAWHFRSRLLNSKAEME  189

Query  598   AMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAA  777
             A      F+S+C GV   GPFWDHV  YW++SLE+P +V F+KYEE+K +P    +R+A 
Sbjct  190   AQ-----FESFCSGVRFYGPFWDHVLGYWRKSLESPKQVFFVKYEEIKNDPRAQTKRLAR  244

Query  778   FLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDW  951
             FL CPF+EEEE  G+V  IL LCS  SLSNL+VNK   NG     ++    FRKG+VGDW
Sbjct  245   FLDCPFTEEEERSGLVDEILELCSLRSLSNLDVNK---NGKTPSSIDCSAFFRKGEVGDW  301

Query  952   SNHMTEEMARRLDQIVQEKFTGTGL  1026
              NH+T +MA R+DQI++ +  G+GL
Sbjct  302   KNHLTPDMATRIDQIIEHQLRGSGL  326



>ref|XP_004307199.1| PREDICTED: cytosolic sulfotransferase 15-like [Fragaria vesca 
subsp. vesca]
Length=329

 Score =   294 bits (753),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 150/318 (47%), Positives = 210/318 (66%), Gaps = 7/318 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             +E   ++E +  L SLPKE GW T   Y ++GFW +   +Q  +    HFQ  DSD++L+
Sbjct  12    EEEKLSDECKAHLLSLPKEKGWRTLHQYQFQGFWCQAAEIQSIMAFQNHFQASDSDVVLA  71

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALT  432
             + PKSGT WLKALAFA++ R +F  + ++HPL T+NPH L+PFLE + YA  + PD +  
Sbjct  72    SIPKSGTTWLKALAFAVVNRHRF--DIKSHPLLTSNPHHLVPFLEYNLYADNQLPDLSKF  129

Query  433   NGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFP  612
                RL  TH+P   L  ++ +S  K+VY+CRNP DT VS WHF+NK + + +    M   
Sbjct  130   PEPRLFGTHVPYPSL-GTIKKSNCKIVYICRNPFDTFVSTWHFINKGKPQSQA--PMLLE  186

Query  613   EAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCP  792
             EAFD YC+G+   GPFW+H+  YWKESL  P KVLFLKYE+MK++   HL+R+A FL  P
Sbjct  187   EAFDMYCKGIIGFGPFWEHMLGYWKESLNRPDKVLFLKYEDMKEDGAFHLKRLAKFLEYP  246

Query  793   FSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEE  972
             F+ EEE  GV+  I +LCSFE++  LEVNK+ +      EN  LFRK +VGDW N++  +
Sbjct  247   FTLEEERNGVIQDIEKLCSFETMKKLEVNKSGMFVK-NFENKSLFRKAEVGDWVNYLNPK  305

Query  973   MARRLDQIVQEKFTGTGL  1026
             MA RL ++++E+  G+GL
Sbjct  306   MAERLSKVIEERLGGSGL  323



>ref|XP_009114139.1| PREDICTED: cytosolic sulfotransferase 12-like [Brassica rapa]
Length=323

 Score =   294 bits (752),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 153/321 (48%), Positives = 204/321 (64%), Gaps = 12/321 (4%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             +L++ + T+E R+ L+SLP E GWL   +Y ++G W  P  LQG +   +HF+  DSD+I
Sbjct  9     YLKDENLTQETRDLLSSLPTEKGWLVSQMYQFEGSWQAPALLQGIVNCQKHFEANDSDVI  68

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFAL  429
             L+TFPKSGT WLKAL FALI R +F    + HPL   NPH L+PFLE  Y       F+ 
Sbjct  69    LATFPKSGTTWLKALLFALIPRHKFPVSGK-HPLLVTNPHSLVPFLEGDYCVSPEVKFSE  127

Query  430   TNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
                 R++ TH+    LP S+  S  K+VY CRNPKD  VS WHF  KL  E       P 
Sbjct  128   LPSPRIMQTHVTHHSLPVSIKSSCCKIVYCCRNPKDKFVSLWHFGRKLAPEETA--EYPI  185

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
               A +++C G    GPFWDHV EYW ES +NP KVLF+ YEE+KK+ EV ++R+A F+GC
Sbjct  186   ETAVEAFCEGKFIGGPFWDHVLEYWYESRKNPNKVLFVTYEELKKQTEVEVKRIADFIGC  245

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHM  963
              F+ EEE    VS I++LCSFESLS LEVN+    G L  G+E+   FRKG++G W + +
Sbjct  246   GFTAEEE----VSEIVKLCSFESLSKLEVNR---QGKLPNGIESNSYFRKGEIGGWRDTL  298

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             +E +A  +D+  +EKF G+GL
Sbjct  299   SESLAEVIDRTTEEKFRGSGL  319



>emb|CDY54154.1| BnaA09g53490D [Brassica napus]
Length=323

 Score =   294 bits (752),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 153/321 (48%), Positives = 204/321 (64%), Gaps = 12/321 (4%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             +L++ + T+E R+ L+SLP E GWL   +Y ++G W  P  LQG +   +HF+  DSD+I
Sbjct  9     YLKDENLTQETRDLLSSLPSEKGWLVSQMYQFEGSWQAPALLQGIVNCQKHFEANDSDVI  68

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFAL  429
             L+TFPKSGT WLKAL FALI R +F    + HPL   NPH L+PFLE  Y       F+ 
Sbjct  69    LATFPKSGTTWLKALLFALIHRHKFPVSGK-HPLLVTNPHSLVPFLEGDYCVSPEVKFSE  127

Query  430   TNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
                 R++ TH+    LP S+  S  K+VY CRNPKD  VS WHF  KL  E       P 
Sbjct  128   LPSPRIMQTHVTHHSLPVSIKSSCCKIVYCCRNPKDKFVSLWHFGRKLAPEETA--EYPI  185

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
               A +++C G    GPFWDHV EYW ES +NP KVLF+ YEE+KK+ EV ++R+A F+GC
Sbjct  186   ETAVEAFCEGKFIGGPFWDHVLEYWYESRKNPNKVLFVTYEELKKQTEVEVKRIANFIGC  245

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHM  963
              F+ EEE    VS I++LCSFESLS LEVN+    G L  G+E+   FRKG++G W + +
Sbjct  246   GFTAEEE----VSEIVKLCSFESLSKLEVNR---QGKLPNGIESNSYFRKGEIGGWRDTL  298

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             +E +A  +D+  +EKF G+GL
Sbjct  299   SESLAEVIDRTTEEKFRGSGL  319



>ref|XP_002314916.2| hypothetical protein POPTR_0010s14820g [Populus trichocarpa]
 gb|EEF01087.2| hypothetical protein POPTR_0010s14820g [Populus trichocarpa]
Length=334

 Score =   294 bits (752),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 156/280 (56%), Positives = 186/280 (66%), Gaps = 8/280 (3%)
 Frame = +1

Query  193   LQGALTIHQHFQPQDSDIILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHD  372
             LQG L   +H Q QD DI L T PKSG+ WLKA+ FAL+ R  F  + + HPL TNNPH 
Sbjct  59    LQGVLACQKHLQAQDGDIFLVTTPKSGSTWLKAVMFALVNRVSF-PDTKQHPLLTNNPHA  117

Query  373   LIPFLELSYAAKERPDFALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSF  552
             L+PFLE+ Y  KE  DF      RL +THLP+  LP+SV +S+ K+VYLCRNPKD  VS 
Sbjct  118   LLPFLEMQYIGKENLDFTNYTFPRLFSTHLPLLSLPRSVEDSECKLVYLCRNPKDIFVSL  177

Query  553   WHFMNKLRSELRGLEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYE  732
             WHF NKLR    G  A    E FD +CRGV   GPFWDHV  YWKESLE P +V FLKYE
Sbjct  178   WHFTNKLRPIDWG--ASSLEETFDKFCRGVNLYGPFWDHVLGYWKESLERPHRVFFLKYE  235

Query  733   EMKKEPEVHLRRMAAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--G  906
             EMK EP + LRR++ FLGCPFS EEE  GV+  IL LCSFE+LSNLEVN     G L  G
Sbjct  236   EMKNEPRIQLRRLSEFLGCPFSLEEENSGVLDEILELCSFENLSNLEVNNI---GRLHSG  292

Query  907   VENGVLFRKGKVGDWSNHMTEEMARRLDQIVQEKFTGTGL  1026
              E+   FR+G+VGD  N++T EM  ++D I ++K    GL
Sbjct  293   EEHQAFFRRGEVGDSMNYLTAEMVEKIDMITEQKLHCHGL  332



>emb|CDY49688.1| BnaA02g27270D [Brassica napus]
Length=334

 Score =   294 bits (752),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 145/326 (44%), Positives = 214/326 (66%), Gaps = 7/326 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
              +++++  + E +  +++LP +  ++   LYNYKG W  P  LQ  L + +HF+P+D+DI
Sbjct  11    NYMKDDKVSHETKNLISTLPSDKDFMGYPLYNYKGCWYYPNILQAVLDVQKHFRPRDTDI  70

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL++ PK GT WLK+L FAL+ R+++L   +THPL + NPHDL+PFLE+  YA  + PD 
Sbjct  71    ILASLPKGGTTWLKSLVFALVHREKYLENPQTHPLLSQNPHDLVPFLEVELYAGSQTPDL  130

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKG---KVVYLCRNPKDTVVSFWHFMNKLRSELRGL  594
                    + +TH+ ++ L ++  +S     KVVY+CR  KDT VS WH+ N L      +
Sbjct  131   TKFPSPMIYSTHMHLNTLREATTKSSSSPCKVVYVCRGIKDTFVSGWHYRNMLHR--TKM  188

Query  595   EAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMA  774
             +   F   FD+YC+GV   GP+W+HV  YW  SLE+   VLFLKYEEM +EP V ++R+A
Sbjct  189   DQATFELMFDAYCKGVLLYGPYWEHVLGYWNGSLEDGENVLFLKYEEMIEEPRVQVKRLA  248

Query  775   AFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWS  954
              FL  PF+EEEE+ G V  IL+LCS  +LSNLE+N       +G+++ V FRKG+VGDW 
Sbjct  249   EFLDFPFTEEEEKSGSVEEILKLCSLRNLSNLEINMNGTT-RIGIDSNVFFRKGEVGDWK  307

Query  955   NHMTEEMARRLDQIVQEKFTGTGLML  1032
             NH+T +MA+++D IV+ K  G+GL+ 
Sbjct  308   NHLTPQMAKKIDDIVECKLQGSGLIF  333



>emb|CDY05012.1| BnaAnng01940D [Brassica napus]
Length=368

 Score =   295 bits (755),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 153/320 (48%), Positives = 209/320 (65%), Gaps = 8/320 (3%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             +E SY  EF+E L SLPKE GW T  LY ++GFW +   +Q  ++  +HF+P  +D++++
Sbjct  49    EELSY--EFQEMLESLPKERGWRTRHLYLFQGFWCQSKEIQAIMSFQKHFKPLQNDVVIA  106

Query  256   TFPKSGTVWLKALAFALITRKQF--LAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA  426
             T PKSGT WLKAL + L+ R +F  ++    HPL T+NPHDL+PF E   YA  + PD +
Sbjct  107   TIPKSGTTWLKALTYTLLNRHRFDPVSSNTDHPLLTSNPHDLVPFFEYKLYANGDVPDLS  166

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
                  R  ATH+P   L  S+ +   KVVYLCRNP DT +S WH+ N ++SE   +  + 
Sbjct  167   GLASPRTFATHVPFGSLKDSIEKPGVKVVYLCRNPFDTFISSWHYTNSIKSE--SVSPVS  224

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               E FD YCRG+   GPFW+H+  YWKESL+ P KVLFL+YE++K++ E +L+++A+FLG
Sbjct  225   LDEGFDMYCRGLIGFGPFWEHMLGYWKESLKRPDKVLFLRYEDLKQDIESNLKKLASFLG  284

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMT  966
              PF+EEEE  GV   I+ LCSFESL  LEVNK   +     EN  LFRKG+V DW N+++
Sbjct  285   VPFTEEEEGKGVTKAIVALCSFESLKKLEVNKAGKSIK-NFENRHLFRKGEVSDWINYLS  343

Query  967   EEMARRLDQIVQEKFTGTGL  1026
                A RL  +V +K  GTGL
Sbjct  344   PPQAERLSALVDDKLGGTGL  363



>ref|XP_009125671.1| PREDICTED: cytosolic sulfotransferase 15-like [Brassica rapa]
Length=368

 Score =   295 bits (755),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 150/313 (48%), Positives = 206/313 (66%), Gaps = 6/313 (2%)
 Frame = +1

Query  97    EFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             EF+E L SLPKE GW T  LY ++GFW +   +Q  ++I +HF+P  +D++++T PKSGT
Sbjct  54    EFQEMLESLPKERGWRTRHLYLFQGFWCQSKEIQAIMSIQKHFKPLQNDVVIATIPKSGT  113

Query  277   VWLKALAFALITRKQF--LAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRL  447
              WLKAL + L+ R +F  ++    HPL T+NPHDL+PF E   YA  + PD +     R 
Sbjct  114   TWLKALTYTLLNRHRFDPVSSNTDHPLLTSNPHDLVPFFEYKLYANGDVPDLSGLASPRT  173

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
              ATH+P   L  S+ +   KVV+LCRNP DT +S WH+ N ++SE   +  +   E FD 
Sbjct  174   FATHVPFGSLKDSIEKPGVKVVHLCRNPFDTFISSWHYTNSIKSE--SVSPVSLDEGFDM  231

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             YCRG+   GPFW+H+  YWKESL+ P KVLFL+YE++K++ E +L+++A+FLG PF+EEE
Sbjct  232   YCRGLIGFGPFWEHMLGYWKESLKRPDKVLFLRYEDLKQDIESNLKKLASFLGVPFTEEE  291

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRL  987
             E  GV   I+ LCSFESL  LEVNK   +     EN  LFRKG+V DW N+++   A RL
Sbjct  292   EGKGVTKAIVALCSFESLKKLEVNKAGKSIK-NFENRHLFRKGEVSDWINYLSPPQAERL  350

Query  988   DQIVQEKFTGTGL  1026
               +V +K  GTGL
Sbjct  351   SALVDDKLGGTGL  363



>ref|XP_009336546.1| PREDICTED: flavonol sulfotransferase-like [Pyrus x bretschneideri]
Length=399

 Score =   296 bits (757),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 165/353 (47%), Positives = 213/353 (60%), Gaps = 45/353 (13%)
 Frame = +1

Query  103   REFLNSLPKETGWLTPDLYNYKGFWLEP-FFLQGALTIHQHF---QPQDSDI--------  246
             RE L +LPKE GW+T  L  YKG WL P + L+ A+ +  HF   Q   S          
Sbjct  42    REMLPNLPKEKGWITEHLVQYKGVWLTPTYALKAAVQLQHHFNLFQTTGSSTSAARGLSP  101

Query  247   --ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS--------  396
                L+T PKSGT WL+AL FA + R  + A    HPL T  PHD  PFLE+         
Sbjct  102   ICFLATIPKSGTTWLRALMFATLNRSLYDAASPHHPLLTTGPHDCFPFLEMDNMLENHDH  161

Query  397   ------YAAKERPDFALTN------GSRLLATHLPVSLLPKSVWESK-----GKVVYLCR  525
                   +  ++  D  + N       ++L ATHLP SLLPKSV  S       K VY+CR
Sbjct  162   SRPVTYHDDRDSGDGMINNYAPPTSTTQLFATHLPFSLLPKSVTTSSSAYCVSKFVYVCR  221

Query  526   NPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENP  705
             NPKD  +S W F NK++    GL  +   EAF+ +CRGV   GP+WDHV  +WK SLE P
Sbjct  222   NPKDAFISLWKFGNKVKPVNTGLAPLSIEEAFELFCRGVYPYGPYWDHVLGFWKASLEMP  281

Query  706   GKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKT  885
              KVLFLKYE+++KEP  +++R+A FLG PFSEEEE  GVV  I++LCSFE+LS+LEVNKT
Sbjct  282   AKVLFLKYEDLRKEPSANVKRLAEFLGQPFSEEEESKGVVQQIIKLCSFENLSSLEVNKT  341

Query  886   S------VNGDLGVENGVLFRKGKVGDWSNHMTEEMARRLDQIVQEKFTGTGL  1026
             S      V  ++  EN   FRKG+VGDW N  T++MA+R+DQI+ E+F+G+GL
Sbjct  342   SMTQQYFVKANIVFENSDFFRKGQVGDWKNFFTDDMAKRMDQIIDERFSGSGL  394



>gb|KHN21542.1| Flavonol sulfotransferase-like [Glycine soja]
Length=304

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/306 (49%), Positives = 204/306 (67%), Gaps = 12/306 (4%)
 Frame = +1

Query  130   ETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGTVWLKALAFALI  309
             E GW+   L+ Y+GFW     LQG L+  +HF+  D+D+++ + PKSGT WLKA  F+L+
Sbjct  2     ERGWVASHLHQYQGFWHTTRQLQGVLSCQKHFKALDTDVLIVSTPKSGTTWLKAWTFSLL  61

Query  310   TRKQFL--AEQETHPLHTNNPHDLIPFLELSYAAKER--PDF-ALTNGSRLLATHLPVSL  474
              R Q     + + HPL  NNPH L+PFLEL     +   PD  +L    RL +THLP   
Sbjct  62    HRNQHDPNTQNQNHPLLFNNPHFLVPFLELDLYIDDNTLPDLTSLITSPRLFSTHLPYVS  121

Query  475   LPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCRGVCNTG  654
             LPKSV ES  K++YLCR+PKD  +S WHF N LR + RG+ ++   EAFD +CRGV   G
Sbjct  122   LPKSVQESACKIIYLCRDPKDAFISLWHFTNMLRPKSRGMNSLQ--EAFDKFCRGVSLYG  179

Query  655   PFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeCGVVSGI  834
             PFW HV +YW++SL  P K++F+++EEMK +P + L+ +A F+GCPFS+EEEE GVV  I
Sbjct  180   PFWAHVLDYWQKSLSEPNKIMFMRFEEMKMKPRLVLQELATFVGCPFSKEEEEAGVVDHI  239

Query  835   LRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHMTEEMARRLDQIVQEK  1008
             L+LCSF++LSNL+VNK   NG L  G E+   FR G++GD  NH+T EM ++L+ I QEK
Sbjct  240   LKLCSFDNLSNLQVNK---NGKLSSGEEHKAFFRCGQIGDCKNHLTAEMIQQLNTITQEK  296

Query  1009  FTGTGL  1026
                 GL
Sbjct  297   LAEHGL  302



>ref|XP_009129073.1| PREDICTED: cytosolic sulfotransferase 12-like isoform X3 [Brassica 
rapa]
Length=331

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 154/325 (47%), Positives = 205/325 (63%), Gaps = 8/325 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
              +L +   T+E R+ ++SLP+E GWL   +Y ++G W     LQG +   + F+ +DSDI
Sbjct  10    DYLGDEDLTQETRDLISSLPREKGWLVSQMYQFQGRWHTQALLQGLMECQKRFEAKDSDI  69

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFA  426
             IL T PKSGT WLKAL FALITR +F      HPL   NPH L+PFLE  Y      DF+
Sbjct  70    ILVTNPKSGTTWLKALVFALITRHKFPVSSGDHPLLVTNPHLLVPFLEGVYYESPDFDFS  129

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
               +  RL+ TH+P+  LP++V  S  K+VY CRNPKD  VS WHF  KL  E       P
Sbjct  130   KLSFPRLMNTHIPLLSLPETVKSSSCKIVYCCRNPKDMFVSLWHFGKKLAPEETA--DYP  187

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               +A +++C+G    GPFWDHV EYW  SLENP KVLF+ YEE+KK+    ++R+A FLG
Sbjct  188   IEKAVEAFCQGKFIGGPFWDHVLEYWYASLENPNKVLFVTYEELKKQTGDTIKRIAEFLG  247

Query  787   CPF-SeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
             C F  EEE       GI++LCSFESLS+LEVN+    G L  G+E    FRKG VG W +
Sbjct  248   CGFIGEEEVREEEERGIVKLCSFESLSSLEVNR---EGKLPNGMETKAFFRKGDVGGWGD  304

Query  958   HMTEEMARRLDQIVQEKFTGTGLML  1032
              ++E +A ++D+ ++EKF G+GL+ 
Sbjct  305   TLSESLAEKIDRTIEEKFQGSGLIF  329



>ref|XP_010520091.1| PREDICTED: cytosolic sulfotransferase 15-like [Tarenaya hassleriana]
Length=360

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 200/310 (65%), Gaps = 5/310 (2%)
 Frame = +1

Query  103   REFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGTVW  282
             RE L+SLP+E GW T  LY ++ FW +   +Q  ++  +HF+  D DII++T PKSGT W
Sbjct  49    RELLDSLPRERGWRTRYLYLFQEFWCQAKEIQSIMSFQKHFKSVDGDIIIATIPKSGTTW  108

Query  283   LKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKER--PDFALTNGSRLLAT  456
             LKAL FAL+ R  F      HPL T+NPHDLIPF E    A  R  P  +     R  AT
Sbjct  109   LKALTFALVNRHSFPVSSSGHPLLTSNPHDLIPFFEYKLYANHRYIPHLSHIPSPRTFAT  168

Query  457   HLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCR  636
             H+P   L  S+  S  KVVYLCRNP DT VS WH++N ++SE      +   E FD YCR
Sbjct  169   HVPFGSLKDSIKNSNVKVVYLCRNPFDTFVSSWHYVNNIKSE--STSPISLDEGFDLYCR  226

Query  637   GVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeC  816
             GV   GPFW+H+  YWKESLE P ++LFL+YE+MK++ E +L+++A FLG PF+EEEE+ 
Sbjct  227   GVIGFGPFWEHMLGYWKESLERPDRLLFLQYEDMKEDIESNLKKLADFLGLPFTEEEEKQ  286

Query  817   GVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRLDQI  996
             GV   I +LCSF++L NLEVNK+S +     EN  LFRKG+V DW N++    A RL ++
Sbjct  287   GVAREIAKLCSFDNLRNLEVNKSSKSIK-NFENRFLFRKGQVSDWMNYLRPSQAERLSKL  345

Query  997   VQEKFTGTGL  1026
             V EK   +GL
Sbjct  346   VDEKLGDSGL  355



>gb|AAR14296.1| steroid sulfotransferase 4 [Brassica napus]
 emb|CDY45713.1| BnaC02g35150D [Brassica napus]
Length=323

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 157/321 (49%), Positives = 203/321 (63%), Gaps = 11/321 (3%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             +L++   T+E R+ ++SLP E GWL   +Y ++G W     LQG L   +HF+ +DSDII
Sbjct  8     YLRDEDLTQETRDLISSLPSEKGWLVSQMYQFQGRWHTQALLQGLLQYQKHFEAKDSDII  67

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFAL  429
             L T PKSGT WLKAL F+LI R +F      HPL   NPH LIPFLE  Y      DF  
Sbjct  68    LVTNPKSGTTWLKALVFSLINRHKFPVSSGDHPLLVTNPHLLIPFLEGVYYESPNFDFTE  127

Query  430   TNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
                 RL+ TH+ +  LP+SV  S  K+VY CRNPKD  VS WHF  KL S+       P 
Sbjct  128   LPSPRLMNTHISLLSLPESVKSSSCKIVYCCRNPKDMFVSLWHFGKKLASQETA--DYPI  185

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
              +A +++C+G    GPFWDHV EYW  SLENP KVLF+ YEE+KK+    ++R+A FLGC
Sbjct  186   EKAVEAFCQGKFIGGPFWDHVLEYWYASLENPNKVLFVTYEELKKQTGDTIKRIAEFLGC  245

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHM  963
              F EEEE    V GI++LCSFESLS+LE N+    G L  GVE    FRKG+VG W + +
Sbjct  246   GFIEEEE----VGGIVKLCSFESLSSLEANR---EGKLPNGVETKAFFRKGEVGGWRDTL  298

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             +E +A  +D+ ++EKF G+GL
Sbjct  299   SESLAEEIDRTMEEKFQGSGL  319



>ref|XP_006385979.1| hypothetical protein POPTR_0003s19250g [Populus trichocarpa]
 gb|ERP63776.1| hypothetical protein POPTR_0003s19250g [Populus trichocarpa]
Length=329

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/314 (47%), Positives = 207/314 (66%), Gaps = 8/314 (3%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKS  270
             T+E  + L+SLPKE  W +  +Y Y+GFW     +   +   +HF  Q +D IL T PKS
Sbjct  16    TDEIADLLSSLPKEKSWRSGYVYRYQGFWCPEKQIPAVIAFQKHFIAQKTDTILVTMPKS  75

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRL  447
             GT WLKALAF+++ R ++       PL++ NPHDL+PF E   YA  + PD +     R+
Sbjct  76    GTTWLKALAFSIMNRAKYTPS--CSPLNSVNPHDLVPFFEFGLYANNQLPDLSTFPSPRM  133

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
              ATH+P   +  S+  S  ++VYLCRNP D  +S WHF++K R E  GL  +   EAFDS
Sbjct  134   FATHVPYPSISDSIKNSGCRIVYLCRNPFDNFISSWHFLSKTRPE--GLGPLLLEEAFDS  191

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             +C G    GPF+DHV  YW+ESLE P +VLFL YE+MK++    ++R+A FLGCPFS EE
Sbjct  192   FCNGHGGFGPFFDHVLGYWRESLERPEEVLFLTYEDMKEDINSQMKRLAEFLGCPFSLEE  251

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSVN-GDLGVENGVLFRKGKVGDWSNHMTEEMARR  984
             E  GVV GI +LCSF +L + E+NKT  + G+L  EN +LFR+G+VGDW+N++T EM  R
Sbjct  252   EADGVVEGISKLCSFSNLKDKEINKTGRSLGNL--ENKILFRRGEVGDWTNYLTPEMVDR  309

Query  985   LDQIVQEKFTGTGL  1026
             L++I+++K  G+GL
Sbjct  310   LNKIMEQKLAGSGL  323



>emb|CDY60367.1| BnaA09g54440D [Brassica napus]
Length=330

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/313 (48%), Positives = 204/313 (65%), Gaps = 6/313 (2%)
 Frame = +1

Query  97    EFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             EF+E L SLPKE GW T  LY ++GFW +   +Q  ++  +HF+P  +D++++T PKSGT
Sbjct  16    EFQEMLESLPKERGWRTRHLYLFQGFWCQSKEIQAIMSFQKHFKPLQNDVVIATIPKSGT  75

Query  277   VWLKALAFALITRKQF--LAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRL  447
              WLKAL + L+ R +F  +     HPL T+NPHDL+PFLE   YA  + PD       R 
Sbjct  76    TWLKALTYTLLNRHRFDPVFSTTDHPLLTSNPHDLVPFLEYKLYANGDVPDLFGLASPRT  135

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
              ATH+P   L  S+ +   KVVYLCRNP DT +S WH+ N ++SE   +  +   E FD 
Sbjct  136   FATHVPFGSLKDSIEKPGVKVVYLCRNPFDTFISSWHYTNSIKSE--SVNPVSLDEGFDM  193

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             YCRG+   GPFW+H+  YWKESL+ P KVLFL+YE++K++ E +L+++A+FL  PF+EEE
Sbjct  194   YCRGLIGFGPFWEHMLAYWKESLKRPDKVLFLRYEDLKQDIESNLKKLASFLAVPFTEEE  253

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRL  987
             E  G+V  I+ LCSFESL  LEVNK   +     EN  LFRKG+V DW N+++   A RL
Sbjct  254   ERKGIVKAIVELCSFESLKKLEVNKAGQSIK-NFENRHLFRKGEVSDWINYLSPPQAERL  312

Query  988   DQIVQEKFTGTGL  1026
               +V +K  GTGL
Sbjct  313   SALVDDKLGGTGL  325



>ref|XP_003599784.1| Flavonol sulfotransferase-like protein [Medicago truncatula]
Length=372

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 166/364 (46%), Positives = 215/364 (59%), Gaps = 49/364 (13%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             ++LQE+  T E +E + +LP E GW++  L+ Y+GFW     LQG L+  +HFQ  D+DI
Sbjct  12    KYLQEDDITLECKELIQTLPMEKGWVSTHLHQYQGFWQTKKHLQGVLSFQKHFQAHDTDI  71

Query  247   ILSTFPKSGT---------------------------------------VWLKALAFALI  309
             IL+T PK+GT                                        WLKAL FAL+
Sbjct  72    ILATSPKAGTKFVKIASRLIRAIISSLLAVNSNFRKIGNETHFARSFCTTWLKALIFALL  131

Query  310   TRKQF-LAEQETHPLHTNNPHDLIPFLELS-YAAKE-RPDFALTNGSRLLATHLPVSLLP  480
              RK++       HPL T NPH L+PFLELS Y  K+  PD    +  RL +TH+P   LP
Sbjct  132   NRKRYPNIHDNNHPLLTTNPHVLVPFLELSLYIEKDILPDINSFSAPRLFSTHVPYKSLP  191

Query  481   KSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCRGVCNTGPF  660
             KS+ +S  KVVYLCR+PKDT  S WHF NK+R + R  E +   E+F+ + RGV   GPF
Sbjct  192   KSIKDSTCKVVYLCRDPKDTFASMWHFTNKIRPQNR--ETLQLEESFEKFSRGVSLFGPF  249

Query  661   WDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeCGVVSGILR  840
             W+H+  YWKESLE   KV+FL+YEEMK +P  +L+ +A FLGCPFS+EEE  GVV  IL 
Sbjct  250   WEHLLGYWKESLERQEKVMFLRYEEMKMKPCFYLKEVAEFLGCPFSKEEESKGVVDDILN  309

Query  841   LCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHMTEEMARRLDQIVQEKFT  1014
             LCSFE LSNLEVNK    G L  G EN   FR GKVGDW   ++ EM  RL+ ++++   
Sbjct  310   LCSFEKLSNLEVNKF---GKLPSGEENKAFFRSGKVGDWKTLLSIEMIERLNTVIEQNLG  366

Query  1015  GTGL  1026
               G+
Sbjct  367   KHGM  370



>ref|XP_010425175.1| PREDICTED: cytosolic sulfotransferase 12-like [Camelina sativa]
Length=334

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/322 (48%), Positives = 202/322 (63%), Gaps = 6/322 (2%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             FL +   T+E R+ ++SLPKE GWL  ++Y ++G+W     LQG LT  + F+ +DSDII
Sbjct  12    FLGDELLTQETRDLISSLPKEKGWLGSEMYQFQGYWHTQALLQGLLTCQKRFEAKDSDII  71

Query  250   LSTFPKSGTVWLKALAFALITRKQF-LAEQETHPLHTNNPHDLIPFLELSYAAKERPDFA  426
             L T PKSGT WLKAL F+L+ R +F +     HPL   NPH L+PFLE  Y      DF 
Sbjct  72    LVTSPKSGTTWLKALVFSLVNRHKFPVPSSGNHPLLFTNPHLLLPFLEGVYYKTPEFDFT  131

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
                  RL+ TH+    LP+SV  S  K+VY CRNPKD  VSFWHF   L  E       P
Sbjct  132   GLPIPRLMNTHIAHRSLPESVKSSSCKIVYCCRNPKDMFVSFWHFGKTLAREETTDAEFP  191

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               +A +++C+G   +GP WDH+ EYW  S E+P KV F+ YEE+KK+P V L R+A FLG
Sbjct  192   IEKAVEAFCKGKSMSGPLWDHILEYWYASREDPNKVFFVTYEELKKQPGVVLGRIAEFLG  251

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNH  960
             C F++EE   G V  I+ LCSFESLSNLEVN+    G L  G E+   FRKG+ G W + 
Sbjct  252   CGFTDEEIVQGKVEEIVNLCSFESLSNLEVNR---QGKLPNGTESKAFFRKGETGGWRDT  308

Query  961   MTEEMARRLDQIVQEKFTGTGL  1026
             ++E +A  +D+ ++EKF G+GL
Sbjct  309   LSESLAAEIDRTIEEKFHGSGL  330



>gb|AFK43741.1| unknown [Lotus japonicus]
Length=345

 Score =   293 bits (749),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/329 (45%), Positives = 216/329 (66%), Gaps = 10/329 (3%)
 Frame = +1

Query  76    QENSYTEE--FREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             QE S  E+  F+E + SLP+E GW+TPD   ++GFW     +Q  +T  + FQ +DSDI+
Sbjct  20    QEASDQEDHDFKELILSLPRENGWITPDFTFFQGFWCVSTLIQPIITFQKQFQAKDSDIL  79

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKER---PD  420
             ++T PKSGT WLKAL FA+  R++F   ++ HPL  +N H+L+PFLE+++  +     P 
Sbjct  80    VATLPKSGTTWLKALTFAITNRQRFSPLEDHHPLLKSNSHELVPFLEINFYGQTLDGIPQ  139

Query  421   FALTNGS--RLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGL  594
             F ++  +  R+  TH+P + L KS+ +SK K++Y+CRNP DT VS W F+NK++ E   L
Sbjct  140   FDMSKMTEPRIFGTHIPFNSLAKSIKDSKCKIIYICRNPFDTFVSQWIFLNKIKPE--EL  197

Query  595   EAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMA  774
                   EAF+ YC+GV   GP WDH+  Y KES+  P KVLFLKYE++K++   H++R+ 
Sbjct  198   PEFTLEEAFERYCKGVTEYGPTWDHMLGYLKESVARPNKVLFLKYEDLKEDVNFHVKRIF  257

Query  775   AFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWS  954
              FLG PF++EEE   VV  I++LCSFE + +LEVNK+   G L  E    FRK ++GDW 
Sbjct  258   EFLGVPFTQEEESGEVVENIIKLCSFEKMKDLEVNKSGTLG-LNFEKKYFFRKAEIGDWV  316

Query  955   NHMTEEMARRLDQIVQEKFTGTGLML*SD  1041
             N+++  M  +L +I++EK +G+GL   SD
Sbjct  317   NYLSPSMVEKLSKIMEEKLSGSGLSFRSD  345



>emb|CDY14059.1| BnaC02g01760D [Brassica napus]
Length=368

 Score =   293 bits (751),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/313 (48%), Positives = 204/313 (65%), Gaps = 6/313 (2%)
 Frame = +1

Query  97    EFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             EF+E L SLPKE GW T  LY ++GFW +   +Q  ++  +HF+P  +D++++T PKSGT
Sbjct  54    EFQEMLESLPKERGWRTRHLYLFQGFWCQSKEIQAIMSFQKHFKPLQNDVVIATIPKSGT  113

Query  277   VWLKALAFALITRKQF--LAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRL  447
              WLKAL + L+ R +F  +     HPL T+NPHDL+PFLE   YA  + PD       R 
Sbjct  114   TWLKALTYTLLNRHRFDPVFSTTDHPLLTSNPHDLVPFLEYKLYANGDVPDLFGLASPRT  173

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
              ATH+P   L  S+ +   KVVYLCRNP DT +S WH+ N ++SE   +  +   E FD 
Sbjct  174   FATHVPFGSLKDSIEKPGVKVVYLCRNPFDTFISSWHYTNSIKSE--SVNPVSLDEGFDM  231

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             YCRG+   GPFW+H+  YWKESL+ P KVLFL+YE++K++ E +L+++A+FL  PF+EEE
Sbjct  232   YCRGLIGFGPFWEHMLAYWKESLKRPDKVLFLRYEDLKQDIESNLKKLASFLAVPFTEEE  291

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRL  987
             E  G+V  I+ LCSFESL  LEVNK   +     EN  LFRKG+V DW N+++   A RL
Sbjct  292   ERKGIVKAIVELCSFESLKKLEVNKAGQSIK-NFENRHLFRKGEVSDWINYLSPPQAERL  350

Query  988   DQIVQEKFTGTGL  1026
               +V +K  GTGL
Sbjct  351   SALVDDKLGGTGL  363



>emb|CDY58879.1| BnaA03g55570D [Brassica napus]
Length=359

 Score =   293 bits (750),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 154/311 (50%), Positives = 202/311 (65%), Gaps = 5/311 (2%)
 Frame = +1

Query  97    EFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             EF E L+SLPKE GW T  LY ++GFW +   +   ++  +HF+    D+IL+T PKSGT
Sbjct  48    EFLEMLDSLPKERGWRTRHLYLFQGFWCQAKEIHAIMSFQKHFKTLPKDVILATIPKSGT  107

Query  277   VWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRLLA  453
              WLKAL F L+ R +F    + HPL T+NPHDL+PFLE   YA  E PD +     R  A
Sbjct  108   TWLKALTFTLLNRHRFDPVSD-HPLLTSNPHDLVPFLEYKLYANGEVPDLSGLASPRTFA  166

Query  454   THLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYC  633
             TH+P   L  S+ E   KVVYLCRNP DT +S WHF N ++SE   +  +   E FD YC
Sbjct  167   THVPFGSLKGSIEEPGAKVVYLCRNPFDTFISSWHFSNSIKSE--SVSPVSLEEGFDLYC  224

Query  634   RGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeee  813
             RGV   GPFW+H+  YW+ESLE P KVLFLKYE++K++ E +L+++A+FLG  F+EEEE 
Sbjct  225   RGVIGFGPFWEHMLGYWRESLERPEKVLFLKYEDLKEDIETNLKKLASFLGVSFTEEEEV  284

Query  814   CGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRLDQ  993
              GVV  +  LCSFESL  LEVNK++ +     EN  LFRKG+V DW N+++     RL  
Sbjct  285   KGVVKAVADLCSFESLKKLEVNKSNKSIK-NFENRYLFRKGEVSDWRNYLSPVQVERLSA  343

Query  994   IVQEKFTGTGL  1026
             +V +K  G+GL
Sbjct  344   LVDDKLGGSGL  354



>ref|XP_009122389.1| PREDICTED: cytosolic sulfotransferase 15-like [Brassica rapa]
 emb|CDY70313.1| BnaAnng33290D [Brassica napus]
Length=363

 Score =   293 bits (751),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 152/320 (48%), Positives = 210/320 (66%), Gaps = 6/320 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             +E   + EF+E L SLPKE GW T  LY ++GFW +   +Q  L+  +HF+   +D++L+
Sbjct  42    EEEVLSYEFQEMLESLPKERGWRTRYLYLFQGFWCQSKEIQAILSFQKHFKSLQNDVVLA  101

Query  256   TFPKSGTVWLKALAFALITRKQF--LAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA  426
             T PKSGT WLKAL + ++ R +F  ++    HPL T+NPHDL+PF E   YA  + PD +
Sbjct  102   TIPKSGTTWLKALTYTVLNRDRFDPVSSTTDHPLLTSNPHDLVPFFEYKLYANGDVPDLS  161

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
                  R  ATH+P   L  S+ E   KVVYLCRNP DT +S WH++N ++SE   +  + 
Sbjct  162   GLASPRTFATHVPFGSLKDSIEEPGVKVVYLCRNPFDTFISSWHYINNIKSE--AVSPVS  219

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               E FD YCRGV   GPFW+H+  YWKESL  P KVLFL+YE++K++ E +L+++A+FLG
Sbjct  220   LEEGFDLYCRGVIGFGPFWEHMLGYWKESLRTPEKVLFLRYEDLKQDMESNLKKLASFLG  279

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMT  966
              PF+EEEE+ GVV  I  LCSFE+L  LEVNK+S +     EN  LFRKG+V DW N+++
Sbjct  280   VPFTEEEEQKGVVHSISDLCSFENLKKLEVNKSSKSIK-NFENRHLFRKGEVSDWINYLS  338

Query  967   EEMARRLDQIVQEKFTGTGL  1026
                A RL  ++ +K  G+GL
Sbjct  339   PPQAERLSALMDDKLGGSGL  358



>ref|XP_006291483.1| hypothetical protein CARUB_v10017618mg [Capsella rubella]
 gb|EOA24381.1| hypothetical protein CARUB_v10017618mg [Capsella rubella]
Length=330

 Score =   292 bits (747),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 141/324 (44%), Positives = 213/324 (66%), Gaps = 6/324 (2%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             +++++  ++E +  ++SLP    ++  D++NYKG W  P  LQ  L + +HF+P+D+DII
Sbjct  9     YMKDDHVSQETKNLISSLPSGKDFVGVDIHNYKGCWYYPNLLQAVLDVQKHFKPRDTDII  68

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA  426
             +++ PK GT WLK+L FA++ R ++    + HPL + NPHDL+PFLE+  YA  + PD A
Sbjct  69    MASLPKGGTTWLKSLVFAVVHRDEYRENPQIHPLLSQNPHDLVPFLEVELYADSKAPDLA  128

Query  427   LTNGSRLLATHLPVSLLPKSVWESK--GKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEA  600
                   + +TH+ +  L ++  ++    K+VY+CR  KDT VS WH+ NKL      L+ 
Sbjct  129   KFPSPMIFSTHIHLQALREATKKASRPCKIVYVCRGIKDTFVSGWHYRNKLHRT--KLDQ  186

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAF  780
               F   FD YC+G    GP+W+HV  YWK SLE+   VLF++YEEM +EP V ++R+A F
Sbjct  187   STFELMFDGYCKGYVVYGPYWEHVLSYWKGSLEDKENVLFMRYEEMLEEPRVQVKRLAEF  246

Query  781   LGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNH  960
             L CPF++EEE+ G V  IL+LCS  +LSNLEVN+      +GV++ + FRKG+VGDW NH
Sbjct  247   LNCPFTKEEEQSGSVDEILKLCSLRNLSNLEVNQNGTT-RIGVDSQLFFRKGEVGDWKNH  305

Query  961   MTEEMARRLDQIVQEKFTGTGLML  1032
             +T  MA+ +D+IV+ K  G+GL+ 
Sbjct  306   LTPHMAKTVDEIVECKLRGSGLIF  329



>ref|XP_010939140.1| PREDICTED: flavonol 3-sulfotransferase-like [Elaeis guineensis]
Length=354

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 147/313 (47%), Positives = 204/313 (65%), Gaps = 9/313 (3%)
 Frame = +1

Query  100   FREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGTV  279
             ++E +++LP   GW    L  Y+ FW   + L G + + QHF+   SD+ L ++PKSGT 
Sbjct  34    YKELISTLPSHKGWHPTLLLKYQDFWFPEYILPGIINLQQHFKACPSDLFLMSYPKSGTT  93

Query  280   WLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGSRLLATH  459
             WLKALAFA I R ++  +   HPL ++NPHD IP +++ +A++           R+L +H
Sbjct  94    WLKALAFATINRNRY--QLANHPLLSHNPHDCIPVIDVDFASR----IEGMPSPRILQSH  147

Query  460   LPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCRG  639
              P SLLP S+  S  +++Y+CR+ KD +VS W F N+LR     +E + F +AF+ +C G
Sbjct  148   CPFSLLPDSIKGSDCRIIYVCRDAKDVMVSDWFFTNRLRRS-NEVELVQFGKAFELFCEG  206

Query  640   VCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeCG  819
             +C  GP WDHV EYW+ESL  P +VLFLKYEEM  +P  +L+++A F+GCPFS +EE+ G
Sbjct  207   ICYYGPIWDHVLEYWEESLRRPERVLFLKYEEMLADPAGNLKKLAEFMGCPFSPDEEKDG  266

Query  820   VVSGILRLCSFESLSNLEVNKTS--VNGDLGVENGVLFRKGKVGDWSNHMTEEMARRLDQ  993
             VV  I+RLCS E L NLEVNK S  +   +  + G  FRKG+VGDW NHM  EMA RLD 
Sbjct  267   VVGEIVRLCSLEKLKNLEVNKRSEFIMPHIKFDYGSYFRKGEVGDWRNHMNLEMALRLDG  326

Query  994   IVQEKFTGTGLML  1032
             I++EK  GTGL L
Sbjct  327   IIREKIGGTGLTL  339



>ref|NP_568177.1| sulfotransferase 2A [Arabidopsis thaliana]
 sp|Q8L5A7.1|SOT15_ARATH RecName: Full=Cytosolic sulfotransferase 15; Short=AtSOT15; AltName: 
Full=Sulfotransferase 2a; Short=AtST2a [Arabidopsis 
thaliana]
 gb|AAM20660.1| steroid sulfotransferase-like protein [Arabidopsis thaliana]
 gb|AAM61557.1| steroid sulfotransferase-like protein [Arabidopsis thaliana]
 gb|AAP68286.1| At5g07010 [Arabidopsis thaliana]
 gb|AED91098.1| sulfotransferase 2A [Arabidopsis thaliana]
Length=359

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 149/313 (48%), Positives = 205/313 (65%), Gaps = 6/313 (2%)
 Frame = +1

Query  97    EFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             EF+E L+SLPKE GW T  LY ++GFW +   +Q  ++  +HFQ  ++D++L+T PKSGT
Sbjct  45    EFQEMLDSLPKERGWRTRYLYLFQGFWCQAKEIQAIMSFQKHFQSLENDVVLATIPKSGT  104

Query  277   VWLKALAFALITRKQF--LAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRL  447
              WLKAL F ++ R +F  +A    HPL T+NPHDL+PF E   YA  + PD +     R 
Sbjct  105   TWLKALTFTILNRHRFDPVASSTNHPLFTSNPHDLVPFFEYKLYANGDVPDLSGLASPRT  164

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
              ATHLP   L +++ +   KVVYLCRNP DT +S WH+ N ++SE   +  +   +AFD 
Sbjct  165   FATHLPFGSLKETIEKPGVKVVYLCRNPFDTFISSWHYTNNIKSE--SVSPVLLDQAFDL  222

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             YCRGV   GPFW+H+  YW+ESL+ P KV FL+YE++K + E +L+R+A FL  PF+EEE
Sbjct  223   YCRGVIGFGPFWEHMLGYWRESLKRPEKVFFLRYEDLKDDIETNLKRLATFLELPFTEEE  282

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRL  987
             E  GVV  I  LCSFE+L  LEVNK++ +     EN  LFRKG+V DW N+++     RL
Sbjct  283   ERKGVVKAIAELCSFENLKKLEVNKSNKSIK-NFENRFLFRKGEVSDWVNYLSPSQVERL  341

Query  988   DQIVQEKFTGTGL  1026
               +V +K  G+GL
Sbjct  342   SALVDDKLGGSGL  354



>dbj|BAB11159.1| steroid sulfotransferase-like protein [Arabidopsis thaliana]
Length=354

 Score =   293 bits (749),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 149/313 (48%), Positives = 205/313 (65%), Gaps = 6/313 (2%)
 Frame = +1

Query  97    EFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             EF+E L+SLPKE GW T  LY ++GFW +   +Q  ++  +HFQ  ++D++L+T PKSGT
Sbjct  40    EFQEMLDSLPKERGWRTRYLYLFQGFWCQAKEIQAIMSFQKHFQSLENDVVLATIPKSGT  99

Query  277   VWLKALAFALITRKQF--LAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRL  447
              WLKAL F ++ R +F  +A    HPL T+NPHDL+PF E   YA  + PD +     R 
Sbjct  100   TWLKALTFTILNRHRFDPVASSTNHPLFTSNPHDLVPFFEYKLYANGDVPDLSGLASPRT  159

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
              ATHLP   L +++ +   KVVYLCRNP DT +S WH+ N ++SE   +  +   +AFD 
Sbjct  160   FATHLPFGSLKETIEKPGVKVVYLCRNPFDTFISSWHYTNNIKSE--SVSPVLLDQAFDL  217

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             YCRGV   GPFW+H+  YW+ESL+ P KV FL+YE++K + E +L+R+A FL  PF+EEE
Sbjct  218   YCRGVIGFGPFWEHMLGYWRESLKRPEKVFFLRYEDLKDDIETNLKRLATFLELPFTEEE  277

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRL  987
             E  GVV  I  LCSFE+L  LEVNK++ +     EN  LFRKG+V DW N+++     RL
Sbjct  278   ERKGVVKAIAELCSFENLKKLEVNKSNKSIK-NFENRFLFRKGEVSDWVNYLSPSQVERL  336

Query  988   DQIVQEKFTGTGL  1026
               +V +K  G+GL
Sbjct  337   SALVDDKLGGSGL  349



>ref|XP_011020446.1| PREDICTED: cytosolic sulfotransferase 15-like [Populus euphratica]
Length=330

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 150/324 (46%), Positives = 208/324 (64%), Gaps = 9/324 (3%)
 Frame = +1

Query  67    QFLQEN---SYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQD  237
             Q + EN   + T+   + L+SLPKE  W +  +Y Y+GFW     +   +   +HF+ Q 
Sbjct  6     QMITENNNLAETDVIADLLSSLPKEKSWQSGYVYRYQGFWCPEKQIPALIAFQKHFRAQK  65

Query  238   SDIILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKER  414
             +D IL T PKSGT WLKALAF+++ R ++       PL++ NPHDL+PF E   YA  + 
Sbjct  66    TDTILVTMPKSGTTWLKALAFSIMNRAKYTPS--CSPLNSVNPHDLVPFFEFGLYANNQI  123

Query  415   PDFALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGL  594
             PD +     R+ ATH+P   +  S+  S  ++VYLCRNP D  +S WHF++K R E  GL
Sbjct  124   PDLSTFQSPRMFATHVPYPSISDSIKNSGCRIVYLCRNPFDNFISSWHFLSKTRPE--GL  181

Query  595   EAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMA  774
               +   EAFDS+C G    GPF+DHV  YW+ESLE P +VLFL YEEMK++    ++R+A
Sbjct  182   GPLLLEEAFDSFCNGHGGFGPFFDHVLGYWRESLERPEEVLFLTYEEMKEDINYQMKRLA  241

Query  775   AFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWS  954
              FLGCPFS EEE  G+V GI +LCSF +L + E+NKT     L  EN  LFR+G+VGDW+
Sbjct  242   EFLGCPFSLEEEADGIVEGISKLCSFSNLKDKEINKTG-KSLLYFENKTLFRRGEVGDWT  300

Query  955   NHMTEEMARRLDQIVQEKFTGTGL  1026
             N++T EM  RL++I+++K  G+GL
Sbjct  301   NYLTPEMVDRLNKIMEQKLAGSGL  324



>gb|KFK25092.1| hypothetical protein AALP_AA8G065200 [Arabis alpina]
Length=353

 Score =   292 bits (748),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 152/317 (48%), Positives = 204/317 (64%), Gaps = 6/317 (2%)
 Frame = +1

Query  85    SYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFP  264
             S  +E +E L SLP E GW T  LY Y+GFW +   +Q  ++  +HFQP  +D++L+T P
Sbjct  35    SKRQEEQEMLESLPTERGWRTRYLYLYQGFWCQSKEIQAIMSFQKHFQPLQNDVVLATIP  94

Query  265   KSGTVWLKALAFALITRKQF--LAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTN  435
             KSGT WLKAL F ++ R  F  ++    HPL T+NPHDL+PF E   YA  E PD +   
Sbjct  95    KSGTTWLKALTFTILNRHLFDPVSSSTDHPLFTSNPHDLVPFFEYKLYANGEVPDLSGLA  154

Query  436   GSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPE  615
               R  ATH+P   L  S+ +   KVVYLCRNP DT +S WH++N ++SE   +  +   E
Sbjct  155   SPRTFATHIPFGSLKDSIEKPGVKVVYLCRNPFDTFISSWHYINNIKSE--SVSPVTLEE  212

Query  616   AFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPF  795
              FD YCRGV   GPFW+H+  YW+ SL+ P KVLFLKYE++K + E  L+++A+FLG PF
Sbjct  213   GFDLYCRGVIGFGPFWEHMLGYWRASLKRPEKVLFLKYEDLKHDIESTLKKLASFLGHPF  272

Query  796   SeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEM  975
             ++EEE  GVV  I  LCSFE+L  LEVNK+S +     EN  LFRKG+V DW N+++   
Sbjct  273   TKEEEGKGVVKAIKDLCSFENLKKLEVNKSSKSIK-NFENRHLFRKGEVSDWVNYLSTSQ  331

Query  976   ARRLDQIVQEKFTGTGL  1026
               RL  +V +KF G+GL
Sbjct  332   VERLSHLVDDKFGGSGL  348



>gb|ADX97329.1| sulfotransferase-like protein [Mangifera indica]
Length=341

 Score =   292 bits (747),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 149/321 (46%), Positives = 206/321 (64%), Gaps = 7/321 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             +E   T+E +  L SLPK+ GW TP LY ++GFW +   +Q  ++  +HF  ++SD+IL+
Sbjct  18    EEKFLTQECKNLLLSLPKQKGWRTPYLYEFQGFWCQSKKIQAIISFQKHFISRESDVILA  77

Query  256   TFPKSGTVWLKALAFALITRKQF-LAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFAL  429
             T PKSGT WLK L F+++ RK   +   + HPL  +NPHDL+PF E   Y+  + PD + 
Sbjct  78    TIPKSGTTWLKGLVFSIMNRKHIDVKNLKNHPLLHSNPHDLVPFFEYKLYSDNQIPDLSR  137

Query  430   TNGSRLLATHLPVSLLPK--SVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
                 RL ATH+P + L +  S+  +  K+VYLCRNP DT VS WHF+N LR   + L   
Sbjct  138   LPDPRLFATHIPFNSLMQQNSIKNASPKIVYLCRNPLDTFVSSWHFVNNLRP--KSLPPF  195

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                EAF  YC G+   GPFW+H+  YW ESL+NP  VLFLKYE M+++   +L+ +A FL
Sbjct  196   QIEEAFKMYCDGIIGFGPFWEHMLGYWNESLKNPTAVLFLKYEAMREDIVSNLKELAKFL  255

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHM  963
             GCPFS EEE+ GV+  I +LC F+ + NLE NKT  +     EN  LFRKG+VGDW N++
Sbjct  256   GCPFSVEEEQEGVIKEIAKLCCFDKMKNLEANKTGKSIK-NFENKYLFRKGEVGDWVNYL  314

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             +  M  +L QI++EK  G+GL
Sbjct  315   SPSMVEQLSQIMEEKLAGSGL  335



>ref|XP_008777577.1| PREDICTED: cytosolic sulfotransferase 12-like [Phoenix dactylifera]
Length=355

 Score =   292 bits (748),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 142/312 (46%), Positives = 209/312 (67%), Gaps = 5/312 (2%)
 Frame = +1

Query  100   FREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGTV  279
             F + +++LP E GW    +  Y+GFW+    LQG + + Q+F+ +  D+ + ++PKSGT 
Sbjct  30    FTDLISTLPLEEGWAPLRIRKYQGFWIPERVLQGIMDMQQNFKARPDDLFVLSYPKSGTT  89

Query  280   WLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGSRLLATH  459
             WLKAL +A++TR Q+  +   HPL   NPH+ +P + ++YA  E  +    +  R+L TH
Sbjct  90    WLKALTYAIMTRTQYPLDH--HPLLRQNPHEFVPIMGITYAKGEASELEAMSSPRILNTH  147

Query  460   LPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCRG  639
             LP SLLP ++     K++Y+CR+PKD +VS +H+ N++R +   +E +PF +AF+ +C G
Sbjct  148   LPYSLLPHAIKSLGCKLIYVCRDPKDVLVSRFHYNNRMRPQ--AMEPIPFTKAFEMFCEG  205

Query  640   VCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeCG  819
              C  GP W+HV EYW+ES   P KVLFLKYEEM  +P   ++R+A F+GCPFS EEE+ G
Sbjct  206   NCPYGPIWEHVLEYWEESQRRPEKVLFLKYEEMLGDPPRIVKRLAEFMGCPFSPEEEKEG  265

Query  820   VVSGILRLCSFESLSNLEVNKTS-VNGDLGVENGVLFRKGKVGDWSNHMTEEMARRLDQI  996
             VV  I++LCSF+ + +LEVNKT  +  D  + N   FRKG  GDW NHM+ EMAR+LD+I
Sbjct  266   VVEEIIKLCSFDKMKSLEVNKTGKLRPDFVLTNDSFFRKGGAGDWRNHMSPEMARKLDRI  325

Query  997   VQEKFTGTGLML  1032
              ++KF G+GL L
Sbjct  326   TEQKFEGSGLTL  337



>ref|XP_007218724.1| hypothetical protein PRUPE_ppa009048mg [Prunus persica]
 gb|EMJ19923.1| hypothetical protein PRUPE_ppa009048mg [Prunus persica]
Length=308

 Score =   290 bits (743),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 146/318 (46%), Positives = 202/318 (64%), Gaps = 23/318 (7%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             ++   T+E  E   SLPKE GW T  LY ++GFW +   +Q  ++  +HFQ  D+DI+++
Sbjct  7     EQQKLTDECTELPLSLPKEKGWRTLHLYQFQGFWCQSAEIQSIMSFQKHFQANDTDIVVA  66

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTN  435
             + PKSGT WLK LAFA+  R +F+   ++HPL  +NPHDL+PFLE               
Sbjct  67    SIPKSGTTWLKTLAFAVSNRHRFVPNSKSHPLLNSNPHDLVPFLE---------------  111

Query  436   GSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPE  615
                L  TH+P + L  S+  S  K+VY+CRNP DT VS WHF+NK++ E     +M   E
Sbjct  112   ---LFGTHIPFASLGNSIQNSDAKIVYICRNPLDTFVSSWHFLNKVKPESGSPISM--EE  166

Query  616   AFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPF  795
             AFD YC+G+   GPFWDH+  YWKESL  P  VLFLKYE+MK++    L++MA FLG PF
Sbjct  167   AFDMYCKGIVGFGPFWDHMLGYWKESLLRPNNVLFLKYEDMKEDDAFQLKKMAKFLGFPF  226

Query  796   SeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLG-VENGVLFRKGKVGDWSNHMTEE  972
             + EEE  GVV  I +LC FE++  LEVNK  +   +G  EN  LFRK +VGDW N+++ +
Sbjct  227   TLEEERGGVVENIAKLCCFENMKKLEVNK--IGSSIGNFENKNLFRKAEVGDWVNYLSPK  284

Query  973   MARRLDQIVQEKFTGTGL  1026
             M  RL ++++E+  G+GL
Sbjct  285   MVERLSKVIEERLGGSGL  302



>gb|KDP44527.1| hypothetical protein JCGZ_16360 [Jatropha curcas]
Length=323

 Score =   291 bits (745),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 208/315 (66%), Gaps = 13/315 (4%)
 Frame = +1

Query  97    EFREFLNSLPKETGWLTP-DLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSG  273
             E ++ +++LPKE  W  P +L+ Y+ FW  P FL+G +   + F PQ +DIIL T PKSG
Sbjct  15    ECQKIISNLPKEISWKLPLNLHKYQEFWCYPNFLEGVMLAQKCFTPQPTDIILCTLPKSG  74

Query  274   TVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGSRLLA  453
             T WLKAL FA+  R Q+    + +PL    PHD++P LE  Y    + D    + + LL+
Sbjct  75    TTWLKALCFAIFARSQYSDGSKINPLLKKMPHDIVPVLEFLYCMGRQRD----SRTPLLS  130

Query  454   THLPVSLLPKSVWE-SKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSY  630
             TH+P + LPKS+ + S  KV+Y+CR+PKD  +S WHF+ +       ++A+P  EAFD +
Sbjct  131   THVPYASLPKSIIKCSTCKVIYMCRDPKDVFISQWHFVCRQLD----IDAIPLQEAFDKF  186

Query  631   CRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeee  810
             C G+   GP+WD++  YWK SLE+P K+LFLKYE+++ +   +++R+A F+G PF+ EEE
Sbjct  187   CIGLSAYGPYWDNILGYWKASLEHPEKILFLKYEDLQHDTLFYVKRIAEFMGYPFTAEEE  246

Query  811   eCGVVSGILRLCSFESLSNLEVNKTSVNGDL---GVENGVLFRKGKVGDWSNHMTEEMAR  981
               G+V  I+ LCSFESLSNLEVNK+   G       EN   FRKGKVGDW N++T EM +
Sbjct  247   RQGIVQNIVNLCSFESLSNLEVNKSDKIGTAFPSKFENNAFFRKGKVGDWKNYLTPEMVK  306

Query  982   RLDQIVQEKFTGTGL  1026
             RLDQI ++KF G+G+
Sbjct  307   RLDQITKDKFNGSGI  321



>ref|XP_006465789.1| PREDICTED: cytosolic sulfotransferase 15-like [Citrus sinensis]
Length=346

 Score =   291 bits (746),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 151/326 (46%), Positives = 216/326 (66%), Gaps = 15/326 (5%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             +E   + E +E L SLPKE GW T  LY ++G+W +   +Q  +   +HF+ +D+DIIL+
Sbjct  21    EEKHLSSECKEVLLSLPKERGWRTAFLYQFQGYWCQAREIQAIMAFQKHFKAKDTDIILA  80

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQE----THPLHTNNPHDLIPFLELS-YAAKERPD  420
             + PKSGT W+KAL+FA+I RK F    +     HPL T+NPHDL+PFLE   YA  + P+
Sbjct  81    SIPKSGTTWMKALSFAIINRKNFPIISDHHGHPHPLLTSNPHDLVPFLEYKLYANNQIPE  140

Query  421   FA-LTNGSRLLATHLP---VSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELR  588
              + + +  R+ ATH+P   ++LLP     +  K+VY+CRNP DT +S WHF+NKLRS+  
Sbjct  141   LSQIADEPRVFATHIPFASLNLLPSM---NNIKIVYICRNPFDTFISSWHFLNKLRSQ--  195

Query  589   GLEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRR  768
             GL  +   EAF  YC GV   GPFW+H+  YW ESL+ P  VLFLKY++MK++   +L++
Sbjct  196   GLPEISLEEAFKMYCDGVIGFGPFWEHMLGYWNESLKRPNNVLFLKYDDMKQDIVSNLKK  255

Query  769   MAAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGD  948
             +A+FLG PFS EEE+ GV+  I +LCSFE +  L+VNK   +    +EN  LFRKG+VGD
Sbjct  256   LASFLGFPFSPEEEKQGVIQDIAKLCSFEEMKKLDVNKNGKSIK-DIENKYLFRKGEVGD  314

Query  949   WSNHMTEEMARRLDQIVQEKFTGTGL  1026
             W N+++  M ++L  I++EK   +GL
Sbjct  315   WVNYLSPSMVKQLSLIMEEKLDASGL  340



>gb|AAC63111.1| steroid sulfotransferase 1 [Brassica napus]
Length=323

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/321 (47%), Positives = 204/321 (64%), Gaps = 12/321 (4%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             +L++ + T+E R+ L+SLP E GWL   +Y ++G W     +QG +   +HF+  DSD+I
Sbjct  9     YLKDENLTQETRDLLSSLPSEKGWLVSQMYQFEGIWQTQALVQGIVNCQKHFEANDSDVI  68

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFAL  429
             L+T  KSGT WLKAL FALI R +F    + HPL   NPH L+P+LE  Y +    +FA 
Sbjct  69    LATLAKSGTTWLKALLFALIHRHKFPVSGK-HPLLVTNPHSLVPYLEGDYCSSPEVNFAE  127

Query  430   TNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
                 RL+ THL    LP S+  S  K++Y CRNPKD  VS WHF  KL  E       P 
Sbjct  128   LPSPRLMQTHLTHHSLPVSIKSSSCKIIYCCRNPKDMFVSIWHFGRKLAPEKTA--EYPI  185

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
               A  ++C+G    GPFWDHV EYW ESL+NP KVLF+ YEE+KK+ EV ++R+A F+GC
Sbjct  186   ETAVAAFCKGKFIGGPFWDHVLEYWYESLKNPNKVLFVTYEELKKQTEVEVKRIAEFIGC  245

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHM  963
              F+ EEE    VS I++LCSFESLS+LEVN+    G L  G+E+   FRKG+ G W + +
Sbjct  246   GFTAEEE----VSEIVKLCSFESLSSLEVNR---QGKLPNGIESNAFFRKGETGGWRDTL  298

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             +E +A  +D+  ++KF G+GL
Sbjct  299   SESLADVIDRTTEQKFGGSGL  319



>gb|KDO44381.1| hypothetical protein CISIN_1g019118mg [Citrus sinensis]
Length=346

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/326 (46%), Positives = 216/326 (66%), Gaps = 15/326 (5%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             +E   + E +E L SLPKE GW T  LY ++G+W +   +Q  +   +HF+ +D+DIIL+
Sbjct  21    EEKHLSSECKEVLLSLPKERGWRTAFLYKFQGYWCQAKEIQAIMAFQKHFKAKDTDIILA  80

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQE----THPLHTNNPHDLIPFLELS-YAAKERPD  420
             + PKSGT W+KAL+FA+I RK F    +     HPL T+NPHDL+PFLE   YA  + P+
Sbjct  81    SIPKSGTTWMKALSFAIINRKNFPIISDHHGHPHPLLTSNPHDLVPFLEYKLYANNQIPE  140

Query  421   FA-LTNGSRLLATHLP---VSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELR  588
              + + +  R+ ATH+P   ++LLP     +  K+VY+CRNP DT +S WHF+NKLRS+  
Sbjct  141   LSQIADEPRVFATHIPFASLNLLPSM---NNIKIVYICRNPFDTFISSWHFLNKLRSQ--  195

Query  589   GLEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRR  768
             GL  +   EAF  YC GV   GPFW+H+  YW ESL+ P  VLFLKY++MK++   +L++
Sbjct  196   GLPEISLEEAFKMYCDGVIGFGPFWEHMLGYWNESLKRPNNVLFLKYDDMKQDIVSNLKK  255

Query  769   MAAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGD  948
             +A+FLG PFS EEE+ GV+  I +LCSFE +  L+VNK   +    +EN  LFRKG+VGD
Sbjct  256   LASFLGFPFSPEEEKQGVIQDIAKLCSFEEMKKLDVNKNGKSIK-DIENKYLFRKGEVGD  314

Query  949   WSNHMTEEMARRLDQIVQEKFTGTGL  1026
             W N+++  M ++L  I++EK   +GL
Sbjct  315   WVNYLSPSMVKQLSLIMEEKLDASGL  340



>ref|XP_009142142.1| PREDICTED: cytosolic sulfotransferase 3 [Brassica rapa]
Length=329

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/326 (46%), Positives = 219/326 (67%), Gaps = 16/326 (5%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             L+E   T+E +  ++SLP E  +L  +L  Y+G W    FLQG L + + FQPQD+D+I+
Sbjct  10    LREEDLTDETKTLISSLPSEKEYLGGNLCKYQGSWYYYNFLQGVLNVQRGFQPQDTDVIV  69

Query  253   STFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA-  426
             ++FPK GT+WLKAL  AL+ R +  + ++ HPL +NNPH+L+P LE++ Y    +PD   
Sbjct  70    ASFPKCGTLWLKALTVALLERSKNRSSEDQHPLLSNNPHNLVPVLEMNLYRDTPKPDLTK  129

Query  427   -LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKL--RSELRG-L  594
              L++  RL +TH+P   L +++ +S  KVVY+CR+ KD++VS WH + +   + E R  L
Sbjct  130   LLSSSPRLFSTHMPYHTLQEALKDSPCKVVYICRDAKDSLVSRWHIICRCLNKEEDRSIL  189

Query  595   EAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMA  774
             E+M     F+S+C GVC  GP+WDH+  YWK SLENP +V+F++Y+E+K +P   ++++A
Sbjct  190   ESM-----FESFCSGVCLFGPYWDHILSYWKASLENPKRVMFMRYDEVKTDPHGQVKKLA  244

Query  775   AFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKT--SVNGDLGVENGVLFRKGKVGD  948
              FLGCPFSEEE   G V  IL +CS  SLS+LEVNKT  S+N   G++    FRKG VGD
Sbjct  245   EFLGCPFSEEEVNNGAVDEILEMCSLPSLSSLEVNKTGKSIN---GIDYKNHFRKGIVGD  301

Query  949   WSNHMTEEMARRLDQIVQEKFTGTGL  1026
             W N++T EM  ++D I++EK   +GL
Sbjct  302   WKNYLTPEMGNKIDIIMEEKLKDSGL  327



>ref|XP_008243884.1| PREDICTED: LOW QUALITY PROTEIN: cytosolic sulfotransferase 12 
[Prunus mume]
Length=309

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 162/323 (50%), Positives = 206/323 (64%), Gaps = 30/323 (9%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             Q+L E  +++E R+F++SLP E GW+  +L  Y+GFW     +QG L   +HFQ  D+DI
Sbjct  12    QYLXEYEFSQENRDFISSLPTEKGWVANNLRQYQGFWHATRHMQGXLACQKHFQALDTDI  71

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             +L + PKSGT WL+A+ FAL+ R  +   Q+ HPL TNNPH L+PFLEL  Y  K+ PD 
Sbjct  72    LLVSTPKSGTTWLRAVLFALVKRVHYPDPQQ-HPLLTNNPHVLVPFLELDVYIEKQVPDL  130

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
                   RL  T++    LP SV  S  KVV LCR+PKDT VS WHF NKLR++ RG    
Sbjct  131   TGVEPPRLFLTYVS---LPDSVKNSARKVVDLCRDPKDTFVSLWHFANKLRAKSRG----  183

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                    +  +G         +V  YWKESLE P KV+  K+EEMK+EP VHLRR+A FL
Sbjct  184   -------TRTKG---------NVLGYWKESLERPEKVMCFKFEEMKEEPTVHLRRLAEFL  227

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
             GCPFS  EE  GV   ILRLCSF++LSNL+VNK+   G L  G EN   FRKG+VGD  N
Sbjct  228   GCPFSPVEETQGVADDILRLCSFDNLSNLDVNKS---GKLSSGEENSTFFRKGEVGDRMN  284

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             ++T+EM  RLD I +EK  G+GL
Sbjct  285   YLTDEMVERLDCINEEKLQGSGL  307



>ref|XP_004308399.1| PREDICTED: cytosolic sulfotransferase 15-like [Fragaria vesca 
subsp. vesca]
Length=339

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 155/318 (49%), Positives = 205/318 (64%), Gaps = 10/318 (3%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWL-EPFFLQGALTIHQHFQPQDSDIILSTFPK  267
             + E +E L SLPKE GW+    Y Y+GFW   P  LQ  +   +HFQ +DSDI++++ PK
Sbjct  15    SNECQELLLSLPKERGWVALPQYLYQGFWCPTPEVLQAIIAFQKHFQARDSDIVVASLPK  74

Query  268   SGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTN--G  438
              GT WLKAL FA++ R +F  E  THPL T+N H L+P+  +  Y     PDF+      
Sbjct  75    CGTTWLKALTFAVVNRHRFAIE--THPLLTSNSHKLVPYFTMDLYINNRVPDFSSKYFPE  132

Query  439   SRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEA  618
              RL  THLP   L  SV ES  K++Y CRNP D+ VS WHF+NK R +   L  +   EA
Sbjct  133   PRLFGTHLPYPSL-GSVKESNCKIIYTCRNPFDSFVSTWHFINKARPQ--SLGPLSLDEA  189

Query  619   FDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFS  798
             FD YC+G+   GPFWDH+  YWKESL+ P  VLFLKYE+MKK+   HL+++A F+ CPFS
Sbjct  190   FDRYCQGMDGWGPFWDHILGYWKESLKRPNNVLFLKYEDMKKDVVSHLKKLAEFIDCPFS  249

Query  799   eeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMA  978
             EEEE  GV+  I +LCSF+++  LE+NKT     + +EN  LFRK +VGDW N  T EM 
Sbjct  250   EEEERNGVIEAIAKLCSFDTMKKLEINKTG-KLVMDMENRSLFRKAEVGDWVNCFTPEME  308

Query  979   RRLDQIVQEKFTGTGLML  1032
              R+ ++++EKF G+GL L
Sbjct  309   ERMSKVIEEKFGGSGLTL  326



>ref|XP_003598424.1| Sulfotransferase [Medicago truncatula]
Length=329

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/319 (44%), Positives = 204/319 (64%), Gaps = 5/319 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             ++   ++E ++ + SLP+E GW TP +Y ++GFW +P  +Q   T  +HFQ ++SD+ ++
Sbjct  9     EQGQLSQENKKLILSLPREKGWRTPYIYLFQGFWCQPAEIQAITTFQKHFQAKESDVFVA  68

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKER--PDFAL  429
             T PKSGT WLKAL +A++ R+      + HPL + NPHDL+PF+E +   K    PD + 
Sbjct  69    TVPKSGTTWLKALTYAIMNRQNHFISSKNHPLLSFNPHDLVPFIEYTVYGKHDTIPDLSK  128

Query  430   TNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
              +  RL  TH+P   L  S+  S  K+VY+CRNP DT +S W F NK++     L  +  
Sbjct  129   IHEPRLFGTHIPFDSLSNSIKGSNCKIVYICRNPFDTFISSWTFANKIKPP--SLPTLNL  186

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
              EAF+ YC G+   GPFW+H+  YW ES E P  VLFLKYE+MK++ + HL++MA FL  
Sbjct  187   EEAFEMYCNGLVGFGPFWNHMLGYWNESKERPKNVLFLKYEDMKEDLKFHLKKMAEFLDR  246

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTE  969
             PF+ EEE  GV+  I++LCSFE +  LE+N T   G    EN  LFRKG+VGDWSN+++ 
Sbjct  247   PFTLEEESEGVIENIIKLCSFEKMKGLEINNTGTFGR-NFENKFLFRKGEVGDWSNYLSP  305

Query  970   EMARRLDQIVQEKFTGTGL  1026
              M  +L ++++EK  G+ L
Sbjct  306   SMVEKLSKVIEEKLGGSDL  324



>gb|AES68675.2| sulfotransferase [Medicago truncatula]
Length=340

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/319 (44%), Positives = 204/319 (64%), Gaps = 5/319 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             ++   ++E ++ + SLP+E GW TP +Y ++GFW +P  +Q   T  +HFQ ++SD+ ++
Sbjct  20    EQGQLSQENKKLILSLPREKGWRTPYIYLFQGFWCQPAEIQAITTFQKHFQAKESDVFVA  79

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKER--PDFAL  429
             T PKSGT WLKAL +A++ R+      + HPL + NPHDL+PF+E +   K    PD + 
Sbjct  80    TVPKSGTTWLKALTYAIMNRQNHFISSKNHPLLSFNPHDLVPFIEYTVYGKHDTIPDLSK  139

Query  430   TNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
              +  RL  TH+P   L  S+  S  K+VY+CRNP DT +S W F NK++     L  +  
Sbjct  140   IHEPRLFGTHIPFDSLSNSIKGSNCKIVYICRNPFDTFISSWTFANKIKPP--SLPTLNL  197

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
              EAF+ YC G+   GPFW+H+  YW ES E P  VLFLKYE+MK++ + HL++MA FL  
Sbjct  198   EEAFEMYCNGLVGFGPFWNHMLGYWNESKERPKNVLFLKYEDMKEDLKFHLKKMAEFLDR  257

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTE  969
             PF+ EEE  GV+  I++LCSFE +  LE+N T   G    EN  LFRKG+VGDWSN+++ 
Sbjct  258   PFTLEEESEGVIENIIKLCSFEKMKGLEINNTGTFGR-NFENKFLFRKGEVGDWSNYLSP  316

Query  970   EMARRLDQIVQEKFTGTGL  1026
              M  +L ++++EK  G+ L
Sbjct  317   SMVEKLSKVIEEKLGGSDL  335



>ref|XP_002873289.1| sulfotransferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49548.1| sulfotransferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/313 (48%), Positives = 206/313 (66%), Gaps = 6/313 (2%)
 Frame = +1

Query  97    EFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             EF+E L+SLPKE GW T  LY ++GFW +   +Q  +   +HFQ   +D++L+T PKSGT
Sbjct  42    EFQEMLDSLPKERGWRTRYLYLFQGFWCQAKEIQAIMCFQKHFQSLPNDVVLATIPKSGT  101

Query  277   VWLKALAFALITRKQF--LAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRL  447
              WLKAL F ++ R +F  ++    HPL T+NPHDL+PF E   YA  + P  +     R 
Sbjct  102   TWLKALTFTILNRHRFDPVSLSSDHPLLTSNPHDLVPFFEYKLYANGDVPKLSSLASPRT  161

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
              ATH+P   L  S+ +   KVVYLCRNP DT +S WH++N ++SE   +  +   EAFD 
Sbjct  162   FATHIPFGSLMDSIEKPGVKVVYLCRNPFDTFISSWHYINNIKSE--SVSPVLLDEAFDL  219

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             YCRGV   GPFW+H+  YW+ESL+ P KVLFLKYE++K++ E +L+++A+FLG PF+EEE
Sbjct  220   YCRGVIGFGPFWEHMLGYWRESLKRPEKVLFLKYEDLKEDTETNLKKLASFLGLPFTEEE  279

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRL  987
             E  GVV  I  LCSFE+L  LEVNK++ +     EN  LFRKG+V DW N+++     RL
Sbjct  280   ERKGVVKAIADLCSFENLKKLEVNKSNKSIK-NFENRFLFRKGEVSDWVNYLSPSHVERL  338

Query  988   DQIVQEKFTGTGL  1026
               +V +K  G+GL
Sbjct  339   SALVDDKLGGSGL  351



>emb|CDP14620.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/314 (50%), Positives = 198/314 (63%), Gaps = 10/314 (3%)
 Frame = +1

Query  94    EEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSG  273
             ++ +  L++LP++  W    LY Y GFW     + G +   +HFQ +DSD+++ T PKSG
Sbjct  115   QQRKNLLSTLPRQR-WQGSYLYKYNGFWFSTMQMPGLVEFRKHFQARDSDVLIITTPKSG  173

Query  274   TVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLEL-SYAAKERPDFALTNGSRLL  450
             T WLKALAFAL+ R       + HPL   NPH L+  LE  +   K+ PD++     RLL
Sbjct  174   TTWLKALAFALMNRN-ICPINQNHPLLNQNPHTLVLHLEYPNPYDKQHPDYSFQGSRRLL  232

Query  451   ATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSY  630
              TH P++LLP+SV  S  K+VYL RN KD  VS+WHF NKL     G     F E FD +
Sbjct  233   GTHCPLALLPESVMNSGCKIVYLSRNIKDIFVSYWHFTNKL-----GSTETSFEEFFDLF  287

Query  631   CRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeee  810
             C+GV  +GP WDHV  YWK SL+ P KVLFLKYEEM +EP  +L+ +A FLGCP S+EEE
Sbjct  288   CKGVSLSGPIWDHVLGYWKASLDKPQKVLFLKYEEMTQEPAFNLKHLAEFLGCPISQEEE  347

Query  811   eCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRLD  990
               GVV  IL LCSF+ + NLEVNK+    +    N V FR GKVGDW N +  EMA RLD
Sbjct  348   TAGVVDEILGLCSFDHMRNLEVNKSGTMWNHS--NQVFFRNGKVGDWKNDLPSEMAERLD  405

Query  991   QIVQEKFTGTGLML  1032
             QI  +KF G+GL L
Sbjct  406   QITAQKFLGSGLDL  419



>gb|AAL06879.1| AT5g07010/MOJ9_18 [Arabidopsis thaliana]
Length=359

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/313 (47%), Positives = 204/313 (65%), Gaps = 6/313 (2%)
 Frame = +1

Query  97    EFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             EF+E L+SLPKE GW T  LY ++GFW +   +Q  ++  +HFQ  ++D++L+T PKSGT
Sbjct  45    EFQEMLDSLPKERGWRTRYLYLFQGFWCQAKEIQAIMSFQKHFQSLENDVVLATIPKSGT  104

Query  277   VWLKALAFALITRKQF--LAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRL  447
              WLKAL F ++ R +F  +A    HPL T+NPHDL+PF E   YA  + PD +     R 
Sbjct  105   TWLKALTFTILNRHRFDPVASSTNHPLFTSNPHDLVPFFEYKLYANGDVPDLSGLASPRT  164

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
              ATHLP   L +++ +   KVVYLCRNP DT +S WH+ N ++SE   +  +   +AFD 
Sbjct  165   FATHLPFGSLKETIEKPGVKVVYLCRNPFDTFISSWHYTNNIKSE--SVSPVLLDQAFDL  222

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             YCRGV    PFW+H+  YW+ESL+ P KV FL+YE++K + E +L+R+A FL  PF+EEE
Sbjct  223   YCRGVIGFAPFWEHMLGYWRESLKRPEKVFFLRYEDLKDDIETNLKRLATFLELPFTEEE  282

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRL  987
             E  GVV  I  LCSFE+L  LEVNK++ +     EN  LFRKG+V DW N+++     RL
Sbjct  283   ERKGVVKAIAELCSFENLKKLEVNKSNKSIK-NFENRFLFRKGEVSDWVNYLSPSQVERL  341

Query  988   DQIVQEKFTGTGL  1026
               +V +K  G+GL
Sbjct  342   SALVDDKLGGSGL  354



>ref|XP_010518598.1| PREDICTED: cytosolic sulfotransferase 12 [Camelina sativa]
Length=325

 Score =   290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 154/324 (48%), Positives = 205/324 (63%), Gaps = 12/324 (4%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             +L +   T+E R+ ++SLPKE GWL  ++Y Y+G W     LQG L   + F+ +DSDII
Sbjct  9     YLGDEDLTQETRDLISSLPKEKGWLVSEMYQYQGRWHTQALLQGILICQKRFEAKDSDII  68

Query  250   LSTFPKSGTVWLKALAFALITRKQF-LAEQETHPLHTNNPHDLIPFLELSYAAKERPDFA  426
             L T PKSGT WLKAL FAL+ R +F ++    HPL   NPH L+PFLE  Y      DF+
Sbjct  69    LVTNPKSGTTWLKALVFALLNRHKFPISSSGNHPLLVTNPHLLVPFLEGVYYESPDFDFS  128

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
                  RL+ TH+    LP+S+  S  K+VY CRNPKD  VS WHF  KL  E     A P
Sbjct  129   GLPSPRLMNTHISHLSLPESIKSSSCKIVYCCRNPKDMFVSLWHFGKKLAPEETA--AYP  186

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               +A +++C G    GPFWDH+ EYW  S ENP KVLF+ YE++KK+ E  ++R+A FLG
Sbjct  187   IEKAVETFCEGKFIGGPFWDHILEYWYASRENPNKVLFVTYEDLKKQTEAEMKRIAEFLG  246

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNH  960
             C F EEEE    V  I +LCSFESLS+LEVN+    G L  G+E    FRKG++G WS+ 
Sbjct  247   CGFIEEEE----VREIAKLCSFESLSDLEVNR---QGKLPNGMETKTFFRKGEIGGWSDT  299

Query  961   MTEEMARRLDQIVQEKFTGTGLML  1032
             ++E +A  +D+ ++EKF G+GL+ 
Sbjct  300   LSESLAAEIDRTIEEKFHGSGLIF  323



>ref|XP_010911932.1| PREDICTED: cytosolic sulfotransferase 7-like [Elaeis guineensis]
Length=340

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/320 (45%), Positives = 212/320 (66%), Gaps = 5/320 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             Q  +  +E+ + +++LP+  GWL   L  Y+G W     L G + + + F+ + +D+ + 
Sbjct  25    QNPTPLQEYDDLISTLPQHEGWLPLRLRKYQGSWFPEHNLPGVIAVQKRFKARPTDLFVL  84

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTN  435
             +FPKSGT WLKALAFA+ITR Q       HPLH+ NPH  +  ++  +A  +        
Sbjct  85    SFPKSGTTWLKALAFAIITRTQHPLAH--HPLHSLNPHQCVLTMDRLFALGQASTIEAMP  142

Query  436   GSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPE  615
               R+L +H+P SLL  S+  S  ++VY+CR+ KD +VS+WHF +K+R     ++ +PF +
Sbjct  143   SPRILGSHMPFSLLRDSIEGSGCRIVYVCRDVKDVLVSWWHFHDKMRPA--EMDRVPFAK  200

Query  616   AFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPF  795
             A + +C+G+C++GP W HV EYW+ES   P KVLFLKYEEM +EP  H +R+A F+GCPF
Sbjct  201   ALEMFCQGICHSGPIWSHVLEYWEESQRRPEKVLFLKYEEMMEEPTSHAKRLAEFMGCPF  260

Query  796   SeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVEN-GVLFRKGKVGDWSNHMTEE  972
             S EEE+ G+V  IL+LCSFE+L NLEVN++     + +     LFRKGKVGDW+NHM+ E
Sbjct  261   SLEEEKEGLVEEILKLCSFENLRNLEVNRSDKRDAVHLAKFETLFRKGKVGDWTNHMSPE  320

Query  973   MARRLDQIVQEKFTGTGLML  1032
             MAR+LD++ Q+KF G+GL +
Sbjct  321   MARKLDEMTQQKFKGSGLTV  340



>emb|CDY45712.1| BnaC02g35140D [Brassica napus]
Length=334

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/328 (44%), Positives = 215/328 (66%), Gaps = 11/328 (3%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
              +++++  ++E +  +++LP +  ++   LYNYKG W  P  LQ  L +  HF+P+ +DI
Sbjct  11    NYMKDDKVSQETKNLISTLPSDKDFMGYPLYNYKGCWYYPNTLQAVLDVQTHFRPRKTDI  70

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL++ PK GT WLK+L FAL+ R+++      HPL + NPHDL+PFLE+  YA  + PD 
Sbjct  71    ILASLPKGGTTWLKSLVFALVHREKYRENPLIHPLLSKNPHDLVPFLEIELYAGSQTPDL  130

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKG---KVVYLCRNPKDTVVSFWHFMNKLRSELRGL  594
             +      + +TH+ ++ L ++  +S     KVVY+CR  KDT VS WH+ N L      +
Sbjct  131   SKFPSPMIYSTHMHLNTLREATTKSSSSPCKVVYVCRGIKDTFVSGWHYRNMLHR--TKM  188

Query  595   EAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMA  774
             +   F   FD+YC+GV   GP+W+HV  YW  SLE+   VLFLKYEEM +EP V ++R+A
Sbjct  189   DQATFELMFDAYCKGVILYGPYWEHVLGYWNGSLEDGENVLFLKYEEMIEEPRVQVKRLA  248

Query  775   AFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGD--LGVENGVLFRKGKVGD  948
              FL CPF+EEEE+ G V  IL+LCS  +LSNLE+N   +NG   +G+++ V FRKG+VGD
Sbjct  249   EFLDCPFTEEEEKSGSVEEILKLCSLRNLSNLEIN---MNGTTRIGIDSNVFFRKGEVGD  305

Query  949   WSNHMTEEMARRLDQIVQEKFTGTGLML  1032
             W NH+T +MA+++D IV+ K  G+GL+ 
Sbjct  306   WKNHLTPQMAKKIDDIVECKLQGSGLIF  333



>ref|XP_007208898.1| hypothetical protein PRUPE_ppa026895mg, partial [Prunus persica]
 ref|XP_007211062.1| hypothetical protein PRUPE_ppa018068mg, partial [Prunus persica]
 gb|EMJ10097.1| hypothetical protein PRUPE_ppa026895mg, partial [Prunus persica]
 gb|EMJ12261.1| hypothetical protein PRUPE_ppa018068mg, partial [Prunus persica]
Length=321

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/310 (46%), Positives = 204/310 (66%), Gaps = 5/310 (2%)
 Frame = +1

Query  106   EFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGTVWL  285
             E +++LPK+ GW T   Y Y+GFW  P FL+G +    +F+ +D DI L+TFPK GT W+
Sbjct  12    EIISTLPKDRGWGTEHYYQYEGFWYPPIFLEGVIWAQANFRARDDDIFLATFPKCGTTWV  71

Query  286   KALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGS-RLLATHL  462
             KAL FA+  R+ +  +  +HPL T +P D +P++EL        D+     S R LATH+
Sbjct  72    KALMFAIQNRENY--DFLSHPLLTKSPQDCVPYIELLAHQDNPIDYLDAIASPRFLATHI  129

Query  463   PVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCRGV  642
             P   LP+S+  S  K+V + RNPKD ++S+W F  K+RS +  L  +P  E F+ +C+GV
Sbjct  130   PHRSLPRSILNSGTKIVSVARNPKDVLISYWVFSQKIRSSINKLAPLPMEEGFELFCKGV  189

Query  643   CNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeCGV  822
               +GPFWD+V  YW+ SLENP KVLFLK+E++K + +  ++R+A F+G PFS +EE+ GV
Sbjct  190   ALSGPFWDNVLGYWEASLENPEKVLFLKFEDIKIDTDCSVKRLAEFMGLPFSSKEEQEGV  249

Query  823   VSGILRLCSFESLSNLEVNKTSV--NGDLGVENGVLFRKGKVGDWSNHMTEEMARRLDQI  996
             V  I++LCSF++LSNLEVNK+    N D    N V FR+G+ GD  NH+T EM  RLD+I
Sbjct  250   VREIIKLCSFDNLSNLEVNKSGTFSNADGKFSNAVFFRRGQTGDSKNHLTPEMLDRLDKI  309

Query  997   VQEKFTGTGL  1026
              ++K   +GL
Sbjct  310   TEQKLGASGL  319



>ref|XP_002272968.2| PREDICTED: cytosolic sulfotransferase 13-like [Vitis vinifera]
Length=343

 Score =   290 bits (741),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 150/315 (48%), Positives = 209/315 (66%), Gaps = 7/315 (2%)
 Frame = +1

Query  94    EEFREFLNSLPKETGWLTPDLYNYKGFWLEPFF-LQGALTIHQHFQPQDSDIILSTFPKS  270
             + + E +++LPKE GW T  +Y Y+GFW      LQG + + +HF+P+  D++L + PKS
Sbjct  24    KRYSEIISTLPKEKGWTTEHMYQYQGFWYHSVVGLQGIMWVEEHFKPRHEDLLLVSAPKS  83

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAK-ERPDFALTNGSRL  447
             GT W K+L FA++ R Q+  +  THPL T +PH+L+PF E+ +      P+    +  ++
Sbjct  84    GTTWFKSLMFAIMNRGQY--DCSTHPLLTTSPHELVPFSEIFFHLNIPFPNPDTLSPPQI  141

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
               THLP + L +SV +S+ ++VY+CRNPKDT VS +HF+ K + E    E + F EAF+ 
Sbjct  142   FHTHLPFTSLSQSVLDSQCRIVYVCRNPKDTFVSLFHFLQK-KEEENPREPLSFEEAFEQ  200

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             +C+GV   GPFWDHV  YWK SLE P +VLFLKYE+MK +   HL+R+A F+G  FS EE
Sbjct  201   FCKGVSVYGPFWDHVLGYWKASLEWPERVLFLKYEDMKVDSSFHLKRLAEFMGYAFSLEE  260

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTS--VNGDLGVENGVLFRKGKVGDWSNHMTEEMAR  981
             E+ G+V  IL+LCSFE+ SNL VNKT     G + +EN   FRKG+VGDW NH+T EMA 
Sbjct  261   EKQGLVKEILKLCSFENQSNLRVNKTGRFRVGHMSMENNPFFRKGEVGDWKNHLTAEMAE  320

Query  982   RLDQIVQEKFTGTGL  1026
             RLD+I  +K  G  L
Sbjct  321   RLDRITGQKLNGYDL  335



>ref|XP_002303947.1| hypothetical protein POPTR_0003s19270g [Populus trichocarpa]
 gb|EEE78926.1| hypothetical protein POPTR_0003s19270g [Populus trichocarpa]
Length=337

 Score =   289 bits (740),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 143/319 (45%), Positives = 208/319 (65%), Gaps = 6/319 (2%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             + E   +++ R+ L+SLPKE  W++  +Y ++GFW  P  +   ++   +FQ  ++D IL
Sbjct  13    VSETGESDQCRDLLSSLPKEKDWISCYMYLFQGFWCPPKEIHAVVSFQNNFQSCNTDTIL  72

Query  253   STFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFAL  429
              + PKSGT WLKAL F+++ R+++   +   PL++ NPHDL+PF E   YA  + PD + 
Sbjct  73    VSMPKSGTTWLKALVFSIMNREKYQTAES--PLNSFNPHDLVPFFEYRLYANNQVPDLSA  130

Query  430   TNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
                 R+ +TH+P   LP+S+  S  +VVY+CRNP D  +SFWHF++K R E  G   +  
Sbjct  131   FPSPRIFSTHVPYPSLPESIRNSTCRVVYICRNPLDNFISFWHFLSKARPERLG--PLLL  188

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
              EAFDS+C GV   GPF+DHV  YWKESLE P KVLFLK+E++K++    ++ +A FLGC
Sbjct  189   EEAFDSFCNGVVGFGPFFDHVLGYWKESLERPEKVLFLKFEDLKEDINSQMKSLAVFLGC  248

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTE  969
             PFS EEE  GV+  I +LCS +SL ++E NK   +     EN  LFR+G+VGDW N++T 
Sbjct  249   PFSLEEERDGVIEDISKLCSLDSLKDIEANKRGKSIPY-FENNTLFRRGEVGDWINYLTP  307

Query  970   EMARRLDQIVQEKFTGTGL  1026
             EM  RL++I  +K  G+GL
Sbjct  308   EMVDRLNKITAQKLAGSGL  326



>ref|XP_009339576.1| PREDICTED: cytosolic sulfotransferase 5-like [Pyrus x bretschneideri]
Length=323

 Score =   289 bits (739),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 145/314 (46%), Positives = 203/314 (65%), Gaps = 8/314 (3%)
 Frame = +1

Query  103   REFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGTVW  282
             +E +++LPK+TGW     Y Y+ FW    FL+G +   Q F+ +DSDI L+TFPK GT W
Sbjct  10    QEIISTLPKDTGWAAEHYYQYQNFWYPQVFLEGVIWAQQDFRARDSDIFLATFPKCGTTW  69

Query  283   LKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGS-RLLATH  459
             +KAL  A+  RK    +  +HPL T NPHD++P++EL        ++  +  S RLLA+H
Sbjct  70    VKALMIAIKNRKD--CDYSSHPLLTKNPHDIVPYIELLVHQDNPVEYLDSMASPRLLASH  127

Query  460   LPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCRG  639
             +P S LP S+ +S  +VVY+ RNPKD +VSFW F  KLRS++  L  +   E F+ +C+G
Sbjct  128   IPHSSLPNSLLDSDTRVVYIARNPKDVLVSFWAFSEKLRSKVYRLPPLSLEEGFELFCKG  187

Query  640   VCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeCG  819
             V   GPFWDHV  YW+ SL+NP KVLF K+E++K + E  ++R+A F+G PFS EEE+ G
Sbjct  188   VALAGPFWDHVLGYWEASLKNPNKVLFFKFEDLKADTEGCVKRLAEFIGYPFSSEEEKEG  247

Query  820   VVSGILRLCSFESLSNLEVNKTSV-----NGDLGVENGVLFRKGKVGDWSNHMTEEMARR  984
              V  I++ CSFE+LS+LEVNK+         D    N V FR+G+ GD   H+T EM  R
Sbjct  248   AVQEIIKFCSFENLSSLEVNKSGTYHVGPKTDEKFSNDVFFRRGETGDSQKHLTPEMLER  307

Query  985   LDQIVQEKFTGTGL  1026
             LD+I ++KF  +GL
Sbjct  308   LDKITEQKFGASGL  321



>ref|XP_010452648.1| PREDICTED: cytosolic sulfotransferase 15 [Camelina sativa]
Length=359

 Score =   290 bits (742),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 150/320 (47%), Positives = 206/320 (64%), Gaps = 6/320 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
              +   T EF+E L+SLPKE GW T  LY ++GFW +   +Q  ++  +HF+   +D++L+
Sbjct  38    DDEGLTYEFQEMLDSLPKERGWRTRYLYLFQGFWCQAKEIQAIMSFQKHFRSLPNDVVLA  97

Query  256   TFPKSGTVWLKALAFALITRKQF--LAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA  426
             T PKSGT WLKAL F ++ R +F  ++    HPL T+NPHDL+PF E   YA    PD +
Sbjct  98    TIPKSGTTWLKALTFTILNRHRFDPVSSTTNHPLLTSNPHDLVPFFEYKLYANGAVPDLS  157

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
                  R  ATH+P   L  S+ E   KVVYLCRNP DT +S WHF+N ++SE   +  + 
Sbjct  158   GLARPRTFATHVPFGSLKDSIEEPGVKVVYLCRNPFDTFISSWHFINNIKSET--VSRVL  215

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               E FD YCRGV   GPFW+H+  Y++ESL+ P KV FLKYE++K++ E +L+++A+FLG
Sbjct  216   LDEGFDLYCRGVIGFGPFWEHMLGYYRESLKRPEKVFFLKYEDLKEDIETNLKKLASFLG  275

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMT  966
              PF++EEE+ GVV  I  LCSFE+L  LEVNK S       EN  LFRKG+V DW N+++
Sbjct  276   LPFTKEEEQKGVVKAIADLCSFENLKKLEVNK-SKKSIKNFENRFLFRKGEVSDWVNYLS  334

Query  967   EEMARRLDQIVQEKFTGTGL  1026
                  RL  +V +K  G+GL
Sbjct  335   PSQVERLSALVDDKLGGSGL  354



>ref|XP_010514147.1| PREDICTED: cytosolic sulfotransferase 13-like [Camelina sativa]
Length=324

 Score =   288 bits (738),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 149/323 (46%), Positives = 203/323 (63%), Gaps = 15/323 (5%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             + L E  +++E  E ++SLPK+  +    LY Y+GFW  P  L+G L   +HFQ +DSDI
Sbjct  10    KLLAEAKFSQECEELMSSLPKDRSFFAEYLYQYQGFWYPPNILEGVLYSQKHFQAKDSDI  69

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLE-LSYAAKERPDF  423
             IL + PKSGT WLKAL FALI R +FL   E+HPL  NNPH L+PF+E   +  ++    
Sbjct  70    ILVSSPKSGTTWLKALVFALIHRHEFLTPLESHPLLDNNPHSLVPFIEGFQFHTQD----  125

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
                   ++ +TH+P+  LP S+ +S  KVVY CRNPKD  VS WHF+  L   L+ +   
Sbjct  126   ---TSPKIFSTHIPLRSLPASIKDSSCKVVYCCRNPKDAFVSIWHFLKSLM--LKEMVGC  180

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E    +CRG    GPFWDH  EYWKES ENP KVLF+ YEEM+++P   + R+A FL
Sbjct  181   TIEEMVSGFCRGSSVYGPFWDHALEYWKESQENPDKVLFVMYEEMREQPRDWVMRIAEFL  240

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
             GC F+EEE E GV+  I++LCS E+LS LEVN+    G L  G+E    FRKG++G WS+
Sbjct  241   GCSFTEEEIENGVLDSIIKLCSLENLSKLEVNE---KGKLVNGMETKAFFRKGEIGGWSD  297

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
              +T  +A  +D+  ++K  G+G 
Sbjct  298   TLTPLLAEEIDKTTEQKLFGSGF  320



>ref|XP_006432398.1| hypothetical protein CICLE_v10003688mg [Citrus clementina]
 gb|ESR45638.1| hypothetical protein CICLE_v10003688mg [Citrus clementina]
Length=346

 Score =   289 bits (740),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 150/325 (46%), Positives = 215/325 (66%), Gaps = 17/325 (5%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             +E   + E +E L SLPKE GW T  LY ++G+W +   +Q  +   +HF+ +D+DIIL+
Sbjct  21    EEKHLSSECKEVLLSLPKERGWRTAFLYKFQGYWCQAKEIQAIMAFQKHFKAKDTDIILA  80

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETH----PLHTNNPHDLIPFLELSYAAKERPDF  423
             + PKSGT W+KAL+FA+I RK F    + H    PL T+NPHDL+PFL   YA  + P+ 
Sbjct  81    SIPKSGTTWMKALSFAIINRKNFPIISDHHGHHHPLLTSNPHDLVPFL---YANNQIPEL  137

Query  424   A-LTNGSRLLATHLP---VSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRG  591
             + + +  R+ ATH+P   ++LLP     +  K+VY+CRNP DT +S WHF+NKLRS+  G
Sbjct  138   SQIADEPRVFATHIPFASLNLLPSM---NNIKIVYICRNPFDTFISSWHFLNKLRSQ--G  192

Query  592   LEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRM  771
             L  +   EAF  YC GV   GPFW+H+  YW ESL+ P  VLFLKY++MK++   +L+++
Sbjct  193   LPEISLEEAFKMYCDGVIGFGPFWEHMLGYWNESLKRPNNVLFLKYDDMKQDIVSNLKKL  252

Query  772   AAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDW  951
             A+FLG PFS EEE+ GV+  I +LCSFE +  L+VNK   +    +EN  LFRKG+VGDW
Sbjct  253   ASFLGFPFSPEEEKQGVIQDIAKLCSFEEMKKLDVNKNGKSIK-DIENKYLFRKGEVGDW  311

Query  952   SNHMTEEMARRLDQIVQEKFTGTGL  1026
              N+++  M ++L  I++EK   +GL
Sbjct  312   VNYLSPSMVKQLSLIMEEKLDASGL  336



>ref|XP_008781218.1| PREDICTED: cytosolic sulfotransferase 12-like [Phoenix dactylifera]
Length=288

 Score =   287 bits (735),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 153/290 (53%), Positives = 193/290 (67%), Gaps = 10/290 (3%)
 Frame = +1

Query  163   YKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGTVWLKALAFALITRKQFLAEQET  342
             YKGFW+    L   + +  HF+P+ SD+IL T PKSGT WLKAL FA++ R  +   Q  
Sbjct  2     YKGFWVHENMLPRVMALQDHFKPRPSDLILVTQPKSGTTWLKALLFAIMNRTNYTFAQ--  59

Query  343   HPLHTNNPHDLIPFLELSYAAKERPDFALTNGSRLLATHLPVSLLPKSVWESKGKVVYLC  522
             HPL T NPH  + FLE+ +  +  PD       RLLATHLP S+LP SV +   ++VYLC
Sbjct  60    HPLLTRNPHACVLFLEVPFRHR-FPDLEAIPPPRLLATHLPYSILPSSVADCGCRLVYLC  118

Query  523   RNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLEN  702
             R+PKD VVS WHF  KL+ +  GL      EAF+ +C G   +GP WDH+ EYW+ESL  
Sbjct  119   RDPKDVVVSLWHFAQKLKPDTMGLS-----EAFELFCDGFSFSGPIWDHMLEYWRESLRR  173

Query  703   PGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNK  882
               KVLFLKYEEM  EP  ++RR+A F+G PFSEEEE+ GVV  I++LCSFE LSN+EVNK
Sbjct  174   SEKVLFLKYEEMMTEPVGNVRRLAEFVGRPFSEEEEKDGVVEEIVQLCSFEKLSNMEVNK  233

Query  883   TSVN--GDLGVENGVLFRKGKVGDWSNHMTEEMARRLDQIVQEKFTGTGL  1026
               V   G+  V +   FRKGKVGDW+NH++ EM   LD+IVQEK  G+GL
Sbjct  234   KGVYEVGETTVPHESFFRKGKVGDWANHLSREMGEALDRIVQEKLAGSGL  283



>emb|CDX95244.1| BnaC09g16260D [Brassica napus]
Length=335

 Score =   289 bits (739),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 146/329 (44%), Positives = 218/329 (66%), Gaps = 14/329 (4%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             ++++++ ++E +  ++SLP +  ++   LYNYKG W  P  LQ  L + +HFQP+  DII
Sbjct  12    YMKDDNVSQETKNLISSLPSDKDFMGYSLYNYKGCWYYPNTLQAVLDVQEHFQPRKKDII  71

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA  426
             L++ PK GT WLK++ FA++ R+++    ETHPL + NPHDL+PFLE+  YA  + PD  
Sbjct  72    LASLPKGGTTWLKSIVFAVLHREKYSENPETHPLLSQNPHDLVPFLEIELYAGSQTPDVT  131

Query  427   LTNGSRLLATHLPVSLL----PKSVWESKGKVVYLCRNPKDTVVSFWHFMNKL-RSELRG  591
                   + +TH+ +  L     +S   S  K+VY+CR  KDT VS WH+ NKL R+E   
Sbjct  132   KFPSPMIFSTHMHLKTLLEATTRSSSSSPCKIVYVCRGIKDTFVSAWHYRNKLHRTE---  188

Query  592   LEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRM  771
             ++   F   FD+YCRGV   GP+W+HV  YWK SLE+   VLF+KYEE+ ++P + ++R+
Sbjct  189   MDQASFELMFDAYCRGVHLYGPYWEHVLSYWKGSLEDKEHVLFMKYEEIIEDPRLQVQRL  248

Query  772   AAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVG  945
             A FL CPF++EEEE G V  I+ LCS  +LS+LE+NK   NG +  GV+  V FRKG++G
Sbjct  249   AEFLNCPFTKEEEESGSVEEIVNLCSLRNLSSLEINK---NGTIRVGVDTNVFFRKGEIG  305

Query  946   DWSNHMTEEMARRLDQIVQEKFTGTGLML  1032
             DW NH+T +MA+ +D+IV+ +  G+GL+ 
Sbjct  306   DWKNHLTPQMAKTIDEIVESRLRGSGLIF  334



>ref|XP_008240109.1| PREDICTED: LOW QUALITY PROTEIN: flavonol sulfotransferase-like 
[Prunus mume]
Length=330

 Score =   288 bits (738),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 162/317 (51%), Positives = 202/317 (64%), Gaps = 23/317 (7%)
 Frame = +1

Query  127   KETGWLTPDLYNYKGFWLEPFF-LQGALTIHQHFQPQDSDIILSTFPKSGTVWLKALAFA  303
             KE GW+T  L  Y+GFWL P    +GAL +  HF  + SDI+L+TF KSGT  L+AL FA
Sbjct  13    KERGWMTQHLVQYQGFWLSPACAFKGALLLQHHFHARPSDILLATFQKSGTTRLRALMFA  72

Query  304   LITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGSR-----------LL  450
              + R  +      HPL T  PHD  PFL+   A   + D      SR           L 
Sbjct  73    TMNRALYDMSSYQHPLLTTGPHDCFPFLD---AYIHQTDSISHLNSRPILSHPMMHPALF  129

Query  451   ATHLPVSLLPKSVWESKG--KVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFD  624
             +TH+P +LLPKSV  S    + VY+CRNPKD +VS W FMNKLR   + L  +   EA+D
Sbjct  130   STHMPYALLPKSVTASSSGCRCVYVCRNPKDVLVSKWIFMNKLRP--KQLAPLSLQEAYD  187

Query  625   SYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSee  804
              +C+GV + GPFWDHV  YWK SLE   K+LFLKYE++ K+P VHL+R+A FLG PFS E
Sbjct  188   LFCQGVSHYGPFWDHVLGYWKASLEFHDKILFLKYEDL-KDPFVHLKRLAEFLGQPFSLE  246

Query  805   eeeCGVVSGILRLCSFESLSNLEVNKTSV---NGDLGVENGVLFRKGKVGDWSNHMTEEM  975
             EE  GVV  I++LCSFE LS+LEVNKT V   +  L V+N   FRKG+VGDW N+ T+EM
Sbjct  247   EERKGVVQEIIKLCSFEKLSHLEVNKTEVQWFSSQLVVKNSYFFRKGQVGDWKNYFTDEM  306

Query  976   ARRLDQIVQEKFTGTGL  1026
             ARRLDQI  +KF  +GL
Sbjct  307   ARRLDQITDDKFNASGL  323



>ref|XP_008777580.1| PREDICTED: flavonol sulfotransferase-like [Phoenix dactylifera]
Length=357

 Score =   290 bits (741),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 147/314 (47%), Positives = 200/314 (64%), Gaps = 7/314 (2%)
 Frame = +1

Query  97    EFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             ++ E ++SLP +  ++   +  Y  FW     L G + I QHF+P+  D+ L +FPKSGT
Sbjct  34    DYDELISSLPVKQTFIP--IRKYLEFWFPEGHLPGIMAIRQHFRPRPDDLFLMSFPKSGT  91

Query  277   VWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGSRLLAT  456
              WLKALAFA +TR  +  ++  HPLH+ NPHD++PF++  +AA +          R+LAT
Sbjct  92    TWLKALAFATMTRAHYPWDR--HPLHSLNPHDVVPFMDDLFAAGQASKLEALPSPRVLAT  149

Query  457   HLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCR  636
             H+P SLLP S+  S  +++Y+CR+PKD +VS WHF  K  +E +G E  PF   F+  C 
Sbjct  150   HMPYSLLPDSITSSGCRIIYICRDPKDAIVSLWHFAEKASAE-KGREGFPFDRFFEMACE  208

Query  637   GVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeC  816
             G     P WDH  EYWKESL  P KVLFLKYEEM +EP  +++R+A FLGCPFSE+EE+ 
Sbjct  209   GKFPYSPIWDHSLEYWKESLRRPEKVLFLKYEEMLEEPAANVKRLAEFLGCPFSEDEEKG  268

Query  817   GVVSGILRLCSFESLSNLEVNKTSVN--GDLGVENGVLFRKGKVGDWSNHMTEEMARRLD  990
             GVV  I+ LCSFE L ++E NK          V N   FRKG  GDW N+ + EMA++LD
Sbjct  269   GVVEEIITLCSFEKLKSMEANKKGSQEAAVYKVSNASFFRKGGTGDWRNYGSPEMAQKLD  328

Query  991   QIVQEKFTGTGLML  1032
             +IV EK  G+GL +
Sbjct  329   EIVLEKLEGSGLTI  342



>ref|XP_010425174.1| PREDICTED: cytosolic sulfotransferase 12-like [Camelina sativa]
Length=325

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 204/326 (63%), Gaps = 16/326 (5%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             +L +   T+E R+ ++SL KE GWL  ++Y Y+G W     LQG L   + F+ +DSDII
Sbjct  9     YLGDEDLTQETRDLISSLAKEKGWLVSEMYQYQGRWHTQALLQGILICQKRFEAKDSDII  68

Query  250   LSTFPKSGTVWLKALAFALITRKQF-LAEQETHPLHTNNPHDLIPFLELSYAAKERPDFA  426
             L T PKSGT WLKAL +AL+ R +F ++    HPL   NPH L+PFLE  Y   E PDFA
Sbjct  69    LVTNPKSGTTWLKALVYALLNRHKFPVSSSGNHPLLVTNPHLLVPFLEGVYY--ESPDFA  126

Query  427   LTN--GSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEA  600
              +     RL+ TH+    LP+SV  S  K+VY CRNPKD  VS WHF  KL  E     A
Sbjct  127   FSGLPSPRLMNTHISHPSLPESVKSSSCKIVYCCRNPKDMFVSLWHFGKKLAPEETA--A  184

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAF  780
              P  +A  ++C G    GPFWDH+ EYW  S ENP KVLF+ YE++KK+    ++R+A F
Sbjct  185   YPIEKAVKAFCEGKFIGGPFWDHILEYWYASRENPNKVLFVTYEDLKKQTGAEMKRIAEF  244

Query  781   LGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWS  954
             LGC F EE    G V  I++LCSFESLSNLEVN+    G L  G+E    FRKG++G W 
Sbjct  245   LGCGFIEE----GEVRDIVKLCSFESLSNLEVNR---QGKLPNGMETKTFFRKGEIGGWR  297

Query  955   NHMTEEMARRLDQIVQEKFTGTGLML  1032
             + ++E +A  +D+ ++EKF G+GL+ 
Sbjct  298   DTLSESLAAEIDRTIEEKFHGSGLIF  323



>ref|NP_190094.1| cytosolic sulfotransferase 6 [Arabidopsis thaliana]
 sp|Q9M1V1.1|SOT6_ARATH RecName: Full=Cytosolic sulfotransferase 6; Short=AtSOT6; AltName: 
Full=sulfotransferase 3b; Short=AtST3b [Arabidopsis thaliana]
 emb|CAB72146.1| sulfotransferase-like protein [Arabidopsis thaliana]
 gb|AAT70444.1| At3g45080 [Arabidopsis thaliana]
 gb|AAU45228.1| At3g45080 [Arabidopsis thaliana]
 gb|AEE77989.1| sulfotransferase 6 [Arabidopsis thaliana]
Length=329

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/320 (45%), Positives = 210/320 (66%), Gaps = 4/320 (1%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             ++ +  +EE +  ++SLP +      ++  Y+G W  P  LQG L   ++F+PQD+DII+
Sbjct  10    VRNDELSEESKTLISSLPSDKNSTGVNVCKYQGCWYTPPILQGVLNFQKNFKPQDTDIIV  69

Query  253   STFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA-  426
             ++FPK GT WLKAL FAL+ R +  +  + HPL ++NPH L P LE+  Y   E PD   
Sbjct  70    ASFPKCGTTWLKALTFALVRRSKHPSHDDHHPLLSDNPHVLSPSLEMYLYLCSENPDLTK  129

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
              ++ SRL +TH+P   L + +  S  K+VY+ RN KDT+VS+WHF  K +++   + ++ 
Sbjct  130   FSSSSRLFSTHMPSHTLQEGLKGSTCKIVYMSRNVKDTLVSYWHFFCKKQTDDNIISSVE  189

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               + F+ +CRGV   GPFWDHV  YW+ SLE+P  VLF+K+EEMK+EP   ++R+A FLG
Sbjct  190   --DTFEMFCRGVNFFGPFWDHVLSYWRGSLEDPNHVLFMKFEEMKEEPREQIKRLAEFLG  247

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMT  966
             C F++EEEE G+V  I+ LCS  +LS+LE+NKT      G EN   FRKG+VGDW N++T
Sbjct  248   CLFTKEEEESGLVDEIIDLCSLRNLSSLEINKTGKLHSTGRENKTFFRKGEVGDWKNYLT  307

Query  967   EEMARRLDQIVQEKFTGTGL  1026
              EM  ++D I+QEK   +GL
Sbjct  308   PEMENKIDMIIQEKLQNSGL  327



>emb|CDX81030.1| BnaC03g02840D [Brassica napus]
Length=359

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 152/311 (49%), Positives = 202/311 (65%), Gaps = 5/311 (2%)
 Frame = +1

Query  97    EFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             EF E L+SLPKE GW T  LY ++GFW +   +   ++  +HF+P   D+IL+T PKSGT
Sbjct  48    EFLEMLDSLPKERGWRTRHLYLFQGFWCQAKEIHAIMSFQKHFKPLPKDVILATIPKSGT  107

Query  277   VWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRLLA  453
              WLKAL F L+ R +F    + HPL T+NPHDL+PFLE   YA  E PD +     R  A
Sbjct  108   TWLKALTFTLLNRHRFDPVSD-HPLLTSNPHDLVPFLEYKLYANGEVPDLSSLASPRTFA  166

Query  454   THLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYC  633
             TH+P   L  S+ E   KVVYLCRNP DT +S WHF N ++SE   +  +   E FD YC
Sbjct  167   THVPFGSLKGSIEEPGVKVVYLCRNPFDTFISSWHFSNSIKSE--SVSPVSLEEGFDLYC  224

Query  634   RGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeee  813
             RGV   GPFW+H+  YW+ESL+ P +VLFLKYE++K++ E +L+++A+FLG  F+EEEE 
Sbjct  225   RGVIGFGPFWEHMLGYWRESLKRPEEVLFLKYEDLKEDIETNLKKLASFLGVSFTEEEEG  284

Query  814   CGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRLDQ  993
              GVV  +  LCSFESL  LEVNK++ +     EN  LFRKG+V  W N+++     RL  
Sbjct  285   KGVVKAVADLCSFESLKKLEVNKSNKSIK-NFENRYLFRKGEVSGWRNYLSPVQVERLSA  343

Query  994   IVQEKFTGTGL  1026
             +V +K  G+GL
Sbjct  344   LVDDKLGGSGL  354



>ref|XP_008240107.1| PREDICTED: flavonol sulfotransferase-like [Prunus mume]
Length=336

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/313 (46%), Positives = 204/313 (65%), Gaps = 8/313 (3%)
 Frame = +1

Query  106   EFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGTVWL  285
             E +++LPK+TGW T   Y Y+GFW    FL+G +    +F+ +D+DI L+TFPK GT W+
Sbjct  24    EIISTLPKDTGWGTEHYYQYEGFWYPKIFLEGVIWAQANFRARDNDIFLATFPKCGTTWV  83

Query  286   KALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGS-RLLATHL  462
             KAL FA+  R+ +  +  +HPL T +PHD +P++EL        D+     S R LATH+
Sbjct  84    KALMFAIQNRENY--DFSSHPLLTKSPHDCVPYIELLAHHDNPIDYLDAMASTRFLATHI  141

Query  463   PVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCRGV  642
             P   LPKS+  S  K+V + RNPKD ++S+W F  K+RS    L  +P  E F+ +C+GV
Sbjct  142   PHRSLPKSILNSGTKIVSVARNPKDVLISYWVFSQKIRSSKNKLAPLPIEEGFELFCKGV  201

Query  643   CNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeCGV  822
               +GPFWD+V  YW+ SLENP KVLFLK+E++K + E  ++R+A F+G PFS +EE+ G 
Sbjct  202   ALSGPFWDNVLGYWEASLENPEKVLFLKFEDIKIDTECSVKRLAEFMGLPFSSKEEQEGA  261

Query  823   VSGILRLCSFESLSNLEVNKTSVNG-----DLGVENGVLFRKGKVGDWSNHMTEEMARRL  987
             V  I++LCSF++LSNLEVNK+   G     D    N V FR+G+ GD  NH+T EM  RL
Sbjct  262   VREIIKLCSFDNLSNLEVNKSGTFGVGSKTDGKFSNDVFFRRGQTGDSKNHLTPEMLDRL  321

Query  988   DQIVQEKFTGTGL  1026
             D+I ++K   +GL
Sbjct  322   DKITKQKLGASGL  334



>ref|XP_008785781.1| PREDICTED: cytosolic sulfotransferase 7-like [Phoenix dactylifera]
Length=340

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/320 (46%), Positives = 205/320 (64%), Gaps = 5/320 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             Q  +  +E+ + +++LP + GWL   L  Y+G W     L G + I QHF+ + +D+ + 
Sbjct  25    QNPTPLQEYDDLISTLPLDEGWLPVRLRKYQGSWFPELNLPGVIAIQQHFKARPTDLFVL  84

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTN  435
             +FPK+GT WLKAL FA+ TR Q       HPLH+ NPH  +  ++  +A  +        
Sbjct  85    SFPKAGTTWLKALTFAITTRTQHALGH--HPLHSLNPHQCVVTMDRIFALGQASTIEAMP  142

Query  436   GSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPE  615
               R+L+TH+P SLL  S+  S  +++Y+CR+ KD +VS+WHF +K+R     ++ +PF +
Sbjct  143   SPRILSTHMPFSLLRDSIEGSGCRIIYVCRDVKDVLVSWWHFNDKMRPP--EMDRVPFAK  200

Query  616   AFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPF  795
             A + +C G+C +GP W HV EYW+ESL  P KVLFLKYEEM +EP  H +R+A F+GCPF
Sbjct  201   ALEMFCEGICPSGPIWSHVLEYWEESLRRPEKVLFLKYEEMMEEPMSHAKRLAEFMGCPF  260

Query  796   SeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVEN-GVLFRKGKVGDWSNHMTEE  972
             S EEE  GVV  IL+LCSFE L NLEVNKT     + +     LFRKGKVGDW NHM+ E
Sbjct  261   SLEEEREGVVEEILKLCSFEKLRNLEVNKTHKRDAVHLAKFDSLFRKGKVGDWRNHMSPE  320

Query  973   MARRLDQIVQEKFTGTGLML  1032
             MAR+LD+I Q+ F  +G  +
Sbjct  321   MARKLDEITQQNFKDSGFTV  340



>ref|XP_004514095.1| PREDICTED: cytosolic sulfotransferase 15-like [Cicer arietinum]
Length=342

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/320 (44%), Positives = 206/320 (64%), Gaps = 6/320 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             ++++ ++E ++ + SLP+E GW TP LY ++GFW +P  +Q   T   HFQ +DSD+ ++
Sbjct  20    EQDNLSQEMKDLIFSLPREKGWRTPYLYLFQGFWCQPAEIQAISTFQNHFQAKDSDVFVA  79

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKER-PDFAL  429
             T PKSGT WLKAL FA++ R+      + HPL + NPHDL+PF+E + Y   E  P+F+ 
Sbjct  80    TVPKSGTTWLKALTFAIVNRQHHFISSKNHPLLSFNPHDLVPFIEYTVYGNHENLPNFSN  139

Query  430   TNGSRLLATHLPVSLLPKSVWESKG-KVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
              +  RL  TH+P   L  S+ +S   K+VY+CRNP DT +S W F NK++ +   L  + 
Sbjct  140   FHEPRLFGTHVPFDSLSNSIKDSSNCKIVYICRNPFDTFISSWVFCNKIKQD--SLPTLG  197

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               EAF+ +C G    GPFW+H+  YWKES E P KVLFLKYE++K +    L+++A FL 
Sbjct  198   LDEAFEMFCNGKIGYGPFWNHMLGYWKESQERPKKVLFLKYEDLKDDVNFELKKLAKFLN  257

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMT  966
             CPF+ EEE  GV+  I++LCSFE +   E+NK    G    EN  LFRKG++GDW+N+++
Sbjct  258   CPFTLEEESEGVIENIIKLCSFEKMKEFEINKIGKFGR-NFENKYLFRKGEIGDWTNYLS  316

Query  967   EEMARRLDQIVQEKFTGTGL  1026
               M   L ++++EK +  GL
Sbjct  317   PSMVENLSKVIEEKLSEPGL  336



>ref|XP_009621634.1| PREDICTED: flavonol sulfotransferase-like [Nicotiana tomentosiformis]
 ref|XP_009621635.1| PREDICTED: flavonol sulfotransferase-like [Nicotiana tomentosiformis]
Length=349

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 150/325 (46%), Positives = 209/325 (64%), Gaps = 11/325 (3%)
 Frame = +1

Query  76    QENSYTEEFR---EFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
              EN Y ++ +   + L+S PKE GW+   LY Y+ FW  P  ++G   + + F  Q +D 
Sbjct  15    DENEYKKDDQNDSDMLSSFPKENGWMVKHLYQYESFWFSPAAIRGIKRVQECFNAQPTDF  74

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLE-LSYAAKERPDF  423
              L+TFPK+GT W KAL F++  R +F  +  +HPL   +PHD IPF+E +        D+
Sbjct  75    FLATFPKAGTTWFKALIFSITNRARF--DFSSHPLLAKSPHDCIPFVESIIQDETSYRDY  132

Query  424   ALT-NGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEA  600
              ++ +   L ATH+P SLLP SV  S  K+VY+ R+ KD  VS WH+M K+R   + L +
Sbjct  133   QISCSPCCLFATHIPYSLLPASVVSSGCKIVYVFRDTKDVFVSTWHYMIKIRP--KELPS  190

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAF  780
              P  +AFD +C+GV + GPFWDHV +YWK S+ENP K+LF+ YE+MKK+P + L ++A F
Sbjct  191   FPIEDAFDLFCKGVSHCGPFWDHVLDYWKASMENPNKILFIMYEDMKKDPILCLTKLAKF  250

Query  781   LGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVN--GDLGVENGVLFRKGKVGDWS  954
             L  PF+ EEE  G V  I RLC FESLS+L+VN+T V     + VEN    RKG+VGDW 
Sbjct  251   LDRPFTLEEEREGAVQEIARLCGFESLSSLKVNQTGVMHFNSIVVENRHFLRKGQVGDWK  310

Query  955   NHMTEEMARRLDQIVQEKFTGTGLM  1029
             NH+T EMA+ LD+I ++KF GT L+
Sbjct  311   NHLTLEMAQLLDEITRQKFAGTSLI  335



>gb|AAK17133.1|AF325065_1 putative steroid sulfotransferase [Arabidopsis thaliana]
 gb|AAM65471.1| putative steroid sulfotransferase [Arabidopsis thaliana]
Length=331

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/322 (45%), Positives = 212/322 (66%), Gaps = 5/322 (2%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             ++++++ ++E +  + SLP +  ++   LYNYKG W  P  LQ  L + +HF+P+D+DII
Sbjct  13    YMKDDNVSQETKNLITSLPSDKDFMGYGLYNYKGCWYYPNTLQAVLDVQKHFKPRDTDII  72

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA  426
             L++ PK GT WLK+L FA++ R+++    +THPL   NPHDL+PFLE+  YA  + PD A
Sbjct  73    LASLPKGGTTWLKSLIFAVVHREKYRGTPQTHPLLLQNPHDLVPFLEVELYANSQIPDLA  132

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
               +   + +TH+ +  L ++  ++  K VY+CR  KDT VS WH+ N L      ++   
Sbjct  133   KYSSPMIFSTHMHLQALREATTKA-CKTVYVCRGIKDTFVSGWHYRNMLHRT--KMDQAT  189

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
             F   FD+YCRGV   GP+W+HV  YWK SLE    VLF+KYEE+ +EP V ++R+A FL 
Sbjct  190   FELMFDAYCRGVLLYGPYWEHVLSYWKGSLEAKENVLFMKYEEIIEEPRVQVKRLAEFLE  249

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMT  966
             CPF++EEEE G V  IL+LCS  +LSNLEVNK      +GV++ V FRKG+VGDW NH+T
Sbjct  250   CPFTKEEEESGSVEEILKLCSLRNLSNLEVNKNGTT-RIGVDSQVFFRKGEVGDWKNHLT  308

Query  967   EEMARRLDQIVQEKFTGTGLML  1032
              +MA+  D+I+  +   +GL+ 
Sbjct  309   PQMAKTFDEIIDYRLGDSGLIF  330



>ref|XP_006289894.1| hypothetical protein CARUB_v10003509mg [Capsella rubella]
 gb|EOA22792.1| hypothetical protein CARUB_v10003509mg [Capsella rubella]
Length=360

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 150/313 (48%), Positives = 203/313 (65%), Gaps = 6/313 (2%)
 Frame = +1

Query  97    EFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             EF+E L+SLPKE GW T  LY ++GFW +   +Q  ++  +HF+P  +D++L+T PKSGT
Sbjct  46    EFQEMLDSLPKERGWRTRYLYLFQGFWCQAKEIQAIMSFQRHFRPFPNDVVLATIPKSGT  105

Query  277   VWLKALAFALITRKQF--LAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRL  447
              WLKAL F ++ R +F  ++    HPL T+NPHDL+PF E   YA    PD +     R 
Sbjct  106   TWLKALTFTILNRHRFDPVSSSTDHPLLTSNPHDLVPFFEYKLYADGAVPDLSGLARPRA  165

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
              ATH+P   L  S+ E   KVVYLCRNP DT +S WHF+N ++SE   +  +   E FD 
Sbjct  166   FATHVPFGSLKDSIEEPGVKVVYLCRNPFDTFISSWHFINNIKSE--SVSPVSLDEGFDL  223

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             YCRGV   GPFW+H+  Y++ESL+ P KVLFLKYE++K++ E +L+++A FLG PF+EEE
Sbjct  224   YCRGVIGFGPFWEHMLGYYRESLKRPEKVLFLKYEDLKEDIETNLKKLANFLGLPFTEEE  283

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRL  987
             E  GVV  I  LCSF ++  LEVNK S       EN  LFRKG+V DW N+++     RL
Sbjct  284   ERKGVVKAIADLCSFGNMKKLEVNK-SKKSIKNFENRFLFRKGEVSDWVNYLSPSQVERL  342

Query  988   DQIVQEKFTGTGL  1026
               +V +K  G+GL
Sbjct  343   SALVDDKLGGSGL  355



>ref|XP_008790317.1| PREDICTED: flavonol 4'-sulfotransferase-like [Phoenix dactylifera]
Length=343

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 208/312 (67%), Gaps = 6/312 (2%)
 Frame = +1

Query  94    EEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSG  273
             E++  F+++LP E GW+      Y+GFW    FL GA+ I Q F+ +  DI L +FPKSG
Sbjct  30    EDYDNFISTLPLEKGWVPSR--KYQGFWYPEGFLLGAMAIQQRFKARPDDIFLISFPKSG  87

Query  274   TVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGSRLLA  453
             T WLKALAFA +TRKQ+   +  HPL + NPHD + +++  +A  +          R+LA
Sbjct  88    TTWLKALAFATMTRKQYPLAR--HPLLSLNPHDCVAYMDELFAIGQASKVEALPSPRILA  145

Query  454   THLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYC  633
             TH+P S LP SV  S  +++Y+ R+PKD +VS+WHF+ + RS    ++ +PF EAF+++C
Sbjct  146   THMPYSWLPDSVAGSGCRIIYIARDPKDALVSYWHFIME-RSRSPEMKKIPFMEAFETFC  204

Query  634   RGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeee  813
              G    GP WDH  EYW+ESL+   KVLFL+YE + ++P  +++R+A F+GCPFSEEE+E
Sbjct  205   EGKVPFGPIWDHSLEYWRESLKRTEKVLFLRYEGLLEDPVANVKRLAEFVGCPFSEEEQE  264

Query  814   CGVVSGILRLCSFESLSNLEVNKTSVNGDL-GVENGVLFRKGKVGDWSNHMTEEMARRLD  990
              G+V  I+RLCS E++ +LEVNK   +G +  V     FRKG  GDW NHM+ EMARRLD
Sbjct  265   GGMVEEIVRLCSIENMKSLEVNKDGKHGPIYPVAKSSFFRKGTKGDWRNHMSLEMARRLD  324

Query  991   QIVQEKFTGTGL  1026
              I++EK  G+GL
Sbjct  325   VIIEEKLQGSGL  336



>ref|XP_004292840.1| PREDICTED: cytosolic sulfotransferase 15-like [Fragaria vesca 
subsp. vesca]
Length=331

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 152/323 (47%), Positives = 208/323 (64%), Gaps = 11/323 (3%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWL-EPFFLQGALTIHQHFQPQDSDIILSTFPK  267
             + E +EFL SLPKE GWL    Y Y+GFW      +Q  +   + FQ +DSDI++++ PK
Sbjct  10    SNECKEFLLSLPKERGWLHLPQYQYQGFWCARADIVQATIAFQRQFQARDSDIVVASVPK  69

Query  268   SGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALT---N  435
              GT WLKAL FA++ R +F  E E HPL T+N H L+PFLE+  Y     PDF+      
Sbjct  70    CGTTWLKALTFAVVNRHRF--EIEAHPLLTSNSHKLVPFLEVDLYINNRVPDFSSKFPGE  127

Query  436   GSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPE  615
               RL ATH+P   L  ++ +S  K+VY+CRNP D+ VS+WHF+NK+R +  G   M   E
Sbjct  128   PRRLFATHIPFPSL-GTITKSNCKIVYVCRNPFDSFVSYWHFVNKIRQQSIG--PMSLDE  184

Query  616   AFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPF  795
             AFD YC+G+   GPFWDH+  YWKESL+ P  VLF KYE+MKK+   HL+ +A F+  PF
Sbjct  185   AFDRYCQGLHPYGPFWDHMLGYWKESLKRPNNVLFFKYEDMKKDVVSHLKALAKFIDYPF  244

Query  796   SeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEM  975
             +EEEE   V+  I +LCSFE++  LEVNKT     + VE  +LFRK +VGDW N++T  M
Sbjct  245   TEEEERNSVIEDIAKLCSFETMKELEVNKTGTFV-MNVEKKILFRKAEVGDWVNYLTPMM  303

Query  976   ARRLDQIVQEKFTGTGLML*SDP  1044
               R+ ++++EK  G+GL +  +P
Sbjct  304   KERMSKLIEEKLGGSGLTIIVNP  326



>gb|AFK33848.1| unknown [Lotus japonicus]
Length=339

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/326 (45%), Positives = 207/326 (63%), Gaps = 11/326 (3%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             Q  +E S + E +E + +LP+E GW    LY ++GFW  P  +Q   T  + FQ +DSD+
Sbjct  13    QSREEESLSRECKELIPTLPREKGWTVRYLYLFQGFWCNPHRIQPIYTFQKQFQAKDSDV  72

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAK----ER  414
             I++T+PKSGT WLKAL FA++ R  F    E HPL T+NPH L+PF E S   +    + 
Sbjct  73    IVATYPKSGTTWLKALTFAVVNRHNF-PSSENHPLLTSNPHHLVPFFETSIYGEMIHDQI  131

Query  415   PDFALTNGSRLLATHLPVSLLPKSVWE-SKGKVVYLCRNPKDTVVSFWHFMNKLRSELRG  591
             PD +     R+  TH+P   L KS+ + SK K++YLCRNP D  VS W F+NK++  L  
Sbjct  132   PDLSNVIERRIFGTHVPFPSLAKSIKDNSKCKIIYLCRNPFDNFVSLWMFVNKVK--LES  189

Query  592   LEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRM  771
                +   EAF+ +C G    GPFW+H+  YWKES+  P KVLFLKYE++K +   +++R+
Sbjct  190   APTLMLEEAFEMHCNGTTRYGPFWNHILGYWKESIARPEKVLFLKYEDLKDDVNFYVKRV  249

Query  772   AAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKT-SVNGDLGVENGVLFRKGKVGD  948
               FLGCPF+ EEE  GV+  I++LCSFE +  LEVNK  +   D+G  N   FRKG+VGD
Sbjct  250   GEFLGCPFTHEEESSGVIEDIVQLCSFEKMKELEVNKCGTFTRDVG--NKHFFRKGEVGD  307

Query  949   WSNHMTEEMARRLDQIVQEKFTGTGL  1026
             W N+++  M  +L +I++EKF G+GL
Sbjct  308   WVNYLSPSMVEKLCKIIEEKFRGSGL  333



>ref|XP_010491300.1| PREDICTED: cytosolic sulfotransferase 15-like [Camelina sativa]
Length=360

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/313 (48%), Positives = 204/313 (65%), Gaps = 6/313 (2%)
 Frame = +1

Query  97    EFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             EF+E L+SLPKE GW T  LY ++GFW +   +Q  ++  +HF+   +D++L+T PKSGT
Sbjct  46    EFQEMLDSLPKERGWRTRYLYLFQGFWCQAKEIQAIMSFQKHFRSLPNDVVLATIPKSGT  105

Query  277   VWLKALAFALITRKQF--LAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRL  447
              WLKAL F ++ R +F  ++    HPL T+NPHDL+PF E   YA    PD +     R 
Sbjct  106   TWLKALTFTILKRHRFDPVSSTTNHPLLTSNPHDLVPFFEYKLYANGAVPDLSGLARPRT  165

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
              ATH+P   L  S+ E   KVVYLCRNP DT +S WHF+N ++SE   +  +   E FD 
Sbjct  166   FATHVPFGSLKDSIEEPGVKVVYLCRNPFDTFISSWHFINNIKSE--SVSPVLLDEGFDL  223

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             YCRGV   GPFW+H+  Y++ESL+ P KV FLKYE++K++ E +L+++A+FLG PF++EE
Sbjct  224   YCRGVIGFGPFWEHMLGYYRESLKRPEKVFFLKYEDLKEDIETNLKKLASFLGLPFTKEE  283

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRL  987
             E+ GVV  I  LCSFE+L  LEVNK S       EN  LFRKG+V DW N+++     RL
Sbjct  284   EQKGVVKAIADLCSFENLKKLEVNK-SKKSIKNFENRFLFRKGEVSDWVNYLSPSQVERL  342

Query  988   DQIVQEKFTGTGL  1026
               +V +K  G+GL
Sbjct  343   SALVDDKLGGSGL  355



>gb|KEH21570.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=336

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/333 (43%), Positives = 208/333 (62%), Gaps = 14/333 (4%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             Q  +  EE +  + SLPKE G+     Y ++GFW     +Q  ++   HFQ +DSD++++
Sbjct  12    QLEAIGEECKNLILSLPKEYGFGNQYFYFFQGFWTTAAQIQSIISFQNHFQAKDSDVVVA  71

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTN  435
             T PKSGT WLKAL FA+I R  F +    HPL T+NPH+L+PF EL+        FA  +
Sbjct  72    TVPKSGTTWLKALTFAIINRHHF-SSLHNHPLLTSNPHELVPFFELNIYTDISWQFAKLD  130

Query  436   -----GSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEA  600
                    R+  TH+P   L KS+ ES  K++Y+CRNP DT VS+W+FMNK+    + L  
Sbjct  131   LLNMIEPRIFGTHIPFHSLAKSIKESNCKIIYICRNPFDTFVSYWNFMNKIALN-QSLPT  189

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAF  780
                 + F+ YC G+C+ GPFWDH+  Y KES   P K+LFLKYE++K++   H++R+A F
Sbjct  190   STLEDDFEKYCEGLCHVGPFWDHMLGYLKESKARPNKILFLKYEDLKEDINFHVKRIAEF  249

Query  781   LGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNH  960
             LGCPF++EEE  GV+  I+ LCSFE +  LE NK+ V G +  +    FRKG++GDW N+
Sbjct  250   LGCPFTQEEESNGVIENIINLCSFEKMKGLEANKSGVLGKI-YDKKYFFRKGEIGDWINY  308

Query  961   MTEEMARRLDQIVQEKFTGTGLML*SDPIFNVC  1059
             ++  M  +L +I++EK +G+G+       FNVC
Sbjct  309   LSPSMVDKLSKIIEEKLSGSGIS------FNVC  335



>ref|NP_565305.1| cytosolic sulfotransferase 11 [Arabidopsis thaliana]
 sp|Q8RV79.1|SOT11_ARATH RecName: Full=Cytosolic sulfotransferase 11; Short=AtSOT11 [Arabidopsis 
thaliana]
 gb|AAD20077.2| putative steroid sulfotransferase [Arabidopsis thaliana]
 gb|AAM12960.1| putative steroid sulfotransferase [Arabidopsis thaliana]
 gb|AAN72119.1| putative steroid sulfotransferase [Arabidopsis thaliana]
 gb|AEC05745.1| cytosolic sulfotransferase 11 [Arabidopsis thaliana]
Length=351

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/322 (45%), Positives = 212/322 (66%), Gaps = 5/322 (2%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             ++++++ ++E +  + SLP +  ++   LYNYKG W  P  LQ  L + +HF+P+D+DII
Sbjct  33    YMKDDNVSQETKNLITSLPSDKDFMGYGLYNYKGCWYYPNTLQAVLDVQKHFKPRDTDII  92

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA  426
             L++ PK GT WLK+L FA++ R+++    +THPL   NPHDL+PFLE+  YA  + PD A
Sbjct  93    LASLPKGGTTWLKSLIFAVVHREKYRGTPQTHPLLLQNPHDLVPFLEVELYANSQIPDLA  152

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
               +   + +TH+ +  L ++  ++  K VY+CR  KDT VS WH+ N L      ++   
Sbjct  153   KYSSPMIFSTHMHLQALREATTKA-CKTVYVCRGIKDTFVSGWHYRNMLHRT--KMDQAT  209

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
             F   FD+YCRGV   GP+W+HV  YWK SLE    VLF+KYEE+ +EP V ++R+A FL 
Sbjct  210   FELMFDAYCRGVLLYGPYWEHVLSYWKGSLEAKENVLFMKYEEIIEEPRVQVKRLAEFLE  269

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMT  966
             CPF++EEEE G V  IL+LCS  +LSNLEVNK      +GV++ V FRKG+VGDW NH+T
Sbjct  270   CPFTKEEEESGSVEEILKLCSLRNLSNLEVNKNGTT-RIGVDSQVFFRKGEVGDWKNHLT  328

Query  967   EEMARRLDQIVQEKFTGTGLML  1032
              +MA+  D+I+  +   +GL+ 
Sbjct  329   PQMAKTFDEIIDYRLGDSGLIF  350



>ref|XP_011020447.1| PREDICTED: cytosolic sulfotransferase 15-like [Populus euphratica]
Length=329

 Score =   287 bits (734),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 149/324 (46%), Positives = 206/324 (64%), Gaps = 9/324 (3%)
 Frame = +1

Query  67    QFLQEN---SYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQD  237
             Q + EN   + T+E  + L+SLPKE  W +  +Y Y+GFW     +   +   +HF+ Q 
Sbjct  5     QMITENNNLAETDEIADLLSSLPKEKSWRSGYVYRYQGFWCPEKQIPALIAFQKHFRAQK  64

Query  238   SDIILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKER  414
             +D IL T PKSGT WLKALAF+++ R ++       PL+  NPHDL+PF E   YA K+ 
Sbjct  65    TDTILVTMPKSGTTWLKALAFSIMNRAKYTPS--CSPLNYVNPHDLVPFFEYGLYANKQI  122

Query  415   PDFALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGL  594
             PD +     R+ ATH+P   LP S+  S  ++V LCRNP D  +S WHF +K R E   L
Sbjct  123   PDLSTFPSPRMFATHVPYPSLPDSIKNSGCRLVCLCRNPFDNFISLWHFASKARHE--SL  180

Query  595   EAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMA  774
               +   + FDS+C G+   GPF+DHV  YW+ESLE P +VLFL YE+MK++    ++R+A
Sbjct  181   GPLSLEDCFDSFCDGLGGFGPFFDHVLGYWRESLERPEEVLFLTYEDMKEDINSQMKRLA  240

Query  775   AFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWS  954
              FLGCPFS EEE  GV+ GI +LCSF +L + E+NKT     L  EN  LFR+G+VGDW 
Sbjct  241   EFLGCPFSLEEEADGVLEGISKLCSFSNLKDKEINKTG-KSLLYFENKTLFRRGEVGDWV  299

Query  955   NHMTEEMARRLDQIVQEKFTGTGL  1026
             N++T EM  RL++I+++K  G+GL
Sbjct  300   NYLTPEMVDRLNKIMEQKLAGSGL  323



>emb|CDY55733.1| BnaAnng13870D [Brassica napus]
Length=589

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 154/312 (49%), Positives = 199/312 (64%), Gaps = 11/312 (4%)
 Frame = +1

Query  97    EFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             E R+ ++SLP E GWL   +Y ++G W     LQG LT  +HF+ +DSDIIL T PKSGT
Sbjct  283   ETRDLISSLPSEKGWLVSQIYQFQGRWHTEALLQGILTCQKHFKAKDSDIILVTNPKSGT  342

Query  277   VWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGSRLLAT  456
              WLK+L FALI R +F      HPL   NPH L+PF+E  Y      DF+L    RL+ T
Sbjct  343   TWLKSLVFALINRHKFPVSSGDHPLLVTNPHLLVPFMEGVYYESPDFDFSLLPFPRLMNT  402

Query  457   HLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCR  636
             H+    LP+SV  S  K+VY CRNPKD  VS WHF  KL  +       P  +A +++C+
Sbjct  403   HISHLSLPESVKSSSCKIVYCCRNPKDMFVSLWHFGKKLAPQETA--DYPIEKAVEAFCQ  460

Query  637   GVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeC  816
             G    GPFWDHV EYW  SLENP KVLF+ YEE+KK+ EV ++R+A F+GC F+ EEE  
Sbjct  461   GKFIAGPFWDHVLEYWYASLENPNKVLFVTYEELKKQTEVEVKRIAEFIGCGFTAEEE--  518

Query  817   GVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHMTEEMARRLD  990
               VS I++LCSFESLS+LEVNK    G L  G+E    FRKG+ G W + ++E +A  +D
Sbjct  519   --VSEIVKLCSFESLSSLEVNK---QGKLPNGIETNAFFRKGETGGWRDTLSESLADAID  573

Query  991   QIVQEKFTGTGL  1026
             +  +EKF G+GL
Sbjct  574   RTTEEKFGGSGL  585



>ref|XP_010534168.1| PREDICTED: cytosolic sulfotransferase 12-like [Tarenaya hassleriana]
 ref|XP_010523512.1| PREDICTED: cytosolic sulfotransferase 12-like [Tarenaya hassleriana]
Length=336

 Score =   286 bits (733),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 153/327 (47%), Positives = 202/327 (62%), Gaps = 13/327 (4%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             +L +   TEE ++ + SLP++ GW+    Y ++GFWL P  LQG +   +HFQ QDSD+I
Sbjct  11    YLGDEGMTEEIKDMMTSLPRQKGWMVNHTYQFQGFWLPPSLLQGTINCQKHFQAQDSDVI  70

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSY-----AAKER  414
             L T PKSGT WLKAL FALI R +F   Q  HPL T+NPH L+ FLE  Y        + 
Sbjct  71    LVTNPKSGTTWLKALIFALINRNKFHDCQHQHPLLTHNPHSLVSFLEGVYYNYPHGLPDD  130

Query  415   PDFALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGL  594
                + ++ +R   TH+    LP S+  S  K+VY CRNPKD  VS WHF +KL S+    
Sbjct  131   VVSSSSSCTRFFNTHMAHVSLPDSIKGSSCKIVYCCRNPKDMFVSLWHFGHKLASQ--ET  188

Query  595   EAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMA  774
                P  EA   +C G    GPFWDHV  YW+ S +NP KV F+ YEEMK+ P  HL+RMA
Sbjct  189   LVCPIEEAVKLFCEGSFIGGPFWDHVLGYWEASQKNPDKVFFVTYEEMKERPRTHLKRMA  248

Query  775   AFLGCPFSe-eeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVG  945
              FLGC F++ EEEE G+V  I+RLCSFESLSNLEVN+    G L  G+E    FRKG++ 
Sbjct  249   DFLGCSFTKEEEEEKGMVDEIIRLCSFESLSNLEVNR---KGKLPNGIETNAFFRKGQIE  305

Query  946   DWSNHMTEEMARRLDQIVQEKFTGTGL  1026
              W + +T+ +A  +D+  ++K  G+G 
Sbjct  306   GWRDTLTDSLAEEIDRTSEQKLHGSGF  332



>ref|XP_008779204.1| PREDICTED: cytosolic sulfotransferase 12-like [Phoenix dactylifera]
Length=287

 Score =   285 bits (728),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 151/290 (52%), Positives = 192/290 (66%), Gaps = 11/290 (4%)
 Frame = +1

Query  163   YKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGTVWLKALAFALITRKQFLAEQET  342
             YKGFW+    L   + +  HF+P+ SD+IL T PKSGT WLKAL FA++ R ++   Q  
Sbjct  2     YKGFWVPESSLPRVMALQDHFKPRPSDLILVTPPKSGTTWLKALLFAIMNRTKYTFAQ--  59

Query  343   HPLHTNNPHDLIPFLELSYAAKERPDFALTNGSRLLATHLPVSLLPKSVWESKGKVVYLC  522
             HPL T NPH+ +PFLE+ +   +  D       RLLATHLP S+LP SV +   ++VYLC
Sbjct  60    HPLLTRNPHECVPFLEILFR-DQISDLEAIPPPRLLATHLPYSILPTSVADCGCRLVYLC  118

Query  523   RNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLEN  702
             R+PKD VVS WHF  K R +      M   EAF+ +C GV  +GP WDH+ EYW+ESL  
Sbjct  119   RDPKDVVVSLWHFARKDRPD------MGLSEAFELFCDGVSLSGPIWDHILEYWRESLRR  172

Query  703   PGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNK  882
               KVLFLKYEEM  EP  ++RR+A F+G PFSEEEE+ GVV  I++LC FE LS++EVNK
Sbjct  173   SEKVLFLKYEEMMAEPVGNVRRLAEFVGRPFSEEEEKDGVVEEIVQLCRFEKLSSMEVNK  232

Query  883   TSVN--GDLGVENGVLFRKGKVGDWSNHMTEEMARRLDQIVQEKFTGTGL  1026
                   G L +     FRKGKVGDW+NHM+ EM  +LD+IVQEK  G+GL
Sbjct  233   KGAYELGGLTLPRESFFRKGKVGDWANHMSREMGEKLDRIVQEKMAGSGL  282



>ref|XP_008393378.1| PREDICTED: cytosolic sulfotransferase 13-like [Malus domestica]
Length=323

 Score =   286 bits (731),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 144/314 (46%), Positives = 202/314 (64%), Gaps = 8/314 (3%)
 Frame = +1

Query  103   REFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGTVW  282
             +E +++LPK+TGW     Y Y+ FW    FL+G +   Q F+ +DSD+ L+TFPK GT W
Sbjct  10    QETISTLPKDTGWAAEHYYQYQNFWYPQVFLEGVIWAQQDFRARDSDVFLATFPKCGTTW  69

Query  283   LKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGS-RLLATH  459
             +KAL  A+  RK    +  +HPL T NPHD++ ++EL        ++  +  S RLLATH
Sbjct  70    VKALMIAIKNRKD--CDYSSHPLLTKNPHDIVRYIELLVHQDNPVEYLDSMASPRLLATH  127

Query  460   LPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCRG  639
             +P S LP SV +S  +VVY+ RNPKD +VS W F  KLRS++  L  +P  E F+ +C+G
Sbjct  128   VPHSSLPNSVLDSDTRVVYVARNPKDVLVSLWAFSEKLRSKVYRLPPLPLEEGFELFCKG  187

Query  640   VCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeCG  819
             V   GPFWDHV  YW+ SL+NP KVLF K+E++K + E +++R+A F+G PFS EEE+ G
Sbjct  188   VALAGPFWDHVLGYWEASLKNPNKVLFFKFEDLKADTEGYVKRLAEFIGYPFSSEEEKEG  247

Query  820   VVSGILRLCSFESLSNLEVNKTSV-----NGDLGVENGVLFRKGKVGDWSNHMTEEMARR  984
              V  I++ CSFE+LS+LEVNK+         D    N V FR+G+ GD   H+T EM  R
Sbjct  248   AVQXIIKFCSFENLSSLEVNKSGTYHVGPKTDEKFSNDVFFRRGETGDSQKHLTPEMLER  307

Query  985   LDQIVQEKFTGTGL  1026
             LD+I ++KF  + L
Sbjct  308   LDKITEQKFGASXL  321



>ref|XP_007037642.1| Flavonol 4'-sulfotransferase, putative [Theobroma cacao]
 gb|EOY22143.1| Flavonol 4'-sulfotransferase, putative [Theobroma cacao]
Length=354

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 206/324 (64%), Gaps = 13/324 (4%)
 Frame = +1

Query  79    ENSYTEEFREFLNSLPKETGWLTPD-LYNYKGFWLEP-FFLQGALTIHQHFQPQDSDIIL  252
             E +Y +++RE L +LP    W+  + L  Y+GFWL P   L+  + I   F+ Q +DI L
Sbjct  32    EMAYYKKYREILPTLPVGKAWMIAEHLVQYQGFWLSPNLALKAVIWIQDEFKVQPTDIFL  91

Query  253   STFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALT  432
             ++FPK+GT WLKAL FA I R     +  THPL T +PH+  PFLE +Y  +     +  
Sbjct  92    ASFPKTGTTWLKALIFATINRTH--CDFSTHPLLTRSPHECFPFLE-AYVHESHETISGL  148

Query  433   NG---SRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
             +     RLLATH P +LLP S+  S  K +Y+CR+PKD +VS W F NKLR   + L  +
Sbjct  149   DALPPPRLLATHFPHTLLPNSMITSGCKFIYICRDPKDVLVSTWLFSNKLRP--KELPPL  206

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                EAF+ +C+G+ + GP+WDHV  YWK SLENP K+LFLKYE++KK+P   ++R+A FL
Sbjct  207   SLQEAFELFCQGISHFGPYWDHVLGYWKWSLENPEKILFLKYEDLKKDPSAVVKRLAEFL  266

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSV---NGDLGVENGVLFRKGKVGDWS  954
             G  FS EEE  GV   I RLCSFESLSNLEVNKT       DL + N + FRKG+ GD  
Sbjct  267   GVHFSLEEEGKGVAQEITRLCSFESLSNLEVNKTKTYKFKSDLVLYNNIFFRKGQTGDSK  326

Query  955   NHMTEEMARRLDQIVQEKFTGTGL  1026
             NH+T EM + LD+  QEK  G+GL
Sbjct  327   NHLTNEMIQHLDKTTQEKLAGSGL  350



>ref|XP_006395675.1| hypothetical protein EUTSA_v10004585mg [Eutrema salsugineum]
 gb|ESQ32961.1| hypothetical protein EUTSA_v10004585mg [Eutrema salsugineum]
Length=326

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 152/321 (47%), Positives = 197/321 (61%), Gaps = 11/321 (3%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             +L +   T+E R+ ++SLP E GWL   +Y ++G W     LQG L   +HF+ QDSDII
Sbjct  11    YLGDEDLTQETRDLISSLPSEKGWLVSQMYQFQGRWHTQALLQGILKCQKHFEAQDSDII  70

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFAL  429
             L T PKSGT WLKAL FALI R +       HPL   NPH L+PFLE  Y      DF+ 
Sbjct  71    LVTNPKSGTTWLKALVFALINRHKLPVSSGKHPLLVTNPHLLVPFLEGVYYESPGFDFSA  130

Query  430   TNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
                 RL+ TH+    LP+SV  S  K+VY CRNPKD  VS WHF  KL  E       P 
Sbjct  131   LPSPRLMNTHISHLSLPESVKSSSCKIVYCCRNPKDMFVSLWHFGKKLAPEETA--DYPI  188

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
              +A +++C G    GPFWDHV EYW  S ENP KVLF+ YE++KK+    ++R+A FLGC
Sbjct  189   EKAVEAFCEGKFIGGPFWDHVLEYWYTSRENPNKVLFVTYEDLKKQTGNEIKRIAEFLGC  248

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHM  963
              F  +EE    V  I+RLCSFESLS LEVN+    G L  G+E    FRKG++G W + +
Sbjct  249   GFIGDEE----VRDIVRLCSFESLSTLEVNR---EGKLPNGMETKAFFRKGEIGGWRDTL  301

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             +E +A ++D+ ++EKF G+GL
Sbjct  302   SESLAEQIDKTMEEKFQGSGL  322



>ref|XP_002876895.1| hypothetical protein ARALYDRAFT_484284 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53154.1| hypothetical protein ARALYDRAFT_484284 [Arabidopsis lyrata subsp. 
lyrata]
Length=333

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/324 (44%), Positives = 214/324 (66%), Gaps = 6/324 (2%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             ++++++ ++E +  + SLP +  ++   LYNYKG W  P  LQ  L   +HF+P+D+DII
Sbjct  12    YMKDDNVSQETKNLIASLPSDKDFMGYGLYNYKGCWYYPNTLQAVLDFQKHFKPRDTDII  71

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA  426
             L++ PK GT WLK+L FA++ R+++    +THPL + NPHDL+PFLE+  YA  + PD  
Sbjct  72    LASLPKGGTTWLKSLVFAVVHREKYRENPQTHPLLSQNPHDLVPFLEIELYANSQIPDLT  131

Query  427   LTNGSRLLATHLPVSLLPKSVWESKG--KVVYLCRNPKDTVVSFWHFMNKLRSELRGLEA  600
                   + +TH  +  L ++  ++    K+VY+CR  KDT VS WH+ N L      ++ 
Sbjct  132   KFPSPMIFSTHTHLQALREATTKASSPCKIVYVCRGIKDTFVSGWHYRNMLHRT--KMDQ  189

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAF  780
               F   FD+YCRGV   GP+W+HV  YWK SLE+   VLF+KYEE+ +EP + ++R+A F
Sbjct  190   ATFELMFDAYCRGVLLYGPYWEHVLSYWKWSLEDKENVLFMKYEEIIEEPRIQVKRLAEF  249

Query  781   LGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNH  960
             L CPF+ EEEECG V  IL+LCS  +LSNLEVNK      +G+++ + FRKG+VGDW NH
Sbjct  250   LKCPFTAEEEECGSVEEILKLCSLRNLSNLEVNKKGTT-RIGLDSQIFFRKGEVGDWKNH  308

Query  961   MTEEMARRLDQIVQEKFTGTGLML  1032
             +T +MA+ +D+I++ +  G+GL+ 
Sbjct  309   LTPQMAKTVDEIIECRLRGSGLIF  332



>gb|KFK38089.1| hypothetical protein AALP_AA3G068100 [Arabis alpina]
Length=325

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 199/316 (63%), Gaps = 12/316 (4%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKS  270
             T++ R+F++SLP+E GWL   +Y Y+G W  P  LQG L   +HFQ +DSDIIL T PKS
Sbjct  14    TQQARDFISSLPREKGWLVSQMYQYQGRWHTPALLQGILNCQKHFQAKDSDIILVTNPKS  73

Query  271   GTVWLKALAFALITRKQFLAEQET--HPLHTNNPHDLIPFLELSYAAKERPDFALTNGSR  444
             GT WLKAL FAL+ R +F     +  HPL   NPH L+PFLE  Y      DF+     R
Sbjct  74    GTTWLKALVFALLNRHKFPVSSSSGDHPLLVTNPHLLVPFLEGVYYESPDFDFSELPSPR  133

Query  445   LLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFD  624
             L+ TH+    LP+ V  S  K+VY CRNPKD  VS WHF  KL  E       P  +A +
Sbjct  134   LMNTHISHFSLPEPVQNSACKIVYCCRNPKDMFVSLWHFGKKLAPEETA--DYPIEKAVE  191

Query  625   SYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSee  804
             ++C G    GPFWDHV EYW  S ENP KVLF+ YEE+K +    ++R+A FLGC F+ E
Sbjct  192   AFCEGKFIGGPFWDHVLEYWYASRENPNKVLFVTYEELKTQTGAEVKRIAEFLGCGFTGE  251

Query  805   eeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHMTEEMA  978
             EE+   V  I++LCSFESLSNLEVN+    G L  G+E   LFRKG++G W + ++E +A
Sbjct  252   EEQ---VEEIVKLCSFESLSNLEVNR---QGKLPNGMETKALFRKGEIGGWRDTLSESLA  305

Query  979   RRLDQIVQEKFTGTGL  1026
               +D  +++KF G+GL
Sbjct  306   EEIDAKMEKKFQGSGL  321



>emb|CDX99017.1| BnaC09g48180D [Brassica napus]
Length=370

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 148/313 (47%), Positives = 203/313 (65%), Gaps = 6/313 (2%)
 Frame = +1

Query  97    EFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGT  276
             EF+E L SLPKE GW T  LY ++GFW +   +Q  ++  +HF+   +D++L+T PKSGT
Sbjct  56    EFQEMLESLPKERGWRTRYLYLFQGFWCQSKEIQAIMSFQKHFKSLQNDVVLATIPKSGT  115

Query  277   VWLKALAFALITRKQF--LAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRL  447
              WLKAL F ++ R +F  ++    HPL T+NPHDL+PF E   Y   + PD +     R 
Sbjct  116   TWLKALTFTVLNRHRFDPVSSTTDHPLLTSNPHDLVPFFEYKLYENGDVPDLSGLASPRT  175

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
              ATH+P   L  S+ E   KVVY CRNP DT +S WH++N ++SE   +  +   E FD 
Sbjct  176   FATHVPFGSLKDSIEEPGVKVVYFCRNPFDTFISSWHYINNIKSE--AVSPVSLEEGFDL  233

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             YCRGV   GPFW+H+  YWKESL  P KVLFL+YE++K++ E +L+++A+FL  PF+EEE
Sbjct  234   YCRGVIGFGPFWEHMLGYWKESLRTPEKVLFLRYEDLKQDMESNLKKLASFLDVPFTEEE  293

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRL  987
             ++ GVV  I  LCSFE+L  LEVNK+S +     EN  LFRKG+V DW N+++   A RL
Sbjct  294   DQKGVVHSISDLCSFENLKKLEVNKSSKSIK-NFENRHLFRKGEVSDWVNYLSPPQAERL  352

Query  988   DQIVQEKFTGTGL  1026
               +V +K  G GL
Sbjct  353   SALVDDKLGGYGL  365



>ref|XP_002519139.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
 gb|EEF43350.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
Length=339

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 202/316 (64%), Gaps = 11/316 (3%)
 Frame = +1

Query  94    EEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQ--HFQPQDSDIILSTFPK  267
             + + E L +LPK  GW    L  YKGFWL        L   Q  HF  +  DI+L+T+PK
Sbjct  27    KHYNEILPTLPKSKGWWFDHLLQYKGFWLSSDVAIKGLMFLQDHHFISKPDDIVLATYPK  86

Query  268   SGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGSRL  447
              GT WL+AL FA I R  +  +  THPL T+NP D +PFLE  Y  ++          RL
Sbjct  87    CGTTWLRALIFATINRTSY--DFATHPLLTSNPQDFVPFLE-GYVFQDPSVLENLPLPRL  143

Query  448   LATHLPVSLLPKSVWE---SKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEA  618
             L+THLP SL P+S+     S  + VY+CR+PKD +VS WHF  KLR   +G       +A
Sbjct  144   LSTHLPYSLFPESITAATASGSRFVYICRDPKDVLVSKWHFAQKLRP--KGHPPFSLQDA  201

Query  619   FDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFS  798
             F+ +C GV + GP+WDHV  YWK SLE+P KVLFLKYE+MK+EP VH++R+A +LG PFS
Sbjct  202   FEMFCDGVSHYGPYWDHVLSYWKASLESPRKVLFLKYEDMKREPLVHVKRLAEYLGKPFS  261

Query  799   eeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMA  978
              EE+  GV   I+ LCSF+ +SNLEVNK+  +  L ++N   FRKG++GDW N++T +MA
Sbjct  262   TEEQNEGVAEEIIELCSFKKMSNLEVNKSKSSNYL-IKNSDFFRKGEIGDWRNNLTPDMA  320

Query  979   RRLDQIVQEKFTGTGL  1026
              R+D+I +EK  GTGL
Sbjct  321   ARVDEITKEKLQGTGL  336



>ref|XP_006377316.1| hypothetical protein POPTR_0011s04810g [Populus trichocarpa]
 gb|ERP55113.1| hypothetical protein POPTR_0011s04810g [Populus trichocarpa]
Length=336

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/318 (45%), Positives = 206/318 (65%), Gaps = 10/318 (3%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKS  270
              + + E +++LPK  G    D Y Y+GFW  PFFL+  +++ +HF PQ +DI +++FPK+
Sbjct  23    AKNYNEVMSTLPKVKGLRGDDYYLYQGFWYAPFFLERLMSVQEHFHPQSTDIFVASFPKT  82

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAK-ERPDFALTNGSRL  447
             GT WLKAL FA+ TR +      +  L +  PHD +PFL  + A      D A+     L
Sbjct  83    GTTWLKALTFAIFTRSRLSGSTTSS-LLSKMPHDCVPFLNYNLAQNPSNRDLAIP----L  137

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
             L+TH+P S LPKS+  S  K++Y+CR+ KD  VS W+F   L+   + +E +P  EAF+ 
Sbjct  138   LSTHVPYSCLPKSIISSCCKIIYICRDAKDAFVSLWYFHATLQRS-KNVEPLPLEEAFEL  196

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             +C G+ N GP+W+HV  YW+ SLE P K+LFL YEEMKK+   H++++A F+GC F+ EE
Sbjct  197   FCNGIANFGPYWNHVLGYWRASLEFPEKILFLTYEEMKKDTAAHVKKLAEFMGCSFTLEE  256

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTS---VNGDLGVENGVLFRKGKVGDWSNHMTEEMA  978
             EE G V  I+ +CSFE LSNLEVNK     ++  + + N + FRKG++GDW+NH+T EM 
Sbjct  257   EEEGEVQKIIGMCSFEKLSNLEVNKNGKCLLDISIPIPNSIFFRKGEIGDWANHLTPEMG  316

Query  979   RRLDQIVQEKFTGTGLML  1032
              RLD I++ K  G+GL L
Sbjct  317   ARLDDIMERKLKGSGLKL  334



>ref|XP_004514767.1| PREDICTED: cytosolic sulfotransferase 15-like isoform X1 [Cicer 
arietinum]
Length=342

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/320 (43%), Positives = 205/320 (64%), Gaps = 6/320 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             ++++ +++ ++ + SLP+E GW TP LY ++GFW +P  +Q   T   HFQ +DSD+ ++
Sbjct  20    EQDNLSQDMKDLIFSLPREKGWRTPYLYLFQGFWCQPAEIQAISTFQNHFQAKDSDVFVA  79

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKER-PDFAL  429
             T PKSGT WLKAL FA + R+      + HPL + NPHDL+PF+E + Y   E  P+F+ 
Sbjct  80    TVPKSGTTWLKALTFATVNRQHHFISSKNHPLLSYNPHDLVPFIEYTVYGNHENLPNFSN  139

Query  430   TNGSRLLATHLPVSLLPKSVWE-SKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
              +  RL  TH+P   L  S+ + S  K+VY+CRNP DT +S W F NK++ +   L  + 
Sbjct  140   FHEPRLFGTHVPFDSLSNSIKDFSNCKIVYICRNPFDTFISSWVFCNKIKQD--SLPTLG  197

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               EAF+ +C G    GPFW+H+  YWKES E P +VLFLKYE++K +    L+++A FL 
Sbjct  198   LDEAFEMFCNGKIGYGPFWNHMLGYWKESQERPKRVLFLKYEDLKDDVNFELKKLAKFLN  257

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMT  966
             CPF+ EEE  GV+  I++LCSFE +   E+NK    G    EN  LFRKG++GDW+N+++
Sbjct  258   CPFTLEEESEGVIENIIKLCSFEKMKEFEINKIGKFGR-NFENKYLFRKGEIGDWTNYLS  316

Query  967   EEMARRLDQIVQEKFTGTGL  1026
               M   L ++++EK +  GL
Sbjct  317   PSMVENLSKVIEEKLSECGL  336



>ref|XP_009789859.1| PREDICTED: flavonol sulfotransferase-like [Nicotiana sylvestris]
Length=347

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 156/314 (50%), Positives = 202/314 (64%), Gaps = 10/314 (3%)
 Frame = +1

Query  106   EFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGTVWL  285
             + L +L KE GW+T  LY Y+ FW  P  ++G     Q F+ Q +D IL TFPKSGT W 
Sbjct  24    DMLTTLNKEKGWITEHLYQYQSFWFTPAAIRGVKRAQQCFKAQPTDAILVTFPKSGTTWF  83

Query  286   KALAFALITRKQFLAEQETHPLHTNNPHDLIPFLE-LSYAAKERPDFALT-NGSRLLATH  459
             KAL F+L+ R +F     +HPL T  PHD IPFLE +        D+ ++ +   LLATH
Sbjct  84    KALIFSLMNRDRF--NFSSHPLLTKGPHDCIPFLEAIIQDETSYQDYRISCSPCCLLATH  141

Query  460   LPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCRG  639
             +P SLLP SV  S  K+VY+ R PKD +VS W FM KLR   + L + P  +AFD +C+G
Sbjct  142   IPYSLLPASVMSSGCKIVYVFREPKDVLVSNWLFMTKLR--FKELPSFPIKDAFDLFCKG  199

Query  640   VCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeCG  819
             V + GPFWD V  YWK S+ENP KVLFL YE+MKK+P + L ++A FL  PFS EEE  G
Sbjct  200   VSHYGPFWDQVLGYWKASMENPDKVLFLTYEDMKKDPIICLTKLAKFLDKPFSLEEEREG  259

Query  820   VVSGILRLCSFESLSNLEVNKTSV---NGDLGVENGVLFRKGKVGDWSNHMT-EEMARRL  987
             VV  I+RLCSFE+LS+LEVN+T V   +    V N    RKG+VGDW +H+T  EMA +L
Sbjct  260   VVQEIVRLCSFENLSSLEVNQTGVQHFSPQFAVANRHFLRKGQVGDWKSHLTPPEMAEQL  319

Query  988   DQIVQEKFTGTGLM  1029
             D+I ++K   T L+
Sbjct  320   DEITRQKLARTSLI  333



>ref|XP_004499637.1| PREDICTED: cytosolic sulfotransferase 15-like [Cicer arietinum]
Length=342

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/320 (43%), Positives = 205/320 (64%), Gaps = 6/320 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
             ++++ +++ ++ + SLP+E GW TP LY ++GFW +P  +Q   T   HFQ +DSD+ ++
Sbjct  20    EQDNLSQDMKDLIFSLPREKGWRTPYLYLFQGFWCQPAEIQAISTFQNHFQAKDSDVFVA  79

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKER-PDFAL  429
             T PKSGT WLKAL FA + R+      + HPL + NPHDL+PF+E + Y   E  P+F+ 
Sbjct  80    TVPKSGTTWLKALTFATVNRQHHFISSKNHPLLSFNPHDLVPFIEYTVYGNHENLPNFSN  139

Query  430   TNGSRLLATHLPVSLLPKSVWESKG-KVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
              +  RL  TH+P   L  S+ +S   K+VY+CRNP DT +S W F NK++ +   L  + 
Sbjct  140   FHEPRLFGTHVPFDSLSNSIKDSSNCKIVYICRNPFDTFISSWVFCNKIKQD--SLPTLG  197

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               EAF+ +C G    GPFW+H+  YWKES E P +VLFLKYE++K +    L+++A FL 
Sbjct  198   LDEAFEMFCNGKIGYGPFWNHMLGYWKESQERPKRVLFLKYEDLKDDVNFELKKLAKFLN  257

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMT  966
             CPF+ EEE  GV+  I++LCSFE +   E+NK    G    EN  LFRKG++GDW+N+++
Sbjct  258   CPFTLEEESEGVIENIIKLCSFEKMKEFEINKIGKFGR-NFENKYLFRKGEIGDWTNYLS  316

Query  967   EEMARRLDQIVQEKFTGTGL  1026
               M   L ++++EK +  GL
Sbjct  317   PSMVENLSKVIEEKLSECGL  336



>ref|NP_190093.1| sulfotransferase 5 [Arabidopsis thaliana]
 sp|Q9M1V2.1|SOT5_ARATH RecName: Full=Cytosolic sulfotransferase 5; Short=AtSOT5; AltName: 
Full=Flavonoid 7-sulfotransferase 3a; Short=AtST3a [Arabidopsis 
thaliana]
 emb|CAB72145.1| sulfotransferase-like protein [Arabidopsis thaliana]
 gb|AAS49096.1| At3g45070 [Arabidopsis thaliana]
 gb|AEE77988.1| sulfotransferase 5 [Arabidopsis thaliana]
Length=323

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/320 (45%), Positives = 206/320 (64%), Gaps = 5/320 (2%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             L+     EE +  ++SLP +  +    +  Y+G W     LQ  L   + F+PQD+DII+
Sbjct  5     LRIEDLNEETKTLISSLPSDKDFTGKTICKYQGCWYTHNVLQAVLNFQKSFKPQDTDIIV  64

Query  253   STFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA-  426
             ++FPK GT WLKAL FAL+ R +  +  + HPL +NNPH L+P+ E+  Y   E PD   
Sbjct  65    ASFPKCGTTWLKALTFALLHRSKQPSHDDDHPLLSNNPHVLVPYFEIDLYLRSENPDLTK  124

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
              ++  RL +TH+P   L + +  S  K+VY+ RN KDT+VS+WHF  K +++ + + +  
Sbjct  125   FSSSPRLFSTHVPSHTLQEGLKGSTCKIVYISRNVKDTLVSYWHFFTKKQTDEKIISS--  182

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
             F + F+ +CRGV   GPFWDHV  YW+ SLE+P  VLF+K+EEMK EP   +++ A FLG
Sbjct  183   FEDTFEMFCRGVSIFGPFWDHVLSYWRGSLEDPNHVLFMKFEEMKAEPRDQIKKFAEFLG  242

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMT  966
             CPF++EEEE G V  I+ LCS  +LS+LE+NKT    + G EN + FRKG+VGDW N++T
Sbjct  243   CPFTKEEEESGSVDEIIDLCSLRNLSSLEINKTG-KLNSGRENKMFFRKGEVGDWKNYLT  301

Query  967   EEMARRLDQIVQEKFTGTGL  1026
              EM  ++D I+QEK   +GL
Sbjct  302   PEMENKIDMIIQEKLQNSGL  321



>ref|XP_006418637.1| hypothetical protein EUTSA_v10002851mg [Eutrema salsugineum]
 gb|ESQ37073.1| hypothetical protein EUTSA_v10002851mg [Eutrema salsugineum]
Length=327

 Score =   285 bits (728),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 155/327 (47%), Positives = 198/327 (61%), Gaps = 14/327 (4%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
              +L+++  T+E R+ ++SLP E GWL   +Y +KGFW     LQG L   +HF+ +DSDI
Sbjct  8     DYLRDDDLTQETRDLISSLPSEKGWLVSQMYQFKGFWQTQALLQGILKCQKHFEAKDSDI  67

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQET---HPLHTNNPHDLIPFLELSYAAKERP  417
             IL T PKSGT WLKAL FALI R +F     +   HPL   NPH L+PFLE  Y   E P
Sbjct  68    ILVTNPKSGTTWLKALLFALINRHKFPVSSSSSGDHPLLVTNPHLLVPFLEGVYY--ESP  125

Query  418   DFALTN--GSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRG  591
             DF  +     RL+ TH+    LP+SV  S  K+VY CRNPKD  VS WHF  KL  E   
Sbjct  126   DFNFSELPSPRLMNTHISYLSLPESVKSSSCKIVYCCRNPKDMFVSLWHFGKKLAPEETA  185

Query  592   LEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRM  771
                 P  +A  ++C G    GPFWDHV EYW  S ENP KVLF+ YE++KK+    + R+
Sbjct  186   --DYPIEKAVKAFCEGKFIAGPFWDHVLEYWYASRENPNKVLFVTYEDLKKQTGKEITRI  243

Query  772   AAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDW  951
             A FLGC    EEE    V  I+RLCSFE LS LEVNK     + G+E    FRKG++G W
Sbjct  244   AEFLGCGSIGEEE----VKDIVRLCSFEHLSKLEVNKEGTLPN-GIETKAFFRKGEIGGW  298

Query  952   SNHMTEEMARRLDQIVQEKFTGTGLML  1032
              + ++E +A  +D+ + EKF G+GL L
Sbjct  299   RDTLSESLAEEIDRTIDEKFRGSGLEL  325



>ref|XP_010502398.1| PREDICTED: cytosolic sulfotransferase 12-like [Camelina sativa]
Length=325

 Score =   284 bits (727),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 153/324 (47%), Positives = 204/324 (63%), Gaps = 12/324 (4%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             +L +   T+E R+ ++SLPKE GWL  ++Y Y+G W     LQG L   + F+ +DSDII
Sbjct  9     YLGDEDLTQETRDLISSLPKEKGWLVSEMYQYQGRWNTQALLQGILICQKRFEAKDSDII  68

Query  250   LSTFPKSGTVWLKALAFALITRKQF-LAEQETHPLHTNNPHDLIPFLELSYAAKERPDFA  426
             L T PKSGT WLKAL FAL+ R +F ++    HPL   NPH L+PFLE  Y      DF+
Sbjct  69    LVTNPKSGTTWLKALVFALLNRHKFPVSSSGNHPLLVTNPHLLVPFLEGVYYESPDSDFS  128

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
                  RL+ TH+    LP+SV  S  K+VY CRNPKD  VS WHF  KL  E     A P
Sbjct  129   GLPSPRLMNTHISHLSLPESVKSSSCKIVYCCRNPKDMFVSLWHFGKKLAPEETA--AYP  186

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               +A +++C G    GPFWDH+ EYW  S ENP KVLF+ YE++KK+    ++R+A FLG
Sbjct  187   IEKAVEAFCEGKFIGGPFWDHILEYWYASRENPNKVLFVTYEDLKKQTGTEMKRIAEFLG  246

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNH  960
             C F EEE     V  I++LCSFESLSNLEVN+   +G L  G+E    FRKG++G W + 
Sbjct  247   CGFIEEE----EVREIVKLCSFESLSNLEVNR---HGKLPNGMETKTFFRKGEIGGWRDT  299

Query  961   MTEEMARRLDQIVQEKFTGTGLML  1032
             ++E +A  +D+ ++EKF G+GL+ 
Sbjct  300   LSESLAAEIDRTIEEKFHGSGLIF  323



>gb|KFK33526.1| hypothetical protein AALP_AA5G024400 [Arabis alpina]
Length=334

 Score =   285 bits (728),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/326 (43%), Positives = 214/326 (66%), Gaps = 7/326 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
              +++++  ++E ++ ++SLP    ++   LYNYKG W  P  LQ  L + +HF+P+ +DI
Sbjct  11    NYMKDDKVSQETKKLISSLPAAKDFMGYGLYNYKGCWYYPNTLQAVLDVQKHFRPRSTDI  70

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDF  423
             IL++ PK GT WLK+LAFA++ R+++    + HPL + NPHDL+PFLE+  Y   + PD 
Sbjct  71    ILASLPKGGTTWLKSLAFAVVNREKYRENPQLHPLLSQNPHDLVPFLEIELYTKNQIPDL  130

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKG---KVVYLCRNPKDTVVSFWHFMNKLRSELRGL  594
             +      + +TH+ ++ L ++  +S     K+VY+CR  KDT VS WH+ N L       
Sbjct  131   SNFPSPVIFSTHMHLNTLHEATTKSSSSPCKIVYVCRGIKDTFVSGWHYRNMLHRTNMSQ  190

Query  595   EAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMA  774
             +A  F   FD+YC+G+   GP+W+HVS YWK SLE+   VLF+KYE++  EP V ++R+A
Sbjct  191   DA--FELMFDAYCKGILLYGPYWEHVSSYWKGSLEDKENVLFMKYEDIIMEPSVQVKRLA  248

Query  775   AFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWS  954
              FL C F++EEEE G V  IL+LCS  +LSNLEVNK      +G+++ V FRKG+VGDW 
Sbjct  249   EFLNCSFTKEEEESGSVEEILKLCSLSNLSNLEVNKKGTT-RIGIDSNVFFRKGEVGDWK  307

Query  955   NHMTEEMARRLDQIVQEKFTGTGLML  1032
             NH+T +MA+  D+IV+ +  G+GL+ 
Sbjct  308   NHLTPQMAKTFDEIVEYRLRGSGLIF  333



>ref|XP_002514612.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
 gb|EEF47718.1| Flavonol 4'-sulfotransferase, putative [Ricinus communis]
Length=358

 Score =   285 bits (730),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 148/318 (47%), Positives = 209/318 (66%), Gaps = 9/318 (3%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWL--TPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFP  264
             +++++E + + P+E  W   +  LY Y+ FW    FL G L+   HF  + +DIIL++F 
Sbjct  32    SDKYKEIILTFPRERDWSLNSGGLYQYQDFWFMGPFLAGVLSAQDHFMARSTDIILASFM  91

Query  265   KSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGSR  444
             K+GTVWLKALAFA++TR  F  +  T PL    PHD +PFLE+  A K+  +  +T    
Sbjct  92    KTGTVWLKALAFAIVTRSNFDIDS-TSPLLKKGPHDCVPFLEVDLA-KDSNNRDMT--IP  147

Query  445   LLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFD  624
             L+ TH+P + LPKS+  S  K+VYL R+PKD  VS W F+ KL   L G E +P  EAF+
Sbjct  148   LVGTHMPYTSLPKSILASGCKIVYLWRDPKDVFVSMWFFLAKLL-RLMGSEPLPLGEAFE  206

Query  625   SYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSee  804
              +C+G    GP+W+HV  YWK   E P K+LFLKYE+MKK+   H++++A F+G  F+ E
Sbjct  207   LFCKGFVTYGPYWNHVLGYWKARREYPEKILFLKYEDMKKDATFHVKKLADFMGYSFTLE  266

Query  805   eeeCGVVSGILRLCSFESLSNLEVNKTSV--NGDLGVENGVLFRKGKVGDWSNHMTEEMA  978
             EEE G +  I+ +CSFE+LSNLEVNK     N  + +EN + FRKGKVGDW +H+T EM 
Sbjct  267   EEENGAMQKIVNMCSFENLSNLEVNKHGRRENTSIDIENNIFFRKGKVGDWKSHLTPEMG  326

Query  979   RRLDQIVQEKFTGTGLML  1032
              RLD+I+++K TG+GL +
Sbjct  327   ARLDEIMEQKLTGSGLTM  344



>ref|XP_003575593.1| PREDICTED: cytosolic sulfotransferase 5-like [Brachypodium distachyon]
Length=331

 Score =   284 bits (727),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 144/319 (45%), Positives = 202/319 (63%), Gaps = 10/319 (3%)
 Frame = +1

Query  79    ENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILST  258
             EN   +    F+++LP   GW  P +  YK +W  P  +   + +   F+P+  DIIL+T
Sbjct  18    ENVSAQNMEVFISTLPTREGWSQP-MVLYKNYWCRPHLVGMIMLLQDTFEPRRDDIILAT  76

Query  259   FPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNG  438
              PK GT WLKAL FA+  R +       HPL  +NP  L+PF+E+    ++       + 
Sbjct  77    QPKCGTTWLKALGFAITNRSRHSFRD--HPLLASNPQYLVPFIEIPDPGRDHTYLETLSS  134

Query  439   SRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEA  618
              RLL+THLP+S+LP        ++VYLCR PKD  VS WHF NK+   ++G   +    A
Sbjct  135   PRLLSTHLPLSMLPAETSSCGCRIVYLCREPKDAFVSRWHFENKI---VKG-SNIELDRA  190

Query  619   FDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFS  798
             FD +C+G   +GPFW+H  EYWKESL  P +VLFLKYEE+K  PE  +R++A FLG P +
Sbjct  191   FDMFCQGFSPSGPFWNHCLEYWKESLARPNEVLFLKYEELKSHPEEVVRQLAKFLGVPLT  250

Query  799   eeeeeCGVVSGILRLCSFESLSNLEVNKTSV---NGDLGVENGVLFRKGKVGDWSNHMTE  969
             EEEE  GV   +++LCSFE+L++L+VN+T        + VEN V FRKGKVGDW+NHM+E
Sbjct  251   EEEESSGVAKEVVKLCSFENLTSLKVNQTGGVYHGNKIYVENSVFFRKGKVGDWANHMSE  310

Query  970   EMARRLDQIVQEKFTGTGL  1026
             EMA ++D+++QEK +G+GL
Sbjct  311   EMAEKIDRVIQEKLSGSGL  329



>ref|XP_002303948.2| hypothetical protein POPTR_0003s19260g [Populus trichocarpa]
 gb|ABK94985.1| unknown [Populus trichocarpa]
 gb|EEE78927.2| hypothetical protein POPTR_0003s19260g [Populus trichocarpa]
Length=330

 Score =   284 bits (726),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 199/313 (64%), Gaps = 6/313 (2%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKS  270
             T+E  + L+SLPKE  W    LY Y+GFW     +   +   +HF  Q +D IL T PKS
Sbjct  17    TDEIADLLSSLPKEKSWRLGYLYRYQGFWCPEKQIPAVIAFQKHFIAQKTDTILVTMPKS  76

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRL  447
             GT WLKALAF+++ R ++       PL++ NPHDL+PF E   YA  + PD +     R+
Sbjct  77    GTTWLKALAFSIMNRAKYTPS--CSPLNSVNPHDLVPFFEFRLYANNQLPDLSTFPSPRM  134

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
              ATH+P   LP S+  S  ++V LCRNP D  +S WHF +K R E  G  +M   + FDS
Sbjct  135   FATHVPYPSLPDSIKNSGCRIVCLCRNPFDNFISLWHFASKARHESLGPLSME--DCFDS  192

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             +C G+   GPF+DHV  YW+ESLE P +VLFL YE+MK++    ++R+A FLGCPFS EE
Sbjct  193   FCNGLGGFGPFFDHVLGYWRESLERPEEVLFLTYEDMKEDINSQMKRLAEFLGCPFSLEE  252

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRL  987
             E  GVV GI +LCSF ++ + E+NKT        EN  LFR+G+VGDW N+++ EM  RL
Sbjct  253   EADGVVEGISKLCSFSNMKDKEINKTG-KSIPHFENKTLFRRGEVGDWVNYLSPEMVDRL  311

Query  988   DQIVQEKFTGTGL  1026
             ++I+++K  G+GL
Sbjct  312   NKIMEQKLAGSGL  324



>ref|NP_178471.1| sulphotransferase 12 [Arabidopsis thaliana]
 sp|P52839.2|SOT12_ARATH RecName: Full=Cytosolic sulfotransferase 12; Short=AtSOT12; AltName: 
Full=Sulfotransferase 1; Short=AtST1 [Arabidopsis thaliana]
 pdb|1Q44|A Chain A, Crystal Structure Of An Arabidopsis Thaliana Putative 
Steroid Sulfotransferase
 pdb|2Q3M|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of An Arabidopsis Thaliana Putative Steroid Sulphotransferase
 gb|AAK53042.1|AF375458_1 At2g03760/F19B11.21 [Arabidopsis thaliana]
 gb|AAD20078.1| putative steroid sulfotransferase [Arabidopsis thaliana]
 gb|AAM47358.1| At2g03760/F19B11.21 [Arabidopsis thaliana]
 gb|AEC05746.1| sulphotransferase 12 [Arabidopsis thaliana]
Length=326

 Score =   284 bits (726),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 154/322 (48%), Positives = 201/322 (62%), Gaps = 12/322 (4%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             +L +   T+E R  ++SLPKE GWL  ++Y ++G W     LQG L   + F+ +DSDII
Sbjct  10    YLGDEDLTQETRALISSLPKEKGWLVSEIYEFQGLWHTQAILQGILICQKRFEAKDSDII  69

Query  250   LSTFPKSGTVWLKALAFALITRKQF-LAEQETHPLHTNNPHDLIPFLELSYAAKERPDFA  426
             L T PKSGT WLKAL FAL+ R +F ++    HPL   NPH L+PFLE  Y      DF+
Sbjct  70    LVTNPKSGTTWLKALVFALLNRHKFPVSSSGNHPLLVTNPHLLVPFLEGVYYESPDFDFS  129

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
                  RL+ TH+    LP+SV  S  K+VY CRNPKD  VS WHF  KL  E       P
Sbjct  130   SLPSPRLMNTHISHLSLPESVKSSSCKIVYCCRNPKDMFVSLWHFGKKLAPEETA--DYP  187

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               +A +++C G    GPFWDH+ EYW  S ENP KVLF+ YEE+KK+ EV ++R+A FL 
Sbjct  188   IEKAVEAFCEGKFIGGPFWDHILEYWYASRENPNKVLFVTYEELKKQTEVEMKRIAEFLE  247

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNH  960
             C F EEE     V  I++LCSFESLSNLEVNK    G L  G+E    FRKG++G W + 
Sbjct  248   CGFIEEE----EVREIVKLCSFESLSNLEVNK---EGKLPNGIETKTFFRKGEIGGWRDT  300

Query  961   MTEEMARRLDQIVQEKFTGTGL  1026
             ++E +A  +D+ ++EKF G+GL
Sbjct  301   LSESLAEEIDRTIEEKFKGSGL  322



>ref|XP_004973902.1| PREDICTED: cytosolic sulfotransferase 5-like [Setaria italica]
Length=325

 Score =   283 bits (725),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 196/315 (62%), Gaps = 9/315 (3%)
 Frame = +1

Query  94    EEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSG  273
             +E     + LP   GW  P  + ++GFW  P  ++  + +   F+P+  DIIL+T+PK G
Sbjct  14    KEEESLTSRLPTREGWWKP-FFLFQGFWFTPQMVRSTVLVQAQFRPRADDIILATYPKCG  72

Query  274   TVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAA-KERPDFALTNGSRLL  450
             T WLKALAF +  R Q       HP+ T++P DL+PFLEL +       +       RLL
Sbjct  73    TTWLKALAFTVAHRSQHPVASHGHPVLTSHPQDLVPFLELPHRELHPIEELEALPSPRLL  132

Query  451   ATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSY  630
             +THLP + LP        ++VYLCR PKD +VS WH+ NK+R +      +   +AF+ +
Sbjct  133   STHLPCTSLPSGASTLGCRIVYLCREPKDVLVSMWHYTNKVRKDFH----IDLGKAFEFF  188

Query  631   CRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeee  810
             C GV   GPFW+H   YWK S+E PG+VLFLKY+EM   P  H++ +A FLG PF+EEEE
Sbjct  189   CEGVSLGGPFWEHCLGYWKWSMEEPGRVLFLKYDEMMANPAEHVKMLAEFLGVPFTEEEE  248

Query  811   eCGVVSGILRLCSFESLSNLEVNKTSVN---GDLGVENGVLFRKGKVGDWSNHMTEEMAR  981
               GVV  ++RLCSFE+L +L VN T V+   G L +EN   FR GKVGDW NH+TEEMAR
Sbjct  249   SAGVVEEVVRLCSFENLKSLPVNSTGVSDRVGGLPMENASFFRSGKVGDWKNHLTEEMAR  308

Query  982   RLDQIVQEKFTGTGL  1026
             +LD IV+EK  G+GL
Sbjct  309   KLDCIVEEKLKGSGL  323



>ref|XP_010423267.1| PREDICTED: cytosolic sulfotransferase 15-like [Camelina sativa]
Length=422

 Score =   287 bits (734),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 146/320 (46%), Positives = 205/320 (64%), Gaps = 6/320 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
              + + + EF+E L+SLPKE GW T  LY ++GFW +   +Q  ++  +HF+   +D++L+
Sbjct  101   DDEALSYEFQEMLDSLPKERGWRTRYLYLFQGFWCQAKEIQAIMSFQKHFRSLPNDVVLA  160

Query  256   TFPKSGTVWLKALAFALITRKQF--LAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA  426
             T PKSGT WLKAL F ++ R +F  ++    HPL T+NPHDL+PF E   YA    PD +
Sbjct  161   TIPKSGTTWLKALTFTILNRHRFDPVSSTTNHPLLTSNPHDLVPFFEYKLYANGAVPDLS  220

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
                  R  ATH+P   L  S+ E   KVVYLCRNP DT +S WHF+N ++SE   +  + 
Sbjct  221   GLARPRTFATHVPFGSLKDSIEEPGVKVVYLCRNPFDTFISSWHFINNIKSE--SVSPVS  278

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               E FD YC+GV   GPFW+H+  Y++ESL+ P KV FLKYE++K++ E +L+++ +FLG
Sbjct  279   LDEGFDLYCQGVIGFGPFWEHMLGYYRESLKRPEKVFFLKYEDLKEDIETNLKKLGSFLG  338

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMT  966
              PF++E+E  GVV  I  LCSFE+L  LEVNK S       EN  LFRKG+V DW N+++
Sbjct  339   LPFTKEDERKGVVKAIADLCSFENLKKLEVNK-SKKSIKNFENRFLFRKGEVSDWVNYLS  397

Query  967   EEMARRLDQIVQEKFTGTGL  1026
                  RL  +V +K  G+GL
Sbjct  398   PSQVERLSALVDDKLGGSGL  417



>gb|KCW80592.1| hypothetical protein EUGRSUZ_C01953, partial [Eucalyptus grandis]
Length=290

 Score =   282 bits (722),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 149/302 (49%), Positives = 192/302 (64%), Gaps = 23/302 (8%)
 Frame = +1

Query  136   GWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGTVWLKALAFALITR  315
             GW  P L  Y+GFW   + L G L   +HFQ  +SDIIL T PKSGT WLKA+ FAL+  
Sbjct  5     GWDNPSLILYQGFWFPSWPLDGVLACQKHFQAHNSDIILVTSPKSGTTWLKAILFALLNH  64

Query  316   KQFLA--EQETHPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRLLATHLPVSLLPKS  486
              ++     ++ HPL T NPHDL+P+LE   Y  +E PD A     RLLATHLP SLLP+S
Sbjct  65    AKYSNPNSEQCHPLLTRNPHDLVPYLEFQLYLQQEDPDHATFASPRLLATHLPYSLLPQS  124

Query  487   VWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCRGVCNTGPFWD  666
             V +SK K+VYLCRNPKD  +S WHF  K+  +  G +  P  E  D +C+ +   GP+WD
Sbjct  125   VRDSKCKLVYLCRNPKDNFISLWHFTKKMMLKENG-DQTPLSECLDKFCQRLSMYGPYWD  183

Query  667   HVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeCGVVSGILRLC  846
             HV  Y K S E P KVLF+KYEEMK++P VH+RR+A F+G              GILR+ 
Sbjct  184   HVLGYHKMSSEMPEKVLFMKYEEMKEDPCVHVRRLADFVG--------------GILRMW  229

Query  847   SFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHMTEEMARRLDQIVQEKFTGT  1020
             SF++LS LEVNK+   G L  G EN   FR+G+VGDW N+M+ EM  R+D +++EK   +
Sbjct  230   SFDNLSTLEVNKS---GSLWTGAENKSFFRRGEVGDWVNYMSAEMGERIDSVMEEKLHSS  286

Query  1021  GL  1026
             GL
Sbjct  287   GL  288



>emb|CDY04166.1| BnaA09g19440D [Brassica napus]
Length=323

 Score =   283 bits (725),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 152/321 (47%), Positives = 200/321 (62%), Gaps = 12/321 (4%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             +L + + T+E R+ L+SLP E GWL   +Y Y+G W     LQG +   +HF+ +DSDII
Sbjct  9     YLGDENLTQETRDLLSSLPSEKGWLVSQMYQYEGSWHTKAMLQGIVNCQKHFEAKDSDII  68

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFAL  429
             L+T PKSGT WLKAL FALI + +F      HPL   NPH L+P+LE  Y       F+ 
Sbjct  69    LATIPKSGTTWLKALLFALIHQNKFPVSG-NHPLLATNPHPLVPYLEGDYCVSPDVGFSK  127

Query  430   TNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
                 RL+ THL    LP S+  S  K+VY CRNPKD  VS WHF  KL  E       P 
Sbjct  128   LPSPRLMQTHLTHHSLPVSIKSSSCKIVYCCRNPKDVFVSLWHFGKKLAPEETA--DYPI  185

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
              +A +++C+G    GPFW+HV EYW ES +NP KVLF+ YEE+KK+    ++RMA FLGC
Sbjct  186   EKAVEAFCQGKFIGGPFWEHVLEYWYESRKNPNKVLFVTYEELKKQTGDMVKRMAEFLGC  245

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHM  963
              F+ EEE    VS I++LCSFESLS+LEVN+    G L  G+E    FRKG+ G W + +
Sbjct  246   GFTAEEE----VSEIVKLCSFESLSSLEVNR---QGKLPNGIETNAFFRKGETGGWRDTL  298

Query  964   TEEMARRLDQIVQEKFTGTGL  1026
             +E +A  +D+  +EKF G+GL
Sbjct  299   SESLADVIDRTTEEKFGGSGL  319



>ref|XP_003542828.1| PREDICTED: cytosolic sulfotransferase 15-like [Glycine max]
Length=328

 Score =   283 bits (725),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 143/323 (44%), Positives = 210/323 (65%), Gaps = 12/323 (4%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTP-DLYNYKGFWLEPFFLQGALTIHQHFQP-QDSDI  246
             +QEN    E  + + SLPKE  W  P DLY ++ FW     +Q      ++F+  +DSD+
Sbjct  7     IQEN----EDEKLILSLPKEKPWAQPYDLYLFQNFWCPGIHIQAVNRFQKYFEAVKDSDV  62

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFA  426
             ++++FPKSGT+W+KAL F++    +F    E HPL T NPH+L+PFLE S+    +    
Sbjct  63    VVASFPKSGTIWIKALTFSIANHHRF-PSLENHPLLTTNPHELVPFLEFSFGGNIQDQIL  121

Query  427   -LTNGS--RLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLE  597
              L+N +  R+  TH P + LPKS+ ES  K+VY+CR+P D  VS W++ NK++     L 
Sbjct  122   HLSNMTEPRIFGTHTPFTSLPKSIKESNCKLVYICRDPFDNFVSAWNYFNKVKP--MSLP  179

Query  598   AMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAA  777
             A+   EAF+ YC G+ + GP+W H+  YW ES+ NP KVLFLKYE++K++   H++R+A 
Sbjct  180   ALTMEEAFEKYCNGIMDYGPWWSHMLGYWNESIANPNKVLFLKYEDLKEDTNFHVKRIAE  239

Query  778   FLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSN  957
             FLGCPF+++EE  GV+  I++LCSFE++ +LEVNK+   G  G+E    FRKG+ GDW N
Sbjct  240   FLGCPFTQKEESSGVIQSIIKLCSFENMKDLEVNKSGKIGRGGIEKKDFFRKGEKGDWVN  299

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             + T  M  +L  IV+EK +G+GL
Sbjct  300   YFTPSMQEKLSAIVEEKLSGSGL  322



>ref|XP_010677191.1| PREDICTED: flavonol sulfotransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=330

 Score =   283 bits (725),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/323 (44%), Positives = 201/323 (62%), Gaps = 9/323 (3%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             L E+    +    L SLPKE GW    LY YKGFW +   LQG L   + F+ Q + ++L
Sbjct  8     LSESKVVVDIERILPSLPKEKGWWLETLYKYKGFWFDEPLLQGTLITQKTFKAQPNTVVL  67

Query  253   STFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALT  432
             +T PKSGT W  AL F  + R ++     +HPL T++PHD +P +E  YA+K   +  + 
Sbjct  68    ATLPKSGTTWFAALLFTTMNRTRY--SYSSHPLLTSSPHDCVPGIEF-YASKNPSNPTMP  124

Query  433   NGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFP  612
                 L+A H+P  LLP+S+  S   ++Y+CRNP D  VS WHF NKLR   + L+ +   
Sbjct  125   TTFPLVAAHIPYPLLPESIKSSSCPIIYVCRNPNDVFVSLWHFANKLRP--KELQPLNIE  182

Query  613   EAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCP  792
             EAFD +C+GV   G +WDHV  +WK S+E P KVLF++YE+MK +P   L+++A F+GCP
Sbjct  183   EAFDLFCKGVSPFGSYWDHVLGFWKASIEMPNKVLFVRYEDMKNQPFTLLKKLAEFVGCP  242

Query  793   FSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL----GVENGVLFRKGKVGDWSNH  960
             F+  EEE GV+  I+  CSFESL++ EVN+  V  +      V N V FRKGKVGD  N+
Sbjct  243   FTLAEEESGVIEKIIDFCSFESLTSFEVNRVEVERNTLPGANVPNNVFFRKGKVGDHKNY  302

Query  961   MTEEMARRLDQIVQEKFTGTGLM  1029
             +T+EM +RL +I + +F  +GL+
Sbjct  303   LTDEMMKRLREITEMRFKDSGLL  325



>gb|KHN37661.1| Flavonol sulfotransferase-like [Glycine soja]
Length=325

 Score =   283 bits (724),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 143/323 (44%), Positives = 210/323 (65%), Gaps = 12/323 (4%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTP-DLYNYKGFWLEPFFLQGALTIHQHFQP-QDSDI  246
             +QEN    E  + + SLPKE  W  P DLY ++ FW     +Q      ++F+  +DSD+
Sbjct  4     IQEN----EDEKLILSLPKEKPWAQPYDLYLFQNFWCPGIHIQAVNRFQKYFEAVKDSDV  59

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFA  426
             ++++FPKSGT+W+KAL F++    +F    E HPL T NPH+L+PFLE S+    +    
Sbjct  60    VVASFPKSGTIWIKALTFSIANHHRF-PSLENHPLLTTNPHELVPFLEFSFGGNIQDQIL  118

Query  427   -LTNGS--RLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLE  597
              L+N +  R+  TH P + LPKS+ ES  K+VY+CR+P D  VS W++ NK++     L 
Sbjct  119   HLSNMTEPRIFGTHTPFTSLPKSIKESNCKLVYICRDPFDNFVSAWNYFNKVKP--MSLP  176

Query  598   AMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAA  777
             A+   EAF+ YC G+ + GP+W H+  YW ES+ NP KVLFLKYE++K++   H++R+A 
Sbjct  177   ALTMEEAFEKYCNGIMDYGPWWSHMLGYWNESIANPNKVLFLKYEDLKEDTNFHVKRIAE  236

Query  778   FLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSN  957
             FLGCPF+++EE  GV+  I++LCSFE++ +LEVNK+   G  G+E    FRKG+ GDW N
Sbjct  237   FLGCPFTQKEESSGVIQSIIKLCSFENMKDLEVNKSGKIGRGGIEKKDFFRKGEKGDWVN  296

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             + T  M  +L  IV+EK +G+GL
Sbjct  297   YFTPSMQEKLSAIVEEKLSGSGL  319



>ref|XP_006377321.1| hypothetical protein POPTR_0011s04870g [Populus trichocarpa]
 gb|ERP55118.1| hypothetical protein POPTR_0011s04870g [Populus trichocarpa]
Length=336

 Score =   283 bits (725),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 146/313 (47%), Positives = 206/313 (66%), Gaps = 10/313 (3%)
 Frame = +1

Query  106   EFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGTVWL  285
             E +++LPK  G    D Y Y+GFW + FFL+G +++ +HF PQ +DI +++FPK+GT WL
Sbjct  28    EVMSTLPKVKGLRGDDYYLYQGFWYDAFFLEGLMSVQEHFNPQSTDIFVASFPKTGTTWL  87

Query  286   KALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAK-ERPDFALTNGSRLLATHL  462
             KAL FA+ TR + L+   T  L T  PHD +P LE   A      D A+     LL+TH+
Sbjct  88    KALTFAIFTRSR-LSGSTTSSLLTKMPHDCVPLLENDLAKNPSNRDLAIP----LLSTHV  142

Query  463   PVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYCRGV  642
             P S LPKS+  S  K++Y+CR+ KD  VS W+F   L+   + +E +P  EAF+ +C G+
Sbjct  143   PYSCLPKSIISSSCKIIYICRDAKDAFVSLWYFHATLQRS-KNVEHLPLEEAFELFCNGI  201

Query  643   CNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeeeCGV  822
              N GP+W+HV  YW+ SLE P K+LFL YEEMKK+   H++++A F+GC F+ EEEE G 
Sbjct  202   ANFGPYWNHVLGYWRASLEFPEKILFLTYEEMKKDTAAHVKKVAEFMGCSFTLEEEEGGE  261

Query  823   VSGILRLCSFESLSNLEVNKTSV---NGDLGVENGVLFRKGKVGDWSNHMTEEMARRLDQ  993
             V  I  +CSFE LSNLEVNK      +  + ++N V FR+G++GDW+NH+T EM  RLD 
Sbjct  262   VQKIKSMCSFEKLSNLEVNKNGKHRPDTSIAIQNSVYFRRGEIGDWANHLTPEMGARLDD  321

Query  994   IVQEKFTGTGLML  1032
             I+++K  G+GL L
Sbjct  322   IMEQKLKGSGLTL  334



>ref|XP_004291155.1| PREDICTED: cytosolic sulfotransferase 15-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=332

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/323 (46%), Positives = 212/323 (66%), Gaps = 12/323 (4%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETG-WLTPDLYNYKGFW-LEPFFLQGALTIHQHFQPQDSDII  249
             +E + ++E +E L SLPKE G WL P  Y Y+GFW +    +Q  +   + FQ +DSDI+
Sbjct  5     EEKNLSDECKELLLSLPKERGGWLGPPQYQYQGFWCVTADIVQATIAFQRQFQARDSDIV  64

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA  426
             +++ PK GT WLKAL FA++ R +F  E E HPL T+N H+L+   E+  Y     PDF+
Sbjct  65    VASVPKCGTTWLKALTFAVVNRHRF--EIEAHPLLTSNSHNLVQHFEVDLYINNRVPDFS  122

Query  427   LT---NGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLE  597
                     RL ATH+P   L  ++ +S  K+VY+CRNP D+ VS+WHF+NK+R +   L 
Sbjct  123   SKFPGEPRRLFATHIPFPSL-GTITKSNCKIVYVCRNPFDSFVSYWHFINKVRPQ--SLG  179

Query  598   AMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAA  777
              +   E FD YC+G+   GPFWDH+  YWKESL+ P  VLF KYE+MKK+  +HL+ +A 
Sbjct  180   PLSLDETFDKYCQGMDGFGPFWDHILRYWKESLKRPNNVLFFKYEDMKKDVVLHLKALAK  239

Query  778   FLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSN  957
             F+ CPF+EEEE  GV+  + +LCSF+++  LEVNKT     + +E+  LFRK +VGDW N
Sbjct  240   FIDCPFTEEEERNGVIEDMAKLCSFDTMKKLEVNKTGTFV-MNLESKHLFRKAEVGDWVN  298

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
             ++T  M  R+ ++++EKF+G+GL
Sbjct  299   YLTPMMKERMSRLIEEKFSGSGL  321



>ref|XP_009148006.1| PREDICTED: cytosolic sulfotransferase 11-like [Brassica rapa]
 emb|CDY29781.1| BnaA01g18850D [Brassica napus]
Length=335

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/327 (43%), Positives = 213/327 (65%), Gaps = 8/327 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
              ++++++ ++E    ++SLP +  ++   LYNYKG W  P  LQ  L +  +F+PQ +DI
Sbjct  11    NYMKDDNTSQETNNLISSLPADKDFMGYSLYNYKGCWYYPNTLQAVLDVQDNFRPQKNDI  70

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAE-QETHPLHTNNPHDLIPFLELS-YAAKERPD  420
             IL++ PK GT WLK+L FA++ R+++    Q  HPL + NPHDL+PFLE+  YA+   PD
Sbjct  71    ILASLPKGGTTWLKSLVFAIVHREKYRENPQIIHPLLSQNPHDLVPFLEIELYASSHTPD  130

Query  421   FALTNGSRLLATHLPVSLLPKSVWESKG---KVVYLCRNPKDTVVSFWHFMNKLRSELRG  591
              A      + +TH+ ++ L ++  +S     K+VY+CR  KDT VS WH+ N L      
Sbjct  131   LAKFPSPMIFSTHMHLNALHEATTKSSSSPCKIVYVCRGLKDTFVSGWHYKNMLHRT--K  188

Query  592   LEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRM  771
             ++   F   FD YCRGV   GP+W+H+  YWK SLE+   VLF++YEE+ +EP + ++R+
Sbjct  189   MDQASFELMFDGYCRGVTLYGPYWEHMLSYWKGSLEDRENVLFMRYEEIIEEPLIQVKRL  248

Query  772   AAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDW  951
             A FL CPF+EEEEE G    IL LCS  +LSNLE+NK      +G+++ V FRKG+VGDW
Sbjct  249   AEFLNCPFTEEEEESGSAEEILNLCSLRNLSNLEINKKGTT-RIGIDSNVFFRKGEVGDW  307

Query  952   SNHMTEEMARRLDQIVQEKFTGTGLML  1032
              NH+T +MA+R+D++V+ K  G+GL+ 
Sbjct  308   KNHLTPQMAKRIDEVVEVKLRGSGLIF  334



>emb|CDY42798.1| BnaC01g22680D [Brassica napus]
Length=335

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/327 (43%), Positives = 215/327 (66%), Gaps = 8/327 (2%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
              ++++++ ++E    ++SLP +  ++   LYNYKG W  P  LQ  L +  +F+PQ +DI
Sbjct  11    NYMKDDNISQETNNLISSLPADKDFMGYSLYNYKGCWYYPNTLQAVLDVQDNFRPQKNDI  70

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAE-QETHPLHTNNPHDLIPFLELS-YAAKERPD  420
             IL++ PK GT WLK+L FA++ R+++    Q  HPL + NPHDL+PFLE+  YA+ + PD
Sbjct  71    ILASLPKGGTTWLKSLVFAVVHREKYRENPQIIHPLLSQNPHDLVPFLEIELYASSQTPD  130

Query  421   FALTNGSRLLATHLPVSLLPKSVWESKG---KVVYLCRNPKDTVVSFWHFMNKLRSELRG  591
              A      + +TH+ ++ L ++  +S     K+VY+CR  KDT VS WH+ N L      
Sbjct  131   LAKFPSPMIFSTHMHLNALHEATTKSSSSPCKIVYVCRGLKDTFVSGWHYKNMLHRT--K  188

Query  592   LEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRM  771
             ++   F   FD+YCRGV   GP+W+H+  YWK SLE+   VLF++YEE+ +EP + ++R+
Sbjct  189   MDQASFELMFDAYCRGVTLYGPYWEHMLSYWKGSLEDKENVLFMRYEEIIEEPLIQVKRL  248

Query  772   AAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDW  951
             A FL CPF+EEEEE G V  IL LCS  +L NLE+NK      +G+++ V FRKG+VGDW
Sbjct  249   AEFLNCPFTEEEEESGSVEEILNLCSLRNLRNLEINKKGTT-RIGIDSNVFFRKGEVGDW  307

Query  952   SNHMTEEMARRLDQIVQEKFTGTGLML  1032
              NH+T +MA+R+D++V+ K  G+GL+ 
Sbjct  308   KNHLTPQMAKRIDEVVEVKLRGSGLIF  334



>ref|XP_009129074.1| PREDICTED: cytosolic sulfotransferase 12-like [Brassica rapa]
Length=341

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/322 (48%), Positives = 198/322 (61%), Gaps = 11/322 (3%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
              +L     T+E R+ ++SLP E GWL   LY ++G W     LQG L   +HF+ +DSDI
Sbjct  10    DYLGSEDPTQETRDLISSLPSEKGWLVSHLYQFQGRWHTQALLQGLLECQKHFEAKDSDI  69

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFA  426
             IL T PKSGT WLKAL F+L+ R +F      HPL   NPH LIPFLE  Y      DF 
Sbjct  70    ILVTNPKSGTTWLKALVFSLLNRHKFPVSSGNHPLLDTNPHLLIPFLEGVYHEFPDFDFP  129

Query  427   LTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
                  RL+ TH+P+  LP+SV  S  K+VY CR PKD  VS WHF  KL  E       P
Sbjct  130   KLPSPRLMNTHIPLLSLPESVKSSSCKIVYCCRTPKDMFVSLWHFRKKLAPEETA--DCP  187

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
               +A +++C+G   +GPFWDHV EYW  SLENP KVLF+ YEE+KK+    ++++  FLG
Sbjct  188   IEKAIEAFCQGKFTSGPFWDHVLEYWHASLENPNKVLFVTYEELKKQTGDTIKKICEFLG  247

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNH  960
             C F  EEEE     GI++LCSFESLS+ EVN+    G L  G+E    FRKG VG W + 
Sbjct  248   CGFVGEEEE----RGIVKLCSFESLSSSEVNR---EGKLPNGMETKAFFRKGDVGGWGDT  300

Query  961   MTEEMARRLDQIVQEKFTGTGL  1026
             ++E +A  +D+ ++EKF G+GL
Sbjct  301   LSESLAEEIDRTMEEKFQGSGL  322



>ref|XP_008785639.1| PREDICTED: flavonol sulfotransferase-like [Phoenix dactylifera]
Length=360

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 152/323 (47%), Positives = 203/323 (63%), Gaps = 11/323 (3%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWL-EPFFLQGALTIHQHFQPQDSDIILSTFPK  267
              +E+ + +++LP E GW    L  YKGFW+ +   L+G L I  HF+P+ +D++L+T PK
Sbjct  29    VQEYNDLISTLPPEQGWQPVSLRKYKGFWIPDQVHLRGLLAIQDHFKPRPTDLLLATLPK  88

Query  268   SGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGSRL  447
             SGT WLKAL FA +TR Q+      HPL + NPH+ +  LE  +A  +          RL
Sbjct  89    SGTTWLKALIFATMTRSQYSFAH--HPLLSLNPHNCVHLLEELFAIGQASKVEALPSPRL  146

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKL-RSELRGLEAMP------  606
             L TH+P S+LP S+  S  +++Y+CR+PKD VVS WHF +   RS+    E MP      
Sbjct  147   LNTHMPYSVLPDSIGASDCRIIYVCRDPKDRVVSAWHFTSSWHRSKKTTWEMMPTTESLS  206

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
             F  A +  CRG    GP WDH  EYW+ESL  P KVLFLKYEE+ +EP  + +R+A F+G
Sbjct  207   FATACEMVCRGNSPWGPDWDHALEYWRESLRRPEKVLFLKYEEVMEEPVANAKRLAEFMG  266

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGD-LGVENGVLFRKGKVGDWSNHM  963
             CPFS EEE+ GVV  I+RLCSF+ LS LEVNK+        + N   FRKGKVGDW N +
Sbjct  267   CPFSSEEEKEGVVEEIIRLCSFDKLSKLEVNKSGDQASFFRIPNSCYFRKGKVGDWRNQL  326

Query  964   TEEMARRLDQIVQEKFTGTGLML  1032
             + EMA RLD+++ EK  G+GL L
Sbjct  327   SPEMALRLDRVMDEKLQGSGLTL  349



>ref|XP_009130913.1| PREDICTED: cytosolic sulfotransferase 1-like isoform X1 [Brassica 
rapa]
Length=329

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/324 (47%), Positives = 210/324 (65%), Gaps = 12/324 (4%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             L+E+  +EE ++ ++SLP +  +    L  Y+G W     LQ  +  H +FQPQ++DIIL
Sbjct  10    LREDKVSEETKKLISSLPTDKDFQGRRLCKYQGSWYYYNTLQAVINFHNNFQPQETDIIL  69

Query  253   STFPKSGTVWLKALAFALITR-KQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA  426
             ++ PKSGT WLKAL  AL+ R KQ   +   HPL ++NPH ++PFLE + Y     PD  
Sbjct  70    ASSPKSGTTWLKALTVALLERSKQQDDDPLNHPLRSDNPHGIVPFLENNLYLKSSTPDLT  129

Query  427   LTNGS-RLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNK---LRSELRGL  594
               + S RL ATH+P+  L + +  S  K+V++CRN KD ++S W+F+ K   + +    L
Sbjct  130   KYSSSPRLFATHMPLHTLKEGLKGSPCKIVFMCRNAKDVLISMWYFVCKYQRVEASRSIL  189

Query  595   EAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMA  774
             E++     F+S C GV   GPFWD V  YW+ SLE+P +VLF+KYEEMK+EP   L+R+A
Sbjct  190   ESL-----FESLCSGVTFYGPFWDQVLSYWRGSLEDPSRVLFMKYEEMKEEPYAQLKRLA  244

Query  775   AFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWS  954
              FLGCPF+EEE E G V  IL LCS  SLS+LE+NK+  N + GV+    FRKG+VGDW 
Sbjct  245   EFLGCPFTEEELESGSVDMILELCSLRSLSDLEINKSGKNVN-GVDYKFYFRKGEVGDWK  303

Query  955   NHMTEEMARRLDQIVQEKFTGTGL  1026
             NH+T EM  R+D I++EK  G+GL
Sbjct  304   NHLTPEMESRIDMIIEEKLGGSGL  327



>ref|XP_010665242.1| PREDICTED: cytosolic sulfotransferase 15-like [Vitis vinifera]
Length=343

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/314 (47%), Positives = 201/314 (64%), Gaps = 7/314 (2%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKS  270
             + E +E   +LP+E  W    +Y Y+GFW     LQ  ++  +HFQ +DSD+++ +  KS
Sbjct  22    SSECQELFQTLPRERNWDGTYIYQYQGFWFRARTLQSIISFQRHFQAEDSDVLVISPQKS  81

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLE--LSYAAKERPDFALTNGSR  444
             GT WLKAL FA+I R Q    Q   PL T+NPHDL+ FLE  L +  KE P+       R
Sbjct  82    GTTWLKALTFAIINRNQSAFSQS--PLLTSNPHDLVRFLEFDLYFMKKEGPNLQDLPRPR  139

Query  445   LLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFD  624
             LLATH P S+LP S+ +S+ ++VY+CRNP D  VS WHF+N + ++   L         +
Sbjct  140   LLATHTPCSMLPSSIKDSECRIVYICRNPLDRFVSIWHFVNTIPTQ--PLNPTSLDHGLE  197

Query  625   SYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSee  804
              +CRGV + GP+WDHV EYWK S E P KVLFLKYE++K++   H++R+A FLG PFSEE
Sbjct  198   MFCRGVESFGPYWDHVLEYWKMSRERPDKVLFLKYEDLKEDISTHIKRLAHFLGFPFSEE  257

Query  805   eeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTEEMARR  984
             EE  G++  I RLCS +SL NL VNKT      G +N   FRKG+VGDW +++T  MA R
Sbjct  258   EERVGIIEEISRLCSLQSLKNLMVNKTG-KRPCGFKNSAHFRKGEVGDWVSYVTPAMAER  316

Query  985   LDQIVQEKFTGTGL  1026
             +  +++EK  G+GL
Sbjct  317   IRILMEEKLRGSGL  330



>gb|EYU36903.1| hypothetical protein MIMGU_mgv1a024755mg [Erythranthe guttata]
Length=327

 Score =   282 bits (721),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 209/314 (67%), Gaps = 9/314 (3%)
 Frame = +1

Query  112   LNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSGTVWLKA  291
             L  L + T W    +  Y+GFW    F + AL+  ++F+ +DSDIILS+ PKSGT WLKA
Sbjct  7     LEKLEQRTNWDGWRIVKYQGFWCPLPFFRAALSAQKYFKAKDSDIILSSLPKSGTTWLKA  66

Query  292   LAFALITRKQFLAEQET---HPLHTNNPHDLIPFLELS-YAAKERPDFALTNGSRLLATH  459
             LAF++  R  +++  +T    PL T+NPH ++P LEL+ Y  +E PD   T+  R+ +TH
Sbjct  67    LAFSVANRSTYMSNIDTTQISPLLTSNPHKVVPHLELNLYLNQENPDLEQTSAPRIFSTH  126

Query  460   LPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFM--NKLRSELRGLEAMPFPEAFDSYC  633
             +P   LP S+ +S  K++Y+CRNP D  +SF HF   NK   E R    +   EAFD +C
Sbjct  127   MPFHALPNSIPKSGCKIIYICRNPMDQFISFRHFSLDNKFGEEDRHGGPVELDEAFDMFC  186

Query  634   RGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeee  813
              GV   GPF++H++ YW   L+NP KVLFLKYE++K +  +H+R++A F+GCPFS+EEEE
Sbjct  187   DGVHLYGPFYEHITGYWDAHLKNPDKVLFLKYEDLKDDIGLHVRKIAEFMGCPFSQEEEE  246

Query  814   CGVVSGILRLCSFESLSNLEVNKT-SVNGDLGVENGVLFRKGKVGDWSNHMTEEMARRLD  990
              G+V  I R+CSF++L NLEVNK+ S NG   V+N   FRKG+VGDW+NH+T  MA R+D
Sbjct  247   RGLVEEICRVCSFDNLKNLEVNKSGSFNG--RVKNSSFFRKGEVGDWANHLTPAMAERMD  304

Query  991   QIVQEKFTGTGLML  1032
             +++  K  G+GL L
Sbjct  305   KLINTKLEGSGLTL  318



>ref|XP_002317223.1| sulfotransferase family protein [Populus trichocarpa]
 gb|EEE97835.1| sulfotransferase family protein [Populus trichocarpa]
Length=336

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/318 (45%), Positives = 209/318 (66%), Gaps = 10/318 (3%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKS  270
              + + E +++ PK  G    D Y Y+GFW  PFFL+G +++ + F PQ +DI +++FPK+
Sbjct  23    AKNYNEVMSTFPKVKGLNGYDYYLYQGFWYAPFFLEGLMSVQEGFNPQSTDIFVASFPKT  82

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAK-ERPDFALTNGSRL  447
             GT WLKAL FA++TR + L+   T  L T  PHD +PFLE   A      D A+     L
Sbjct  83    GTTWLKALTFAIVTRSR-LSGSTTSSLLTKMPHDCVPFLEYDLAQNPSNRDLAIP----L  137

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
             ++TH+P + LPKS+  S  K++Y+CR+ KD  VS W+F+ +L+   + +E +P   AF+ 
Sbjct  138   VSTHVPYTCLPKSIISSSCKIIYICRDAKDAFVSLWYFLARLQMS-KNVEPLPLEGAFEL  196

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             +C G+ N GP+WDHV  YW+ S E P K+LFL YEEMK++   H++++A F+GC F+ EE
Sbjct  197   FCNGIANFGPYWDHVLGYWRASFEFPEKILFLTYEEMKQDTAAHVKKLAEFMGCSFTLEE  256

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTSV---NGDLGVENGVLFRKGKVGDWSNHMTEEMA  978
             EE G V  I+ +CSFE LS+LEVNK      +  L ++N V FR+G++GDW+NH+T EM 
Sbjct  257   EEGGEVQKIISMCSFEKLSSLEVNKNGKHRPDTSLAIQNSVYFRRGEIGDWANHLTPEMG  316

Query  979   RRLDQIVQEKFTGTGLML  1032
              RLD I+++K  G+GL L
Sbjct  317   ARLDDIMEQKLKGSGLKL  334



>ref|XP_010430710.1| PREDICTED: cytosolic sulfotransferase 13 [Camelina sativa]
Length=324

 Score =   282 bits (721),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/323 (45%), Positives = 203/323 (63%), Gaps = 15/323 (5%)
 Frame = +1

Query  67    QFLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDI  246
             + L +  +++E  E L+SLPK+  +    LY Y+GFW  P  L+G L   +HFQ +DSDI
Sbjct  10    KLLADAKFSQECEELLSSLPKDRSFFAEYLYQYQGFWYPPNLLEGVLYSQKHFQARDSDI  69

Query  247   ILSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLE-LSYAAKERPDF  423
             IL + PKSG  WLKAL FALI R++F    E+HPL  NNPH L+PF+E   +  ++    
Sbjct  70    ILVSSPKSGATWLKALVFALIHRREFQTPLESHPLLDNNPHSLVPFIEGFQFHTQD----  125

Query  424   ALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAM  603
                   ++ +TH+P+  LP+S+ +S  KVVY CRNPKD  VS WHF+  L   L+ +   
Sbjct  126   ---TSPKIFSTHIPLRSLPESIKDSSCKVVYCCRNPKDAFVSLWHFVKSLI--LKEMVGC  180

Query  604   PFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFL  783
                E    +CRG    GPFWDH  EYWKES ENP KVLF+ YEEM+++P   + R+A FL
Sbjct  181   TMEEMVSGFCRGSSVYGPFWDHALEYWKESQENPDKVLFVMYEEMREQPRDWVIRIAEFL  240

Query  784   GCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSN  957
             GC F+EEE E GV+  I++LCS E++S LEVN+    G L  G+E    FRKG++G W++
Sbjct  241   GCSFTEEEIENGVLDSIIKLCSLENMSKLEVNE---KGKLVNGMETKAFFRKGEIGGWTD  297

Query  958   HMTEEMARRLDQIVQEKFTGTGL  1026
              +   +A ++D+  ++K  G+G 
Sbjct  298   TLPPLLAEKIDKTTEQKLIGSGF  320



>ref|XP_011006878.1| PREDICTED: flavonol sulfotransferase-like [Populus euphratica]
Length=336

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/318 (46%), Positives = 210/318 (66%), Gaps = 10/318 (3%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKS  270
              + + E +++LPK  G    D Y Y+GFW   FFL+G +++ +HF PQ +DI +++ PK+
Sbjct  23    AKNYNEMMSTLPKAKGLRGNDYYLYQGFWYSSFFLEGLMSVQEHFNPQSTDIFVASSPKT  82

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKER-PDFALTNGSRL  447
             GT WLKALAFA++TR + L+   T  L T  PHD +PFLE   A   R  D A+     L
Sbjct  83    GTTWLKALAFAVLTRSR-LSGSTTSSLLTKMPHDCVPFLEFQVAQNPRIRDLAVP----L  137

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
             L+TH+P S LPKS+  S  K++Y+CR+ KDT VS+W F++  +   + +E +P  EAF+ 
Sbjct  138   LSTHVPYSCLPKSIISSSCKIIYICRDAKDTFVSWWCFVSTHQMS-KNVEPVPLEEAFEM  196

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             +C G+   GP+WDHV  YW+ SLE P K+LFL YEEMKK+   H +++A F+GC F+ EE
Sbjct  197   FCNGISILGPYWDHVLGYWRASLEFPEKILFLTYEEMKKDTAAHAKKLAEFMGCSFTLEE  256

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTS---VNGDLGVENGVLFRKGKVGDWSNHMTEEMA  978
             EE G V  I+  CSFE LS LEVNK     ++  + ++N + FRKG++GDW+NH+T EM 
Sbjct  257   EEEGEVQKIISTCSFEKLSRLEVNKNGKLHLDTSIAIQNSLYFRKGEIGDWANHLTPEMG  316

Query  979   RRLDQIVQEKFTGTGLML  1032
              RLD I+++K  G+GL L
Sbjct  317   ARLDDIMEQKLKGSGLKL  334



>ref|XP_011011419.1| PREDICTED: flavonol sulfotransferase-like [Populus euphratica]
Length=336

 Score =   282 bits (721),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 146/318 (46%), Positives = 210/318 (66%), Gaps = 10/318 (3%)
 Frame = +1

Query  91    TEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKS  270
              + + E +++LPK  G    D Y Y+GFW   FFL+G +++ +HF PQ +DI +++ PK+
Sbjct  23    AKNYNEMMSTLPKAKGLRGNDYYLYQGFWYSSFFLEGLMSVQEHFNPQSTDIFVASSPKT  82

Query  271   GTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAK-ERPDFALTNGSRL  447
             GT WLKALAFA++TR + L+   T  L  N PHD +PFLE   A      D A+     L
Sbjct  83    GTTWLKALAFAVLTRSR-LSGSTTSSLLINMPHDCVPFLEFHVAQNPSNRDLAIP----L  137

Query  448   LATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDS  627
             L+TH+P S LPKS+  S  K++Y+CR+ KDT VS+W F++  +   + +E +P  EAF+ 
Sbjct  138   LSTHVPYSCLPKSIISSSCKIIYICRDAKDTFVSWWCFVSAHQMS-KNVEPLPLEEAFEM  196

Query  628   YCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeee  807
             +C G+   GP+WDHV  YW+ SLE P K+LFL YEEMKK+   H +++A F+GC F+ EE
Sbjct  197   FCNGISILGPYWDHVLGYWRASLEFPEKILFLTYEEMKKDTAAHAKKLAEFMGCSFTLEE  256

Query  808   eeCGVVSGILRLCSFESLSNLEVNKTS---VNGDLGVENGVLFRKGKVGDWSNHMTEEMA  978
             EE G V  I+ +CSFE LS LEVNK     ++  + ++N + FRKG++GDW+NH+T EM 
Sbjct  257   EEEGEVQKIISMCSFEKLSRLEVNKNGKLHLDTSIAIQNSLYFRKGEIGDWANHLTPEMG  316

Query  979   RRLDQIVQEKFTGTGLML  1032
              RLD I+++K  G+GL L
Sbjct  317   ARLDDIMEQKLKGSGLKL  334



>emb|CDY42346.1| BnaA09g15810D [Brassica napus]
Length=336

 Score =   282 bits (721),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/330 (43%), Positives = 219/330 (66%), Gaps = 15/330 (5%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             ++++++ ++E +  ++SLP +  ++   LYNYKG W  P  LQ  L + +HFQP+  DII
Sbjct  12    YMKDDNVSQETKNLISSLPSDKDFMGYSLYNYKGCWYYPNTLQAVLDVQEHFQPRKKDII  71

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA  426
             L++ PK GT WLK++ FA++ R+++    +THPL + NPHDL+PFLE+  YA  + PD  
Sbjct  72    LASLPKGGTTWLKSIVFAVLHREKYRENPQTHPLLSQNPHDLVPFLEIELYAGSQTPDLT  131

Query  427   LTNGSRLLATHLPVSLLPKSVWESKG-----KVVYLCRNPKDTVVSFWHFMNKL-RSELR  588
                   + +TH+ ++ L ++  +S       K+VY+CR  KDT VS WH+ NKL R+E  
Sbjct  132   KFPSPMIFSTHMHLNTLLEATTKSSSSSSPCKIVYVCRGIKDTFVSAWHYRNKLHRTE--  189

Query  589   GLEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRR  768
              ++   F   FD+YCRGV   GP+W+H+  YWK SLE+   VLF+KYEE+ ++P + ++R
Sbjct  190   -MDQASFELMFDAYCRGVHLYGPYWEHILSYWKGSLEDKEHVLFMKYEEIIEDPRLQVKR  248

Query  769   MAAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKV  942
             +  FL CPF++EEEE G V  I+ LCS  +LS+LE+NK   NG +  GV+  V FRKG+V
Sbjct  249   LGEFLNCPFTKEEEESGSVEEIVNLCSLRNLSSLEINK---NGTIRVGVDTNVFFRKGEV  305

Query  943   GDWSNHMTEEMARRLDQIVQEKFTGTGLML  1032
             GDW NH+T ++A+ +D+IV+ +  G+GL+ 
Sbjct  306   GDWKNHLTPQIAKSIDEIVESRLRGSGLIF  335



>ref|XP_009113421.1| PREDICTED: cytosolic sulfotransferase 11-like [Brassica rapa]
Length=336

 Score =   282 bits (721),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 142/330 (43%), Positives = 219/330 (66%), Gaps = 15/330 (5%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             ++++++ ++E +  ++SLP +  ++   LYNYKG W  P  LQ  L + +HFQP+  DII
Sbjct  12    YMKDDNVSQETKNLISSLPSDKDFMGYSLYNYKGCWYYPNTLQAVLDVQEHFQPRKKDII  71

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA  426
             L++ PK GT WLK++ FA++ R+++    +THPL + NPHDL+PFLE+  YA  + PD  
Sbjct  72    LASLPKGGTTWLKSIVFAVLHREKYRENPQTHPLLSQNPHDLVPFLEIELYAGSQTPDLT  131

Query  427   LTNGSRLLATHLPVSLLPKSVWESKG-----KVVYLCRNPKDTVVSFWHFMNKL-RSELR  588
                   + +TH+ ++ L ++  +S       K+VY+CR  KDT VS WH+ NKL R+E  
Sbjct  132   KFPSPMIFSTHMHLNTLLEATTKSSSSSSPCKIVYVCRGIKDTFVSAWHYRNKLHRTE--  189

Query  589   GLEAMPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRR  768
              ++   F   FD+YCRGV   GP+W+H+  YWK SLE+   VLF+KYEE+ ++P + ++R
Sbjct  190   -MDQASFELMFDAYCRGVHLYGPYWEHILSYWKGSLEDKEHVLFMKYEEIIEDPRLQVKR  248

Query  769   MAAFLGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKV  942
             +  FL CPF++EEEE G V  I+ LCS  +LS+LE+NK   NG +  GV+  V FRKG+V
Sbjct  249   LGEFLNCPFTKEEEESGSVEEIVNLCSLRNLSSLEINK---NGTIRVGVDTNVFFRKGEV  305

Query  943   GDWSNHMTEEMARRLDQIVQEKFTGTGLML  1032
             GDW NH+T ++A+ +D+IV+ +  G+GL+ 
Sbjct  306   GDWKNHLTPQIAKTIDEIVESRLRGSGLIF  335



>gb|KCW81757.1| hypothetical protein EUGRSUZ_C03121 [Eucalyptus grandis]
Length=280

 Score =   280 bits (716),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/315 (47%), Positives = 188/315 (60%), Gaps = 39/315 (12%)
 Frame = +1

Query  94    EEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILSTFPKSG  273
             + F++  +SLP E  W+T     Y+GFWL      G LT   HFQ   SDI+L T PKSG
Sbjct  3     QAFKDLFSSLPSEEDWITVSFRLYQGFWLSSRLFNGILTCQNHFQAHPSDILLVTSPKSG  62

Query  274   TVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALTNGSRLLA  453
             T WLKA+ FAL+                                 + PD       RL A
Sbjct  63    TTWLKAILFALLN--------------------------------QNPDLTAIASPRLFA  90

Query  454   THLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPFPEAFDSYC  633
             TH+P SLLP+SV +S  K+VYLCRNPKDT VS WHF N++R E +G   +P  E  D +C
Sbjct  91    THMPYSLLPQSVRDSNCKLVYLCRNPKDTFVSMWHFANRMRPEEKG--QIPIQEGLDKFC  148

Query  634   RGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGCPFSeeeee  813
             RGV   GP+WDHV  Y K SL+ P KVLF+ YE+MK +P VH+RR+A FLGCPFS+EE  
Sbjct  149   RGVSVCGPYWDHVLGYHKASLDMPEKVLFMMYEQMKVDPHVHVRRLADFLGCPFSKEELR  208

Query  814   CGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWSNHMTEEMARRL  987
              G + GIL++CSF+++S LEVNK    G L  G E    FR+G+VGDW N M+ EM  R+
Sbjct  209   DGTLEGILKICSFDNMSALEVNKC---GKLWTGAETKWFFRRGEVGDWVNCMSSEMGERI  265

Query  988   DQIVQEKFTGTGLML  1032
             D +++EK  G+GL L
Sbjct  266   DGVMEEKLHGSGLKL  280



>ref|XP_010450178.1| PREDICTED: cytosolic sulfotransferase 1-like [Camelina sativa]
Length=327

 Score =   281 bits (720),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/321 (44%), Positives = 207/321 (64%), Gaps = 7/321 (2%)
 Frame = +1

Query  76    QENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIILS  255
              ++    EFR  ++SLP +       L NY+G W     L   L   +HF+P D+DIILS
Sbjct  12    DDDDVRTEFRSLISSLPSDINVQGKKLCNYQGCWYYEKNLHAVLDYQKHFKPLDTDIILS  71

Query  256   TFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELS-YAAKERPDFA-L  429
             ++PKSGT WLKAL  AL+ R +     ++HPL +++PH L+PFLE++ Y     PD   +
Sbjct  72    SYPKSGTTWLKALTVALLHRSK--DGIQSHPLTSDSPHGLVPFLEMNLYLKSSTPDLTKI  129

Query  430   TNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMPF  609
             ++  RL +TH+P+  L + + +S  K+VY+ RN KD +VS WHF +K+  E +  E    
Sbjct  130   SSSPRLFSTHMPLHTLREPLKDSPCKIVYVSRNAKDVLVSLWHFRSKI--EKKEAEISSL  187

Query  610   PEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLGC  789
                 +S+C+GV N GP WDHV  YWK SLE+P  VLF++YE++K+EP   + R+A FLGC
Sbjct  188   NSIVESFCKGVDNNGPVWDHVLSYWKGSLEDPKHVLFIRYEDLKEEPYAQVMRLADFLGC  247

Query  790   PFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLGVENGVLFRKGKVGDWSNHMTE  969
             PF++EE   G V  IL LCS  +LSNL++NKT V+ +  +++ + FRKG+V DW NH+T 
Sbjct  248   PFTQEEIHRGSVEKILNLCSLCNLSNLDINKTGVSWN-NMDHSIYFRKGEVDDWKNHLTT  306

Query  970   EMARRLDQIVQEKFTGTGLML  1032
             +MA ++D ++ EKF G+GL +
Sbjct  307   DMANKIDMVIHEKFQGSGLKI  327



>ref|XP_002463161.1| hypothetical protein SORBIDRAFT_02g038840 [Sorghum bicolor]
 gb|EER99682.1| hypothetical protein SORBIDRAFT_02g038840 [Sorghum bicolor]
Length=341

 Score =   282 bits (721),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 139/324 (43%), Positives = 194/324 (60%), Gaps = 14/324 (4%)
 Frame = +1

Query  73    LQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDIIL  252
             + E++  EEF + + SLP+    +  +L  Y+GFWL   ++ G +   + F P+  D+IL
Sbjct  23    VPEHTPKEEFGDLVASLPRREQSIL-ELRLYQGFWLPEHWVPGTIVFQRRFTPRPDDVIL  81

Query  253   STFPKSGTVWLKALAFALITRKQFLAEQETHPLHTNNPHDLIPFLELSYAAKERPDFALT  432
             +++PK GT WLKALAFA   R  +      HPL   NPHD IPF++  +A  E       
Sbjct  82    ASYPKCGTTWLKALAFATAARTAYPPSDAGHPLRRMNPHDCIPFIDEIFAGGEDAKLDAL  141

Query  433   NGSRLLATHLPVSLLPKSVWESKG--KVVYLCRNPKDTVVSFWHFMNKLRSELRGLEAMP  606
                RL+ THLP +LLP SV  + G  +V Y+CR+PKD VVS WHF+ + + +L       
Sbjct  142   PSPRLMNTHLPYALLPASVVTATGGCRVAYVCRDPKDMVVSLWHFLRRTKPDLS------  195

Query  607   FPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAFLG  786
             F + F+S C G    GP WDHV  YW+ S+  P + LFLKYE++ ++P  ++RR+A F+G
Sbjct  196   FADTFESVCDGTVAAGPVWDHVLSYWRASVATPDRALFLKYEDLLRDPAGNVRRLAEFMG  255

Query  787   CPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDLG----VENGVLFRKGKVGDWS  954
             CPFS  EE  G V+ ++ LCSF+ +  LEVN+    G  G    +     FRKG  GDW+
Sbjct  256   CPFSAAEEAAGNVAAVVELCSFDEMKGLEVNRPG-GGTAGKYRAMPRDAFFRKGVAGDWA  314

Query  955   NHMTEEMARRLDQIVQEKFTGTGL  1026
             NHMT EMA RLDQI ++K  GTGL
Sbjct  315   NHMTPEMAARLDQIFRDKLQGTGL  338



>ref|XP_009114140.1| PREDICTED: cytosolic sulfotransferase 12-like [Brassica rapa]
Length=328

 Score =   281 bits (719),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 152/324 (47%), Positives = 203/324 (63%), Gaps = 14/324 (4%)
 Frame = +1

Query  70    FLQENSYTEEFREFLNSLPKETGWLTPDLYNYKGFWLEPFFLQGALTIHQHFQPQDSDII  249
             +L++ + T++ ++ ++SLP E GWL   +Y ++G W     L+G LT  + F+ +DSDII
Sbjct  10    YLRDENLTQKTKDLISSLPSEKGWLVCQMYQFQGRWHTQALLKGILTCQKQFEAKDSDII  69

Query  250   LSTFPKSGTVWLKALAFALITRKQFLAEQET---HPLHTNNPHDLIPFLELSYAAKERPD  420
             L T PKSGT WLKAL FALI R +F     +   HPL   NPH L+PFLE  Y      D
Sbjct  70    LVTNPKSGTTWLKALVFALINRHKFPVYSSSSGEHPLLVTNPHSLVPFLEGVYYESPDFD  129

Query  421   FALTNGSRLLATHLPVSLLPKSVWESKGKVVYLCRNPKDTVVSFWHFMNKLRSELRGLEA  600
             F+  +  RL+ TH+    LP+SV  S  K+VY CR PKD  VS WHF  KL  E      
Sbjct  130   FSQLSSPRLMNTHISHLSLPESVKSSPCKIVYCCRKPKDMFVSLWHFGKKLAPEETA--D  187

Query  601   MPFPEAFDSYCRGVCNTGPFWDHVSEYWKESLENPGKVLFLKYEEMKKEPEVHLRRMAAF  780
              P  +A +++C+G    GPFWDHV EYW  SLENP KVLF+ YEE+KK+    ++R+A F
Sbjct  188   YPIEKAVEAFCQGKFIGGPFWDHVLEYWYASLENPNKVLFVSYEELKKKTGDTIKRIAEF  247

Query  781   LGCPFSeeeeeCGVVSGILRLCSFESLSNLEVNKTSVNGDL--GVENGVLFRKGKVGDWS  954
             LGC F  EEE    V  I++LCSFESLS+LEVN+    G L  G+E    FRKG+VG W 
Sbjct  248   LGCGFVGEEE----VRAIVKLCSFESLSSLEVNR---EGKLPSGMETRAFFRKGEVGGWR  300

Query  955   NHMTEEMARRLDQIVQEKFTGTGL  1026
             + +TE +A  +D+ ++EKF G+GL
Sbjct  301   DTLTESLAEVIDRTIEEKFQGSGL  324



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2929097739896