BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24923_g1_i2 len=3838 path=[10227:0-193 223:194-214 244:215-215
@77@!:216-1870 282:1871-2940 200:2941-3837]

Length=3838
                                                                      Score     E

emb|CCA66009.1|  hypothetical protein                                   429   4e-165   
ref|XP_009124282.1|  PREDICTED: putative ribonuclease H protein A...    431   2e-144   
ref|XP_009101981.1|  PREDICTED: putative ribonuclease H protein A...    407   8e-142   
ref|XP_008341993.1|  PREDICTED: uncharacterized protein LOC103404803    365   9e-140   
gb|AAC63844.1|  putative non-LTR retroelement reverse transcriptase     400   1e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006490008.1|  PREDICTED: uncharacterized protein LOC102624085    365   3e-135   
ref|XP_009151561.1|  PREDICTED: putative ribonuclease H protein A...    396   5e-131   
ref|XP_010670869.1|  PREDICTED: uncharacterized protein LOC104887816    368   5e-118   
ref|XP_009126860.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    413   3e-117   
emb|CCA65997.1|  hypothetical protein                                   311   8e-116   
ref|XP_009119466.1|  PREDICTED: uncharacterized protein LOC103844431    408   3e-115   
emb|CAB10337.1|  reverse transcriptase like protein                     394   4e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008245529.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    325   6e-109   
gb|ABD28627.2|  RNA-directed DNA polymerase (Reverse transcriptas...    294   7e-107   Medicago truncatula
ref|XP_008221358.1|  PREDICTED: putative ribonuclease H protein A...    369   1e-106   
ref|XP_009344908.1|  PREDICTED: uncharacterized protein LOC103936764    379   2e-106   
ref|XP_008228034.1|  PREDICTED: putative ribonuclease H protein A...    364   4e-106   
ref|XP_010026656.1|  PREDICTED: uncharacterized protein LOC104417027    306   1e-103   
gb|ABW81175.1|  non-LTR retrotransposon transposase                     292   7e-102   Arabidopsis cebennensis
ref|XP_010668235.1|  PREDICTED: uncharacterized protein LOC104885230    265   1e-100   
gb|AFP55574.1|  non-ltr retroelement reverse transcriptase              274   7e-100   
ref|XP_009375083.1|  PREDICTED: uncharacterized protein LOC103963932    301   8e-100   
ref|XP_010054376.1|  PREDICTED: uncharacterized protein LOC104442671    287   1e-99    
ref|XP_010507122.1|  PREDICTED: uncharacterized protein LOC104783698    290   3e-99    
emb|CCA66036.1|  hypothetical protein                                   263   3e-98    
ref|XP_007203344.1|  hypothetical protein PRUPE_ppa020282mg             279   7e-98    
ref|XP_010682933.1|  PREDICTED: uncharacterized protein LOC104897695    293   1e-97    
ref|XP_010688582.1|  PREDICTED: uncharacterized protein LOC104902493    285   1e-97    
ref|XP_009118883.1|  PREDICTED: uncharacterized protein LOC103843855    291   1e-97    
emb|CCA66040.1|  hypothetical protein                                   285   2e-97    
ref|XP_010682492.1|  PREDICTED: uncharacterized protein LOC104897331    312   2e-97    
ref|XP_010473926.1|  PREDICTED: uncharacterized protein LOC104753360    313   3e-97    
emb|CCA66044.1|  hypothetical protein                                   294   4e-97    
emb|CCA66054.1|  hypothetical protein                                   292   5e-97    
ref|XP_010694802.1|  PREDICTED: uncharacterized protein LOC104907559    310   6e-97    
ref|XP_010666306.1|  PREDICTED: uncharacterized protein LOC104883473    290   2e-96    
ref|XP_010039097.1|  PREDICTED: uncharacterized protein LOC104427753    316   2e-96    
ref|XP_010690177.1|  PREDICTED: uncharacterized protein LOC104903764    278   2e-96    
gb|AAD37021.1|  putative non-LTR retrolelement reverse transcriptase    335   5e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118875.1|  PREDICTED: uncharacterized protein LOC103843847    313   6e-96    
ref|XP_009103763.1|  PREDICTED: uncharacterized protein LOC103829818    313   8e-96    
ref|XP_010501912.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    244   5e-95    
ref|XP_009140200.1|  PREDICTED: putative ribonuclease H protein A...    316   1e-94    
ref|XP_010430691.1|  PREDICTED: uncharacterized protein LOC104714925    289   2e-94    
ref|XP_010412448.1|  PREDICTED: uncharacterized protein LOC104698743    296   3e-94    
ref|XP_008382376.1|  PREDICTED: uncharacterized protein LOC103445169    288   3e-94    
gb|ABA98491.1|  retrotransposon protein, putative, unclassified         286   3e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010506884.1|  PREDICTED: uncharacterized protein LOC104783422    296   4e-94    
ref|XP_010451822.1|  PREDICTED: uncharacterized protein LOC104734004    296   6e-94    
ref|XP_010670096.1|  PREDICTED: uncharacterized protein LOC104887198    282   3e-93    
ref|XP_008351830.1|  PREDICTED: putative ribonuclease H protein A...    295   3e-93    
ref|XP_008387639.1|  PREDICTED: uncharacterized protein LOC103450094    306   5e-93    
ref|XP_010041058.1|  PREDICTED: uncharacterized protein LOC104429964    299   6e-93    
ref|XP_009114416.1|  PREDICTED: uncharacterized protein LOC103839673    281   2e-92    
ref|XP_010513001.1|  PREDICTED: uncharacterized protein LOC104788939    287   3e-92    
ref|XP_009129032.1|  PREDICTED: uncharacterized protein LOC103853884    307   3e-92    
ref|XP_010686122.1|  PREDICTED: uncharacterized protein LOC104900404    293   9e-92    
ref|XP_009116295.1|  PREDICTED: putative ribonuclease H protein A...    264   1e-91    
ref|XP_010495131.1|  PREDICTED: uncharacterized protein LOC104772187    293   2e-91    
ref|XP_010451785.1|  PREDICTED: uncharacterized protein LOC104733961    271   2e-91    
ref|XP_010513742.1|  PREDICTED: uncharacterized protein LOC104789794    297   6e-91    
ref|XP_009124968.1|  PREDICTED: uncharacterized protein LOC103850017    298   1e-90    
ref|XP_010674616.1|  PREDICTED: uncharacterized protein LOC104890737    312   1e-90    
ref|XP_008367994.1|  PREDICTED: uncharacterized protein LOC103431605    262   2e-90    
ref|XP_010693383.1|  PREDICTED: uncharacterized protein LOC104906342    296   2e-90    
ref|XP_006480844.1|  PREDICTED: putative ribonuclease H protein A...    295   2e-90    
ref|XP_008340956.1|  PREDICTED: uncharacterized protein LOC103403885    271   2e-90    
ref|XP_004298219.1|  PREDICTED: uncharacterized protein LOC101304768    266   4e-90    
ref|XP_009126346.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    291   4e-90    
ref|XP_010480950.1|  PREDICTED: uncharacterized protein LOC104759762    280   1e-89    
emb|CCA66050.1|  hypothetical protein                                   293   1e-89    
ref|XP_007226707.1|  hypothetical protein PRUPE_ppa020120mg             274   2e-89    
ref|XP_010445339.1|  PREDICTED: uncharacterized protein LOC104727990    285   3e-89    
ref|XP_010474119.1|  PREDICTED: uncharacterized protein LOC104753583    293   8e-89    
gb|EEC79647.1|  hypothetical protein OsI_20882                          327   1e-88    Oryza sativa Indica Group [Indian rice]
ref|XP_009123679.1|  PREDICTED: putative ribonuclease H protein A...    287   3e-88    
ref|XP_010666976.1|  PREDICTED: uncharacterized protein LOC104884079    285   4e-88    
ref|XP_009102116.1|  PREDICTED: uncharacterized protein LOC103828254    277   9e-88    
ref|XP_009112590.1|  PREDICTED: uncharacterized protein LOC103837948    288   9e-88    
ref|XP_008351907.1|  PREDICTED: uncharacterized protein LOC103415345    277   9e-88    
gb|EAZ20803.1|  hypothetical protein OsJ_36426                          313   1e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010673997.1|  PREDICTED: uncharacterized protein LOC104890275    318   5e-87    
ref|XP_010684763.1|  PREDICTED: uncharacterized protein LOC104899296    317   6e-87    
ref|XP_010484806.1|  PREDICTED: uncharacterized protein LOC104763089    317   8e-87    
ref|XP_008356060.1|  PREDICTED: uncharacterized protein LOC103419743    211   9e-87    
ref|XP_009113016.1|  PREDICTED: uncharacterized protein LOC103838337    286   2e-86    
gb|AAP54692.2|  retrotransposon protein, putative, unclassified         273   2e-86    Oryza sativa Japonica Group [Japonica rice]
gb|AAO00713.1|  retrotransposon protein, putative, unclassified         273   2e-86    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001057661.2|  Os06g0484800                                       266   3e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010039996.1|  PREDICTED: uncharacterized protein LOC104428743    316   4e-86    
ref|XP_009130050.1|  PREDICTED: putative ribonuclease H protein A...    285   4e-86    
gb|AAB82639.1|  putative non-LTR retroelement reverse transcriptase     271   7e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124289.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    262   9e-86    
ref|XP_010674085.1|  PREDICTED: uncharacterized protein LOC104890338    274   9e-86    
ref|XP_010684019.1|  PREDICTED: uncharacterized protein LOC104898622    285   1e-85    
pir||T00833  RNA-directed DNA polymerase homolog T13L16.7 - Arabi...    290   1e-85 
gb|ABA97040.1|  retrotransposon protein, putative, unclassified         318   2e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010445598.1|  PREDICTED: uncharacterized protein LOC104728296    275   3e-85    
gb|EEC84753.1|  hypothetical protein OsI_31756                          314   4e-85    Oryza sativa Indica Group [Indian rice]
ref|XP_009135908.1|  PREDICTED: uncharacterized protein LOC103860050    294   4e-85    
ref|XP_008356436.1|  PREDICTED: putative ribonuclease H protein A...    273   5e-85    
gb|AAT58873.1|  hypothetical protein                                    268   6e-85    Oryza sativa Japonica Group [Japonica rice]
emb|CCA66180.1|  hypothetical protein                                   254   8e-85    
emb|CAB39638.1|  RNA-directed DNA polymerase-like protein               259   1e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010687489.1|  PREDICTED: uncharacterized protein LOC104901596    281   1e-84    
ref|XP_010451584.1|  PREDICTED: uncharacterized protein LOC104733725    281   2e-84    
ref|XP_010233096.1|  PREDICTED: uncharacterized protein LOC104583080    306   2e-84    
ref|XP_008242862.1|  PREDICTED: uncharacterized protein LOC103341160    305   2e-84    
ref|XP_010669434.1|  PREDICTED: uncharacterized protein LOC104886665    241   3e-84    
gb|AAG51783.1|AC079679_3  reverse transcriptase, putative; 16838-...    285   4e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009121338.1|  PREDICTED: uncharacterized protein LOC103846184    261   9e-84    
ref|XP_007203701.1|  hypothetical protein PRUPE_ppa020995mg             230   1e-83    
gb|AAD29058.1|  putative non-LTR retroelement reverse transcriptase     273   1e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008391838.1|  PREDICTED: uncharacterized protein LOC103454030    310   1e-83    
ref|XP_010495785.1|  PREDICTED: uncharacterized protein LOC104772929    280   1e-83    
dbj|BAE79385.1|  unnamed protein product                                309   2e-83    Ipomoea batatas [batate]
ref|XP_010671205.1|  PREDICTED: uncharacterized protein LOC104888072    264   2e-83    
ref|XP_010673168.1|  PREDICTED: uncharacterized protein LOC104889608    257   2e-83    
ref|XP_010476358.1|  PREDICTED: uncharacterized protein LOC104755638    281   2e-83    
ref|XP_010681283.1|  PREDICTED: uncharacterized protein LOC104896266    307   3e-83    
ref|XP_004305437.1|  PREDICTED: uncharacterized protein LOC101296313    290   3e-83    
ref|XP_009150816.1|  PREDICTED: uncharacterized protein LOC103874152    276   3e-83    
ref|XP_010469706.1|  PREDICTED: uncharacterized protein LOC104749719    277   3e-83    
ref|XP_010513002.1|  PREDICTED: uncharacterized protein LOC104788940    307   5e-83    
ref|XP_009140393.1|  PREDICTED: uncharacterized protein LOC103864388    270   6e-83    
dbj|BAE79382.1|  unnamed protein product                                307   6e-83    Ipomoea batatas [batate]
gb|ABA98898.1|  retrotransposon protein, putative, unclassified         306   7e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010430664.1|  PREDICTED: uncharacterized protein LOC104714891    281   9e-83    
gb|AAF69169.1|AC007915_21  F27F5.21                                     280   1e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002454941.1|  hypothetical protein SORBIDRAFT_03g001780          294   1e-82    Sorghum bicolor [broomcorn]
ref|XP_009126341.1|  PREDICTED: uncharacterized protein LOC103851249    278   2e-82    
emb|CCA66188.1|  hypothetical protein                                   249   2e-82    
dbj|BAE79384.1|  unnamed protein product                                308   2e-82    Ipomoea batatas [batate]
ref|XP_010495286.1|  PREDICTED: uncharacterized protein LOC104772356    268   2e-82    
emb|CCA65974.1|  hypothetical protein                                   254   2e-82    
ref|XP_007212615.1|  hypothetical protein PRUPE_ppa017091mg             249   3e-82    
ref|XP_009150035.1|  PREDICTED: uncharacterized protein LOC103873375    273   3e-82    
ref|XP_010676027.1|  PREDICTED: uncharacterized protein LOC104891937    305   3e-82    
ref|XP_010054717.1|  PREDICTED: uncharacterized protein LOC104443052    299   6e-82    
ref|XP_008387315.1|  PREDICTED: uncharacterized protein LOC103449768    255   7e-82    
ref|XP_009102231.1|  PREDICTED: uncharacterized protein LOC103828378    261   1e-81    
ref|XP_010693052.1|  PREDICTED: uncharacterized protein LOC104906048    303   1e-81    
ref|XP_010419439.1|  PREDICTED: uncharacterized protein LOC104705159    258   1e-81    
ref|XP_008393538.1|  PREDICTED: uncharacterized protein LOC103455726    246   1e-81    
ref|XP_010418618.1|  PREDICTED: uncharacterized protein LOC104704191    258   1e-81    
ref|XP_010238942.1|  PREDICTED: uncharacterized protein LOC100831270    303   2e-81    
ref|XP_010058710.1|  PREDICTED: uncharacterized protein LOC104446568    303   2e-81    
ref|XP_009102778.1|  PREDICTED: uncharacterized protein LOC103828890    247   2e-81    
emb|CCA66140.1|  hypothetical protein                                   252   3e-81    
ref|XP_010674186.1|  PREDICTED: uncharacterized protein LOC104890406    255   3e-81    
ref|XP_009146506.1|  PREDICTED: uncharacterized protein LOC103870148    269   4e-81    
gb|KDP39672.1|  hypothetical protein JCGZ_02692                         280   4e-81    
ref|XP_010687808.1|  PREDICTED: uncharacterized protein LOC104901884    277   4e-81    
ref|XP_007017131.1|  Uncharacterized protein TCM_033752                 248   4e-81    
ref|XP_010689711.1|  PREDICTED: uncharacterized protein LOC104903385    246   6e-81    
ref|XP_008364002.1|  PREDICTED: putative ribonuclease H protein A...    295   7e-81    
gb|ABB46931.2|  retrotransposon protein, putative, unclassified         303   7e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009107566.1|  PREDICTED: uncharacterized protein LOC103833219    276   8e-81    
gb|AAM01179.2|AC113336_31  Putative retroelement                        303   9e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007046404.1|  Uncharacterized protein TCM_011923                 248   9e-81    
ref|XP_010686872.1|  PREDICTED: uncharacterized protein LOC104901027    223   1e-80    
ref|XP_010485231.1|  PREDICTED: uncharacterized protein LOC104763574    238   1e-80    
ref|XP_010490159.1|  PREDICTED: uncharacterized protein LOC104767890    239   2e-80    
ref|XP_007022832.1|  Uncharacterized protein TCM_026877                 248   2e-80    
ref|XP_007031313.1|  Uncharacterized protein TCM_016763                 243   2e-80    
ref|XP_007008704.1|  Uncharacterized protein TCM_042330                 245   3e-80    
emb|CAE04866.2|  OSJNBa0086O06.14                                       298   3e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007020288.1|  Uncharacterized protein TCM_036737                 242   7e-80    
ref|XP_009103791.1|  PREDICTED: uncharacterized protein LOC103829852    258   7e-80    
gb|EEC83100.1|  hypothetical protein OsI_28249                          297   8e-80    Oryza sativa Indica Group [Indian rice]
gb|EEE61581.1|  hypothetical protein OsJ_15963                          298   1e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008372905.1|  PREDICTED: uncharacterized protein LOC103436258    293   1e-79    
ref|XP_008244613.1|  PREDICTED: putative ribonuclease H protein A...    292   1e-79    
ref|XP_007227312.1|  hypothetical protein PRUPE_ppa016553mg             293   1e-79    
emb|CCA66235.1|  hypothetical protein                                   249   1e-79    
emb|CCA65995.1|  hypothetical protein                                   297   2e-79    
ref|XP_009102787.1|  PREDICTED: uncharacterized protein LOC103828902    292   2e-79    
gb|AAD21778.1|  putative non-LTR retroelement reverse transcriptase     254   2e-79    Arabidopsis thaliana [mouse-ear cress]
gb|EEE69906.1|  hypothetical protein OsJ_29747                          294   3e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010495306.1|  PREDICTED: uncharacterized protein LOC104772378    290   3e-79    
ref|XP_008350747.1|  PREDICTED: uncharacterized protein LOC103414113    254   4e-79    
gb|EEC71228.1|  hypothetical protein OsI_03168                          252   4e-79    Oryza sativa Indica Group [Indian rice]
ref|XP_009125370.1|  PREDICTED: putative ribonuclease H protein A...    291   4e-79    
ref|XP_008345353.1|  PREDICTED: putative ribonuclease H protein A...    291   5e-79    
ref|XP_009147172.1|  PREDICTED: uncharacterized protein LOC103870758    263   5e-79    
emb|CCA66198.1|  hypothetical protein                                   242   6e-79    
gb|ABA96650.1|  retrotransposon protein, putative, unclassified         293   6e-79    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066197.2|  Os12g0156200                                       297   6e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009146764.1|  PREDICTED: uncharacterized protein LOC103870391    291   7e-79    
gb|AAS55787.1|  hypothetical protein                                    297   8e-79    Oryza sativa Japonica Group [Japonica rice]
gb|AAQ19327.1|  bZIP-like protein                                       297   1e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009140970.1|  PREDICTED: uncharacterized protein LOC103864947    295   1e-78    
ref|XP_008237273.1|  PREDICTED: uncharacterized protein LOC103336015    249   1e-78    
emb|CAB75484.1|  putative protein                                       288   1e-78    Arabidopsis thaliana [mouse-ear cress]
emb|CCA66178.1|  hypothetical protein                                   258   1e-78    
gb|AAP54617.2|  retrotransposon protein, putative, unclassified         294   1e-78    Oryza sativa Japonica Group [Japonica rice]
gb|AAG13524.1|AC068924_29  putative non-LTR retroelement reverse ...    294   2e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010451797.1|  PREDICTED: uncharacterized protein LOC104733977    274   2e-78    
gb|AAG03119.1|AC004133_13  F5A9.24                                      254   2e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010692477.1|  PREDICTED: uncharacterized protein LOC104905588    292   3e-78    
ref|XP_010468391.1|  PREDICTED: uncharacterized protein LOC104748447    287   3e-78    
gb|AAF97969.1|AC000103_19  F21J9.30                                     254   3e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009361334.1|  PREDICTED: uncharacterized protein LOC103951630    292   4e-78    
ref|XP_010667308.1|  PREDICTED: uncharacterized protein LOC104884364    292   4e-78    
gb|EEE59033.1|  hypothetical protein OsJ_10782                          286   8e-78    Oryza sativa Japonica Group [Japonica rice]
gb|EEC75230.1|  hypothetical protein OsI_11503                          283   9e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_009102759.1|  PREDICTED: uncharacterized protein LOC103828873    289   9e-78    
ref|XP_007203452.1|  hypothetical protein PRUPE_ppa022115mg             290   1e-77    
ref|XP_010513204.1|  PREDICTED: uncharacterized protein LOC104789164    263   1e-77    
gb|AAB84340.1|  putative non-LTR retroelement reverse transcriptase     271   1e-77    Arabidopsis thaliana [mouse-ear cress]
gb|EAZ03196.1|  hypothetical protein OsI_25347                          285   2e-77    Oryza sativa Indica Group [Indian rice]
ref|XP_010495329.1|  PREDICTED: uncharacterized protein LOC104772406    250   2e-77    
ref|XP_009123326.1|  PREDICTED: uncharacterized protein LOC103848097    248   2e-77    
ref|XP_010472440.1|  PREDICTED: uncharacterized protein LOC104752070    257   3e-77    
ref|XP_010681744.1|  PREDICTED: uncharacterized protein LOC104896672    285   3e-77    
ref|XP_007207799.1|  hypothetical protein PRUPE_ppa024472mg             285   3e-77    
gb|AAD15377.1|  putative non-LTR retroelement reverse transcriptase     265   3e-77    Arabidopsis thaliana [mouse-ear cress]
gb|ABF95850.1|  retrotransposon protein, putative, unclassified         285   3e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008372934.1|  PREDICTED: putative ribonuclease H protein A...    286   4e-77    
ref|XP_010688579.1|  PREDICTED: uncharacterized protein LOC104902491    290   4e-77    
ref|XP_010058565.1|  PREDICTED: uncharacterized protein LOC104446406    251   4e-77    
ref|XP_008355389.1|  PREDICTED: putative ribonuclease H protein A...    283   7e-77    
gb|EEE52912.1|  hypothetical protein OsJ_35521                          285   9e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010058837.1|  PREDICTED: uncharacterized protein LOC104446716    241   1e-76    
ref|XP_009111228.1|  PREDICTED: uncharacterized protein LOC103836687    282   1e-76    
gb|EEE50824.1|  hypothetical protein OsJ_31232                          287   2e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007031450.1|  LINE-type retrotransposon LIb DNA, Insertion...    276   2e-76    
ref|XP_009149314.1|  PREDICTED: uncharacterized protein LOC103872634    283   3e-76    
ref|XP_010668002.1|  PREDICTED: uncharacterized protein LOC104884990    239   3e-76    
ref|XP_008392963.1|  PREDICTED: uncharacterized protein LOC103455142    238   4e-76    
ref|XP_010693613.1|  PREDICTED: uncharacterized protein LOC104906541    284   4e-76    
gb|KHN25562.1|  LINE-1 reverse transcriptase like                       255   5e-76    
ref|XP_010513448.1|  PREDICTED: uncharacterized protein LOC104789452    275   5e-76    
ref|XP_010672383.1|  PREDICTED: uncharacterized protein LOC104888966    287   5e-76    
ref|XP_008801646.1|  PREDICTED: uncharacterized protein LOC103715697    284   8e-76    
ref|XP_004296207.1|  PREDICTED: uncharacterized protein LOC101297422    261   1e-75    
ref|XP_007210729.1|  hypothetical protein PRUPE_ppa021798mg             222   1e-75    
ref|NP_001174443.1|  Os05g0434000                                       236   1e-75    
emb|CAN81579.1|  hypothetical protein VITISV_023185                     244   1e-75    Vitis vinifera
ref|XP_010667378.1|  PREDICTED: uncharacterized protein LOC104884431    284   2e-75    
ref|XP_009113456.1|  PREDICTED: uncharacterized protein LOC103838755    244   2e-75    
ref|XP_008390125.1|  PREDICTED: uncharacterized protein LOC103452416    232   2e-75    
gb|EPS64876.1|  hypothetical protein M569_09903                         219   2e-75    
ref|XP_009138624.1|  PREDICTED: uncharacterized protein LOC103862701    281   3e-75    
gb|EEC75227.1|  hypothetical protein OsI_11496                          281   3e-75    Oryza sativa Indica Group [Indian rice]
ref|XP_010058631.1|  PREDICTED: uncharacterized protein LOC104446483    238   4e-75    
ref|XP_008393387.1|  PREDICTED: uncharacterized protein LOC103455579    278   4e-75    
ref|XP_007031312.1|  Uncharacterized protein TCM_016762                 224   5e-75    
ref|XP_008802031.1|  PREDICTED: putative ribonuclease H protein A...    279   5e-75    
ref|XP_008366302.1|  PREDICTED: uncharacterized protein LOC103429949    273   5e-75    
ref|XP_011085143.1|  PREDICTED: uncharacterized protein LOC105167219    235   5e-75    
emb|CCA66153.1|  hypothetical protein                                   239   9e-75    
ref|XP_009139326.1|  PREDICTED: uncharacterized protein LOC103863321    278   9e-75    
ref|XP_008226782.1|  PREDICTED: putative ribonuclease H protein A...    278   9e-75    
emb|CAN76892.1|  hypothetical protein VITISV_005356                     250   1e-74    Vitis vinifera
ref|XP_009107743.1|  PREDICTED: uncharacterized protein LOC103833410    240   1e-74    
ref|XP_008808644.1|  PREDICTED: putative ribonuclease H protein A...    278   1e-74    
ref|XP_002453763.1|  hypothetical protein SORBIDRAFT_04g014351          241   2e-74    Sorghum bicolor [broomcorn]
gb|EEC80620.1|  hypothetical protein OsI_22990                          267   2e-74    Oryza sativa Indica Group [Indian rice]
emb|CAB40051.1|  putative protein                                       281   2e-74    Arabidopsis thaliana [mouse-ear cress]
gb|EEE50691.1|  hypothetical protein OsJ_30951                          272   2e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010034422.1|  PREDICTED: uncharacterized protein LOC104423658    240   2e-74    
emb|CAN77861.1|  hypothetical protein VITISV_005457                     243   2e-74    Vitis vinifera
ref|XP_008346916.1|  PREDICTED: putative ribonuclease H protein A...    269   3e-74    
gb|AAD24831.1|  putative non-LTR retroelement reverse transcriptase     282   3e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010666711.1|  PREDICTED: uncharacterized protein LOC104883845    275   4e-74    
ref|XP_007202950.1|  hypothetical protein PRUPE_ppa016504mg             243   4e-74    
ref|XP_009145555.1|  PREDICTED: putative ribonuclease H protein A...    275   5e-74    
gb|AAD20714.1|  putative non-LTR retroelement reverse transcriptase     281   6e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008351105.1|  PREDICTED: uncharacterized protein LOC103414509    266   7e-74    
ref|XP_007212995.1|  hypothetical protein PRUPE_ppa022768mg             271   7e-74    
gb|AAC33961.1|  contains similarity to reverse trancriptase (Pfam...    281   8e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008375111.1|  PREDICTED: putative ribonuclease H protein A...    267   8e-74    
emb|CCA66222.1|  hypothetical protein                                   234   8e-74    
ref|XP_004289367.1|  PREDICTED: putative ribonuclease H protein A...    278   8e-74    
emb|CAN79190.1|  hypothetical protein VITISV_000232                     230   8e-74    Vitis vinifera
ref|XP_010026295.1|  PREDICTED: uncharacterized protein LOC104416631    252   9e-74    
emb|CAN73982.1|  hypothetical protein VITISV_007640                     239   9e-74    Vitis vinifera
ref|XP_009115101.1|  PREDICTED: uncharacterized protein LOC103840357    275   1e-73    
emb|CAN78577.1|  hypothetical protein VITISV_020585                     241   1e-73    
ref|XP_010668313.1|  PREDICTED: uncharacterized protein LOC104885316    259   1e-73    
emb|CAN65298.1|  hypothetical protein VITISV_008130                     231   2e-73    
gb|EEC66671.1|  hypothetical protein OsI_32959                          270   2e-73    
ref|XP_008798809.1|  PREDICTED: putative ribonuclease H protein A...    273   2e-73    
ref|XP_009113843.1|  PREDICTED: putative ribonuclease H protein A...    273   2e-73    
emb|CAN75609.1|  hypothetical protein VITISV_002943                     234   3e-73    
emb|CAN68838.1|  hypothetical protein VITISV_030956                     229   3e-73    
ref|XP_010495441.1|  PREDICTED: uncharacterized protein LOC104772536    273   3e-73    
ref|XP_009119675.1|  PREDICTED: putative ribonuclease H protein A...    254   3e-73    
ref|XP_009108843.1|  PREDICTED: uncharacterized protein LOC103834526    275   3e-73    
gb|EPS72636.1|  hypothetical protein M569_02121                         259   3e-73    
ref|XP_010451544.1|  PREDICTED: uncharacterized protein LOC104733678    268   4e-73    
ref|XP_007224290.1|  hypothetical protein PRUPE_ppa020085mg             244   4e-73    
ref|XP_010490312.1|  PREDICTED: uncharacterized protein LOC104768075    237   4e-73    
ref|XP_010040552.1|  PREDICTED: uncharacterized protein LOC104429377    237   4e-73    
ref|XP_010480636.1|  PREDICTED: uncharacterized protein LOC104759401    271   9e-73    
ref|XP_009138115.1|  PREDICTED: putative ribonuclease H protein A...    237   1e-72    
ref|XP_010549577.1|  PREDICTED: uncharacterized protein LOC104820715    237   1e-72    
gb|EEC83406.1|  hypothetical protein OsI_28856                          274   2e-72    
ref|XP_009137133.1|  PREDICTED: uncharacterized protein LOC103861184    272   2e-72    
ref|XP_010068169.1|  PREDICTED: uncharacterized protein LOC104455000    251   2e-72    
ref|XP_009139360.1|  PREDICTED: uncharacterized protein LOC103863362    270   2e-72    
ref|XP_007207773.1|  hypothetical protein PRUPE_ppa026368mg             272   3e-72    
ref|XP_010679283.1|  PREDICTED: uncharacterized protein LOC104894690    244   4e-72    
ref|XP_010692491.1|  PREDICTED: uncharacterized protein LOC104905603    275   4e-72    
gb|KFK27799.1|  hypothetical protein AALP_AA8G430800                    273   4e-72    
ref|XP_010692841.1|  PREDICTED: uncharacterized protein LOC104905886    159   5e-72    
gb|KFK27798.1|  hypothetical protein AALP_AA8G430800                    273   5e-72    
gb|KFK27800.1|  hypothetical protein AALP_AA8G430800                    273   6e-72    
emb|CAN72097.1|  hypothetical protein VITISV_042083                     217   6e-72    
ref|XP_007198897.1|  hypothetical protein PRUPE_ppa015748mg             240   7e-72    
ref|XP_009115737.1|  PREDICTED: uncharacterized protein LOC103840975    268   7e-72    
gb|EEC68887.1|  hypothetical protein OsI_37529                          275   7e-72    
ref|XP_007214027.1|  hypothetical protein PRUPE_ppa016677mg             238   8e-72    
emb|CAN69474.1|  hypothetical protein VITISV_014375                     223   9e-72    
emb|CAN68165.1|  hypothetical protein VITISV_008538                     234   1e-71    
ref|XP_010684619.1|  PREDICTED: uncharacterized protein LOC104899180    234   1e-71    
emb|CAN75040.1|  hypothetical protein VITISV_026478                     239   1e-71    
ref|XP_008234850.1|  PREDICTED: putative ribonuclease H protein A...    270   1e-71    
ref|XP_004233579.1|  PREDICTED: uncharacterized protein LOC101260201    212   2e-71    
emb|CAN68820.1|  hypothetical protein VITISV_009132                     229   2e-71    
ref|XP_009140270.1|  PREDICTED: putative ribonuclease H protein A...    267   2e-71    
ref|XP_004289445.1|  PREDICTED: putative ribonuclease H protein A...    264   2e-71    
gb|ABD33126.2|  RNA-directed DNA polymerase (Reverse transcriptase)     263   2e-71    
emb|CAN82386.1|  hypothetical protein VITISV_029348                     233   3e-71    
ref|XP_007212886.1|  hypothetical protein PRUPE_ppa021750mg             249   3e-71    
ref|XP_010671909.1|  PREDICTED: uncharacterized protein LOC104888584    243   3e-71    
emb|CAN74843.1|  hypothetical protein VITISV_037042                     227   4e-71    
ref|XP_006491472.1|  PREDICTED: uncharacterized protein LOC102626455    272   4e-71    
ref|XP_010472251.1|  PREDICTED: uncharacterized protein LOC104751896    270   4e-71    
ref|XP_010507233.1|  PREDICTED: uncharacterized protein LOC104783828    262   4e-71    
emb|CAN65484.1|  hypothetical protein VITISV_029474                     230   5e-71    
ref|XP_006485449.1|  PREDICTED: uncharacterized protein LOC102621413    272   5e-71    
emb|CAN76026.1|  hypothetical protein VITISV_027817                     232   6e-71    
gb|AAD24601.1|  putative non-LTR retroelement reverse transcriptase     269   8e-71    
ref|XP_006487889.1|  PREDICTED: uncharacterized protein LOC102617714    270   8e-71    
emb|CAN82456.1|  hypothetical protein VITISV_010028                     231   8e-71    
emb|CAN68860.1|  hypothetical protein VITISV_023024                     228   1e-70    
ref|XP_007206246.1|  hypothetical protein PRUPE_ppa015607mg             246   1e-70    
ref|XP_007212580.1|  hypothetical protein PRUPE_ppa015871mg             241   1e-70    
ref|XP_007212800.1|  hypothetical protein PRUPE_ppa020180mg             268   1e-70    
ref|XP_009349611.1|  PREDICTED: uncharacterized protein LOC103941142    270   1e-70    
ref|XP_010677875.1|  PREDICTED: uncharacterized protein LOC104893474    227   1e-70    
ref|XP_009107553.1|  PREDICTED: uncharacterized protein LOC103833206    263   2e-70    
ref|XP_009115910.1|  PREDICTED: putative ribonuclease H protein A...    264   2e-70    
gb|AAC26674.1|  putative non-LTR retroelement reverse transcriptase     256   2e-70    
gb|KFK31800.1|  hypothetical protein AALP_AA6G160500                    266   3e-70    
ref|XP_009101684.1|  PREDICTED: uncharacterized protein LOC103827880    236   3e-70    
gb|AAC28197.1|  contains similarity to reverse transcriptases           215   3e-70    
ref|XP_010495217.1|  PREDICTED: uncharacterized protein LOC104772285    267   3e-70    
ref|XP_010674612.1|  PREDICTED: uncharacterized protein LOC104890735    233   3e-70    
ref|XP_010513219.1|  PREDICTED: uncharacterized protein LOC104789182    211   4e-70    
gb|EEE55133.1|  hypothetical protein OsJ_02920                          266   4e-70    
ref|XP_010644016.1|  PREDICTED: uncharacterized protein LOC104877459    218   4e-70    
ref|XP_007199601.1|  hypothetical protein PRUPE_ppa023095mg             224   4e-70    
ref|XP_010236480.1|  PREDICTED: uncharacterized protein LOC104584065    262   4e-70    
emb|CAB78008.1|  putative protein                                       219   7e-70    
ref|XP_010507236.1|  PREDICTED: uncharacterized protein LOC104783832    248   1e-69    
ref|XP_008785084.1|  PREDICTED: putative ribonuclease H protein A...    262   1e-69    
ref|XP_006493121.1|  PREDICTED: putative ribonuclease H protein A...    263   1e-69    
emb|CAN69430.1|  hypothetical protein VITISV_024658                     231   1e-69    
emb|CAN75888.1|  hypothetical protein VITISV_023640                     230   1e-69    
ref|XP_008794416.1|  PREDICTED: uncharacterized protein LOC103710479    266   1e-69    
ref|XP_010666820.1|  PREDICTED: uncharacterized protein LOC104883940    215   1e-69    
ref|XP_010666276.1|  PREDICTED: uncharacterized protein LOC104883442    267   2e-69    
gb|EPS63383.1|  hypothetical protein M569_11401                         267   2e-69    
ref|XP_010667704.1|  PREDICTED: uncharacterized protein LOC104884717    266   3e-69    
ref|XP_010474601.1|  PREDICTED: uncharacterized protein LOC104754160    209   3e-69    
emb|CAN74004.1|  hypothetical protein VITISV_006235                     232   4e-69    
ref|XP_011102248.1|  PREDICTED: uncharacterized protein LOC105180271    237   4e-69    
ref|XP_010695270.1|  PREDICTED: uncharacterized protein LOC104907939    232   5e-69    
emb|CAN67355.1|  hypothetical protein VITISV_002170                     233   5e-69    
ref|XP_004954924.1|  PREDICTED: uncharacterized protein LOC101756955    261   5e-69    
gb|EPS61425.1|  hypothetical protein M569_13371                         264   6e-69    
ref|XP_009127418.1|  PREDICTED: uncharacterized protein LOC103852254    263   8e-69    
ref|XP_011101577.1|  PREDICTED: uncharacterized protein LOC105179637    225   8e-69    
ref|XP_010451645.1|  PREDICTED: uncharacterized protein LOC104733795    261   8e-69    
emb|CAN64256.1|  hypothetical protein VITISV_040148                     237   1e-68    
emb|CAN74183.1|  hypothetical protein VITISV_034261                     233   1e-68    
ref|NP_001175161.1|  Os07g0417700                                       261   1e-68    
ref|XP_008800872.1|  PREDICTED: uncharacterized protein LOC103715119    261   1e-68    
gb|EAZ29765.1|  hypothetical protein OsJ_13823                          250   1e-68    
ref|XP_010468497.1|  PREDICTED: uncharacterized protein LOC104748579    238   2e-68    
ref|XP_007217321.1|  hypothetical protein PRUPE_ppa019733mg             262   2e-68    
emb|CAN70803.1|  hypothetical protein VITISV_044067                     232   2e-68    
emb|CAN77614.1|  hypothetical protein VITISV_035196                     240   2e-68    
ref|XP_010674286.1|  PREDICTED: uncharacterized protein LOC104890473    243   2e-68    
ref|XP_010694673.1|  PREDICTED: uncharacterized protein LOC104907438    231   3e-68    
ref|XP_010681601.1|  PREDICTED: uncharacterized protein LOC104896541    260   4e-68    
ref|XP_008341112.1|  PREDICTED: uncharacterized protein LOC103404034    259   4e-68    
gb|EEE54705.1|  hypothetical protein OsJ_02026                          253   5e-68    
ref|XP_010681228.1|  PREDICTED: uncharacterized protein LOC104896209    232   5e-68    
emb|CAN70922.1|  hypothetical protein VITISV_016266                     240   6e-68    
ref|XP_011101886.1|  PREDICTED: uncharacterized protein LOC105179931    224   8e-68    
ref|XP_008367519.1|  PREDICTED: putative ribonuclease H protein A...    256   8e-68    
emb|CAN77641.1|  hypothetical protein VITISV_007623                     223   9e-68    
ref|XP_006494016.1|  PREDICTED: uncharacterized protein LOC102608298    221   1e-67    
emb|CAN78035.1|  hypothetical protein VITISV_031077                     207   1e-67    
ref|XP_010688970.1|  PREDICTED: uncharacterized protein LOC104902764    211   1e-67    
ref|XP_009334552.1|  PREDICTED: uncharacterized protein LOC103927360    197   2e-67    
emb|CAN80807.1|  hypothetical protein VITISV_023749                     237   2e-67    
ref|XP_008791119.1|  PREDICTED: uncharacterized protein LOC103708118    258   2e-67    
ref|XP_009334551.1|  PREDICTED: uncharacterized protein LOC103927359    197   2e-67    
ref|XP_009363712.1|  PREDICTED: uncharacterized protein LOC103953670    256   2e-67    
emb|CAN71912.1|  hypothetical protein VITISV_018965                     227   3e-67    
ref|XP_010501979.1|  PREDICTED: uncharacterized protein LOC104779321    226   3e-67    
ref|XP_010666352.1|  PREDICTED: uncharacterized protein LOC104883509    212   4e-67    
ref|XP_008806372.1|  PREDICTED: putative ribonuclease H protein A...    253   4e-67    
emb|CAH66382.1|  OSIGBa0092E09.9                                        243   4e-67    
ref|XP_010672360.1|  PREDICTED: uncharacterized protein LOC104888944    175   4e-67    
ref|XP_008342824.1|  PREDICTED: putative ribonuclease H protein A...    257   4e-67    
emb|CAN71630.1|  hypothetical protein VITISV_015580                     235   4e-67    
ref|XP_002452318.1|  hypothetical protein SORBIDRAFT_04g023610          251   4e-67    
emb|CAN77370.1|  hypothetical protein VITISV_033119                     238   5e-67    
ref|XP_004310201.1|  PREDICTED: uncharacterized protein LOC101298860    253   5e-67    
emb|CAN82939.1|  hypothetical protein VITISV_013126                     214   5e-67    
ref|XP_002438545.1|  hypothetical protein SORBIDRAFT_10g021720          256   5e-67    
emb|CAN77850.1|  hypothetical protein VITISV_020834                     228   5e-67    
ref|XP_008360144.1|  PREDICTED: putative ribonuclease H protein A...    252   5e-67    
gb|AFP55557.1|  non-ltr retroelement reverse transcriptase              259   6e-67    
ref|XP_009132673.1|  PREDICTED: putative ribonuclease H protein A...    253   6e-67    
ref|XP_010669873.1|  PREDICTED: uncharacterized protein LOC104886993    241   6e-67    
emb|CAN69754.1|  hypothetical protein VITISV_024938                     228   6e-67    
emb|CAN77480.1|  hypothetical protein VITISV_021632                     228   6e-67    
emb|CAD40735.2|  OSJNBa0072D21.13                                       243   6e-67    
ref|XP_010468816.1|  PREDICTED: uncharacterized protein LOC104748941    255   7e-67    
gb|EEE66057.1|  hypothetical protein OsJ_22054                          254   9e-67    
ref|XP_010682494.1|  PREDICTED: uncharacterized protein LOC104897333    245   9e-67    
gb|ABN08038.1|  RNA-directed DNA polymerase (Reverse transcriptase)     247   9e-67    
gb|ABD28670.2|  RNA-directed DNA polymerase (Reverse transcriptase)     225   9e-67    
ref|XP_010676026.1|  PREDICTED: uncharacterized protein LOC104891936    236   1e-66    
emb|CAN75028.1|  hypothetical protein VITISV_026823                     224   1e-66    
ref|XP_010682478.1|  PREDICTED: uncharacterized protein LOC104897316    246   1e-66    
ref|XP_010677694.1|  PREDICTED: uncharacterized protein LOC104893292    218   1e-66    
ref|XP_010495271.1|  PREDICTED: uncharacterized protein LOC104772340    253   1e-66    
ref|XP_010512944.1|  PREDICTED: uncharacterized protein LOC104788863    253   2e-66    
ref|XP_008345114.1|  PREDICTED: putative ribonuclease H protein A...    254   2e-66    
ref|XP_010451093.1|  PREDICTED: uncharacterized protein LOC104733187    219   2e-66    
ref|XP_002446475.1|  hypothetical protein SORBIDRAFT_06g016600          236   3e-66    
ref|XP_008779911.1|  PREDICTED: putative ribonuclease H protein A...    244   3e-66    
ref|XP_010445465.1|  PREDICTED: uncharacterized protein LOC104728135    246   4e-66    
emb|CAN71106.1|  hypothetical protein VITISV_000041                     227   4e-66    
gb|EEE65727.1|  hypothetical protein OsJ_21368                          253   5e-66    
ref|XP_008367240.1|  PREDICTED: putative ribonuclease H protein A...    250   5e-66    
emb|CAN79956.1|  hypothetical protein VITISV_017151                     207   5e-66    
ref|XP_009335445.1|  PREDICTED: uncharacterized protein LOC103928158    253   6e-66    
ref|XP_010681687.1|  PREDICTED: uncharacterized protein LOC104896616    254   6e-66    
gb|AAM18736.1|AC092548_14  putative reverse transcriptase               250   6e-66    
gb|AAP53315.2|  retrotransposon protein, putative, unclassified         250   7e-66    
gb|EEE60876.1|  hypothetical protein OsJ_14536                          241   7e-66    
ref|XP_007207581.1|  hypothetical protein PRUPE_ppa018489mg             251   9e-66    
ref|XP_010419021.1|  PREDICTED: uncharacterized protein LOC104704671    217   1e-65    
ref|XP_010645162.1|  PREDICTED: uncharacterized protein LOC104877807    209   1e-65    
emb|CCA66020.1|  hypothetical protein                                   254   1e-65    
ref|XP_009118886.1|  PREDICTED: uncharacterized protein LOC103843858    214   1e-65    
ref|XP_008795217.1|  PREDICTED: putative ribonuclease H protein A...    249   1e-65    
emb|CAN80166.1|  hypothetical protein VITISV_033619                     222   1e-65    
ref|XP_010687204.1|  PREDICTED: uncharacterized protein LOC104901340    241   1e-65    
ref|XP_009107610.1|  PREDICTED: putative ribonuclease H protein A...    249   1e-65    
ref|XP_007224079.1|  hypothetical protein PRUPE_ppa015473mg             231   2e-65    
gb|ABD28505.2|  RNA-directed DNA polymerase (Reverse transcriptas...    247   2e-65    
gb|EAY93853.1|  hypothetical protein OsI_15629                          242   2e-65    
emb|CAN70538.1|  hypothetical protein VITISV_040070                     234   2e-65    
emb|CAN76604.1|  hypothetical protein VITISV_012933                     219   3e-65    
emb|CAN67932.1|  hypothetical protein VITISV_013913                     219   3e-65    
ref|XP_010692445.1|  PREDICTED: uncharacterized protein LOC104905555    231   3e-65    
ref|XP_010694896.1|  PREDICTED: uncharacterized protein LOC104907635    253   3e-65    
ref|XP_010675126.1|  PREDICTED: uncharacterized protein LOC104891166    253   4e-65    
ref|XP_008232623.1|  PREDICTED: putative ribonuclease H protein A...    249   4e-65    
emb|CAN70431.1|  hypothetical protein VITISV_030910                     238   4e-65    
gb|KHN27546.1|  LINE-1 reverse transcriptase like                       233   5e-65    
ref|XP_007225095.1|  hypothetical protein PRUPE_ppa016563mg             249   5e-65    
emb|CAD39568.2|  OSJNBa0019G23.12                                       251   5e-65    
ref|XP_010694891.1|  PREDICTED: uncharacterized protein LOC104907631    234   5e-65    
ref|XP_010676966.1|  PREDICTED: uncharacterized protein LOC104892675    249   5e-65    
ref|XP_010666661.1|  PREDICTED: uncharacterized protein LOC104883796    213   6e-65    
emb|CAN70311.1|  hypothetical protein VITISV_022886                     211   6e-65    
gb|EEC84982.1|  hypothetical protein OsI_32248                          248   7e-65    
ref|XP_010678549.1|  PREDICTED: uncharacterized protein LOC104894081    249   1e-64    
emb|CAN80288.1|  hypothetical protein VITISV_006820                     216   1e-64    
ref|XP_009123425.1|  PREDICTED: uncharacterized protein LOC103848222    247   1e-64    
ref|XP_010674016.1|  PREDICTED: uncharacterized protein LOC104890294    248   1e-64    
emb|CAN71772.1|  hypothetical protein VITISV_002507                     209   1e-64    
ref|XP_007219602.1|  hypothetical protein PRUPE_ppa023113mg             246   2e-64    
ref|XP_009123659.1|  PREDICTED: uncharacterized protein LOC103848514    246   2e-64    
ref|XP_010686886.1|  PREDICTED: uncharacterized protein LOC104901041    250   2e-64    
emb|CAN72837.1|  hypothetical protein VITISV_031500                     227   2e-64    
ref|XP_010424030.1|  PREDICTED: uncharacterized protein LOC104709061    141   2e-64    
gb|AAX92720.1|  retrotransposon protein, putative, unclassified         209   2e-64    
emb|CAN62743.1|  hypothetical protein VITISV_033107                     242   3e-64    
ref|XP_010675525.1|  PREDICTED: uncharacterized protein LOC104891516    243   3e-64    
ref|XP_002466324.1|  hypothetical protein SORBIDRAFT_01g005660          242   3e-64    
emb|CAN70669.1|  hypothetical protein VITISV_037506                     219   3e-64    
emb|CAN65100.1|  hypothetical protein VITISV_039725                     213   4e-64    
ref|XP_010513760.1|  PREDICTED: uncharacterized protein LOC104789816    246   5e-64    
ref|XP_010681460.1|  PREDICTED: uncharacterized protein LOC104896407    249   6e-64    
emb|CAN79050.1|  hypothetical protein VITISV_004869                     211   7e-64    
ref|XP_008366311.1|  PREDICTED: putative ribonuclease H protein A...    244   7e-64    
ref|XP_010463260.1|  PREDICTED: uncharacterized protein LOC104743929    245   1e-63    
ref|XP_007040948.1|  Uncharacterized protein TCM_016755                 248   1e-63    



>emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1378

 Score =   429 bits (1104),  Expect(2) = 4e-165, Method: Compositional matrix adjust.
 Identities = 234/570 (41%), Positives = 339/570 (59%), Gaps = 8/570 (1%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             +F   VK +++   S+  S    P G NDT I L+P +  P L   FR IGLCN+ YK++
Sbjct  465   RFWDLVKPNVMHLVSEILSGRDFPEGFNDTFIVLIPKMDIPQLAKHFRPIGLCNIVYKIV  524

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLE  1442
             TK +  RLK  +  LI P Q SFV  RQIT+NV++ QE+ +S+R+K GK G M +KID E
Sbjct  525   TKVIINRLKPILPSLISPTQCSFVPNRQITDNVIIVQEMFHSMRNKQGKKGFMAVKIDFE  584

Query  1443  KAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDP  1622
             KAYDRL W+FIR +L +       +  +M+CVS++ L I ++    +     RG+RQGDP
Sbjct  585   KAYDRLRWTFIRESLMELRIPQHLVDIVMNCVSSANLQILWNGEPMEKICPTRGLRQGDP  644

Query  1623  LSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASV  1802
             LSP L+V+ +ERL+HLI+Q V NG WK +K +R GP IS+L F DDL+ F EAS+ QA V
Sbjct  645   LSPYLYVICMERLAHLIDQEVTNGNWKPVKASRNGPPISNLAFADDLILFSEASVEQAQV  704

Query  1803  VKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHG  1982
             +K CL+ FC  SG +++  KS I+FS NT ++I+ A+ ++L +    D G+YLGVP+I+G
Sbjct  705   MKWCLDRFCEASGSKVNEDKSKIYFSANTHLDIRDAVCNTLAMEATADFGKYLGVPTING  764

Query  1983  RLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRL  2162
             R  +  Y  L+ RI  +L GWK +TLS  GR+TLIQS  S+IP YTMQS+ LP+     +
Sbjct  765   RSSKREYQYLVDRINGKLAGWKTKTLSIAGRATLIQSAFSSIPYYTMQSTKLPRSTCDDI  824

Query  2163  ERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKED  2342
             +R SR FLWG  +G R+ +L++W+ +++SK +G LGI+ +   N A   KLGW+L+ +  
Sbjct  825   DRKSRSFLWGEQEGKRRVHLVAWENISKSKKEGGLGIRSMRQANSAFLVKLGWRLLAEPS  884

Query  2343  GLCVKIMEAK-------VQLPSLPSQACQMYGRVFLSRRQSF*KGAKSW*RTTDQHCFGS  2501
              L  +I+ AK       + +    S A   + R  LS      KG  S      +  F  
Sbjct  885   SLWSRILRAKYCDNRCDIDMFKEKSNASSTW-RGILSSIDVVRKGINSAVGNGAKTLFWH  943

Query  2502  IHG*ENKPLC*VALGMIPSTE*YAKVFEYWVPESGWLWEKLSNLLLEECLSMLAAFNLLD  2681
                  ++PL  +A  + P     A V E W   SGW  +  +N L E  L ++AA  L+D
Sbjct  944   HRWATSEPLISLASPIPPIELQDATVKEMWDLVSGWKVDVFANYLPEATLKLIAAHELID  1003

Query  2682  DCELENGLG*DVAYSGKFSVKSTYDITVGA  2771
             D E  + +  + + SG F++ S  +IT  A
Sbjct  1004  DEEAIDDIYWNGSPSGGFTIGSAMNITRNA  1033


 Score =   182 bits (463),  Expect(2) = 4e-165, Method: Compositional matrix adjust.
 Identities = 126/305 (41%), Positives = 172/305 (56%), Gaps = 14/305 (5%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             F +WI    LIDLG++GPA+TW +GLS   FK ARLDR L N EWK++  +  V +LP  
Sbjct  163   FANWIENNALIDLGFTGPAHTWSRGLSPTTFKSARLDRGLANSEWKLKFTEGVVRNLPKS  222

Query  400   NSYH------TLGES------RRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQ  543
              S H      T G +      + FRF AAW  H  + E V   W +D  +     + + +
Sbjct  223   QSDHCPILISTSGFAPVPRIIKPFRFQAAWLNHQVFCEFVRKNWNADAPIVPFLKSFADK  282

Query  544   LDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLW  723
             L+ WNK    NIFR+K  + ARISGVQ  LS  ++  LIKL+ KLRRE+D +L  EE LW
Sbjct  283   LNKWNKEEFYNIFRKKSELWARISGVQALLSTGRQNHLIKLEAKLRREMDIVLDDEETLW  342

Query  724   F*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDL  903
             F +SR E I  GDRNTR++H +T +R+S + +  L++N GEWIS+   +      ++  L
Sbjct  343   FQKSRMEAICDGDRNTRYFHLSTVIRRSRNRIDMLQNNDGEWISNPMEVKAMVLGYWKHL  402

Query  904   FSEDST-TQLEDLNDAFFPPLHTSQWLAINAHFT-VKDLEAVFEMAQFKAPSSDGFQTSF  1077
             FSEDS  +    L   FFP +    +  +    + V+   A+  M  FKAP  DGFQ  F
Sbjct  403   FSEDSVQSNFCHLPRDFFPQITADDFEKMMRPLSEVEVTLALKSMKPFKAPGPDGFQPLF  462

Query  1078  YQNSW  1092
             YQ  W
Sbjct  463   YQRFW  467


 Score =   101 bits (252),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 103/359 (29%), Positives = 161/359 (45%), Gaps = 26/359 (7%)
 Frame = +2

Query  2393  KSGMSNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQA--TLLSRIRYDPFDRV  2566
             KS  S+ W+GIL S  ++ KG    V N   TLFW   W   +   +L S I        
Sbjct  908   KSNASSTWRGILSSIDVVRKGINSAVGNGAKTLFWHHRWATSEPLISLASPIPPIELQDA  967

Query  2567  IR*SL*VLGPRIGVAVGETFEPAS*GVLEYVGGVQLIR*L*A*K---WPGLGRGLFW*IL  2737
                 +  L     V V   + P +   L+ +   +LI    A     W G   G F  I 
Sbjct  968   TVKEMWDLVSGWKVDVFANYLPEA--TLKLIAAHELIDDEEAIDDIYWNGSPSGGFT-IG  1024

Query  2738  C*INL*HYSR--GLSTYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEV  2911
               +N+   +    +  + + W+ +  +  P R+R F+WLA  D  MTN+ R  R  T + 
Sbjct  1025  SAMNITRNAELANMDAHPK-WSAVWKIPTPQRVRFFIWLAIQDRLMTNSNRFLRRLTDDP  1083

Query  2912  FCGICRNLPEDIDHIMQRCPIANSVWESLIPYDHRRL*DQDYTNWFDEGISELSSGNRKH  3091
              C +C  + E+ DHI++RCP+A  +W  L         + +  +W  + +S  +      
Sbjct  1084  RCLVCGEVEENTDHILRRCPVARILWRKLGMLGEHNREEINLGSWITKNLS--ADTMMGS  1141

Query  3092  EQRVTFAVTMWWLWKWRNDLVFS---GTNIN----LAARIKWIRDQVEEINISFSKAKGL  3250
             E    FAV+ WWLW+WRND  F+      I+    + AR+K I++ ++  + + S+  G 
Sbjct  1142  EWLRVFAVSCWWLWRWRNDRCFNRNPSIPIDQVSFIFARVKEIKEAMDRNDTNKSQHSGR  1201

Query  3251  IAPIESICWRQLKWIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNIG  3427
                I       ++W  P+ GWVK N DG+S  +   A  GG IR  +G   + F  N G
Sbjct  1202  RKEI------LVRWQCPKEGWVKLNTDGASKGNPGPAGGGGLIRGPRGEIHEVFAINCG  1254



>ref|XP_009124282.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1011

 Score =   431 bits (1109),  Expect(2) = 2e-144, Method: Compositional matrix adjust.
 Identities = 231/576 (40%), Positives = 347/576 (60%), Gaps = 19/576 (3%)
 Frame = +3

Query  1065  PNQLLPKFMG----TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSI  1232
             P+   P F      TV +S+ +FA+ FF TG LP   ND ++ L+P +  P  + QFR I
Sbjct  93    PDGFQPVFYQRCWETVGNSVARFATLFFETGKLPEDTNDALVVLIPKVTKPESITQFRPI  152

Query  1233  GLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKG  1412
              LCNV +K++TKAM  RLK  M+ LIGP Q+SF+ GR   +N++V QE ++S+R K G+ 
Sbjct  153   SLCNVLFKIITKAMVGRLKGVMKKLIGPAQSSFIPGRLSADNIVVVQEAVHSMRRKKGRK  212

Query  1413  GLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFM  1592
             G M++K+DLEKAYDRL W F+  TL+ AG S  W+R +M CVS   + I ++   ++ F 
Sbjct  213   GWMLLKLDLEKAYDRLRWDFLEDTLRAAGLSEVWVRRVMECVSGPSMCILWNGEKTESFK  272

Query  1593  LERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFF  1772
               RG+RQGDPLSP LFVL +ERL HLIE++V+  +WK +K++R GP +SH+ F DDL+ F
Sbjct  273   PSRGLRQGDPLSPYLFVLCMERLCHLIEEAVEEKRWKPIKLSRGGPELSHICFADDLILF  332

Query  1773  GEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLG  1952
              EAS+ Q  V++K L +FC  SGQ++S  KS IFFS N + E  + IS + GI    DLG
Sbjct  333   AEASVTQVRVIRKVLEKFCKASGQKVSLPKSKIFFSNNVTTERGERISRASGIAATRDLG  392

Query  1953  RYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSS  2132
             +YLG+P +  R+ +D++ +++ ++ +RL+GWK +TLS  GR T+ ++VLS+IP +TM + 
Sbjct  393   KYLGMPILQKRINKDTFGEVLEKVASRLSGWKKQTLSLAGRVTMTKAVLSSIPVHTMSTI  452

Query  2133  LLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAK  2312
              LP   L +L+ LSR F+WGS +     +L+SW+K+ + K +G LGI+    MN+AL AK
Sbjct  453   NLPVSTLEKLDSLSRSFVWGSGQ-----HLVSWEKICKPKAEGGLGIRGSRDMNKALIAK  507

Query  2313  LGWKLMNKEDGLCVKIMEAKVQLPSLP--------SQACQMYGRVFLSRRQSF*KGAKSW  2468
             +GW+L+   + L  +++ +K  + S+         S     +  V L  R+    G  SW
Sbjct  508   VGWRLLRDTESLWARVLRSKYNVGSIHDLSWTGRRSNGSSTWSSVVLGIREVVMTG-HSW  566

Query  2469  *RTTDQHC-FGSIHG*ENKPLC*VALGMIPSTE*YAKVFEYWVPESGWLWEKLSNLLLEE  2645
                  +   F +     N+PL  V +G +P       V E WV   GW    ++  + +E
Sbjct  567   AIGNGRDIKFWTDRWLSNQPLSSVTIGELPEGYEDVTVREMWVVGGGWDLAHIAPFVTDE  626

Query  2646  CLSMLAAFNLLDDCELENGLG*DVAYSGKFSVKSTY  2753
                 LAA  +    + E+ L      +G+F+VKS Y
Sbjct  627   TRLELAAVVVDTVNDSEDRLAWSQTNNGQFTVKSAY  662


 Score =   112 bits (280),  Expect(2) = 2e-144, Method: Compositional matrix adjust.
 Identities = 67/217 (31%), Positives = 113/217 (52%), Gaps = 8/217 (4%)
 Frame = +2

Query  2780  YRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIM  2959
             +RR+W+ +     P R+R FLWL  +   MTN +R RR  +    C +C+   E I H++
Sbjct  679   FRRMWHVV----APERVRMFLWLVGNQAIMTNAERYRRHLSGTDVCQVCKGGIETILHVL  734

Query  2960  QRCPIANSVWESLIPYDHRR-L*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWK  3136
             + CP    +W+  +P   R+         W  + +S+  +G+ +     TFA+ +WW WK
Sbjct  735   RDCPAMRGIWDRFVPAVKRQTFFSMPLLEWLYKNLSDNGTGS-EIPWPTTFALAVWWGWK  793

Query  3137  WRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGWV  3316
             WR   +F G N     R+ ++R+  +E+ +S ++A+   + ++    R + W  P+ GW+
Sbjct  794   WRCGNIF-GKNSLWRDRVGFLRNLAKEV-MSANEAEKGNSNVDHRTERMVGWAPPRSGWM  851

Query  3317  KANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNIG  3427
             K N DGSS  +   A  GG +R+ +G    GF  NIG
Sbjct  852   KLNTDGSSHGNPGAATAGGVLRNGEGEWCGGFALNIG  888


 Score = 67.8 bits (164),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = +1

Query  787   ATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFS-EDSTTQLEDLNDAFFPPL  963
             +T +R+  + V  LK+N   W+SD   + E    ++  L+S ED  T ++ L++  F  L
Sbjct  2     STVIRRRRNRVEMLKNNENRWVSDAQELEELAVNYFRKLYSLEDVDTDVQGLSERRFVSL  61

Query  964   HTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSFYQNSW  1092
              +  +  +N  F+V+++E AV +M  FKAP  DGFQ  FYQ  W
Sbjct  62    TSHDYELLNKTFSVEEVERAVRDMGSFKAPGPDGFQPVFYQRCW  105



>ref|XP_009101981.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1235

 Score =   407 bits (1047),  Expect(2) = 8e-142, Method: Compositional matrix adjust.
 Identities = 222/585 (38%), Positives = 344/585 (59%), Gaps = 20/585 (3%)
 Frame = +3

Query  1053  LGRF----PNQLLPKFM----GTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*  1208
             +G+F    P+   P F       V  S+ +F  +FF +G L  G ND ++ L+P +  P 
Sbjct  304   MGKFKAPGPDGFQPVFYQDSWEVVGASVTRFGLEFFESGVLTEGMNDALVVLIPKVLKPE  363

Query  1209  LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNS  1388
              + QFR I LCNV +K++TK M LRLK  M  LIGP Q SF+ GR  ++N+++ QE ++S
Sbjct  364   RIMQFRPISLCNVLFKIITKTMVLRLKKLMSKLIGPSQASFIPGRLSSDNIVIVQEAVHS  423

Query  1389  LRSKSGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFD  1568
             +R K G+ G M++K+DLEKAYDR+ W F+  TL  A   P WI+ IM CV+   +++ ++
Sbjct  424   MRRKKGRRGWMLLKLDLEKAYDRIRWDFLEDTLNAARLPPVWIKWIMECVTNPGMSLLWN  483

Query  1569  SRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLF  1748
                ++ F  +RG+RQGDPLSP LFVL +ERL H IE +V    WK +K++R GP +SH+ 
Sbjct  484   GERTEAFKPQRGLRQGDPLSPYLFVLCMERLCHQIEFAVAKEDWKPIKLSRGGPALSHIC  543

Query  1749  FVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLG  1928
             F DDL+ F EAS+ Q  V++K L  FC  SGQ++S  KS IFFS+N   ++   IS+  G
Sbjct  544   FADDLILFAEASVSQVRVIRKVLENFCEASGQKVSLEKSVIFFSENVHRDLATLISNESG  603

Query  1929  IPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAI  2108
             I    +LG+YLG+P +  ++ ++++ +++ ++ ++L GWK + LS  GR TL +SV+S+I
Sbjct  604   IKGTKELGKYLGMPVLQKKINKETFGEVVEKVSSKLAGWKRKFLSLAGRITLTKSVISSI  663

Query  2109  PCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*  2288
             P +TM +  LP   L +L++++R F+WGSS+GNRK +LI+W+K+   K +G LGI++   
Sbjct  664   PVHTMSTIALPASTLGQLDKIARSFIWGSSEGNRKQHLIAWEKICTPKREGGLGIRKAKE  723

Query  2289  MNQALFAKLGWKLMNKEDGLCVKIMEAKVQLPSLPSQACQMYGR---------VFLSRRQ  2441
             MN AL  KLGW+L+N  D L V+I++ K ++  L    C M  R         + L  R+
Sbjct  724   MNVALLGKLGWRLLNTHDALWVRILQKKFRVGEL-YDPCWMVSRGNWSPTWRSLILGIRE  782

Query  2442  SF*KGAKSW*RTTDQHC-FGSIHG*ENKPLC*VALGMIPSTE*YAKVFEYWVPESGWLWE  2618
                 G   W     +   F   +   ++PL  ++   IP     AK  + W   +GWL +
Sbjct  783   VVVPGT-CWILGDGRRVRFWRDNWLLDQPLYELSTADIPEEIIEAKARDLWQHGTGWLTQ  841

Query  2619  KLSNLLLEECLSMLAAFNLLDDCELENGLG*DVAYSGKFSVKSTY  2753
              +   +       LA+  + +     + +    +  G+FSVKS Y
Sbjct  842   LMEPYMSTHNSLRLASVVIDEVTGARDRMSWSGSNDGQFSVKSAY  886


 Score =   127 bits (319),  Expect(2) = 8e-142, Method: Compositional matrix adjust.
 Identities = 74/220 (34%), Positives = 116/220 (53%), Gaps = 8/220 (4%)
 Frame = +2

Query  2774  STYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDH  2953
             + YRRVW     + VP R R FLWL  H   MTN +R RR  +    C +C+N  E I H
Sbjct  901   ALYRRVWR----VAVPERTRVFLWLVSHQVIMTNMERKRRHLSDSSVCLLCKNGDETILH  956

Query  2954  IMQRCPIANSVWESLI-PYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWL  3130
             +++ CP A  +W  ++ P   +R  +     W  E ++  SS +   +    FA+T+WW 
Sbjct  957   VLRDCPAAAGLWLRIVTPSRRQRFFELPLLEWLYENLASDSSVS-GDQWPTLFALTVWWC  1015

Query  3131  WKWRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVG  3310
             WKWR   VF G       R++++RD+ +E+  ++   + + +P      +Q+ W RP+  
Sbjct  1016  WKWRCGYVF-GEVGKCRDRVEFVRDKAKEVLAAYKNLR-VHSPGGLRVEKQIAWHRPESN  1073

Query  3311  WVKANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNIGL  3430
             WVK N DG++  +  +A  GG +RD+ G    GF  NIG+
Sbjct  1074  WVKLNTDGAARGNPGLATAGGVVRDEYGTWRGGFAINIGI  1113


 Score =   137 bits (344),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 101/295 (34%), Positives = 149/295 (51%), Gaps = 32/295 (11%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             L F DWI    L+D+G+ G  +TW +G  + NF   RLDR  CN + ++R  +  V HLP
Sbjct  60    LAFGDWINELALVDMGFRGNTFTWRRGKETQNFVAKRLDRVFCNAQARVRWQEAVVSHLP  119

Query  394   MVNSYHTLGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQLDDWNKHTIG  573
              + S H                 P Y           V LE  K    K+    NK   G
Sbjct  120   FLASDHA----------------PVY-----------VQLEPEKKEKLKKW---NKEIFG  149

Query  574   NIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREEWIV  753
             N+ +RK ++L  I  +Q  L    + DL+  +  L++ELD  L QEE+LW+ +SRE+W+V
Sbjct  150   NVMKRKEKLLGEIKDIQEKLEQNPRDDLLLRESVLQKELDVALEQEEVLWYQKSREKWVV  209

Query  754   SGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFS-EDSTTQL  930
              GDRNT++YH +T VR+  + +  L+D  G WI   + + +   ++Y  L+S ED     
Sbjct  210   LGDRNTKYYHTSTIVRRKRNRIEMLRDEDGRWIDQSEELEKLAISYYKRLYSTEDLNLDT  269

Query  931   EDLNDAFFPPLHTSQWLAINAHFTVKDLEA-VFEMAQFKAPSSDGFQTSFYQNSW  1092
               L    F      +   ++  F+  ++EA V  M +FKAP  DGFQ  FYQ+SW
Sbjct  270   RKLPQQGFTGFTREEVQILDEPFSEVEIEASVKSMGKFKAPGPDGFQPVFYQDSW  324



>ref|XP_008341993.1| PREDICTED: uncharacterized protein LOC103404803 [Malus domestica]
Length=1433

 Score =   365 bits (937),  Expect(3) = 9e-140, Method: Compositional matrix adjust.
 Identities = 177/413 (43%), Positives = 262/413 (63%), Gaps = 0/413 (0%)
 Frame = +3

Query  1134  FSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIG  1313
             F++  LP+  N+T I L+P + NP  + Q R I LC+  YK+++K +  +L+     L+ 
Sbjct  603   FNSTQLPDNINNTFISLIPKVDNPTSMTQLRPISLCSTLYKVISKILVGKLRPLXHKLVS  662

Query  1314  PFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDRLSWSFIRSTLQK  1493
             P Q SFV GRQI + V+V QE+L+  R+  GK G +  KIDL KAYDRL WSFIR  L +
Sbjct  663   PTQVSFVPGRQIIDXVIVAQEILHKYRNTKGKKGFIAWKIDLSKAYDRLQWSFIRDVLWE  722

Query  1494  AGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLI  1673
              G     +  IM CV+T +     +  ++  F    GIRQGDPLSP LFVL +E+L H+I
Sbjct  723   IGLRGKVLELIMQCVTTVKYQAIVNGEITDSFSPHCGIRQGDPLSPYLFVLCMEKLXHII  782

Query  1674  EQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLS  1853
                +   +WK +K+ R GP +SHLFF DDL+ F EAS  QA ++K CL+ FC +SGQ+++
Sbjct  783   XGCITTKKWKPVKLXRNGPSVSHLFFADDLILFAEASSTQARILKDCLDIFCDVSGQQVN  842

Query  1854  YMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQAR  2033
             + KS I+ S N S      I++  G P+ +DLG YLGVP +H R+ +++Y +++ ++Q R
Sbjct  843   FDKSCIYCSPNISRSKAXEIANICGSPLTSDLGHYLGVPLLHSRVNKETYGNIVEKVQRR  902

Query  2034  LTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRK  2213
             L+ WK+ TLS  GR   +QSV SAIP Y+MQS+ L   +  ++++L+R+FLWG ++ N K
Sbjct  903   LSAWKSNTLSMAGRLVYLQSVXSAIPIYSMQSTRLXISICDKIDKLNRNFLWGHTEENSK  962

Query  2214  CNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
              +L+ W+ V   K  G LG++    MNQAL AK  WKLM ++ G   ++++ K
Sbjct  963   VHLVKWETVCTPKFMGGLGLKDTHVMNQALLAKTXWKLMQRDSGJWAQVLKGK  1015


 Score =   158 bits (400),  Expect(3) = 9e-140, Method: Compositional matrix adjust.
 Identities = 105/307 (34%), Positives = 153/307 (50%), Gaps = 16/307 (5%)
 Frame = +1

Query  217   GFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPM  396
             G  +WI R  L+DLG+ G  +TW +     +    RLDR LCNI W+    +  V HL  
Sbjct  283   GLGNWISRNSLVDLGFIGAKFTWSKKNEYGDIVWERLDRGLCNIAWRHLYSEAYVRHLAK  342

Query  397   VNSYHT---LG---------ESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKS-NLS  537
             VNS H    +G         + + FRF A W  H  ++  V+ TW S     + KS  LS
Sbjct  343   VNSDHCPLLIGLXSXHIPXPDLKAFRFQAMWMLHQEFEXFVNDTWNSAQGDASCKSITLS  402

Query  538   KQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEEL  717
               L  WN +  G IF++K R LARI G+Q++L V     L  L+ +L  E + IL QEEL
Sbjct  403   SALQSWNHNVFGCIFQKKRRXLARICGIQKALCVRHVPYLFALENQLTNEYNTILEQEEL  462

Query  718   LWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYM  897
              W  +SR  W+  GD+NT+F+H +  VR+  + +    ++ G W  + + +      ++ 
Sbjct  463   FWLQKSRNTWLREGDKNTKFFHLSAVVRRRKNKLEGXNNSEGVWTBEKENLKSIVVNYFK  522

Query  898   DLFS-EDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQT  1071
             DLFS   +TT +E L    FP L       +N   T  ++ + +F +   KAP  DG   
Sbjct  523   DLFSFRITTTXMESL-PHLFPCLSGEDLAILNGEVTDDEIKDCMFAIGGLKAPGPDGIXA  581

Query  1072  SFYQNSW  1092
              FYQ  W
Sbjct  582   RFYQKFW  588


 Score = 26.6 bits (57),  Expect(3) = 9e-140, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 23/43 (53%), Gaps = 1/43 (2%)
 Frame = +2

Query  2387  SAK-SGMSNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             SAK +  S+ W GIL  A IL  G +  V +     FW D+W+
Sbjct  1027  SAKYTNCSHTWXGILFGAQILPNGMRWRVGSGSQIHFWKDNWL  1069


 Score = 82.4 bits (202),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 90/202 (45%), Gaps = 15/202 (7%)
 Frame = +2

Query  2879  KRARRGFTSEVFCGICRNLPEDIDHIMQRCPIANSVWESL-IPYDHRRL*DQDYTNWFDE  3055
             KRA+RGFT++  C IC  + E  DHI + C  + S W ++ IP +       D+ +W   
Sbjct  1131  KRAKRGFTNDPCCPICPTVEESXDHIFRYCRHSPSFWNNVGIPLEVAHSFALDFQSWMAI  1190

Query  3056  GISELSSGNRKHEQRVTFAVTMWWLWKWRNDLVFSGTNINLAARIKWI----RDQVEEIN  3223
              +    S        + FA T+W+ WK RN+  F+       + +K I    RD  +   
Sbjct  1191  NLRTHCSTIHGLPWNLIFASTLWYCWKRRNNFXFNNGQQPPVSPLKVIFQFARDWYDANK  1250

Query  3224  ISFSKAKGLIAPIESICWRQLKWIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQGC*L  3403
                SK    I  I         WIRP +G  K N DGS     S    GG IR+ +G  +
Sbjct  1251  CXSSKPPRQIISIH--------WIRPPIGRYKINTDGSCKDXFSHISAGGLIRNSEGDWI  1302

Query  3404  KGFMHNIGLNQRVSS*PRLWGL  3469
              GF  N+G    + +   LWG+
Sbjct  1303  XGFAANLGRGTXMEA--ELWGV  1322


 Score = 34.3 bits (77),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 0/66 (0%)
 Frame = +1

Query  3541  PVDNILAACRKEIRSIPVWKVLHAVREQNRAADLLAHMATTISRGTSILHDPCDELLDVL  3720
             P+ N++  C++ I      +V H  RE+N +AD +A +   +S G  +   P     + L
Sbjct  1359  PLYNLILDCKEAIERNWRCEVTHIYREKNASADHMADLGHGLSLGLHVFDSPPTTATNFL  1418

Query  3721  NDDCLG  3738
               D +G
Sbjct  1419  ASDSIG  1424



>gb|AAC63844.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1231

 Score =   400 bits (1027),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 222/595 (37%), Positives = 343/595 (58%), Gaps = 30/595 (5%)
 Frame = +3

Query  1053  LGRF----PNQLLPKFM----GTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*  1208
             +GRF    P+   P F      TV  S+ +F  +FF TG LP   ND ++ L+  +  P 
Sbjct  304   MGRFKAPGPDGYQPVFYQQCWETVGPSVTRFVLEFFETGVLPASTNDALLVLIAKVAKPE  363

Query  1209  LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNS  1388
              + QFR + LCNV +K++TK M  RLK+ +  LIGP Q SF+ GR   +N+++ QE ++S
Sbjct  364   RIQQFRPVSLCNVLFKIITKMMVTRLKNVISKLIGPAQASFIPGRLSIDNIVLVQEAVHS  423

Query  1389  LRSKSGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFD  1568
             +R K G+ G M++K+DLEKAYDR+ W F++ TL+ AG S  W   IM+ V+   +++ ++
Sbjct  424   MRRKKGRKGWMLLKLDLEKAYDRVRWDFLQETLEAAGLSEGWTSRIMAGVTDPSMSVLWN  483

Query  1569  SRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLF  1748
                +  F+  RG+RQGDPLSP LFVL +ERL HLIE SV   +WK + ++  G  +SH+ 
Sbjct  484   GERTDSFVPARGLRQGDPLSPYLFVLCLERLCHLIEASVGKREWKPIAVSCGGSKLSHVC  543

Query  1749  FVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLG  1928
             F DDL+ F EAS+ Q  ++++ L  FC  SGQ++S  KS IFFS N S E++Q IS   G
Sbjct  544   FADDLILFAEASVAQIRIIRRVLERFCEASGQKVSLEKSKIFFSHNVSREMEQLISEESG  603

Query  1929  IPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAI  2108
             I    +LG+YLG+P +  R+ ++++ +++ R+ ARL GWK R+LS  GR TL ++VLS+I
Sbjct  604   IGCTKELGKYLGMPILQKRMNKETFGEVLERVSARLAGWKGRSLSLAGRITLTKAVLSSI  663

Query  2109  PCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*  2288
             P + M + LLP   L  L+R SR FLWGS+   +K +L+SW+K+ + K +G +G++    
Sbjct  664   PVHVMSAILLPVSTLDTLDRYSRTFLWGSTMEKKKQHLLSWRKICKPKAEGGIGLRSARD  723

Query  2289  MNQALFAKLGWKLMNKEDGLCVKIMEAKVQLPSLPSQA--------CQMYGRVFLSRRQS  2444
             MN+AL AK+GW+L+  ++ L  +++  K ++  +   +           +  V +  R+ 
Sbjct  724   MNKALVAKVGWRLLQDKESLWARVVRKKYKVGGVQDTSWLKPQPRWSSTWRSVAVGLREV  783

Query  2445  F*KGAKSW*RTTDQHC---FGSIHG*ENKPLC*VALGMIPSTE*YAKVFEYWVPESGWLW  2615
               KG   W       C   F        +PL  +   MIP  E      +YW+P SGW  
Sbjct  784   VVKGV-GW--VPGDGCTIRFWLDRWLLQEPLVELGTDMIPEGERIKVAADYWLPGSGWNL  840

Query  2616  EKLSNLLLEECLSMLAAFNLLDDCELENGLG*DVAY----SGKFSVKSTYDITVG  2768
             E L   L E     L +  +    ++  G G ++++     G F+V+S Y +  G
Sbjct  841   EILGLYLPETVKRRLLSVVV----QVFLGNGDEISWKGTQDGAFTVRSAYSLLQG  891


 Score =   114 bits (286),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 100/219 (46%), Gaps = 12/219 (5%)
 Frame = +2

Query  2774  STYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDH  2953
             S + R+W  I     P R+R F+WL   +  MTN +R RR  +    C +C    E I H
Sbjct  901   SFFNRIWKLI----TPERVRVFIWLVSQNVIMTNVERVRRHLSENAICSVCNGAEETILH  956

Query  2954  IMQRCPIANSVWESLIPY-DHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWL  3130
             +++ CP    +W  L+P   H     Q    W    +  +     K      F + +WW 
Sbjct  957   VLRDCPAMEPIWRRLLPLRRHHEFFSQSLLEWLFTNMDPV-----KGIWPTLFGMGIWWA  1011

Query  3131  WKWRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVG  3310
             WKWR   VF    I    R+K+I+D  EE+      A G   P      R ++W  P  G
Sbjct  1012  WKWRCCDVFGERKI-CRDRLKFIKDMAEEVRRVHVGAVG-NRPNGVRVERMIRWQVPSDG  1069

Query  3311  WVKANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNIG  3427
             WVK   DG+S  ++ +A  GG IR+ QG  L GF  NIG
Sbjct  1070  WVKITTDGASRGNHGLAAAGGAIRNGQGEWLGGFALNIG  1108


 Score =   116 bits (290),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 93/295 (32%), Positives = 142/295 (48%), Gaps = 32/295 (11%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             L F DWI    LIDLG+ G  +TW +G         RLDR       +++  +  V HLP
Sbjct  60    LAFGDWINELSLIDLGFKGNKFTWRRGRQESTVVAKRLDRVFVCAHARLKWQEAVVSHLP  119

Query  394   MVNSYHTLGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQLDDWNKHTIG  573
              + S H                 P Y           V LE  +    ++L  WN+   G
Sbjct  120   FMASDHA----------------PLY-----------VQLEPLQQ---RKLRKWNREVFG  149

Query  574   NIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREEWIV  753
             +I  RK +++A I  VQ  L V    DL+  +  L +E+D +L QEE LWF +SRE++I 
Sbjct  150   DIHVRKEKLVADIKEVQDLLGVVLSDDLLAKEEVLLKEMDLVLEQEETLWFQKSREKYIE  209

Query  754   SGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTTQLE  933
              GDRNT F+H +T +R+  + +  LK +   W++D   +      +Y  L+S +  +++ 
Sbjct  210   LGDRNTTFFHTSTIIRRRRNRIESLKGDDDRWVTDKVELEAMALTYYKRLYSLEDVSEVR  269

Query  934   D-LNDAFFPPLHTSQWLAINAHFTVKD-LEAVFEMAQFKAPSSDGFQTSFYQNSW  1092
             + L    F  +  ++  A+   FT  + + AV  M +FKAP  DG+Q  FYQ  W
Sbjct  270   NMLPTGGFASISEAEKAALLQAFTKAEVVSAVKSMGRFKAPGPDGYQPVFYQQCW  324



>ref|XP_006490008.1| PREDICTED: uncharacterized protein LOC102624085 [Citrus sinensis]
Length=1635

 Score =   365 bits (938),  Expect(2) = 3e-135, Method: Compositional matrix adjust.
 Identities = 185/442 (42%), Positives = 272/442 (62%), Gaps = 2/442 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             V +S  K   + F T  LP   N TV+ L+P I  P   + +R I LC V YK +TK + 
Sbjct  960   VGESFCKAIKEVFQTQCLPAEVNRTVLVLIPKIEQPTSFSMYRPISLCTVMYKTITKIIA  1019

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
              RL+  +  LIGP QTSFV GR IT N++V QE+++S+R K G+ G M IK+DL KAYDR
Sbjct  1020  NRLQELLPELIGPHQTSFVPGRHITENIIVAQEIIHSMRRKKGRKGFMAIKVDLGKAYDR  1079

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             LSW+FI+ TLQ+       I  IM C++T+ + + ++  LS  F   RG+RQGDPLSP +
Sbjct  1080  LSWTFIQETLQELNLPTMLINLIMECITTATMNVLWNGELSSEFCPGRGVRQGDPLSPYI  1139

Query  1638  FVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCL  1817
             FVL +ERLSH I +S++ G WK +++ R G  +SHLFF DDL+F  EAS  QA ++ K +
Sbjct  1140  FVLCIERLSHGISRSIQQGHWKPIRLARMGTPLSHLFFADDLLFLSEASSQQAIIINKII  1199

Query  1818  NEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQD  1997
             +EF + SG +++  K+ ++FS N S      I S LG  + ++LG+YLGVP  H R+ + 
Sbjct  1200  DEFSASSGAKVNKSKTLVYFSANISAMEASRIGSDLGYSVTDNLGKYLGVPLCHSRISKQ  1259

Query  1998  SYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSR  2177
             +Y  ++ +I  RL+GW    L+  GR TL QSVL AI  Y MQ++ LP+ +  ++++L R
Sbjct  1260  TYQSIVDKIDQRLSGWNASHLTLAGRITLAQSVLQAISVYAMQTTKLPRSIKMKIDQLCR  1319

Query  2178  DFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVK  2357
              F+W  S  ++K +L++W  +   K +G LG ++LD MN AL  K  W+L+ +   L  +
Sbjct  1320  RFIWSGSAEHQKMSLVNWDMICTPKCKGGLGFKKLDIMNHALLMKNTWRLITEPTKLSNQ  1379

Query  2358  IMEAK--VQLPSLPSQACQMYG  2417
             ++  K  V L   P+     YG
Sbjct  1380  VLLTKYGVHLDEFPTSLPTRYG  1401


 Score =   147 bits (371),  Expect(2) = 3e-135, Method: Compositional matrix adjust.
 Identities = 103/298 (35%), Positives = 155/298 (52%), Gaps = 34/298 (11%)
 Frame = +1

Query  262   YSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHT-----LGES  426
             + GP YTW +G  S      RLDR +CN  W +++P+  VLHLP V S H        ++
Sbjct  673   FKGPKYTWSRGSLS-----KRLDRVVCNKAWFLQNPNASVLHLPKVASDHRPVLIRFDQN  727

Query  427   RR-------FRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQLDDWNKHTIGNIFR  585
              R       FRF AAW T   + + + + W++ V  +   S   +Q+  WNK+  GNIF+
Sbjct  728   SRNNNFPKLFRFMAAWLTDSRFADFMKTHWQNGVPYDRAVSEFIQQVQHWNKNIFGNIFQ  787

Query  586   RK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREEWIVSGDR  765
             RK  +LARI GVQR+L       L +L+ KL++EL+E+L QEELLW  RSR +WI+ GDR
Sbjct  788   RKKILLARIGGVQRALERRPLCSLYRLEIKLKKELEEVLMQEELLWLQRSRRDWILFGDR  847

Query  766   NTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTTQLEDLND  945
             NT ++H  T  R+  + +  +    G W  D + I +    F+ +L++ +          
Sbjct  848   NTAYFHQKTITRRHHNRIDAIMAEDGRWFYDMEAIKQQATNFFSNLYTPE--------QG  899

Query  946   AFFPPLHTSQWLAINAH---FTVKDLE------AVFEMAQFKAPSSDGFQTSFYQNSW  1092
              + P      +L ++ +   F   ++E      AVF M+  KAP  DG    FYQ+ W
Sbjct  900   GYKPYQICGAFLRVDDYRLKFLATEIEEEEIRHAVFNMSPLKAPGVDGLHAIFYQSQW  957


 Score = 61.6 bits (148),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 55/125 (44%), Gaps = 3/125 (2%)
 Frame = +2

Query  2792  WNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCP  2971
             W  + S K P+ IR FLWL  H    T  +  RR       C  C    EDI H ++ C 
Sbjct  1487  WCLVWSWKGPHSIRVFLWLLLHGRLKTKKELNRRHLIDSTQCDRCGGPVEDILHTLRDCV  1546

Query  2972  IANSVWESLIP--YDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWRN  3145
              A  VW  L+P  Y H        ++W    +    +   +   RV F V +W LW WRN
Sbjct  1547  TARRVWSHLLPNNYPHSFF-LCPLSDWLQMNLMRKKNNTSQEYWRVCFGVAVWRLWFWRN  1605

Query  3146  DLVFS  3160
             + +F+
Sbjct  1606  NFLFN  1610



>ref|XP_009151561.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1204

 Score =   396 bits (1017),  Expect(2) = 5e-131, Method: Compositional matrix adjust.
 Identities = 216/578 (37%), Positives = 335/578 (58%), Gaps = 19/578 (3%)
 Frame = +3

Query  1065  PNQLLPKFMG----TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSI  1232
             P+   P F      TV  S+I F   FF  G LP   ND ++ L+P +  P  + QFR I
Sbjct  286   PDGFQPVFYQRCWETVGPSVISFILRFFEVGKLPENTNDALVVLIPKVSKPESITQFRPI  345

Query  1233  GLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKG  1412
              LCNV +K++TKAM  RLK  M+ LIGP Q+SF+ GR   +N++V QE ++S+R K G+ 
Sbjct  346   SLCNVLFKIITKAMVGRLKGVMKKLIGPAQSSFIPGRLSADNIVVVQEAVHSMRKKKGQK  405

Query  1413  GLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFM  1592
             G M++K+DLEKAYDRL W F+  TL+ AG    W+  IM CVS   ++I ++   +  F 
Sbjct  406   GWMLLKLDLEKAYDRLRWDFLEDTLRAAGLPEGWVGRIMECVSGPSMSILWNGEKTDSFK  465

Query  1593  LERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFF  1772
               RG+RQGDPLSP L VL + RL H+I+++V + +WK +K++R GP ++H+ F DDL+ F
Sbjct  466   PSRGLRQGDPLSPYLLVLCMGRLCHMIDRAVMDKKWKPIKLSRGGPQLTHICFADDLILF  525

Query  1773  GEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLG  1952
              EAS+ Q  V++  L  FC  SGQ++S  KS IFFS N + E  + IS   GI    +LG
Sbjct  526   AEASVSQVRVIRDVLETFCRASGQKVSLPKSKIFFSGNVTRERGELISRESGISSTRELG  585

Query  1953  RYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSS  2132
             +YLG+P +  R+ ++++ +++ ++ +RL+GWK +TLS  GR T+ ++VLS+IP ++M + 
Sbjct  586   KYLGMPILQKRINKETFGEVLEKVASRLSGWKKQTLSLAGRVTMTKAVLSSIPVHSMSTI  645

Query  2133  LLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAK  2312
              +P   L +L+ LSR F+WGS +     +LISW +V   K  G LGI+    MN+AL AK
Sbjct  646   HMPVSTLDKLDSLSRSFVWGSGQ-----HLISWDRVCRPKADGGLGIRVSRDMNKALLAK  700

Query  2313  LGWKLMNKEDGLCVKIMEAKVQLPSLPSQACQMYG--------RVFLSRRQSF*KGAKSW  2468
             +GW+L+N ++GL  +++ +K  +  +   +  + G         V +  R+   KG  SW
Sbjct  701   VGWRLLNDKEGLWARVLRSKYSVGDMHDSSWMVAGSNVSSTWRSVVMGIREVVAKG-HSW  759

Query  2469  *RTTDQHC-FGSIHG*ENKPLC*VALGMIPSTE*YAKVFEYWVPESGWLWEKLSNLLLEE  2645
                  +   F +      +PL    LG +P         E W+   GW   ++S  + +E
Sbjct  760   VIGNGREIKFWTDKWLSRQPLMGEVLGDLPEGYENITARELWLDGGGWDLSRISPYIPDE  819

Query  2646  CLSMLAAFNLLDDCELENGLG*DVAYSGKFSVKSTYDI  2759
                   A  +     +++ L      +G+F+VK+ YD+
Sbjct  820   RRLERVAVVVDTVSGVKDRLAWGEVPNGQFTVKTAYDL  857


 Score =   103 bits (256),  Expect(2) = 5e-131, Method: Compositional matrix adjust.
 Identities = 66/222 (30%), Positives = 106/222 (48%), Gaps = 18/222 (8%)
 Frame = +2

Query  2780  YRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIM  2959
             ++ +W  +     P R+R FLWL  +   MTN +R RR  +    C +C+   E I H++
Sbjct  872   FKSMWRVV----APERVRVFLWLVGNQAIMTNAERYRRHLSGTDVCQVCKGGVETILHVL  927

Query  2960  QRCPIANSVWESLIPYDHRR------L*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTM  3121
             + CP    +W   +P   R+      L +  Y N +D      +    +     TFA+ +
Sbjct  928   RDCPAMEGIWSRFVPSTKRQAFFSMPLLEWLYRNLYD------NDAQNEIPWATTFALGV  981

Query  3122  WWLWKWRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRP  3301
             WW WKWR   VF G N     R+K++R+   E+  +    +   A ++ +    + W  P
Sbjct  982   WWGWKWRCGNVF-GDNRLWRDRVKFLRNLAREVMRAKKTEEESRARVQRVEI-MVGWTPP  1039

Query  3302  QVGWVKANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNIG  3427
             + GW+K N DG+S  +  +A  GG +RD +G    GF  NIG
Sbjct  1040  RGGWMKLNTDGASHGNPGLASAGGVLRDGEGEWCGGFALNIG  1081


 Score =   165 bits (418),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 95/296 (32%), Positives = 164/296 (55%), Gaps = 14/296 (5%)
 Frame = +1

Query  247   LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHTL---  417
             LID+G+SG  +TW +G S+  F   RLDR LC  + +++  +  V HLP + S H     
Sbjct  3     LIDMGFSGNQFTWKRGKSASTFVAKRLDRVLCCAQSRLKWQEARVTHLPFLASDHAPLYL  62

Query  418   ---------GESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQLDDWNKHTI  570
                         R FRF AAW  H  +QE ++ +W  D+        L  +L  WNK   
Sbjct  63    QLTPEVQGNACRRPFRFEAAWLQHSEFQELLTVSWDRDIDTREALVRLGLKLKKWNKEVF  122

Query  571   GNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREEWI  750
             GN+ +RK +++  I  +Q  +      +L+  + +L +E + +L QEE++WF +SR++W+
Sbjct  123   GNVQQRKEKLVTEIKEIQEKIEEDLSDELLVKEGELLKEFEIVLEQEEVIWFQKSRKKWV  182

Query  751   VSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFS-EDSTTQ  927
               GD+NT+F+H +T +R+  + V  L+++  +W++D   + +    ++  L+S E+  T+
Sbjct  183   AHGDKNTKFFHMSTVIRRRRNRVEMLRNDANQWLTDAKELEKLAVNYFKTLYSLENVDTE  242

Query  928   LEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSFYQNSW  1092
             ++ L  + F  L + +  ++N  F+ +++E AV +M  FKAP  DGFQ  FYQ  W
Sbjct  243   VQSLPMSGFVRLTSQEHTSLNRPFSAEEVEIAVRKMGSFKAPGPDGFQPVFYQRCW  298



>ref|XP_010670869.1| PREDICTED: uncharacterized protein LOC104887816 [Beta vulgaris 
subsp. vulgaris]
Length=1295

 Score =   368 bits (945),  Expect(2) = 5e-118, Method: Compositional matrix adjust.
 Identities = 212/576 (37%), Positives = 315/576 (55%), Gaps = 16/576 (3%)
 Frame = +3

Query  1065  PNQLLPKFM----GTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSI  1232
             P+   P F       VKD + K  +       LP   N+T I L+P + NP    QFR I
Sbjct  402   PDGFQPLFFQKNWDLVKDDVTKAVTQALEGKGLPEKMNETFIALLPKVDNPETAAQFRPI  461

Query  1233  GLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKG  1412
             GLCNV YK++TK +  R+K  +  LI   Q SFV GRQIT+N+++ QEV+++++ K G+ 
Sbjct  462   GLCNVIYKVVTKVLVNRIKPVLPRLISNTQGSFVPGRQITDNIIIMQEVIHTMKRKQGRK  521

Query  1413  GLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFM  1592
             G M IKID EKAYDRL W FIR TL +       +  IM CV ++ + + ++   +  F 
Sbjct  522   GFMAIKIDFEKAYDRLRWKFIRDTLLQMNLPILLVDTIMECVCSASMRVLWNGEPTDSFS  581

Query  1593  LERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFF  1772
               RGIRQGDPLSP LFV+ +ERL   IE+++   +WK +  +R GP +S+LFF DD+V F
Sbjct  582   PSRGIRQGDPLSPYLFVMCMERLYQTIEEAIIAKKWKPIHASRNGPSLSNLFFADDIVLF  641

Query  1773  GEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLG  1952
              EAS+ QA V++  L  FC  SGQ+LS  KS I+FS+N   E+   I  ++GI    D  
Sbjct  642   AEASIDQAQVIQDVLRRFCKASGQKLSLPKSRIYFSQNVLPEVPAQICDAIGIGGTTD--  699

Query  1953  RYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSS  2132
               LG+P+   R+ +++   L  +I  RL G K + LS  GR TL +S +S++  Y+MQ++
Sbjct  700   --LGMPTFTSRISRETLNFLCEKIDRRLAGRKTKYLSLAGRITLAKSTVSSLAYYSMQTA  757

Query  2133  LLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAK  2312
              +P+ V   ++R +R F+WG ++  +K +LI+W  +   KDQG LG+      N+A  AK
Sbjct  758   KIPKTVCDDIDRKTRRFVWGGNEDTKKVHLIAWDALQRPKDQGGLGLHSASHANKAFMAK  817

Query  2313  LGWKLMNKEDGLCVKIMEAKV-------QLPSLPSQACQMYGRVFLSRRQSF*KGAKSW*  2471
             LGW+L+ + + L  +++  K         +    + A  ++ R+         +G +S  
Sbjct  818   LGWRLLTEPNALWSRVLRTKYCKGRCDSDMFQPKTGASNVWNRI-AENSNILCEGIRSAI  876

Query  2472  RTTDQHCFGSIHG*ENKPLC*VALGMIPSTE*YAKVFEYWVPESGWLWEKLSNLLLEECL  2651
                 +  F       N PL        P+    A V E W    GW WE  S  L E+ L
Sbjct  877   GNGIKTLFWDHKWMSNTPLIDCVTQPPPTEIAGATVSEMWESGGGWKWEVFSPYLSEDSL  936

Query  2652  SMLAAFNLLDDCELENGLG*DVAYSGKFSVKSTYDI  2759
              ++ A  ++DD E+E+ L  D    GKFS+KS   I
Sbjct  937   KLIQAHVVIDDPEVEDLLYWDGDPKGKFSIKSAIRI  972


 Score = 87.4 bits (215),  Expect(2) = 5e-118, Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 100/227 (44%), Gaps = 29/227 (13%)
 Frame = +2

Query  2786  RVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQR  2965
             ++WN +    V  R+R F+WL  HD  + N  R +R  T +  C +C +  E   HI++ 
Sbjct  983   QLWNLVWKASVQQRVRAFMWLVCHDRLLGNANRFKRNLTDDPKCFVCGDFVESTLHILRD  1042

Query  2966  CPIANSVWE-----SLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWL  3130
             CP A SVW      +L P  +R     D  NW    IS     N +      FA+ +WWL
Sbjct  1043  CPAARSVWRKVEGFALDPNFYR----VDLKNW----ISSNLEYNDQETWPSFFAIIIWWL  1094

Query  3131  WKWRNDLVFSGTN---INLAARIKWIRDQV-----EEINISFSKAKGLIAPIESICWRQL  3286
             W+WRN  VF   N   I++ A +K   D+       +++ S S    +         + +
Sbjct  1095  WRWRNMFVFGRGNEVPIDVGAFLKIRFDETWRSLHGDMDTSGSNGHRV--------EKYI  1146

Query  3287  KWIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNIG  3427
              W  P +GW   N DG++  +   A  G  IR+  G  +     N G
Sbjct  1147  AWSPPPMGWYVLNTDGAARGTPGDAGGGVIIRNHSGMFISALSLNFG  1193


 Score =   115 bits (289),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 109/193 (56%), Gaps = 12/193 (6%)
 Frame = +1

Query  220  FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
            F DW+    L+++ + G +YTW +GLS    + ARLDRA CN EW ++     V HLP +
Sbjct  176  FNDWVDEMDLLEIEFVGASYTWSRGLSPETRQCARLDRAFCNPEWGLQCSQARVKHLPAI  235

Query  400  NSYHTL------------GESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQ  543
             S H                ++ FRF A W  H  +QE V S WK    + ++  +LS+ 
Sbjct  236  ASDHCPLLISPNGFVPLPSLNKPFRFQAMWLHHEKFQEFVQSKWKHSEPIMSSLHSLSEA  295

Query  544  LDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLW  723
            L DWN+    NIF+RK  +LARI GVQ+++       LIKL+ KLRREL+++L +EE  W
Sbjct  296  LQDWNRDVFKNIFQRKRLLLARIEGVQKNIGFSTHRGLIKLESKLRRELEDVLQEEETYW  355

Query  724  F*RSREEWIVSGD  762
            F +SR  W+  GD
Sbjct  356  FQKSRITWLKDGD  368



>ref|XP_009126860.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103851737 
[Brassica rapa]
Length=1638

 Score =   413 bits (1061),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 201/446 (45%), Positives = 295/446 (66%), Gaps = 4/446 (1%)
 Frame = +3

Query  1065  PNQLLPKFM----GTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSI  1232
             P+   P F       V +S+ +F  +FF +G L  G ND ++ L+P +  P  + QFR I
Sbjct  875   PDGFQPVFYQDSWDVVGESVARFGLEFFESGKLTEGMNDAMVVLIPKVLKPERIAQFRPI  934

Query  1233  GLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKG  1412
              LCNV +K++TKAM LRLKS M +LIGP Q SF+ GR  T+N++V QE ++S+R K G+ 
Sbjct  935   SLCNVLFKIITKAMVLRLKSLMPVLIGPAQASFIPGRLSTDNIVVVQEAVHSMRRKKGRK  994

Query  1413  GLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFM  1592
             G M++K+DLEKAYDR+ W F+  TL  A     WI+ IM CV    +++ ++   ++ F 
Sbjct  995   GWMLLKLDLEKAYDRIRWDFLEDTLYAAKLPQVWIKWIMECVMNPGMSLLWNGERTEAFT  1054

Query  1593  LERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFF  1772
              +RG+RQGDPLSP LFVL +ERL HLIE SV   +WK ++++R GP +SH+ F DDL+ F
Sbjct  1055  PQRGLRQGDPLSPYLFVLCMERLCHLIEFSVAKKEWKPIRLSRGGPSLSHICFADDLILF  1114

Query  1773  GEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLG  1952
              EAS+ Q  V++K L  FC  SGQ++S  KS IFFS+N   ++  AIS   GI    DLG
Sbjct  1115  AEASISQIRVIRKVLESFCGASGQKVSLEKSLIFFSENVHRDLASAISHESGIKGTKDLG  1174

Query  1953  RYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSS  2132
             +YLG+P +  R+ ++++  ++ ++ ++L GWK R LS  GR TL +SVLS++P +TM + 
Sbjct  1175  KYLGMPVLQKRINKETFGAVIEKVSSKLAGWKRRFLSLAGRITLTKSVLSSVPVHTMSTI  1234

Query  2133  LLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAK  2312
              LP   L++L++++R F+WGS  G RK +L+SW+K+ + K +G LGI+    MN AL AK
Sbjct  1235  ALPSSTLNQLDKIARAFIWGSIDGTRKQHLVSWEKICKPKREGGLGIRLAKEMNVALLAK  1294

Query  2313  LGWKLMNKEDGLCVKIMEAKVQLPSL  2390
             LGW+++N EDGL V I+  K ++  L
Sbjct  1295  LGWRMLNTEDGLWVNILCKKFRVGEL  1320


 Score =   174 bits (442),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/297 (36%), Positives = 160/297 (54%), Gaps = 14/297 (5%)
 Frame = +1

Query  244   GLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHT---  414
              L+D+G+ G  +TW +G  S NF   RLDR LCN + ++R  +  V HL  + S HT   
Sbjct  591   ALVDMGFKGSTFTWRRGKESHNFVAKRLDRVLCNAQTRVRWQEAVVSHLLFLASDHTPIY  650

Query  415   -------LGESRR--FRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQLDDWNKHT  567
                     G  RR  FRF AAW  H  ++E + ++W  ++S      +L ++L  WNK  
Sbjct  651   VQLEPVRKGNPRRRPFRFEAAWLKHDGFKELLLASWNGEMSTPEALVSLKEKLKKWNKEI  710

Query  568   IGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREEW  747
              GN+  RK ++L  I  +Q  L       LI  +  L++E D +L QEE+LW+ +SRE+W
Sbjct  711   FGNVTIRKEKLLGEIKEIQEELERNPNDMLIARETVLQKEFDIVLEQEEVLWYQKSREKW  770

Query  748   IVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFS-EDSTT  924
             IV GDRNT+FYH  T VR+  + +  LKD  G WI   + + +    +Y  L+S +D + 
Sbjct  771   IVLGDRNTKFYHTTTIVRRKRNRIEMLKDENGRWIEQSEELEKLAIEYYKRLYSTQDISM  830

Query  925   QLEDLNDAFFPPLHTSQWLAINAHFTVKDLEA-VFEMAQFKAPSSDGFQTSFYQNSW  1092
               + L    F  L + +   +   F+  D+EA    M ++KAP  DGFQ  FYQ+SW
Sbjct  831   DTDKLPQQGFTDLKSDELECLIKPFSAADMEASARSMGKYKAPGPDGFQPVFYQDSW  887


 Score = 94.4 bits (233),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 90/180 (50%), Gaps = 8/180 (4%)
 Frame = +2

Query  2780  YRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIM  2959
             Y RVW     +  P R+R FLWL  H   MTN +R RR  +    C +C++  E I H++
Sbjct  1466  YSRVWR----VTAPERVRVFLWLVTHQVIMTNMERKRRHISENGTCPLCKSGDETILHVL  1521

Query  2960  QRCPIANSVWESLI-PYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWK  3136
             + CP A  +W  L+ P   +R  +     W  E ++   S N      + FA+T+WW WK
Sbjct  1522  RDCPAAAGLWRKLVLPTRQQRFFNLTLFEWLYENLANDKSVNGDQWPSL-FALTVWWCWK  1580

Query  3137  WRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGWV  3316
             WR   VF G       R+++++D+ +E+ I  +K     + I     R + W+ P+ GWV
Sbjct  1581  WRCGYVF-GEIGKCRDRVRFVKDKAQEV-IKANKKVREPSAIGGHVERPIAWVVPENGWV  1638



>emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1363

 Score =   311 bits (798),  Expect(2) = 8e-116, Method: Compositional matrix adjust.
 Identities = 194/579 (34%), Positives = 306/579 (53%), Gaps = 16/579 (3%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             K+   +  S++      F    +P+G +D+ + L+P I +P     FR IGLCN  YKM+
Sbjct  463   KYWEQMGPSVVSLIIRAFENNRIPSGLSDSFLALIPKIESPVCCKDFRPIGLCNTVYKMI  522

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLE  1442
             TK +  R+K  +  LI P QTSFV GR I  N+++ +E+    +  + K  +M +KIDL 
Sbjct  523   TKVIANRIKPILGELIHPSQTSFVPGRNIQENIIIAKEMAFLFKKSNPKRNIMALKIDLS  582

Query  1443  KAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDP  1622
             KAYD L W FIR TLQ   F    I  IM C+S+  +++ ++  +++ F   RGIRQGDP
Sbjct  583   KAYDSLEWGFIRETLQGFNFPQSLIALIMDCISSPAISLIWNGEVTQSFSPSRGIRQGDP  642

Query  1623  LSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASV  1802
             LSP +FVL +ERLS LI   +++G WK +KI+     +SH+F+ DD+  FG+AS+    V
Sbjct  643   LSPYIFVLCMERLSMLISDRIRDGSWKPIKIS-SDLGVSHIFYADDVFLFGQASVRNGGV  701

Query  1803  VKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHG  1982
             ++  L EF ++SG R++  KS   F    + + ++ ++  L +      G+YLG   +  
Sbjct  702   IQNVLEEFGNISGLRVNMSKSLAIFPPKMNPQRRRMLADFLTMKGSTSFGKYLGCNILPN  761

Query  1983  RLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRL  2162
             +L++  Y  L+ ++++ + GW+ + L+  GR TLI+SV+S+ P Y MQSSLLP  V++ +
Sbjct  762   KLRRGDYDGLLEKVKSAINGWQAKYLNMAGRCTLIKSVVSSFPVYGMQSSLLPVSVMNEI  821

Query  2163  ERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKED  2342
             E+  R FLW     +     +SW ++     +G LG +RL   N A  AKLGW ++  E 
Sbjct  822   EKDCRKFLWNKMDKSHYLARMSWDRICSPTGKGGLGFRRLHNWNLAFMAKLGWMIIKDET  881

Query  2343  GLCVKIMEAKVQ-----LPSLPSQACQMYGRVFLSRRQSF*KGAKSW---*RTTDQHCFG  2498
              L V+I++A+       L ++         R  +  R+   KG        R+T      
Sbjct  882   KLWVRILKARYWERGSFLSAVGKNHHSPIWRDIVKGRELLEKGLVRRIGNGRSTSLWYHW  941

Query  2499  SIHG*ENKPLC*VALGMIPSTE*YAKVFEYWVPESGWLWEKLSNLLLEECLSMLAAFNLL  2678
              + G    PL  V    IP    + +V    +    W  +K+S+LL  + L  +    L 
Sbjct  942   WVGG---GPLVDVMGSNIPEFMSHWQVSNI-IKRGRWDTKKISHLLPPDILKQIKEIPLA  997

Query  2679  DDCELENGLG*DVAYSGKFSVKSTYDITVGAFRRTEEYG  2795
                E+E+    +   +G FSVKS Y +     RR EE G
Sbjct  998   SMSEVEDDFTWNFEKNGTFSVKSAYYLIN---RREEETG  1033


 Score =   136 bits (343),  Expect(2) = 8e-116, Method: Compositional matrix adjust.
 Identities = 94/304 (31%), Positives = 154/304 (51%), Gaps = 16/304 (5%)
 Frame = +1

Query  223   QDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVN  402
             +DWI    L+DLG+ GP +TW  G +  +    RLDRAL N EW    PD +V+HLP   
Sbjct  164   KDWIAANALLDLGFQGPKFTWTNGRTGGSLIKERLDRALVNSEWLDLFPDTKVIHLPRTF  223

Query  403   SYHTL----------GESRRFRFNAAW*THPNYQE*VSSTWKS-DVSLEANKSNLSKQLD  549
             S H             ES  FR    W  HP++   +  TW S   S  A +      + 
Sbjct  224   SDHCPLLILFNENPRSESFPFRCKEVWAYHPDFTNVIEETWGSHHNSYVAARDLFLSSVK  283

Query  550   DWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*  729
              W+K+  G+IF++K R+LAR+ G+Q+SLS++  + L KL+  L  EL+E+  QE + W  
Sbjct  284   SWSKYVFGSIFQKKKRILARLGGIQKSLSIHPSVFLSKLEIDLLVELNELSKQERVFWAQ  343

Query  730   RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFS  909
             ++  +    GD NT+++H    +R     +  LK++  +W+S+ + + +   + +  +F+
Sbjct  344   KAGIDRAKLGDMNTKYFHTLAKIRTCKRKISCLKNDNHDWVSNNEDLKKMMMSHFEKIFT  403

Query  910   EDSTTQLEDLNDAFFPPLHTS-QWLAINAHFTVKD--LEAVFEMAQFKAPSSDGFQTSFY  1080
               ++      N++F      S +W    A    +D   EA+ +MA  K+P  DG Q  F+
Sbjct  404   --TSMYSHQRNNSFRGECRISDEWNKRLARRVEEDEIKEALAQMAPLKSPGPDGIQAFFF  461

Query  1081  QNSW  1092
             +  W
Sbjct  462   KKYW  465



>ref|XP_009119466.1| PREDICTED: uncharacterized protein LOC103844431 [Brassica rapa]
Length=1834

 Score =   408 bits (1048),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 200/451 (44%), Positives = 296/451 (66%), Gaps = 8/451 (2%)
 Frame = +3

Query  1053  LGRF----PNQLLPKFM----GTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*  1208
             +G+F    P+   P F       V +S+ +   +FF TG L  G ND ++ L+P +  P 
Sbjct  903   MGKFKAPGPDGFQPIFYQESWDVVGESVTRCGLEFFRTGVLQKGMNDAMLVLIPKVLKPE  962

Query  1209  LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNS  1388
              + QFR I LCNV +K +TKAM +RLK+ M  LIGP Q SF+ GR  T+N+++ QE ++S
Sbjct  963   KIMQFRPISLCNVLFKTITKAMVMRLKTLMSKLIGPAQASFIPGRLSTDNIVIVQEAVHS  1022

Query  1389  LRSKSGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFD  1568
             +R K GK G M++K+DLEKAYDR+ W F+  TL  A     WI  IM CV+   +++ ++
Sbjct  1023  MRRKKGKKGWMLLKLDLEKAYDRIRWDFLEDTLHAAKLPQTWITWIMECVTNPGMSLLWN  1082

Query  1569  SRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLF  1748
                ++ F+ +RG+RQGDPLSP LFVL +ERL H IE SV N +WK +K++R GP +SH+ 
Sbjct  1083  GERTEAFIPQRGLRQGDPLSPYLFVLCMERLCHQIELSVANKEWKPIKLSRGGPSVSHIC  1142

Query  1749  FVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLG  1928
             F DDL+ F EAS+ Q  V++K L +FC  SGQ++S  KS IFFS+N   ++   IS   G
Sbjct  1143  FADDLIMFAEASVAQIRVIRKVLEKFCGASGQKVSLEKSLIFFSENVHRDLTTLISDESG  1202

Query  1929  IPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAI  2108
             I    DLG+YLG+P +  R+ ++++  ++ R+ ++L GWK R LS  GR TL +SVLS+I
Sbjct  1203  IKATKDLGKYLGMPVLQKRINKETFGTIIERMSSKLAGWKRRFLSLAGRITLTKSVLSSI  1262

Query  2109  PCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*  2288
             P +TM S  LP   L++L++++R F+WGS  G+RK +L++W+KV + + +G LGI+    
Sbjct  1263  PVHTMSSIALPMSTLNQLDKIARSFIWGSVDGDRKQHLVAWEKVCKPRREGGLGIRSAKE  1322

Query  2289  MNQALFAKLGWKLMNKEDGLCVKIMEAKVQL  2381
             MN AL AKLGW+++N  D L V+I+  K ++
Sbjct  1323  MNIALLAKLGWRVLNTHDDLWVQILRKKFRV  1353


 Score =   186 bits (473),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 113/303 (37%), Positives = 167/303 (55%), Gaps = 14/303 (5%)
 Frame = +1

Query  226   DWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNS  405
             DWI    L+D+G+ G +YTW +G  + NF   RLDR LC+ + ++R  + EV HLP + S
Sbjct  621   DWINDLSLVDMGFKGNSYTWKRGKDTRNFVAKRLDRVLCSAQTRVRWQEAEVAHLPFLAS  680

Query  406   YHT----------LGESRR--FRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQLD  549
              H            G  RR  FRF AAW  H  ++E +S++W  ++S     + L  +L 
Sbjct  681   DHAPLYVQLEPEQKGNPRRRPFRFEAAWLKHDGFKELLSASWNREMSTSEALAALKVKLK  740

Query  550   DWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*  729
              WNK   G++ +RK ++L  I  VQ ++       L+  +  L +E D +L QEE+LW+ 
Sbjct  741   KWNKEIFGDVHKRKEKLLCEIKEVQEAVERNPSDALLLREEALHKEFDVVLEQEEVLWYQ  800

Query  730   RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFS  909
             +SRE+WIV GDRNT +YH  T VR+  + +  LKD+ G WI   + + +    +Y  L+S
Sbjct  801   KSREKWIVLGDRNTNYYHTTTIVRRKRNRIEMLKDDEGHWIEQPEQLEKLAMNYYKRLYS  860

Query  910   -EDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLEA-VFEMAQFKAPSSDGFQTSFYQ  1083
              ED +   E L    F  L   +  ++N  F+  ++EA V  M +FKAP  DGFQ  FYQ
Sbjct  861   TEDISLDTEKLPMVGFTELTRDELESLNKPFSAVEMEASVRSMGKFKAPGPDGFQPIFYQ  920

Query  1084  NSW  1092
              SW
Sbjct  921   ESW  923


 Score =   136 bits (342),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 120/231 (52%), Gaps = 10/231 (4%)
 Frame = +2

Query  2780  YRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIM  2959
             Y RVW  I    VP R+R FLWL  H   MTN +R RR  +    C +C++  E I H +
Sbjct  1502  YDRVWRVI----VPERVRVFLWLVSHQVIMTNMERKRRHLSDNGMCQLCKSGNETILHTL  1557

Query  2960  QRCPIANSVWESLI-PYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWK  3136
             + CP +  +W  L+ P   +R  DQ    W  E ++   S N +      FA+T+WW WK
Sbjct  1558  RDCPASMGLWRRLVDPSRQQRFFDQSLLQWLYENLTSAQSANGER-WPTMFALTVWWCWK  1616

Query  3137  WRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGWV  3316
             WR   VF  T      R+K+++D+ +E+ ++ +K +  +A +     R +KW RP  GW 
Sbjct  1617  WRCGYVFGETG-KCPDRVKFVKDKTQEVTLANNKLRLHLA-VGLREERHIKWRRPSNGWC  1674

Query  3317  KANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNIGLNQRVSS*PRLWGL  3469
             K N DG+S  +  +A  GG +RD+ G    GF  NIG+     +   LWG+
Sbjct  1675  KLNTDGASRGNPGLATAGGVMRDENGEWQGGFAVNIGICSATLA--ELWGV  1723



>emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis thaliana]
 emb|CAB78601.1| reverse transcriptase like protein [Arabidopsis thaliana]
Length=929

 Score =   394 bits (1012),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 219/580 (38%), Positives = 333/580 (57%), Gaps = 44/580 (8%)
 Frame = +3

Query  1053  LGRF----PNQLLPKFMG----TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*  1208
             +GRF    P+   P F      TV +S+ KF  +FF +G LP   ND ++ L+  +  P 
Sbjct  256   MGRFKAPGPDGYQPVFYQQCWETVGESVSKFVMEFFESGVLPKSTNDVLLVLLAKVAKPE  315

Query  1209  LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNS  1388
              + QFR + LCNV +K++TK M +RLK+ +  LIGP Q SF+ GR   +N++V QE ++S
Sbjct  316   RITQFRPVSLCNVLFKIITKMMVIRLKNVISKLIGPAQASFIPGRLSFDNIVVVQEAVHS  375

Query  1389  LRSKSGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFD  1568
             +R K G+ G M++K+DLEKAYDR+ W F+  TL+ AG S  WI+ IM CV+   +++ ++
Sbjct  376   MRRKKGRKGWMLLKLDLEKAYDRIRWDFLAETLEAAGLSEGWIKRIMECVAGPEMSLLWN  435

Query  1569  SRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLF  1748
                +  F  ERG+RQGDP+SP LFVL +ERL H IE +V  G WK + I++ GP +SH+ 
Sbjct  436   GEKTDSFTPERGLRQGDPISPYLFVLCIERLCHQIETAVGRGDWKSISISQGGPKVSHVC  495

Query  1749  FVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLG  1928
             F DDL+ F EAS+                  Q++S  KS IFFS N S +++  I++  G
Sbjct  496   FADDLILFAEASV-----------------AQKVSLEKSKIFFSNNVSRDLEGLITAETG  538

Query  1929  IPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAI  2108
             I    +LG+YLG+P +  R+ +D++ +++ R+ +RL+GWK+R+LS  GR TL ++VL +I
Sbjct  539   IGSTRELGKYLGMPVLQKRINKDTFGEVLERVSSRLSGWKSRSLSLAGRITLTKAVLMSI  598

Query  2109  PCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*  2288
             P +TM S LLP  +L +L+++SR+FLWGS+   RK +L+SWKKV   K  G LG++    
Sbjct  599   PIHTMSSILLPASLLEQLDKVSRNFLWGSTVEKRKQHLLSWKKVCRPKAAGGLGLRASKD  658

Query  2289  MNQALFAKLGWKLMNKEDGLCVKIMEAKVQLPSLPSQACQMYGRVFLSRRQSF*KG----  2456
             MN+AL AK+GW+L+N +  L  +++  K ++  +   +  +    + S  +S   G    
Sbjct  659   MNRALLAKVGWRLLNDKVSLWARVLRRKYKVTDVHDSSWLVPKATWSSTWRSIGVGLREG  718

Query  2457  -AKSW*RTTDQHCFGSIHG*ENKPLC*VALGMIPSTE*YAKVFEYWVPESGWLWEKLSNL  2633
              AK W           +H    +PLC  A  ++   E  A+V E+W    GW   KL   
Sbjct  719   VAKGW----------ILH----EPLCTRATCLLSPEELNARVEEFWTEGVGWDMVKLGQC  764

Query  2634  LLEECLSMLAAFNLLDDCELENGLG*DVAYSGKFSVKSTY  2753
             L       L A  +     L + +       G F+V S Y
Sbjct  765   LPRSVTDRLHAVVIKGVLGLRDRISWQGTSDGDFTVGSAY  804


 Score =   148 bits (373),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 151/285 (53%), Gaps = 15/285 (5%)
 Frame = +1

Query  256   LGYSGPAYTWMQGLSSPNFKGARLDRAL-C---NIEWKIRSPDVEVLHLPMVNSYHTLGE  423
             +G+ G  +TW +GL    F   RLDR L C    ++W+      E L  P  N       
Sbjct  1     MGFKGNRFTWRRGLVESTFVAKRLDRVLFCAHARLKWQ------EALLCPAQNVD---AR  51

Query  424   SRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQLDDWNKHTIGNIFRRK*RVL  603
              R FRF AAW +H  ++E ++++W + +S     + L  QL  WNK   GNI  RK +V+
Sbjct  52    RRPFRFEAAWLSHEGFKELLTASWDTGLSTPVALNRLRWQLKKWNKEVFGNIHVRKEKVV  111

Query  604   ARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREEWIVSGDRNTRFYH  783
             + +  VQ  L V Q  DL+  +  L +E D +L+QEE LWF +SRE+ +  GDRNT F+H
Sbjct  112   SDLKAVQDLLEVVQTDDLLMKEDTLLKEFDVLLHQEETLWFQKSREKLLALGDRNTTFFH  171

Query  784   AATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFS-EDSTTQLEDLNDAFFPP  960
              +T +R+  + +  LKD+   W+++ + + +    +Y  L+S ED +     L    FP 
Sbjct  172   TSTVIRRRRNRIEMLKDSEDRWVTEKEALEKLAMDYYRKLYSLEDVSVVRGTLPTEGFPR  231

Query  961   LHTSQWLAINAHFTVKD-LEAVFEMAQFKAPSSDGFQTSFYQNSW  1092
             L   +   +N  FT  + + AV  M +FKAP  DG+Q  FYQ  W
Sbjct  232   LTREEKNNLNRPFTRDEVVVAVRSMGRFKAPGPDGYQPVFYQQCW  276



>ref|XP_008245529.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103343662 
[Prunus mume]
Length=1725

 Score =   325 bits (834),  Expect(3) = 6e-109, Method: Compositional matrix adjust.
 Identities = 163/431 (38%), Positives = 262/431 (61%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             K+   V + + +   +FFS        N T I L+P +P+P  V QFR I LCN SYK++
Sbjct  482   KYWSIVGNDVCRLVKNFFSNTMSMETLNRTEIALIPKVPHPEWVTQFRPISLCNYSYKII  541

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDL  1439
             +K +  RL+  +  +I P Q +F+ GRQI +NVLV  E  +SL+  K  K   M +K+D+
Sbjct  542   SKILANRLQPFLDKIISPQQCAFIPGRQIQDNVLVAHEAFHSLKIRKKTKIFEMGLKLDM  601

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+++ L K GF+  W+R ++ C+S+   A+  + ++  +F   RG+RQGD
Sbjct  602   SKAYDRIEWDFVQAVLLKMGFARQWVRWVLRCLSSVEFAVIVNGKVGSYFKPTRGLRQGD  661

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF++  + LS +I Q+V +G  +GMK  R GP +SHLFF DD + F +A+ +   
Sbjct  662   PLSPYLFLIVSDVLSSMINQAVTHGFIQGMKFGRGGPVLSHLFFADDSLMFLKATENNCR  721

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             V+ + L+ +C+ SGQ +++ KS +FFS NT +E++  + + L + I  D G+YLG+P+I 
Sbjct  722   VIVRILDAYCTASGQLVNFEKSNMFFSPNTPLEVKDRLRAILNVTISEDPGKYLGLPTIW  781

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+ + A +  +I  ++ GWK+  LS  GR  LI+SV  A+P Y M   L P G    
Sbjct  782   GRSKKMALAFVKDKILGKIQGWKHGLLSQAGREVLIKSVAQAVPSYPMSVFLFPNGFCQE  841

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             ++ +  +F WG S+ + K + ISWK +   K++G +G + L   N AL AK GW+++ + 
Sbjct  842   IDSILANFWWGQSQQSNKIHWISWKDLGMPKNEGGMGFRNLKDFNVALLAKQGWRMVTEP  901

Query  2340  DGLCVKIMEAK  2372
                  +++++K
Sbjct  902   QAFWAQLLKSK  912


 Score = 98.6 bits (244),  Expect(3) = 6e-109, Method: Compositional matrix adjust.
 Identities = 84/313 (27%), Positives = 141/313 (45%), Gaps = 30/313 (10%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
              Q+++ ++ L+DLGY G ++TW    +       RLDR L N+ W+   P+   +HLP V
Sbjct  182   LQEFLDKKELVDLGYQGSSFTWRGTRADGVVVQERLDRGLINVPWQETWPNSHAIHLPAV  241

Query  400   NSYH------TLGESRR----FRFNAAW*THPNYQE*VSSTW------KSDVSLEANKSN  531
              S H      T    RR    F+F A W + P  +E V  +W       S  S +     
Sbjct  242   GSDHCPVLILTEINVRRGLKPFKFEAFWASDPECREVVDRSWGLCSPAASCFSWDTKLGT  301

Query  532   LSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQE  711
                +L  W+     N       +L+ +  +QR        +     +++ R L+++   E
Sbjct  302   CRTELKQWSDGKFKNNRIMATALLSDLDSLQRDWE-----ENTVKIKEVERSLNQVWRCE  356

Query  712   ELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAF  891
             EL W  R++ +W+  GD NT F+H  T  ++  + + R+++  G+W    D +      +
Sbjct  357   ELYWKQRAKIQWLKHGDANTAFFHNCTIQKRRRNYLGRIRNLAGDWEMGEDHVRSIIEDY  416

Query  892   YMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHF--TVKDLE---AVFEMAQFKAPSS  1056
             + +LF+ +      D+  AF P + +     INA     + D E    VF+M   K+P  
Sbjct  417   FKNLFTSEGPRDWGDIL-AFVPVVISDN---INASLLAPISDEEIRITVFQMGALKSPGP  472

Query  1057  DGFQTSFYQNSWA  1095
             DGF   FYQ  W+
Sbjct  473   DGFSGIFYQKYWS  485


 Score = 23.5 bits (49),  Expect(3) = 6e-109, Method: Compositional matrix adjust.
 Identities = 43/219 (20%), Positives = 77/219 (35%), Gaps = 41/219 (19%)
 Frame = +2

Query  2411  VWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI------GKQATLLSRIRYDPFDRVIR  2572
              W  +L    I++ G++  V +      W D WI        Q + LS++  +     I 
Sbjct  931   AWSSLLVGRNIIMNGARWQVLDGSRVHLWTDKWIPGCTEHALQPSHLSQVDLEAKVETI-  989

Query  2573  *SL*VLGPRIGV--------AVGETFEPAS*GVLEYV---GGVQLIR*L*A*KWPGLGRG  2719
                      I          A+G  F P +  +++ +    G +  R +    WP L + 
Sbjct  990   ---------IDCHSREWNLEAIGGMFSPNAAKIIKAMPLGDGWEKDRLI----WP-LNQT  1035

Query  2720  LFW*ILC*INL*HYSRGLSTYR---------RVWNYI*SLKVPYRIRTFLWLARHDCHMT  2872
               + +    N+ H +   ++ R          +W  I   ++  ++  F W     C  T
Sbjct  1036  GSYTVKSGYNMIHMAHLDTSVRPSSSRILDKALWKLIWGSQMVPKLMNFWWRLVRGCLPT  1095

Query  2873  NTKRARRGFTSEVFCGICRNLPEDIDHIMQRCPIANSVW  2989
                  RR   +   C IC   PE ++H+   C     VW
Sbjct  1096  RDALFRRHLGTSPLCPICGEFPESVEHLFLLCNWVRPVW  1134



>gb|ABD28627.2| RNA-directed DNA polymerase (Reverse transcriptase); Ribonuclease 
H [Medicago truncatula]
Length=1296

 Score =   294 bits (753),  Expect(2) = 7e-107, Method: Compositional matrix adjust.
 Identities = 155/430 (36%), Positives = 240/430 (56%), Gaps = 1/430 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             ++   V D +       F TGH     ++T+I L+P I +P     FR I LCN  YK++
Sbjct  461   QYWHIVGDDVFHLVRSAFLTGHFDPAISNTLIALIPKIDSPNTYKDFRPISLCNTLYKII  520

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLE  1442
             TK +  RL+  +  LIGP+Q+SF+ GR   +N ++ QE+L+ ++    K G +  K+DLE
Sbjct  521   TKVLVHRLRPFLNNLIGPYQSSFLPGRGTADNSIILQEILHFMKRSKRKKGYVAFKLDLE  580

Query  1443  KAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDP  1622
             KA+D ++W F+ S L   GF    ++ IM CVS++  ++ ++      F    G+RQGDP
Sbjct  581   KAFDNVNWDFLNSCLLDFGFPDIIVKLIMHCVSSANYSLLWNGNKMPPFKPTHGLRQGDP  640

Query  1623  LSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASV  1802
             LSP LF+L +E+LS  I+ +V  G W+ + I   GP ISHL F DD++ F +A   Q   
Sbjct  641   LSPYLFILCMEKLSVAIQDAVLQGSWEPIHIINDGPQISHLLFADDVLLFTKAKSSQLQF  700

Query  1803  VKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHG  1982
             +    + F   SG +++  KS  ++S  T       +++  GI     LG+YLG P + G
Sbjct  701   ITNLFDRFSRASGLKINISKSRAYYSSGTPNGKINNLTAISGIQSTTTLGKYLGFPMLQG  760

Query  1983  RLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRL  2162
             R K+  +  ++ ++Q RL  WKNR L+  GR TL  SVLS IP Y MQ + LPQ +   +
Sbjct  761   RPKRSDFNFILEKMQTRLASWKNRLLNRTGRLTLATSVLSTIPTYYMQINWLPQNICDSI  820

Query  2163  ERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKED  2342
             ++ +R+FLW  S  N+  +L++WK +T  K  G LGI+     N  L  KL W ++   +
Sbjct  821   DQTARNFLWKGSN-NKGIHLVNWKTITRPKSIGGLGIRSARDANICLLGKLVWDMVQSTN  879

Query  2343  GLCVKIMEAK  2372
              L V ++  K
Sbjct  880   KLWVNLLAKK  889


 Score =   124 bits (310),  Expect(2) = 7e-107, Method: Compositional matrix adjust.
 Identities = 91/306 (30%), Positives = 155/306 (51%), Gaps = 17/306 (6%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPD--VEVL---  384
             F +++    L+DL  +G  +TW +  +       +LDR + N++W++  P+  VEVL   
Sbjct  160   FSNFMNNCNLLDLTTTGGRFTWHKNNNGIRILSKKLDRGMANVDWRLSFPEAFVEVLCRL  219

Query  385   ---HLPMVNSYHTLGESR---RFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQL  546
                H P++  +  L  +R    FRF AAW  H +Y   V  +W +        ++L K +
Sbjct  220   HSDHNPLLLRFGGLPLTRGPRPFRFEAAWIDHYDYGNVVKRSWSTHT--HNPTASLIKVM  277

Query  547   DD---WNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEEL  717
             ++   +N    GNIF+RK RV  R+ GVQ  L          L+++L+ E + IL+QEE+
Sbjct  278   ENSIIFNHDVFGNIFQRKSRVEWRLKGVQSYLERVDSYRHTLLEKELQDEYNHILFQEEM  337

Query  718   LWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYM  897
             LW+ +SRE+W+  GD+NT F+HA T +R+  + + +L+   G   SD + + E    ++ 
Sbjct  338   LWYQKSREQWVKLGDKNTAFFHAQTVIRRKWNKIHKLQLPNGISTSDSNILQEEALKYFK  397

Query  898   DLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQTS  1074
               F           N+   P L  +   ++ +  T K++  A+  M  +KAP  DGF   
Sbjct  398   KFFCGSQIPYSRFFNEGRHPALDDTGKTSLTSPITKKEVFAALNSMKPYKAPGPDGFHCI  457

Query  1075  FYQNSW  1092
             F++  W
Sbjct  458   FFKQYW  463


 Score = 62.4 bits (150),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 55/213 (26%), Positives = 87/213 (41%), Gaps = 12/213 (6%)
 Frame = +2

Query  2774  STYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDH  2953
             S+   VW++I  L  P + +  +WLA H+   T +    R       C  C    E   H
Sbjct  971   SSNDSVWSWIWQLTAPEKYKLLIWLACHNAAPTLSLLHHRKMAPAATCSRCGENDESFLH  1030

Query  2954  IMQRCPIANSVWESLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLW  3133
              ++ C  + ++W  L              +W    I   SSG+R     +TF   +WW W
Sbjct  1031  CVRDCKHSAAIWHKLGFVTAAFFSVSSVQDW----IRNFSSGSRA----ITFLAGLWWSW  1082

Query  3134  KWRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGW  3313
             + RN +  S     L      I D +  I  +F K+  +I P  +   R +KW +     
Sbjct  1083  RHRNLMCLSNETWPLTRISFRINDSINAIRSAFVKSN-VIQPDSA---RMVKWNQGNHQC  1138

Query  3314  VKANIDGSSIPSNSIARCGGFIRDDQGC*LKGF  3412
                N+DGS + +   A  GG  R++ G  L G+
Sbjct  1139  HILNVDGSCLGTPIRAGFGGIFRNNVGGYLSGY  1171



>ref|XP_008221358.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=877

 Score =   369 bits (948),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 187/408 (46%), Positives = 263/408 (64%), Gaps = 23/408 (6%)
 Frame = +3

Query  1125  SDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRM  1304
             SD F T  LP+  N+T+I LVP +  P  +NQ R I LCN  YK+++K +  RL+  M  
Sbjct  51    SDCFHTATLPDHLNETLIALVPKVERPMSMNQLRPISLCNTLYKVVSKILVARLRPCMTK  110

Query  1305  LIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDRLSWSFIRST  1484
             L+ P Q SFVLGRQIT+N++V QEVL+  +S  GK G +  KIDL KAYDR+ WS IR  
Sbjct  111   LVSPSQVSFVLGRQITDNIIVAQEVLHKFKSAKGKKGFIAWKIDLSKAYDRIQWSLIRE-  169

Query  1485  LQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLS  1664
                        + I+            +  L+  F  + GIRQGDPLSP +FVL +E+LS
Sbjct  170   ----------YKAIL------------NGELTDSFSPQCGIRQGDPLSPYIFVLCMEKLS  207

Query  1665  HLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQ  1844
             HLI+Q +++  WK ++I +  P ISHLFF DDL+ FGEA++ QA  +K+CL++FC LSGQ
Sbjct  208   HLIQQKIQDRAWKSVQICQGDPHISHLFFADDLILFGEATIDQAWFMKQCLDDFCQLSGQ  267

Query  1845  RLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRI  2024
             R+S+ KS I  S NT  ++  +I++  G P+   LG+YLGVP IH R+ + +Y +++++I
Sbjct  268   RVSFEKSMICVSPNTCSDLANSIAAISGSPLTATLGKYLGVPLIHTRVNKQTYQEVIAKI  327

Query  2025  QARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKG  2204
             Q RL  WK+ TL    R TL+QSV  AIP YTMQ++ LP  V  +L++L++ FLWG +  
Sbjct  328   QTRLASWKSHTLFMACRMTLLQSVTPAIPIYTMQTAKLPMSVYDKLDQLNKKFLWGHTNN  387

Query  2205  NRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGL  2348
               K +L++W++V + K  G LGI+R   MNQAL AK GW+L+  E GL
Sbjct  388   TSKIHLVNWEQVCKPKIVGGLGIKRSAWMNQALLAKTGWRLLQHEQGL  435


 Score =   101 bits (251),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 70/243 (29%), Positives = 111/243 (46%), Gaps = 15/243 (6%)
 Frame = +2

Query  2759  YSRGLSTYRRV---WNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICR  2929
             YS  L T   V   W +I  L +P +++TFLW+  H   +TN +R +RG T    C  C 
Sbjct  533   YSSFLPTEASVKWDWQFIWGLLLPPKVKTFLWIVCHQKLLTNVQRQKRGLTQVPTCPKCD  592

Query  2930  NLPEDIDHIMQRCPIANSVWESLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTF  3109
                + I H+ + CP + ++W  L   D+  L   D+  W    +             + F
Sbjct  593   YPMKAIAHLFKDCPFSLAIWNYLQIGDNSSLDLMDFKEWLLRNLQSKRKVYNGLPWPLVF  652

Query  3110  AVTMWWLWKWRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLK  3289
             A+ +W++WKWR   VF    +        ++  + +  + +  A     P       QL 
Sbjct  653   ALYLWFIWKWRCKGVFYQRFVMPGN----LQQLILQYALEWFNATKPPPPSYVPYVVQLH  708

Query  3290  WIRPQVGWVKANIDGSSIPSNSIAR---CGGFIRDDQGC*LKGFMHNIGLNQRVSS*PRL  3460
             WI P  G  K N DGS    NS++R    GG +RD+ G  +KGF  N+G+   + +  +L
Sbjct  709   WIAPTYGVCKINTDGS---RNSVSRFIGVGGLLRDNYGAWIKGFSVNLGVGSVLEA--KL  763

Query  3461  WGL  3469
             WG+
Sbjct  764   WGI  766


 Score = 36.6 bits (83),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 18/67 (27%), Positives = 37/67 (55%), Gaps = 0/67 (0%)
 Frame = +1

Query  3541  PVDNILAACRKEIRSIPVWKVLHAVREQNRAADLLAHMATTISRGTSILHDPCDELLDVL  3720
             P+ ++++ C+ ++++   + + H  REQN AAD+LA  ++    G     +    L++ L
Sbjct  803   PLFSLMSCCKLKVQAGWRFSIKHIFREQNVAADVLASKSSEFGPGVRYFTEVPAFLVNCL  862

Query  3721  NDDCLGV  3741
               D +GV
Sbjct  863   AVDAIGV  869



>ref|XP_009344908.1| PREDICTED: uncharacterized protein LOC103936764 [Pyrus x bretschneideri]
Length=1365

 Score =   379 bits (972),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 186/436 (43%), Positives = 276/436 (63%), Gaps = 0/436 (0%)
 Frame = +3

Query  1065  PNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCN  1244
             P +   KF       +       F+T  LP+  N+T I L+P + NP  + Q R I LC+
Sbjct  452   PARFYQKFWHLCGKDVCDMVKVCFNTTQLPDNINNTFISLIPKVDNPTSMTQLRPISLCS  511

Query  1245  VSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMV  1424
               YK+++K +  +L+  +  L+ P Q SFV GRQI +NV+V QE+L+  R+  GK G + 
Sbjct  512   TLYKVISKILVGKLRPLLHKLVSPTQVSFVPGRQIIDNVIVAQEILHKYRNTKGKKGFIA  571

Query  1425  IKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERG  1604
              KIDL KAYDRL WSFIR  L + G     +  IM CV+T       +  L+  F  + G
Sbjct  572   WKIDLSKAYDRLQWSFIRDVLWEIGLRGKMLELIMQCVTTVNYQAIVNGELTDSFSPQCG  631

Query  1605  IRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEAS  1784
             IRQGDPLSP LFVL +E+LSH+I   +   +WK +K++R GP +SHLFF DDL+ F EAS
Sbjct  632   IRQGDPLSPYLFVLCMEKLSHIINGCITTKKWKPVKLSRYGPPVSHLFFADDLILFAEAS  691

Query  1785  LHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLG  1964
               QA ++K CL+ FC++SGQ++++ KS I+ S N S      I++  G P+ +DLG+YLG
Sbjct  692   STQAKLLKDCLDIFCAVSGQQVNFDKSCIYCSPNISRSKAIEIANICGSPLTSDLGQYLG  751

Query  1965  VPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQ  2144
             VP +H R+ +++Y +++ ++Q RL+ WK+ TLS  GR   +QSV SAIP Y+MQS+ LP 
Sbjct  752   VPLLHSRVNKETYGNIVEKVQRRLSAWKSNTLSMAGRLVYLQSVASAIPIYSMQSTRLPI  811

Query  2145  GVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWK  2324
              +  ++++L+R+FLWG ++   K +L+ W+ V+  K  G LG++    MNQAL AK GWK
Sbjct  812   SICDKIDKLNRNFLWGHTEDKSKVHLVKWETVSTPKSMGGLGLKDTHAMNQALLAKTGWK  871

Query  2325  LMNKEDGLCVKIMEAK  2372
             LM ++ GL  ++++ K
Sbjct  872   LMQRDPGLWAQVLKGK  887


 Score =   161 bits (407),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 105/307 (34%), Positives = 156/307 (51%), Gaps = 16/307 (5%)
 Frame = +1

Query  217   GFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPM  396
             G  +W  R  L+DLG+ G  +TW +          RLDR LCNI W+    +  V HL  
Sbjct  155   GLGNWSARNSLVDLGFIGAKFTWSKKNEHGEIVWERLDRGLCNIAWRHLFSEAYVRHLAK  214

Query  397   VNSYHT---LG---------ESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSN-LS  537
             V S H    +G         + + FRF A W  HP ++  V+ TW S     + K+  LS
Sbjct  215   VKSDHCPLLIGLHSNHIPNPDLKAFRFQAMWMLHPEFEPFVNDTWSSAQGDASCKTIFLS  274

Query  538   KQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEEL  717
              +L  WN +  G IF++K R+LARI G+Q++L +     L  L+++L  E   IL QEEL
Sbjct  275   SELQSWNHNVFGCIFQKKRRLLARICGIQKALCICHVPYLFDLEKQLTTEYSTILEQEEL  334

Query  718   LWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYM  897
              W  +SR  W+  GD+NT+F+H +  VR+  + +  L ++ G W  D + +      ++ 
Sbjct  335   FWLQKSRNTWLREGDKNTKFFHLSAVVRRRKNKLEGLNNSEGVWTEDKETLKSIVVNYFK  394

Query  898   DLFS-EDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLEA-VFEMAQFKAPSSDGFQT  1071
             DLFS   +TT +E+L    FP L       +N   T  +++A +F +   KAP  DG   
Sbjct  395   DLFSFRITTTTMENL-PHLFPCLIDEDLFVLNGEVTDDEIKACMFAIGGLKAPGPDGIPA  453

Query  1072  SFYQNSW  1092
              FYQ  W
Sbjct  454   RFYQKFW  460


 Score =   108 bits (271),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/231 (33%), Positives = 109/231 (47%), Gaps = 15/231 (6%)
 Frame = +2

Query  2792  WNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCP  2971
             WN+I  LK+P ++ TFLW   H   +TN +RARRGFT+   C IC N+ E +DHI + C 
Sbjct  1034  WNFIWKLKLPPKLVTFLWTIGHGKILTNVQRARRGFTNNPCCPICPNIEESMDHIFRSCK  1093

Query  2972  IANSVWESL-IPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWRND  3148
              +   W  + IP +       D+ +W    +    S        + FA T+W+ WK RN+
Sbjct  1094  QSPFFWNGVGIPPEVAHSFALDFQSWMAINLRTQCSTIHGLPWNLIFASTLWYCWKGRNN  1153

Query  3149  LVFSGTNINLAARIKWI----RDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGWV  3316
             LVF+       +  K+I    RD  +    + SK    I  I         WI P +G  
Sbjct  1154  LVFNDGQQPPVSPQKFIFQFARDWYDANKSTSSKPPRQIISIH--------WIHPPIGRY  1205

Query  3317  KANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNIGLNQRVSS*PRLWGL  3469
             K N DGS          GG IR+ +G  +KGF  N+G    + +   LWG+
Sbjct  1206  KINTDGSCNDPFRHISAGGLIRNSEGDWIKGFAANLGRGTIMEA--ELWGV  1254



>ref|XP_008228034.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=751

 Score =   364 bits (935),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 185/408 (45%), Positives = 267/408 (65%), Gaps = 0/408 (0%)
 Frame = +3

Query  1149  LPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTS  1328
             +P+  N T+I LVP + +P  + QFR I LC+  YK+++K +  RL+  +  LI P Q S
Sbjct  61    IPDRLNYTLITLVPKVQSPQSMVQFRPISLCSTLYKVISKILVARLRPILPDLISPNQVS  120

Query  1329  FVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSP  1508
             F+ GR IT+N+L+ QE+++  +   GK G +  KIDL KAYDRLSW F+   L +     
Sbjct  121   FIPGRHITDNILIAQELMHKFKLSKGKKGFVAWKIDLSKAYDRLSWHFVEYVLLELRLPA  180

Query  1509  DWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVK  1688
              +++ IM+CV + R  I+ +  L+  F    GIRQGDPLSP LFVL +E+LSH+I  +V 
Sbjct  181   PFVKLIMNCVQSVRYQINVNGELTAPFSPMNGIRQGDPLSPYLFVLCIEKLSHIICDAVS  240

Query  1689  NGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*  1868
               +W+ +K ++ GP ISHLFF DDLV F EAS  QA ++K CL+ FCS SGQ +++ KS 
Sbjct  241   KKKWRPVKSSQSGPAISHLFFADDLVLFAEASASQAKIMKSCLDLFCSASGQVVNFEKSA  300

Query  1869  IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWK  2048
             +F S NT  E+ + IS   G P+ NDLG+YLG+P +H R+ + +Y+ L+ ++  RL  WK
Sbjct  301   VFCSPNTCKEVAKEISLICGSPLTNDLGKYLGMPLLHSRIGKRTYSSLVDKVHKRLAAWK  360

Query  2049  NRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLIS  2228
             ++ LS  GR+TLIQ+V ++IP Y MQ++ LP  V + L+RL+R+F WGSS+   K +L  
Sbjct  361   SKLLSLAGRATLIQAVTTSIPVYAMQTTKLPVSVCNDLDRLNRNFFWGSSEKKYKIHLCQ  420

Query  2229  WKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
             W      K +G LG ++   MNQAL AK+GW+L +K+ GL  KI EAK
Sbjct  421   WDLACRPKGKGGLGFKKTASMNQALLAKIGWRLHSKDSGLWAKIYEAK  468



>ref|XP_010026656.1| PREDICTED: uncharacterized protein LOC104417027 [Eucalyptus grandis]
Length=1695

 Score =   306 bits (783),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/412 (37%), Positives = 241/412 (58%), Gaps = 1/412 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             +K  L++   DFF++G LP   N T+I L+P   +P  + Q+R I LCN +YK+++K + 
Sbjct  787   IKYDLLRLVEDFFNSGSLPRQLNKTIIALIPKTNHPQSLEQYRPISLCNYAYKIISKVLA  846

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKG-GLMVIKIDLEKAYD  1454
              RLK  +  LI   Q +FV GR I +NVL+ QEV++  +++  K    +++K D+ KAYD
Sbjct  847   NRLKPWLPNLIAKEQAAFVSGRHIQDNVLILQEVMHQFKARKWKRRHKILVKTDMHKAYD  906

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             R+ W F++  L K GF   W+  +M CV+T+ L + F+     +    RG+RQGDPLSP 
Sbjct  907   RVEWDFLKDYLLKLGFHHRWVLWVMQCVTTTSLGLRFNGATLPYIQPTRGLRQGDPLSPY  966

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LFVL    LS LI Q+V +G  KG+K  R  P +SHLFF DD VFF + ++ +   +   
Sbjct  967   LFVLVANVLSTLITQAVSSGYLKGIKFARSCPTLSHLFFADDSVFFLDGTITECQNMSNI  1026

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             LN++C  +GQ ++  KS +  SK   + +Q+ ++    +P++   G+YLG+PS  GR K+
Sbjct  1027  LNQYCIATGQTINRNKSGMICSKYCPISLQEHLAREFRVPVLQRFGKYLGIPSDWGRSKR  1086

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
             D ++ +++R+ +++ GWK   LS  G+  L+++V+ AIP Y M    LPQ +   LE+  
Sbjct  1087  DMFSWIVARVSSKMEGWKESLLSKGGKEVLLKAVVQAIPQYAMSVFQLPQSICKTLEQRI  1146

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLM  2330
               F W +    R  +   W  +  SK  G LG + L   N+AL  K  WKL+
Sbjct  1147  AQFWWRNDVSRRGVHWHPWNALKISKHSGGLGFRDLMVFNKALLGKQAWKLV  1198


 Score =   102 bits (253),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 130/307 (42%), Gaps = 17/307 (6%)
 Frame = +1

Query  217   GFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPM  396
              F  +I    L+++   G  +TW       +    RLDR LC   W++  P   V  LP 
Sbjct  480   SFHSFINDCSLMEVESKGCRFTWTNKRVGDDLIKERLDRVLCTSNWRVLYPTAVVFALPA  539

Query  397   VNSYH------TLGES----RRFRFNAAW*THPNYQE*VSSTWKS----DVSLEANKSNL  534
             V S H      T+G      R+F + A W   P  Q  V   W S        +     +
Sbjct  540   VGSDHSPLLLDTIGTPAKNRRQFVYEAYWNRDPECQHIVQRHWNSSRHHQSMFDHKIQVV  599

Query  535   SKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEE  714
             ++ L  W++    N  +R   +  +++ +  + S++          +          QEE
Sbjct  600   TRALQAWSREKFQNGHQRINALYQQLTDLNNTPSLHSNDTEDASQIRDEIRNLWQ--QEE  657

Query  715   LLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFY  894
             L W  RSR  W+ SGD+N++F+HA+T  R+  + +  L+D   EW+ D   + E    F+
Sbjct  658   LFWAMRSRINWLRSGDKNSKFFHASTIQRRQRNRIIMLQDGNEEWVRDPQALREMTTDFF  717

Query  895   MDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQT  1071
               L++ +       + D     +       + A  T+++++ A F++   KAP  DG   
Sbjct  718   SQLYTSERARNYNPVLDQCPSVVTLDMNNQLTASVTMEEVQKATFQLGISKAPGPDGLNG  777

Query  1072  SFYQNSW  1092
              FYQN W
Sbjct  778   LFYQNHW  784


 Score = 54.3 bits (129),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 73/186 (39%), Gaps = 11/186 (6%)
 Frame = +2

Query  2789  VWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGIC-RNLPEDIDHIMQR  2965
             +W  I ++    ++R FLW   H+   T     RR  TS+  C +C +  PE I+HI   
Sbjct  1364  IWKRIWTMSTEPKVRMFLWSVFHNALATKDNLFRRHITSDPICDLCNQQTPETIEHIFFS  1423

Query  2966  CPIANSVWE--SLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKW  3139
             C     +W+   LI  + +         W    + + SS           A  +W +W+ 
Sbjct  1424  CSWTKEIWKHPDLIALNIQTT-VHSIAGWIATQVRQKSSV----PGLAFIAYVLWQIWRG  1478

Query  3140  RNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGWVK  3319
             RN  VF          +   R Q+   +    + K    P  +  + +  W  P  G +K
Sbjct  1479  RNSFVFRHKQPKSHFVVPDARAQLNSYDRINPRRK---KPQSNALYSEFLWRPPDRGAIK  1535

Query  3320  ANIDGS  3337
              NIDG+
Sbjct  1536  CNIDGA  1541



>gb|ABW81175.1| non-LTR retrotransposon transposase [Arabidopsis cebennensis]
Length=799

 Score =   292 bits (748),  Expect(2) = 7e-102, Method: Compositional matrix adjust.
 Identities = 175/495 (35%), Positives = 263/495 (53%), Gaps = 46/495 (9%)
 Frame = +3

Query  1272  MTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAY  1451
             M +RLK  M  LIGP Q+SF+ G    +N++V QE ++S+R K G               
Sbjct  1     MVMRLKRVMPKLIGPTQSSFIPGWLSADNIVVVQEAVHSMRRKKGH--------------  46

Query  1452  DRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSP  1631
                       TL  A     WI  IM CV    + + ++   ++ F+  RG+RQGDPLSP
Sbjct  47    ----------TLHAANLPSSWINWIMKCVKEPAMTVLWNGEKTESFIPSRGLRQGDPLSP  96

Query  1632  LLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKK  1811
              LFVL +ERL H I+ +V   +WK + ++R GP +SH+ F DDL+ F EAS+ Q  VV+K
Sbjct  97    YLFVLCLERLCHQIDLAVGTKEWKPISMSRGGPLLSHICFADDLILFAEASVAQIRVVRK  156

Query  1812  CLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLK  1991
              L +FC  SGQ++S  KS IFFS+N   ++++ IS   GI    +LG+YLG+P +  R+ 
Sbjct  157   VLEKFCIASGQKVSLEKSKIFFSQNVHRDLEKFISDESGIKSTKELGKYLGMPVLQKRIN  216

Query  1992  QDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERL  2171
             +D++ +++ R+ +RL GWK R LS  GR TL +SVLS+IP +TM +  LP+  L   +R+
Sbjct  217   KDTFGEILLRVSSRLAGWKGRMLSLAGRLTLTKSVLSSIPIHTMSTIALPKATLDGFDRI  276

Query  2172  SRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLC  2351
             S+ F+WGSS   +K +L++W K+  +K  G LGI+    MN AL AK+GW+L+  +  L 
Sbjct  277   SKSFVWGSSTEKKKQHLLAWNKIYCTKQAGGLGIRSSRAMNTALLAKIGWRLLQDKSSLW  336

Query  2352  VKIMEAKVQLPSLPSQACQMYGRVFLSRRQSF*KGAKSW*RTTDQHC-FGSIHG*ENKPL  2528
              ++                    + L  R+    G  SW     Q   F +     N PL
Sbjct  337   ARV--------------------IMLGMREVVIPGV-SWVVGDGQTTRFWADKWLMNTPL  375

Query  2529  C*VALGMIPSTE*YAKVFEYWVPESGWLWEKLSNLLLEECLSMLAAFNLLDDCELENGLG  2708
                 +G  P     A+V + W    GWL E ++  +  +    L A  + +   + + L 
Sbjct  376   REDIIGPAPVGLEEARVCDLWQHGRGWLLENIAPYVAPDIRLRLKAVVVDNITGVRDRLS  435

Query  2709  *DVAYSGKFSVKSTY  2753
                +  GKF+VKS Y
Sbjct  436   WGESLDGKFTVKSAY  450


 Score =   109 bits (272),  Expect(2) = 7e-102, Method: Compositional matrix adjust.
 Identities = 70/219 (32%), Positives = 101/219 (46%), Gaps = 15/219 (7%)
 Frame = +2

Query  2780  YRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIM  2959
             Y RVW  I     P R++ FLWL  H   MTN +R RR  +    C +C+   E I HI+
Sbjct  467   YDRVWKVI----APERVKIFLWLGVHQVIMTNMERQRRHLSDTGICQVCKGGDETIIHIL  522

Query  2960  QRCPIANSVWESLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFA--VTMWWLW  3133
             + CP    +W  +IP   R         +F + + E    N     +V       + W W
Sbjct  523   RDCPAMYGIWTRIIPRRKR-------GTFFTQTLLEWVYDNLGDSGKVDGCPWSCVRWGW  575

Query  3134  KWRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGW  3313
             KWR   VF G N      +K++RD+  E+ I     +G    I     R + W++P  GW
Sbjct  576   KWRCGNVF-GVNGKCRDMVKFVRDRASEV-IQAHLVEGNSGKIRGRIERMVSWVKPAEGW  633

Query  3314  VKANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNIGL  3430
             +K N DG+S  +  +A  GG +R   G  + GF  NIG+
Sbjct  634   LKLNTDGASKGNPGLATAGGILRQQDGSWIGGFAVNIGI  672



>ref|XP_010668235.1| PREDICTED: uncharacterized protein LOC104885230 [Beta vulgaris 
subsp. vulgaris]
Length=1607

 Score =   265 bits (677),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/414 (39%), Positives = 230/414 (56%), Gaps = 0/414 (0%)
 Frame = +3

Query  1131  FFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLI  1310
             +F    +P      +ICL+P   +P  V QFR I LCN  YK++TK +  RLK  +   I
Sbjct  734   WFRQSKVPEDLCQALICLIPKQNSPETVKQFRPISLCNTIYKLVTKILVTRLKPLIPDWI  793

Query  1311  GPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDRLSWSFIRSTLQ  1490
                Q SF+ GR    N++V  EVL+S++ K GK G   +KIDLEKAYDR+ W+F+R  LQ
Sbjct  794   SHNQNSFIKGRGPDINLVVASEVLHSMQKKQGKWGWFALKIDLEKAYDRVEWAFVRECLQ  853

Query  1491  KAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHL  1670
                     I  IMSC+S +   +  +   S+ F   RG+RQGDP+SP LF + +E L+  
Sbjct  854   NLQLDRPAIDLIMSCISQASSRVLINGCKSEEFKHSRGLRQGDPMSPYLFNICLEALTGR  913

Query  1671  IEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRL  1850
             I +S   G+W    + R    ISHL F DDL+ FG      A  V+  L+ FC  SG+R+
Sbjct  914   INESCHQGEWTPFGVGRGQVPISHLLFADDLLLFGRVDESTAFAVRSVLDRFCRDSGERI  973

Query  1851  SYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQA  2030
             +  KS + FS NT  + +   + +L I    +LG YLG+P  H R  +     ++ +++A
Sbjct  974   NEAKSKLMFSPNTPSDHKVLFTETLNIVESPNLGVYLGLPISHKRPTRRQVQFIVDKVRA  1033

Query  2031  RLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNR  2210
             RL  WK++ LS  GR  LI S LS IP Y MQ+  LP   LS L+ +  +FLWG     +
Sbjct  1034  RLATWKSKFLSRAGRLCLISSTLSTIPAYYMQAISLPISTLSDLDSICNNFLWGEEGEKK  1093

Query  2211  KCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
             K +L++ +     K++G LGI+    MN+A  AKLGWKL   +  L  + + +K
Sbjct  1094  KMHLVNKQMTFLPKNKGGLGIRSQRIMNKAYMAKLGWKLAQDQPSLAQQCIRSK  1147


 Score =   132 bits (332),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 93/298 (31%), Positives = 138/298 (46%), Gaps = 24/298 (8%)
 Frame = +1

Query  247   LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHT----  414
             LIDLG++GP +TW       N    RLDR   N+EW    P+  + HLP + S H     
Sbjct  431   LIDLGFNGPRFTWTNK-RKLNPIMERLDRGWVNMEWIQMFPNANLWHLPRITSDHCPILL  489

Query  415   -------LGESRRFRFNAAW*THPNYQE*VSSTWKS-DVSLEANKSNLSKQLDDWNKHTI  570
                    +   + FRF   W     ++E     W +   S++A+ S   + L +WN  T 
Sbjct  490   KFQNVPFVHGEKPFRFEPMWLLDSRFRESALPKWPNPSSSIQASLSTFRETLIEWNHSTF  549

Query  571   GNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQ-EELLWF*RSREEW  747
             GN++RRK R++ R+ G Q  L  +             ++      Q EE LW  +SR   
Sbjct  550   GNVYRRKRRLVGRLKGTQLYLQDHPTSPFHLNLESELQQELMDTLQQEETLWKTKSRMSR  609

Query  748   IVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTTQ  927
             I  G+RNTR++H +  ++++ S +  L+DN G  + D  GI +   AFY DL+S      
Sbjct  610   IGEGERNTRYFHRSVLIKRNRSRINSLRDNVGNEVRDQGGIHDLILAFYKDLYSTGKLFS  669

Query  928   LEDLNDAFFPPLHTSQWLAINAHFTVKDLE---AVFEMAQFKAPSSDGFQTSFYQNSW  1092
               + N     P+     L +N  F    LE   A+F M   KAP  DGF   F+Q +W
Sbjct  670   QWNSNS----PVPN---LGLNVGFEPSPLEIKMAMFSMKPHKAPGPDGFHPIFFQKTW  720



>gb|AFP55574.1| non-ltr retroelement reverse transcriptase [Rosa rugosa]
Length=1656

 Score =   274 bits (700),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 148/402 (37%), Positives = 225/402 (56%), Gaps = 2/402 (0%)
 Frame = +3

Query  1164  NDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGR  1343
             N T + L+P +  P   + +R I LCN SYK+LTK +  RL+  M  LI   Q++FV  R
Sbjct  1094  NRTHLALIPKVKAPTHPSHYRPIALCNFSYKILTKIIASRLQPFMSELISDNQSAFVSNR  1153

Query  1344  QITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIR  1520
             QI +NV++  E+ + L+ ++S   G   +K+D+ KAYDR+ W+F+ + L+K GF   WI 
Sbjct  1154  QIQDNVIIAHEIYHHLKLTRSCNNGAFGLKLDMNKAYDRVEWNFLEAVLRKMGFVDSWIG  1213

Query  1521  NIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQW  1700
              +MSCV+TS L++  + +    F+  RG+RQGDPLSP LF+   + LS +I +  ++   
Sbjct  1214  LVMSCVTTSSLSVLINGKPGPSFLPSRGLRQGDPLSPFLFLFVNDVLSRMINKMCQDSLL  1273

Query  1701  KGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFS  1880
               + I      +SHLFF DD +FF  A+L     +   L+ +C  SGQ ++  KS IFFS
Sbjct  1274  TPVTIGPNNLPVSHLFFADDSLFFLRATLQNCETLSDLLHTYCIASGQLINVEKSSIFFS  1333

Query  1881  KNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTL  2060
              NT  EI   +SS + IP+V+D G YLG+P+   R K+ +   +   I  ++ GWK  TL
Sbjct  1334  PNTPPEIAHLLSSIMQIPVVSDPGTYLGLPTFWHRSKKKALGFIKDSILRKVKGWKQATL  1393

Query  2061  SFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKV  2240
             S  G+  LI++V +AIP Y M     P  +   L  +  DF WG+    R  +  SW  +
Sbjct  1394  SQAGKEVLIKAVATAIPAYPMGCFKFPSTLCKELNGILADFWWGNVD-TRGIHWKSWDFL  1452

Query  2241  TESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIME  2366
                K  G +G + L+  N +L AK  W+L      L  +++E
Sbjct  1453  ARPKKDGGMGFRNLEDFNNSLLAKQAWRLHQNPFALWARVLE  1494


 Score =   121 bits (303),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 89/309 (29%), Positives = 146/309 (47%), Gaps = 23/309 (7%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             F+D++    L DL + GP ++W        F   RLDRAL NI W    P+ ++LHLP +
Sbjct  766   FRDFLNNGHLRDLHFKGPGFSWFAMRHGRVFIKERLDRALGNIAWSSSQPNTQILHLPKI  825

Query  400   NSYH----------TLGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKS------N  531
              S H           L ++R FRF   W TH  Y + +  +W       A +S      +
Sbjct  826   GSDHRPLLLDSNPKMLNKTRLFRFEQMWTTHEEYSDVIQRSWPPAFGGSAMRSWNRNLLS  885

Query  532   LSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQE  711
               K L  W+K    N   +   +L+ I  + +S       D       L  ++ ++  Q+
Sbjct  886   CGKALKMWSKEKFSNPSVQVADLLSDIEKLHQS----NPPDAHHQINILTDQVTKLWTQD  941

Query  712   ELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWI-SDGDGILEPFHA  888
             E+ W  RSR  W+  GD+N+ F+H  T  R+  + + RLKD+ G W+ S+ D  L+ F  
Sbjct  942   EMYWHQRSRVNWLKLGDQNSSFFHQTTIQRRQYNKIVRLKDDHGNWLDSEADVALQ-FLD  1000

Query  889   FYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGF  1065
             ++  L+  +   Q E++ D     +       +++  ++ ++ +AVF++   KAP  DGF
Sbjct  1001  YFTALYQSNGPQQWEEVLDFVDTAVTAEMNKILSSPVSLLEVKKAVFDLGATKAPGPDGF  1060

Query  1066  QTSFYQNSW  1092
                FYQN W
Sbjct  1061  SGIFYQNQW  1069



>ref|XP_009375083.1| PREDICTED: uncharacterized protein LOC103963932 [Pyrus x bretschneideri]
Length=1815

 Score =   301 bits (771),  Expect(2) = 8e-100, Method: Compositional matrix adjust.
 Identities = 157/404 (39%), Positives = 236/404 (58%), Gaps = 1/404 (0%)
 Frame = +3

Query  1164  NDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGR  1343
             N T + L+P +PNP  V+QFR I LCN SYK+L+K +  RLK  +  +I P Q +FV GR
Sbjct  923   NQTHVVLIPKVPNPEFVSQFRPISLCNYSYKILSKILANRLKVLLPKIISPSQNAFVPGR  982

Query  1344  QITNNVLVYQEVLNSLRSKSGKGGL-MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIR  1520
             QI + + +  E+ + L+ +  +    M IK+D++KAYDR+ W F+ + +++ GF   W  
Sbjct  983   QIQDCIGIAHEMFHYLKGRKAQNRFEMGIKLDMQKAYDRVEWDFLDAVMERMGFCSSWRS  1042

Query  1521  NIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQW  1700
              I  CVS+ + A+  + +  K F   RG+RQGDP+SP LF+L  E LS LI+ +V  G+ 
Sbjct  1043  LIGGCVSSVKFAVLLNGQAGKSFAPSRGLRQGDPISPYLFILVGEVLSKLIQGAVDQGRL  1102

Query  1701  KGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFS  1880
             +G+KI   GP ISHLFF DD + F  A +     ++  L+ FC  SGQ+++  KS +FF 
Sbjct  1103  EGVKIGGSGPVISHLFFADDTLLFLRADMENCGNLRNLLDRFCVASGQKVNLEKSSVFFG  1162

Query  1881  KNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTL  2060
              N      + + ++LG+ +V + G YLGVP+I GR K+   A +  R+  +L GWK  TL
Sbjct  1163  ANVPKVNVEQMGNALGMKVVINPGTYLGVPTIWGRSKKRGLAYVKGRVMEKLQGWKQNTL  1222

Query  2061  SFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKV  2240
             S  G+  LI++V+ AIP Y M     P  V   L+ L   F WG  +G  K + +S   +
Sbjct  1223  SRAGKEVLIKAVIQAIPAYPMCIFKFPGAVCKELDALVAGFWWGCKEGAHKIHWVSKGVL  1282

Query  2241  TESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
                KD G LG +     N+AL AK  W+L+ + D L  K+++A+
Sbjct  1283  GLPKDMGGLGFRNFQEFNEALLAKQCWRLITEPDSLWAKVIKAR  1326


 Score = 94.0 bits (232),  Expect(2) = 8e-100, Method: Composition-based stats.
 Identities = 85/313 (27%), Positives = 138/313 (44%), Gaps = 33/313 (11%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
              ++++    LIDLG++GPA+TW +G+   ++   RLDR + N +W+   P  +V+H  ++
Sbjct  597   LEEFLSSSQLIDLGFNGPAFTW-RGMRKGDWVEERLDRVMANEKWQQLWPHSQVMHETVL  655

Query  400   NSYH-------TLGESR---RFRFNAAW*THPNYQE*VSSTWK-----SDVSLEANKSNL  534
              S H        + E +    FRF A W      +  V   W      S V+      N 
Sbjct  656   ASDHCPVILISNIEEQKGRKMFRFEAYWVAEEECKNLVEKCWDRRHNGSPVNRWVRSLND  715

Query  535   SK-QLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkld-----likldrklrrelde  696
              + +L  WN+           + + R S +   LS    L           R++ R +DE
Sbjct  716   CRYRLSRWNRT----------KFMGRGSRIHDLLSQLDLLQRDWGPNYDEIREISRRIDE  765

Query  697   ilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILE  876
             +  QEE  W  RSR +W+  GD NT+F+H++T  R+  + + +L+D  G W+     +  
Sbjct  766   LRLQEESYWCQRSRVKWLREGDANTQFFHSSTLQRRRRNKIVKLRDENGNWVESPAQVRH  825

Query  877   PFHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLEAVF-EMAQFKAPS  1053
                  +  +FS         L D   P +       + A  T ++++A    M   KAP 
Sbjct  826   LVDNHFTSVFSSAGDRNWGSLLDCINPSVSPEMNEVLIAPVTEEEIKAAAGNMGGLKAPG  885

Query  1054  SDGFQTSFYQNSW  1092
              DGFQ  FYQ  W
Sbjct  886   PDGFQGIFYQTYW  898


 Score = 62.4 bits (150),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/200 (27%), Positives = 80/200 (40%), Gaps = 2/200 (1%)
 Frame = +2

Query  2792  WNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCP  2971
             W  I  L+VP ++R FLWL  H+C  T     RR  +    C IC    E I+HI   C 
Sbjct  1484  WKGIWKLEVPPKLRHFLWLTVHNCLPTRDALFRRRSSQTSTCPICCCHDETIEHIFLSCS  1543

Query  2972  IANSVW-ESLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAV-TMWWLWKWRN  3145
                 +W    + Y   R     +++W     S     +     R ++ V T W +WK R 
Sbjct  1544  WVEPIWFGGALGYKMDRPSLPSWSDWIQGVFSPNLCNSGDIMWRQSYIVFTCWCIWKARC  1603

Query  3146  DLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGWVKAN  3325
             D VF    IN    +  I + V     + +K             +  +W  P   +VK N
Sbjct  1604  DFVFKEVPINPLKVLAAISEAVRSFISAKAKDGERGGGEGRRNSQVTRWCAPTYPFVKIN  1663

Query  3326  IDGSSIPSNSIARCGGFIRD  3385
             +D S   ++ +   G  +RD
Sbjct  1664  VDASWSKASKMGFVGVIVRD  1683



>ref|XP_010054376.1| PREDICTED: uncharacterized protein LOC104442671 [Eucalyptus grandis]
Length=1509

 Score =   287 bits (734),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/426 (34%), Positives = 249/426 (58%), Gaps = 1/426 (0%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             T+++ +      FF++G +P   N T + LVP IP P  ++ +R I LCN  YK++++ +
Sbjct  599   TLQEEVFFSVHQFFTSGLMPLDLNKTDVVLVPKIPLPQSLDHYRPISLCNFGYKIISRVL  658

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAY  1451
               RLK  +  LI   Q++ V GRQI +N+LV QE+++ ++ SK  +    ++K+D++KAY
Sbjct  659   VNRLKPILPQLISTEQSASVSGRQIQDNILVTQEIIHQIKISKRRRNFPAILKMDMQKAY  718

Query  1452  DRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSP  1631
             DR+ W F+ + L K GF P W++ I  C+S++ ++I F+ +   +F   RG+RQGDPLSP
Sbjct  719   DRVEWDFLTAYLLKLGFHPRWVQWIYQCISSASISIKFNGQQMDYFNPTRGLRQGDPLSP  778

Query  1632  LLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKK  1811
              LF+L    LS LI Q++  G  +G K++R  P +SHLFF DD +FF  A+  +   +  
Sbjct  779   YLFILVTNLLSSLIHQAIDIGHLQGFKVSRYSPTLSHLFFADDAIFFLTATTTECQNLAS  838

Query  1812  CLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLK  1991
              L+++C  +GQ ++  KS IF  K     +++ ++S L IP+++ +G+YLG+PS  G  K
Sbjct  839   ILSQYCLATGQSINRNKSGIFLGKYCPRCLKENLASELRIPVLDRMGKYLGIPSDWGSSK  898

Query  1992  QDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERL  2171
              + ++ ++ R+ +++ GWK   +S  G+  LI++V+ AIP Y M    +P  +   +E+ 
Sbjct  899   GEMFSWILGRVNSKMEGWKENLISKGGKEVLIKTVVQAIPQYVMSVFKIPISICKSIEKK  958

Query  2172  SRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLC  2351
                F W +       +   W  +  +K  G LG + L   N+A+  K  W+L+ +   L 
Sbjct  959   IARFWWQNDCRKAGIHWKQWDVLKYTKALGGLGFRDLVAFNKAMLGKQAWRLIQQPSSLW  1018

Query  2352  VKIMEA  2369
              K+ +A
Sbjct  1019  SKLFKA  1024


 Score =   107 bits (268),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 86/310 (28%), Positives = 141/310 (45%), Gaps = 26/310 (8%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             F++ +    LID+   G AYTWM      +    RLDR LC ++W+I  P+ EV     V
Sbjct  295   FREVLHDCSLIDMESKGCAYTWMSNRQGEDIIKERLDRCLCTLDWRIAFPNAEVCAFLAV  354

Query  400   NSYHT-------LGESRR---FRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQ--  543
              S H+         ++RR   F F A W  HP+ ++ +S  WK   ++  N   L K+  
Sbjct  355   GSDHSPLLLNTDAPQTRRRQPFTFEAFWLQHPDCKKIISDVWKQASTVAHNLPYLLKKVS  414

Query  544   --LDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEEL  717
               L  W++ T  N    K R+      +Q+  +        +    ++ E+ ++  QEE 
Sbjct  415   LALTLWSRRTFSNA---KERITELQYELQQIANRSDIPYDRETATTIKSEIQQLWQQEEQ  471

Query  718   LWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYM  897
              W  +SR  W+  GD+NT+F+HA T  R+  + +  L D    W+ D   +      F+ 
Sbjct  472   FWAMKSRISWLNWGDKNTKFFHATTIQRRQRNRITMLLDEEQGWVRDAAILKVKTQTFFS  531

Query  898   DLF----SEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDG  1062
             +L+    S D    L+       P ++T    A+ A  T  +++ A F++   KA   DG
Sbjct  532   NLYKSVGSRDFAPILDQCPCLVTPEINT----ALTAMVTKDEIQAATFQLGANKASGPDG  587

Query  1063  FQTSFYQNSW  1092
                 FYQ++W
Sbjct  588   LNGLFYQSNW  597


 Score = 67.0 bits (162),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 83/214 (39%), Gaps = 7/214 (3%)
 Frame = +2

Query  2786  RVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICR-NLPEDIDHIMQ  2962
             ++W  I S+K+P +++ F W   H+   T     RR  T +  C +C  N PE I+H+  
Sbjct  1176  QLWKCIWSVKLPPKLKVFFWSVCHNALPTKENLFRRRITPDPICPLCTLNQPESIEHLFL  1235

Query  2963  RCPIANSVWESLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWR  3142
              CP   ++W       H    D       DE I +     +       F    W +WK R
Sbjct  1236  LCPWTTAIWSHPTINIHI---DTTTVRRIDEWIVDRILHKKSKPDLELFIAVCWQVWKAR  1292

Query  3143  NDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGWVKA  3322
             N  +FS    +    +     QV    I       +  P +S+      W  P  G ++ 
Sbjct  1293  NGAIFSKHQPDPHFGVHAAFAQVRSAAI--CDHSLMTKPKQSVDLGHF-WQPPAPGTLRI  1349

Query  3323  NIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNI  3424
             NIDG+    ++        RD  GC  +G   ++
Sbjct  1350  NIDGAYTSGHTEGSIAFICRDKSGCLQEGLTRSV  1383



>ref|XP_010507122.1| PREDICTED: uncharacterized protein LOC104783698 [Camelina sativa]
Length=1200

 Score =   290 bits (743),  Expect(5) = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/441 (35%), Positives = 245/441 (56%), Gaps = 1/441 (0%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
              VK+ L+   + FF  G      N T ICL+P +  P  + + R I LCNV YK+++K +
Sbjct  428   VVKEDLVAMVNRFFEEGVFDKSLNRTHICLIPKVAKPTRMAEMRPISLCNVGYKLISKNL  487

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDLEKAY  1451
               RLK  +  LI   Q++FV GR I++N+L+  E+ + LR+  S KG  M IK D+ KAY
Sbjct  488   CQRLKGVLPELISETQSAFVPGRLISDNILIAHEMFHGLRTNPSCKGKFMAIKTDMSKAY  547

Query  1452  DRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSP  1631
             DR+ W FI + L+K GF   WI  IM CV++    +  + + +   + ERG+RQGDPLSP
Sbjct  548   DRVEWGFIEALLRKMGFGEIWISRIMFCVTSVEYKVLLNGQPNGRIVPERGLRQGDPLSP  607

Query  1632  LLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKK  1811
              LF+L  E L   I+++ +  Q  G+K+  K P I+HL F DD +FF +A   Q  V+  
Sbjct  608   YLFILCTEVLVANIKRAEREKQITGIKVANKCPPITHLLFADDSLFFCKAEKAQCEVILG  667

Query  1812  CLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLK  1991
              LN++ ++SGQ++++ KS + F       ++  +   LGI  +  +G YLG+P   G  K
Sbjct  668   ILNQYEAVSGQQINFAKSSVQFGHKVDDTVRSEMQGVLGISNLGGMGSYLGLPESLGGSK  727

Query  1992  QDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERL  2171
                ++ +  R+Q R TGW  + LS  G+  +I+SV +A+P + M    +P+ + S+L   
Sbjct  728   TKVFSFVRDRLQGRTTGWSAKLLSKGGKEVMIKSVATAVPTFVMSCFRIPKIITSKLTSA  787

Query  2172  SRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLC  2351
               +F W +S  +   + ++W K+  SK  G LG + +D  N AL AK  W+L+   D L 
Sbjct  788   VANFWWSTSGQSGGLHWLAWDKLCFSKQLGGLGFRNVDAFNTALLAKQLWRLIEAPDTLF  847

Query  2352  VKIMEAKVQLPSLPSQACQMY  2414
              ++ + +    S P    + Y
Sbjct  848   ARVFKGRYYRNSNPMDPLRSY  868


 Score = 75.1 bits (183),  Expect(5) = 3e-99, Method: Compositional matrix adjust.
 Identities = 83/322 (26%), Positives = 127/322 (39%), Gaps = 48/322 (15%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             L F   I   G ++  Y G   +W +G         RLDRAL N +W    PD    +LP
Sbjct  124   LSFHGMIRDCGFLEFPYLGDWLSW-RGWWDKKPIRYRLDRALGNEDWHDLFPDTVTEYLP  182

Query  394   MVNSYHT-----LGESRR-----FRFNAAW*THPNYQE*VSSTW-----KSDVSLEANKS  528
              + S H      +G  R      F F+  W       E +S  W     +   S+     
Sbjct  183   RIASDHAPLIVNIGAKRSRGKRTFMFDRRWIGKAGLMESISQGWNGGHHEGPTSVVDKIV  242

Query  529   NLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQk--ldlikldrklrreldeil  702
             N  + +  W K  +   F R       I  ++R L+V Q        +   L   L +  
Sbjct  243   NCRRAISHWRKEQVP--FGRD-----IIEDLKRQLAVAQADDAVSSGVITDLTMRLRDAY  295

Query  703   YQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPF  882
               EE+ W+ +SR  W+  GD+NT+++ A T  R++ + +  L D    W +  D I    
Sbjct  296   NDEEIYWYQKSRNRWMRVGDKNTKYFQAQTKQRRARNRITGLYDRNNVWSTKDDDICTVA  355

Query  883   HAFYMDLF------------SEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLEAVF  1026
              +++ DLF            SE      ED+N+    P       A+ A       +A+F
Sbjct  356   VSYFEDLFTSIHPSNFEAALSEVKRVITEDVNERLTAP-------AMEAEVR----KALF  404

Query  1027  EMAQFKAPSSDGFQTSFYQNSW  1092
              M+  KAP  DG    F+Q +W
Sbjct  405   LMSPDKAPGPDGMTALFFQKAW  426


 Score = 43.5 bits (101),  Expect(5) = 3e-99, Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 68/168 (40%), Gaps = 12/168 (7%)
 Frame = +2

Query  2819  PYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCPIANSVWE-S  2995
             P +I+ F+W     C        RRG   +  C  C    E I+H +  CP A   W  +
Sbjct  1018  PPKIKHFMWQVLSGCISVLANLRRRGIPCDSACVRCGADEETINHAIFSCPPARQAWALA  1077

Query  2996  LIPYDHRRL*DQD-YTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWRNDLVFSGTNI  3172
              +P        +  Y N     +      +    Q   F   MW++WK RN  VF     
Sbjct  1078  QVPVGPGSFPTESIYAN-----VDHFLGSSNPASQVAAFPWLMWYIWKARNARVFESVME  1132

Query  3173  NLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGWV  3316
             N    +  +R    E N+ + +A+ +   + ++  RQ+  ++ QVG+V
Sbjct  1133  N---PMDVVRLAEGEANV-WLQAQDIGVLLMALGKRQM-LLQVQVGFV  1175


 Score = 27.3 bits (59),  Expect(5) = 3e-99, Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 26/51 (51%), Gaps = 1/51 (2%)
 Frame = +3

Query  2607  WLWEKLSNLLLEECLSMLAAFNLLDDCELENGLG*DVAYSGKFSVKSTYDI  2759
             W  ++L      E + ++ A  L     L++ +G     SGK++VKS Y++
Sbjct  938   WRMDRLKEFFAPEDVDLIGAIPL-GSRRLDDSMGWHYTKSGKYAVKSGYEV  987


 Score = 20.8 bits (42),  Expect(5) = 3e-99, Method: Compositional matrix adjust.
 Identities = 10/37 (27%), Positives = 17/37 (46%), Gaps = 0/37 (0%)
 Frame = +2

Query  2414  WKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQA  2524
             W+ I  +  ++ KG    V +  S   W D W+  Q+
Sbjct  874   WRSITSARSLVNKGLIIRVSSGESISIWTDPWVPAQS  910



>emb|CCA66036.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1369

 Score =   263 bits (673),  Expect(3) = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/404 (36%), Positives = 234/404 (58%), Gaps = 1/404 (0%)
 Frame = +3

Query  1164  NDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGR  1343
             N T I L+P   +      FR I LCNV YK++ K +  R+K  + M+I   Q+ FV GR
Sbjct  494   NQTHIVLIPKKKHCESPVDFRPISLCNVLYKIVAKVLANRMKMVLPMVIHESQSGFVPGR  553

Query  1344  QITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIR  1520
              IT+NVLV  E  + LR K +GK G + +K+D+ KAYDR+ W F+ + + K GF   + +
Sbjct  554   LITDNVLVAYECFHFLRKKKTGKKGYLGLKLDMSKAYDRVEWCFLENMMLKLGFPTRYTK  613

Query  1521  NIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQW  1700
              +M+CV+++R ++  + + S+ F   RG+RQGDPLSP LFV+  E LS L+  + +    
Sbjct  614   LVMNCVTSARFSVLVNGQPSRNFFPSRGLRQGDPLSPFLFVVCAEGLSTLLRDAEEKKVI  673

Query  1701  KGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFS  1880
              G+KI  +   ISHLFF DD + F  A+  +   V   L+ + + SGQ+L+  KS + +S
Sbjct  674   HGVKIGHRVSPISHLFFADDSLLFIRATEEEVENVMDILSTYEAASGQKLNMEKSEMSYS  733

Query  1881  KNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTL  2060
             +N   +    +   L    V    +YLG+P+  G  K+  +  +  R+  +L GWK + L
Sbjct  734   RNLEPDKINTLQMKLAFKTVEGHEKYLGLPTFIGSSKKRVFQAIQDRVWKKLKGWKGKYL  793

Query  2061  SFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKV  2240
             S  GR  LI++V  AIP Y MQ  ++P+ ++  +E++ R+F WG  +  R+   ++W+K+
Sbjct  794   SQAGREVLIKAVAQAIPTYAMQCFVIPKSIIDGIEKMCRNFFWGQKEEERRVAWVAWEKL  853

Query  2241  TESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
                K +G LGI+  D  N+AL AK  W+++ K D L  ++++ K
Sbjct  854   FLPKKEGGLGIRNFDVFNRALLAKQAWRILTKPDSLMARVIKGK  897


 Score =   120 bits (301),  Expect(3) = 3e-98, Method: Compositional matrix adjust.
 Identities = 90/312 (29%), Positives = 141/312 (45%), Gaps = 32/312 (10%)
 Frame = +1

Query  232   IFREGL-----IDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPM  396
             IFR  +     +DLG+ G  +TW            RLDR + N  WKI+ P   V HLP 
Sbjct  165   IFRNAMEECHFMDLGFVGYEFTWTNNRGGDANIQERLDRFVANDLWKIKFPGSFVSHLPK  224

Query  397   VNSYHT---------------LGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSN  531
               S H                  +S+RFRF A W       E V  TW        N + 
Sbjct  225   RKSDHVPIVASVKGAQSAATRTKKSKRFRFEAMWLREGESDEVVKETWMRGTDAGINLAR  284

Query  532   LSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkld----likldrklrreldei  699
              + +L  W+K   G++ +        I   Q  + V  + +     I   R L   +DE+
Sbjct  285   TANKLLSWSKQKFGHVAKE-------IRMCQHQMKVLMESEPSEDNIMHMRALDARMDEL  337

Query  700   lYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEP  879
               +EE+ W  RSR++WI SGD+NT+F+H   + R+  + VRR+++  GEW  D D + E 
Sbjct  338   EKREEVYWHQRSRQDWIKSGDKNTKFFHQKASHREQRNNVRRIRNEAGEWFEDEDDVTEC  397

Query  880   FHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLEAVF-EMAQFKAPSS  1056
             F  ++ +LF   +  +++ + +   P +       ++A F  +++ A   +M   KAP  
Sbjct  398   FAHYFENLFQSGNNCEMDPILNIVKPQITDELGTQLDAPFRREEVSAALAQMHPNKAPGP  457

Query  1057  DGFQTSFYQNSW  1092
             DG    FYQ+ W
Sbjct  458   DGMNALFYQHFW  469


 Score = 27.3 bits (59),  Expect(3) = 3e-98, Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 0/37 (0%)
 Frame = +2

Query  2402  MSNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             MS   K IL +  ++ KG  +++ + R T  W D W+
Sbjct  913   MSFTCKSILSARAVIQKGMCRVIGDGRDTTIWGDPWV  949


 Score = 54.7 bits (130),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 52/218 (24%), Positives = 88/218 (40%), Gaps = 22/218 (10%)
 Frame = +2

Query  2768  GLSTYR----RVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNL  2935
             G ST R    ++W  I   K+P +++ F W A H+     T   +RG   +  C  C   
Sbjct  1039  GPSTSRGPNLKLWQKIWKAKIPPKVKLFSWKAIHNGLAVYTNMRKRGMNIDGACPRCGEK  1098

Query  2936  PEDIDHIMQRCPIANSVWESLIPYDHRRL*DQDYTNWFDEG-----ISELSSGNRKHEQR  3100
              E  +H++  C  ++  W  + P        + +T   + G     +  L   ++  E  
Sbjct  1099  EETTEHLIWGCDESSRAW-YISPL-------RIHTGNIEAGSFRIWVESLLDTHKDTEWW  1150

Query  3101  VTFAVTMWWLWKWRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWR  3280
               F +  W +W  RN  VF    +     ++     V E    F +     +P+E++   
Sbjct  1151  ALFWMICWNIWLGRNKWVFEKKKLAFQEVVERAVRGVME----FEEECAHTSPVETLNTH  1206

Query  3281  QLKWIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQG  3394
             +  W  P VG VK N+D +      I   GG +RD +G
Sbjct  1207  ENGWSVPPVGMVKLNVDAAVFKHVGIG-MGGVVRDAEG  1243



>ref|XP_007203344.1| hypothetical protein PRUPE_ppa020282mg [Prunus persica]
 gb|EMJ04543.1| hypothetical protein PRUPE_ppa020282mg [Prunus persica]
Length=1496

 Score =   279 bits (713),  Expect(3) = 7e-98, Method: Compositional matrix adjust.
 Identities = 151/431 (35%), Positives = 240/431 (56%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             K+   V + ++     FF TG L    N T + L+P +  P  + Q R I LCNV YK+ 
Sbjct  821   KYWPIVGEDVVAAVLHFFKTGKLLKRINFTHVALIPKVHEPKNMMQLRPISLCNVLYKIG  880

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKS-GKGGLMVIKIDL  1439
              K +T RLK+ +  LI   Q++FV GR I++N +V  E+L+ +  K+ G+ G + +KID+
Sbjct  881   AKVLTTRLKAILPTLISDTQSAFVPGRAISDNSIVAFELLHMMHKKNQGRQGYLALKIDM  940

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ WSF+ + ++  GF+P WI+ IM CV+T   +   +     + + +RG+RQGD
Sbjct  941   SKAYDRVEWSFLEALMKGMGFAPRWIQLIMECVTTVSYSFMLNGNPVGYVIPQRGLRQGD  1000

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  E LS LI Q+ +     G+ + R  P +SHLFF DD   F  A      
Sbjct  1001  PLSPYLFLLCAEALSSLILQAERRNLLHGVNLCRGAPSVSHLFFADDSFLFLRADQQDCE  1060

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              +     ++  +SGQ++   KS + FS N     Q  +++ LG+  V+    YLG+P+  
Sbjct  1061  QLSIIFQKYEMVSGQKIHLEKSCVSFSINMDRTDQDNLAAVLGVRRVDQHDVYLGLPTHV  1120

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR ++  +  L  RI  ++ GWK + LSF G+  L++ V  A+P Y M   L+P+ + + 
Sbjct  1121  GRSRRQCFNSLKERIWKKIQGWKAKLLSFAGKEILLKVVAQAVPIYMMNCFLIPKCLCNE  1180

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             ++++   + W    G RK + +SW K+   K +G LG + L   N AL AK  W+L+   
Sbjct  1181  IQQVMARYWWVEQDGQRKIHWLSWNKLCLPKQEGGLGFRNLYAFNMALLAKQLWRLIQTP  1240

Query  2340  DGLCVKIMEAK  2372
             + L   I++A+
Sbjct  1241  NSLVACILKAR  1251


 Score =   103 bits (256),  Expect(3) = 7e-98, Method: Compositional matrix adjust.
 Identities = 81/287 (28%), Positives = 135/287 (47%), Gaps = 13/287 (5%)
 Frame = +1

Query  253   DLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHTLGESRR  432
             DLGY+GP YTW +  ++P     RLDRAL   +W  R    +V+HL    S H L   + 
Sbjct  543   DLGYTGPKYTWWR--NNPMEIRIRLDRALATADWCSRFLGTKVIHLNPTKSDH-LPLKKL  599

Query  433   FRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSK------QLDDWNKHTIGNIFRRK*  594
             FRF   W  H N  + +   W+      A  +   K      +L  W+K   G++  +  
Sbjct  600   FRFEEMWAEHVNCMQTIQDGWQRTCRGSAPFTTTEKLKCTRHKLLGWSKCNFGHLPNQ--  657

Query  595   RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREEWIVSGDRNTR  774
              +      +   L         +L   L ++LD ++ + E+ W   SR  W+ +GDRN++
Sbjct  658   -IKITREKLGELLDAPPSHHTAELRNALTKQLDSLMAKNEVYWRQCSRATWLKAGDRNSK  716

Query  775   FYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTTQLEDLNDAFF  954
             F+H   + R+  +T+  L+D  G W +   G+ +    ++  LFS   +++  ++ D   
Sbjct  717   FFHYKASSRRRRNTISALEDEHGHWQTTEQGLTQTVVNYFQHLFSSTGSSEYTEVVDGVR  776

Query  955   PPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSFYQNSW  1092
               +      A+ A FT ++++ A+F+M   KAP  DGF   FYQ  W
Sbjct  777   GRVTEEMNQALLAVFTPEEIKIALFQMHPSKAPGPDGFSPFFYQKYW  823


 Score = 28.1 bits (61),  Expect(3) = 7e-98, Method: Composition-based stats.
 Identities = 11/36 (31%), Positives = 20/36 (56%), Gaps = 0/36 (0%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             S +W+ + K+  ++ KGS+  + N  S   W D W+
Sbjct  1268  SYIWQSLCKARVLIEKGSRWRIGNGHSVRIWGDRWL  1303



>ref|XP_010682933.1| PREDICTED: uncharacterized protein LOC104897695 [Beta vulgaris 
subsp. vulgaris]
Length=1326

 Score =   293 bits (750),  Expect(3) = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/431 (36%), Positives = 239/431 (55%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             KF   V D ++ F  D+++        N T I L+P   NP  +  FR I LC V YK+L
Sbjct  424   KFWHIVGDDIVLFIRDWWNGRVQIGSLNRTCIVLIPKCSNPQQMGDFRPISLCTVLYKIL  483

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGLMVIKIDL  1439
             +K M  RLK  +  LI   Q++FV GR IT+N +   E+ +S+ R   GK G+M  K+D+
Sbjct  484   SKMMANRLKVFLSDLISLHQSAFVPGRLITDNAMTAFEIFHSMKRGGDGKKGVMAFKLDM  543

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ WSF+   + + GF   W+R IM C+S+   +   +  +    +  RG+RQGD
Sbjct  544   SKAYDRVEWSFLERVMGRLGFCEGWVRRIMECLSSVSYSFKLNGSVEGNIIPSRGLRQGD  603

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  E  S L+ ++  +G   G ++ R  P ISHLFF DD + F  A+L + S
Sbjct  604   PLSPYLFLLCAEAFSALLSKAAGDGLIHGARVCRSAPRISHLFFADDSILFTRAALQECS  663

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             VV   L+ +   SGQ++++ KS + FSKN     +  I S  G+  V    +YLG+P++ 
Sbjct  664   VVADILSTYERASGQKINFDKSEVSFSKNVDDSRKNDIRSLFGVREVERHEKYLGLPTVI  723

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+  +  L  R+  +L GWK + LS  G+  L+++V+ +IP Y M    +P  +LS 
Sbjct  724   GRSKKMVFTVLKERVWKKLQGWKEKLLSRAGKEVLLKAVIQSIPTYMMSLFAIPDCILSE  783

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             +  +   F WGS    R+ + +SW+K+   K  G +G + L   NQAL AK GW+L+   
Sbjct  784   INAMCARFWWGSRGTERRMHWLSWEKMCLPKAYGGMGFRDLKVFNQALLAKQGWRLLCHN  843

Query  2340  DGLCVKIMEAK  2372
               +   +  A+
Sbjct  844   GSMAHAVFNAR  854


 Score = 92.0 bits (227),  Expect(3) = 1e-97, Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 127/301 (42%), Gaps = 26/301 (9%)
 Frame = +1

Query  247   LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHT----  414
             L DLGYSG A+TW +GL        RLDR L    W    P   V + P+  S H     
Sbjct  133   LGDLGYSGGAFTWQRGLEERTIIRERLDRFLACDRWGTLFPHAWVKNFPIYKSDHAPILL  192

Query  415   --------LGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANK--SNLSKQLDDWNKH  564
                       + +RF F A W ++ + Q  V   W +    + ++  +  + +L  W   
Sbjct  193   STDSGQQERRKGKRFHFEALWLSNSDCQTVVKQAWATSGGSQIDERIAGCASELQRWAAV  252

Query  565   TIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQ----EELLWF*R  732
             T G+       V  RI   +  L V+Q            +EL   L +     E  W  R
Sbjct  253   TFGD-------VKKRIKKKEEELQVWQNKAPDGRMLGKCKELVRELDELNRLHESYWHAR  305

Query  733   SREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSE  912
             +R   +  GD+NT ++H   + RK  + + +L+D+ G W +D   +      ++ ++F+ 
Sbjct  306   ARANEMKDGDKNTSYFHHKASQRKKRNAIHKLRDSAGVWKTDEKDVSAIISDYFTNIFAS  365

Query  913   DSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQTSFYQNS  1089
              S    +D      P +  +    + A  TV ++ +A+F+M   KAP  DG    FYQ  
Sbjct  366   SSPANFDDALAGLSPKVPHTANEVLMAEPTVDEVRDALFQMHPNKAPGVDGMHALFYQKF  425

Query  1090  W  1092
             W
Sbjct  426   W  426


 Score = 24.6 bits (52),  Expect(3) = 1e-97, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 1/44 (2%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI-GKQATLL  2533
             S VW+ I  +  +LL+G K  V +  S   W +SW+ G+ A ++
Sbjct  871   SYVWRSIWGAKSLLLEGLKWRVGDGSSIGVWEESWLPGESAAVV  914


 Score = 58.2 bits (139),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 82/207 (40%), Gaps = 16/207 (8%)
 Frame = +2

Query  2789  VWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRC  2968
             VW  I  L+ P +++ FLW A      T  +   R    +  C  C    E I H + RC
Sbjct  1006  VWKVIWGLEGPPKLKHFLWRACMGALATRGRLKERHIVEDGCCTHCNREDESIVHAIFRC  1065

Query  2969  PIANSVWE-SLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWRN  3145
              + + +WE S   Y  R      + ++F   IS +     +    ++F    W  W +RN
Sbjct  1066  SLVSPIWENSPFTYYVRDGPTSSFMDFFVWLISRM-----ERTDLLSFMAMAWAAWSYRN  1120

Query  3146  DLVF----SGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGW  3313
              + F    S   +++   +K + D      + F        P+ +    +  W+ P  G 
Sbjct  1121  SVTFEEPWSNVTVSVVGFMKLVSDYKSYAALVFRA-----GPVTTGFPSRSSWVAPDEGR  1175

Query  3314  VKANIDGSSIPSNSIARCGGFIRDDQG  3394
              + N D + + +  +   G  +RD +G
Sbjct  1176  FRLNTDAAML-AEGLVGVGAVVRDSRG  1201



>ref|XP_010688582.1| PREDICTED: uncharacterized protein LOC104902493 [Beta vulgaris 
subsp. vulgaris]
Length=1771

 Score =   285 bits (730),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/431 (36%), Positives = 241/431 (56%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             KF   V   +I F   ++       G N T I L+P   NP  + +FR I LCNV YK++
Sbjct  667   KFWHVVGIDVINFVQKWWRGELELAGVNQTCIVLIPKCANPKYMTEFRPISLCNVIYKIV  726

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDL  1439
             +K M  +LK  +  LI   Q++FV  R IT+N L+  E+ + ++ K  GK G + +K+D+
Sbjct  727   SKTMANKLKKCLESLISINQSAFVPKRLITDNALIAFEIFHYMKRKGEGKDGTVALKLDM  786

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ WSF+   + K GF   WI+ IM C+ +   +   ++ +    +  RG+RQGD
Sbjct  787   SKAYDRVEWSFLEKVMLKFGFDVGWIQKIMWCLQSVSFSFKLNNTVCGHVVPGRGLRQGD  846

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             P+SP LF+L  +  S L++++ +     G++I R  P ISHLFF DD + F  A+L + S
Sbjct  847   PISPYLFLLCADAFSMLLDKAARERAIHGVRICRGAPRISHLFFADDSILFARANLRECS  906

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              +   +  +   SGQ+++  K+ + FSK  SV  ++ I  +LG+  V+   +YLG+P+I 
Sbjct  907   QIADIIKLYERASGQKVNLSKTDVAFSKKVSVARREEIVDTLGVREVDRHEKYLGLPTII  966

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+  +A L  RI  +LTGWK + LS  G+  LI++V  AIP Y M    LP G++  
Sbjct  967   GRSKKAVFACLKERIWKKLTGWKEKLLSRPGKEVLIKAVAQAIPTYMMSIFRLPDGLIDE  1026

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             +  L   F WGS+   +K +  +W+ +   K  G +G + L   NQA+ AK  W+L    
Sbjct  1027  IHALFAKFWWGSNDVEKKMHWHNWESLCLPKAMGGMGFRDLKCFNQAMLAKQCWRLFENP  1086

Query  2340  DGLCVKIMEAK  2372
               L  K+ +A+
Sbjct  1087  HSLLYKVFKAR  1097


 Score =   102 bits (254),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 80/301 (27%), Positives = 133/301 (44%), Gaps = 26/301 (9%)
 Frame = +1

Query  247   LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHT----  414
             L+DLGY G  YTW +G+S       RLDR L N EW    P  EVLH P+  S H     
Sbjct  376   LLDLGYKGSIYTWQRGISMDTLVKERLDRYLANNEWCTMFPYREVLHYPIFKSDHAPILL  435

Query  415   --------LGESRRFRFNAAW*THPNYQE*VSSTWKSDVS--LEANKSNLSKQLDDWNKH  564
                       + + FRF + W +    ++ VS  WK+ V+  + A   +++  L  W K 
Sbjct  436   KFGKDKTRYAKGKLFRFESLWLSKVECEQVVSRAWKAQVTEDIMARVEHVAGSLATWAKT  495

Query  565   TIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQ----EELLWF*R  732
             T G++ +R       I   +R L   Q         +  R +   L +    +E  W  R
Sbjct  496   TFGDVQKR-------IKDAERRLHNLQAKPPDGFILQQCRAIASELDELYNLKESYWHAR  548

Query  733   SREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSE  912
             +R   +  GDRNT ++H   + R+  ++++ L D  G W +  + +      ++ +LF+ 
Sbjct  549   ARANELRDGDRNTSYFHHKASQRRKRNSIKGLFDRDGVWRTSKEELEGIITQYFDELFAA  608

Query  913   DSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSFYQNS  1089
              +  ++E       P + +     +      ++++ A+FEM   KAP  DG    F+Q  
Sbjct  609   GNPCEMEAAVAGIEPKVTSRMNQDLLNEPNGEEIKAALFEMHPNKAPGVDGMHALFFQKF  668

Query  1090  W  1092
             W
Sbjct  669   W  669



>ref|XP_009118883.1| PREDICTED: uncharacterized protein LOC103843855 [Brassica rapa]
Length=1293

 Score =   291 bits (744),  Expect(3) = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/426 (36%), Positives = 244/426 (57%), Gaps = 1/426 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             V  ++ K    FF +G LP   N T I L+P I +P  V+ +R I LCNV YK ++K ++
Sbjct  409   VGPAITKEIQGFFISGALPYSINSTHIRLIPKIQSPKQVSDYRPIALCNVYYKTISKILS  468

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGL-MVIKIDLEKAYD  1454
             +RLK  +  ++   Q++FV  R I +NVL+  E+L+ L++        M +K D+ KAYD
Sbjct  469   IRLKPVLHDIVSANQSAFVPDRAIQDNVLITHEMLHYLKASGATIHCSMAVKTDISKAYD  528

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             RL WSFIR+ L++ GF+  ++  +M C+ST   +   ++ +      +RGIRQGDPLSP 
Sbjct  529   RLEWSFIRAVLERLGFNDTFVNWMMECISTVSYSFLLNNEVVGEVHPQRGIRQGDPLSPY  588

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             +F++  E LS L   + +NG   G++++R GP ++HL F DD + F +      + + + 
Sbjct  589   IFIICAEVLSGLCRTAQENGTLPGVRVSRYGPKVNHLLFADDTMIFTKTDPLSCTTLVEI  648

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L  +   SGQ ++  KS I FS  T  EI+  +   LGI     +G+YLG+P   GR K+
Sbjct  649   LQSYEKASGQMINAQKSSISFSSKTPAEIRSRVKEKLGIDKEGGVGKYLGLPEHFGRRKK  708

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
             D +A ++  ++ +   W  + LS  G++T+IQSVLSA P + M S LLP  +  +++ + 
Sbjct  709   DLFASIVDSMRQKAASWSTQFLSTAGKATMIQSVLSAKPNFAMSSFLLPVSLCKQIQTIL  768

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
               F W    G +K    SW+ +T  K  G LG + +   N+AL AK+ W+++ K D L  
Sbjct  769   TRFWWDDKDGEKKICWKSWESLTHPKSLGGLGFRDVQAFNEALLAKIAWRILTKPDSLLA  828

Query  2355  KIMEAK  2372
             K++ +K
Sbjct  829   KVLLSK  834


 Score = 84.3 bits (207),  Expect(3) = 1e-97, Method: Compositional matrix adjust.
 Identities = 80/308 (26%), Positives = 144/308 (47%), Gaps = 25/308 (8%)
 Frame = +1

Query  217   GFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHL--  390
              F+ ++    L D+ ++G   +W +G  S +    RLDRA+ N  W    P+    +L  
Sbjct  108   AFRTFLSSCDLFDIKHTGNFLSW-RGRRSTHLVHCRLDRAMANSAWSDMFPNGRSHYLQF  166

Query  391   ------PMVNSYHTLGE--SRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANK--SNLSK  540
                   P+++++ +  +  SR FR++     +P  +  V +TW S   L   +  S    
Sbjct  167   EGSDHRPVLSTFDSKKKKTSRLFRYDRRLRDNPEIKLLVDATWTSGAHLTVAERISRCRH  226

Query  541   QLDDWNKHTIGNIFRRK*RVLARISGVQRSL--SVYQkldlikldrklrreldeilYQEE  714
              +  W+K +  N  +R       I  ++ SL  ++   +        + R+L +    EE
Sbjct  227   AIATWSKKSYVNSQKR-------IVELKESLDQAMTATIVDDSYISLINRDLLQAYKAEE  279

Query  715   LLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFY  894
               W  RSR+ W+  GDRNT F+HAAT  R++ + +  ++D  G  I + D I +    ++
Sbjct  280   EFWKQRSRQLWLSLGDRNTGFFHAATKGRRARNRISVIEDTSGNPIFEEDEIGKVIAEYF  339

Query  895   MDLFSEDSTTQLEDLNDAFFP--PLHTSQWLAINAHFTVKDLEAVFEMAQFKAPSSDGFQ  1068
               +F+      ++ +N A  P   L T++ L       ++  EA+F +   KAP  DGF 
Sbjct  340   RKIFTSSDPAAVDIVNKAITPCITLETNESLTTTPS-ALEIREAMFAIHPDKAPGPDGFS  398

Query  1069  TSFYQNSW  1092
              SF+Q++W
Sbjct  399   ASFFQSNW  406


 Score = 33.9 bits (76),  Expect(3) = 1e-97, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (59%), Gaps = 0/41 (0%)
 Frame = +2

Query  2390  AKSGMSNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             A S +S+ W+GIL    +LL+   + + N  +T  W DSWI
Sbjct  846   AGSAISHGWRGILTGRDLLLRHLGRAIGNGETTNLWADSWI  886



>emb|CCA66040.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1362

 Score =   285 bits (729),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/452 (35%), Positives = 250/452 (55%), Gaps = 1/452 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             KF   +   +I F   ++         N T I L+P   +P  +  FR I LC V YK+L
Sbjct  461   KFWHILGSDVISFVQSWWRGMGDLGVVNKTCIVLIPKCDHPQSMKDFRPISLCTVLYKIL  520

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDL  1439
             +K +  RLK  +  +I P Q++FV  R IT+N LV  E+ ++++ K + K G+  +K+D+
Sbjct  521   SKTLANRLKVILPAIISPNQSAFVPRRLITDNALVAFEIFHAMKRKDANKNGVCALKLDM  580

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+   ++K GF   WI  +M+C+S+     + +  +       RG+RQGD
Sbjct  581   SKAYDRVEWCFLERVMKKMGFCDGWIDRVMACISSVSFTFNVNGVVEGSLSPSRGLRQGD  640

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             P+SP LF+L  +  S L+ ++    +  G +I R  P +SHLFF DD + F +AS+ + S
Sbjct  641   PISPYLFLLCADAFSTLLSKAASEKKIHGAQICRGAPVVSHLFFADDSILFTKASVQECS  700

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             +V   ++++   SGQ+++  K+ + FS++   E + AI + LG+  V+   +YLG+P+I 
Sbjct  701   MVADIISKYERASGQQVNLSKTEVVFSRSVDRERRSAIVNVLGVKEVDRQEKYLGLPTII  760

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+ ++A +  RI  +L GWK + LS  G+  LI+SV  AIP Y M    LP G++  
Sbjct  761   GRSKKVTFACIKERIWKKLQGWKEKLLSRPGKEVLIKSVAQAIPTYMMSVFSLPSGLIDE  820

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             +  L   F WGSS  NRK +  SW  +   K  G LG + L   NQ+L AK  W+L   +
Sbjct  821   IHSLLARFWWGSSDTNRKMHWHSWDTLCYPKSMGGLGFRDLHCFNQSLLAKQAWRLCTGD  880

Query  2340  DGLCVKIMEAKVQLPSLPSQACQMYGRVFLSR  2435
               L  ++++A+    S   +A + Y   F  R
Sbjct  881   QTLLYRLLQARYFKSSELLEARRGYNPSFTWR  912


 Score =   102 bits (254),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 93/310 (30%), Positives = 137/310 (44%), Gaps = 24/310 (8%)
 Frame = +1

Query  217   GFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPM  396
              F++ I    + DLGY G  +TW +G S       RLDR L N EW    P  EV+HLP 
Sbjct  160   AFREVIDDCAVKDLGYVGNRFTWQRGNSPSTLIRERLDRMLANDEWCDNFPSWEVVHLPR  219

Query  397   VNSYHT-------LGESRR-----FRFNAAW*THPNYQE*VSSTWKSDVSLEANK--SNL  534
               S H        + +S R     F+F A W +     + V   W      +       +
Sbjct  220   YRSDHAPLLLKTGVNDSFRRGNKLFKFEAMWLSKEECGKIVEEAWNGSAGEDITNRLDEV  279

Query  535   SKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEE  714
             S+ L  W   T GN+ +RK   L  ++G+Q+          ++  R +  +LDEI   EE
Sbjct  280   SRSLSTWATKTFGNLKKRKKEALTLLNGLQQR---DPDASTLEQCRIVSGDLDEIHRLEE  336

Query  715   LLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFY  894
               W  R+R   I  GD+NT+++H   + RK  +T+  L D  G W    + I      ++
Sbjct  337   SYWHARARANEIRDGDKNTKYFHHKASQRKRRNTINELLDENGVWKKGREEICGVVQHYF  396

Query  895   MDLFSEDSTTQ----LEDLNDAFFPPLHTSQWLAINAHFTVKDLEAVFEMAQFKAPSSDG  1062
               LF+ DS       LE L+      ++T+  L + +   VK  EA+F M   KAP  DG
Sbjct  397   EGLFATDSPVNMELALEGLSHCVSTDMNTAL-LMLPSGDEVK--EALFAMHPNKAPGIDG  453

Query  1063  FQTSFYQNSW  1092
                 F+Q  W
Sbjct  454   LHALFFQKFW  463



>ref|XP_010682492.1| PREDICTED: uncharacterized protein LOC104897331 [Beta vulgaris 
subsp. vulgaris]
Length=1212

 Score =   312 bits (799),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/431 (38%), Positives = 248/431 (58%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             KF   V D +I F   ++ +       N T I L+P   NP  +  FR I LCNV YK++
Sbjct  310   KFWSVVGDDVIDFVQQWWDSRVDLQSLNATCITLIPKCQNPIQMGDFRPISLCNVLYKVI  369

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGLMVIKIDL  1439
             +K M  RL+  +  LI P+Q++FV GR IT+N ++  E+ + + RS   K G M  K+D+
Sbjct  370   SKVMANRLEVILPDLISPYQSAFVPGRLITDNAMIAYEIFHYMKRSGDSKTGSMAFKLDM  429

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ WSF+   ++K GF   W+R IM C+S+   A   + +++   +  RG+RQGD
Sbjct  430   SKAYDRVEWSFLEQVMRKMGFCDSWVRRIMVCLSSVSYAFKLNGKVTGNIIPSRGLRQGD  489

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  E  S L+ ++  +G+  G ++ R  P ISHLFF DD + F  A+L + S
Sbjct  490   PLSPYLFLLCAEAFSTLLAKASDDGRIHGARVCRSAPRISHLFFADDSILFTRATLQECS  549

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             VV   ++ +   SGQ++++ KS + FSKN     +  I S LG+  V    +YLG+P++ 
Sbjct  550   VVADIISVYERASGQKINFNKSEVSFSKNVDDSRRVEIRSMLGVREVVKHDKYLGLPTLI  609

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+  +A L  R+  +L GWK + LS  G+  LI++V+ AIP Y M    +P G+L  
Sbjct  610   GRSKKAVFAVLKERVWKKLQGWKEKLLSKAGKEVLIKAVIQAIPTYMMSLFAIPDGILED  669

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             +  +   F W ++   RK + ISW+K    K  G +G + L   NQAL AK GW+LM  +
Sbjct  670   INSMCARFWWRATGMARKMHWISWEKFCLPKSYGGMGFRDLKTFNQALLAKQGWRLMCDD  729

Query  2340  DGLCVKIMEAK  2372
               L  +IM A+
Sbjct  730   GSLAHQIMRAR  740


 Score = 75.5 bits (184),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 80/308 (26%), Positives = 132/308 (43%), Gaps = 18/308 (6%)
 Frame = +1

Query  217   GFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPM  396
              F++ +    L DLG+ G  +TW +G         RLDR L + +W        V H P+
Sbjct  9     AFREVVAECDLRDLGFRGSPFTWQRGNDPATVIRERLDRFLASEDWCTLFSISSVCHFPI  68

Query  397   VNSYHT-------LGESRR-----FRFNAAW*THPNYQE*VSSTWKSDV--SLEANKSNL  534
               S H        +   RR     F F A W + P   + V S W S     +E+  +  
Sbjct  69    YKSDHAPLLLSADVRGRRRVHKKLFYFEALWLSRPECFDVVRSAWGSHAGEGIESRVAAC  128

Query  535   SKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEE  714
             + QL  W   T G++ +R  R  A +   Q   S      ++   R L  ELDE+   EE
Sbjct  129   AVQLGSWAAATFGDLKKRVKRKEAELEEWQ---SRVPDAAMLSQCRVLVGELDELHRLEE  185

Query  715   LLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFY  894
               W  R+R   +  GD+NT ++H   + RK  +++ +L+D  G    + + I +    ++
Sbjct  186   SYWHARARVNELRDGDKNTSYFHHKASYRKRRNSILQLQDEHGVLKMEEEEIGDINSDYF  245

Query  895   MDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQT  1071
              ++FS    +  ++        +      A+ A  T +++  A+ +M   KAP  DG   
Sbjct  246   TNMFSSSLPSGFDEALAGISSKVVDESNHALVAMPTREEIHSALLQMHPNKAPGVDGMHA  305

Query  1072  SFYQNSWA  1095
              FYQ  W+
Sbjct  306   LFYQKFWS  313



>ref|XP_010473926.1| PREDICTED: uncharacterized protein LOC104753360 [Camelina sativa]
Length=811

 Score =   313 bits (801),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 182/527 (35%), Positives = 284/527 (54%), Gaps = 63/527 (12%)
 Frame = +3

Query  1143  GHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQ  1322
             G  P   ND ++ L+  +  P  + QFR I                          G  +
Sbjct  344   GTFPPETNDVLLVLIAKVAKPERITQFRPIR-------------------------GYVK  378

Query  1323  TS-FVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAG  1499
             T  F+ GR  T+N++V QE ++S++ K G+ G M++K+DLEKAYDR+ W F+  TL  AG
Sbjct  379   TGGFIPGRLSTDNIVVVQEAVHSMKRKKGRKGWMLLKLDLEKAYDRIRWDFLEDTLGVAG  438

Query  1500  FSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQ  1679
              S                                   +GDPLSP LFVL +ERL HLI++
Sbjct  439   LS-----------------------------------EGDPLSPFLFVLCMERLCHLIDR  463

Query  1680  SVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYM  1859
             +V N QWK + ++R GP +SH+ F DDL+ F EAS+ Q  V++  L +FC  SGQ++S  
Sbjct  464   AVVNKQWKPISLSRGGPQLSHICFADDLILFAEASVAQIRVLRSVLEQFCGASGQKVSLE  523

Query  1860  KS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLT  2039
             KS IFFS N S E+ + IS   GI    DLG+YLG+P +  RL ++++ +++ R+ +RL 
Sbjct  524   KSKIFFSNNVSRELGKLISEESGIKSTKDLGKYLGMPVLQKRLNKETFGEVLERVSSRLA  583

Query  2040  GWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCN  2219
             GWK+ TLS  GR TL +++LS+IP ++M + +LP+  L+ L+++SR FLWG +   RK N
Sbjct  584   GWKSHTLSLAGRLTLTKALLSSIPVHSMSTIMLPKATLASLDKISRTFLWGGTGERRKQN  643

Query  2220  LISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAKVQLPSLPSQ  2399
             L+SWKKV   K  G LGI+    MN+AL AK+GW+L++ +  L  +++ +K ++  + S 
Sbjct  644   LVSWKKVCMPKGDGGLGIRASKDMNKALIAKVGWRLLHDKQSLWARVLRSKYKVGVVKSN  703

Query  2400  ACQMYGRVFLSRRQSF*KGAKSW*RTTDQHC-FGSIHG*ENKPLC*VALGMIPSTE*YAK  2576
                 +       R+   KG ++W     Q   F +     + PL  +    +P+   + K
Sbjct  704   WSSTWRSTGTGLREVVCKG-QNWVLGDGQRVKFWTDRWLSHSPLVELETRDVPAEVVHEK  762

Query  2577  VFEYWVPESGWLWEKLSNLLLEECLSMLAAFNLLDDCELENGLG*DV  2717
               + W    GW  +K+   +  +    LAAF L++D + E+ +  +V
Sbjct  763   ACDLWKVGVGWDLDKILPYVSSDTRLELAAFVLVNDTDNEDQISWEV  809


 Score = 73.9 bits (180),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 70/272 (26%), Positives = 116/272 (43%), Gaps = 59/272 (22%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             L F DWI    LID+G+      W Q                          D  V HLP
Sbjct  129   LAFGDWINDSSLIDMGF------WWQ--------------------------DARVTHLP  156

Query  394   MVNSYHTLGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQLDDWNKHTIG  573
              ++S+H                 P Y +     +  ++S +  +         WNK   G
Sbjct  157   FLSSHHA----------------PLYVQ-----FAPEISRDPKRRPFR-----WNKEVFG  190

Query  574   NIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREEWIV  753
              + +RK  +L  +  VQ  + +    +L++++  L ++ D  L QEE+LWF +SRE+WI 
Sbjct  191   AVQKRKELLLTELERVQNFIELSPTDELLEIEDSLLKDFDLFLEQEEMLWFQKSREKWIN  250

Query  754   SGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFS-EDSTTQL  930
              G RNT ++H +T +R+  + +  LK+  G WI+D   +      +Y  L+S +D    +
Sbjct  251   FGGRNTSYFHTSTVIRRRRNRIEMLKNEEGGWITDTQELESLAVHYYTRLYSLQDVHAVV  310

Query  931   EDLNDAFFPPLHTSQWLAINAHFTVKDLEAVF  1026
             E L  + F  L  +    +N  F + D+E   
Sbjct  311   EKLPSSGFMSLSVADHALLNRPFLLVDIEGAI  342



>emb|CCA66044.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1355

 Score =   294 bits (753),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 156/431 (36%), Positives = 243/431 (56%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             KF   + D + +F S        P+  N T I L+P + NP    +FR I LCNV YK++
Sbjct  462   KFWHIIGDDVTQFVSSILHGSISPSCINHTNIALIPKVKNPTTPAEFRPIALCNVVYKLV  521

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKS-GKGGLMVIKIDL  1439
             +KA+ +RLK  +  L+   Q++FV GR IT+N L+  EV +S++ ++  + G + +K+D+
Sbjct  522   SKALVIRLKDFLPRLVSENQSAFVPGRLITDNALIAMEVFHSMKHRNRSRKGTIAMKLDM  581

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+R  L   GF   W+  IMSCVS+   +   +  +       RG+R GD
Sbjct  582   SKAYDRVEWGFLRKLLLTMGFDGRWVNLIMSCVSSVSYSFIINGGVCGSVTPARGLRHGD  641

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  +  S +I++ V+  Q  G K +R GP ISHLFF D  + F  AS  + +
Sbjct  642   PLSPYLFILIADAFSKMIQKKVQEKQLHGAKASRSGPVISHLFFADVSLLFTRASRQECA  701

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             ++ + LN +   SGQ+++Y KS + FSK  S+  ++ +S+ L +  V    +YLG+PSI 
Sbjct  702   IIVEILNLYEQASGQKINYDKSEVSFSKGVSIAQKEELSNILQMKQVERHMKYLGIPSIT  761

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR +   +  LM RI  +L GWK + LS  G+  L++SV+ AIP Y M    LP  ++ +
Sbjct  762   GRSRTAIFDSLMDRIWKKLQGWKEKLLSRAGKEILLKSVIQAIPTYLMGVYKLPCSIIQK  821

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             +      F WGSS   R+ +  +W  +   K  G +G + L   N AL  +  W+L+ + 
Sbjct  822   IHSAMARFWWGSSDTQRRIHWKNWDSLCTLKCFGGMGFRDLRVFNDALLGRQAWRLVREP  881

Query  2340  DGLCVKIMEAK  2372
               L  ++M+AK
Sbjct  882   HSLLARVMKAK  892


 Score = 91.7 bits (226),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 86/301 (29%), Positives = 132/301 (44%), Gaps = 24/301 (8%)
 Frame = +1

Query  247   LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHT----  414
             L DLGY+G  +TW +G S       RLDR +C+  W    P+  V H     S H     
Sbjct  169   LRDLGYNGVWHTWERGNSLSTCIRERLDRFVCSPSWATMYPNTIVDHSMRYKSDHLAICL  228

Query  415   --------LGESRRFRFNAAW*THPNYQE*VSSTWKSDV--SLEANKSNLSKQLDDWNKH  564
                       + RRF F  +W   P  +E +   W      SL      L+ +L  W+  
Sbjct  229   RSNRTRRPTSKQRRFFFETSWLLDPTCEETIRDAWTDSAGDSLTGRLDLLALKLKSWSSE  288

Query  565   TIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREE  744
               GNI ++  RV + +  +Q+           +    L ++LDE+  ++E  W+ RSR  
Sbjct  289   KGGNIGKQLGRVESDLCRLQQQ---PISSANCEARLTLEKKLDELHAKQEARWYLRSRAM  345

Query  745   WIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLF--SEDS  918
              +  GDRNT+++H   + RK  + V+ L D  G W  + D I   F  ++  +F  +  S
Sbjct  346   EVRDGDRNTKYFHHKASQRKKRNFVKGLFDASGTWCEEVDDIECVFTDYFTSIFTSTNPS  405

Query  919   TTQLEDLNDAFFPPL--HTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQTSFYQNS  1089
               QL D+     P +    + WL     F+ ++L  A+ +M   KAP  DG    FYQ  
Sbjct  406   DVQLNDVLCCVDPVVTEECNTWLL--KPFSKEELYVALSQMHPCKAPGPDGMHAIFYQKF  463

Query  1090  W  1092
             W
Sbjct  464   W  464



>emb|CCA66054.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1355

 Score =   292 bits (748),  Expect(2) = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/431 (35%), Positives = 248/431 (58%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             +F   V D +  F S+       P+  N+T I L+P + NP    +FR I LCNV YK++
Sbjct  462   RFWHIVGDDVTSFISNILHGHSSPSCVNNTNIALIPKVKNPTKAAEFRPIALCNVLYKLM  521

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKS-GKGGLMVIKIDL  1439
             +KA+ +RLKS +  +I   Q++FV GR IT+N L+  EV +S+++++  + G + +K+D+
Sbjct  522   SKAIVMRLKSFLPEIISENQSAFVPGRLITDNALIAMEVFHSMKNRNRSRKGTIAMKLDM  581

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+R  L   GF   W+  IM  VS+   +   +  +    +  RG+RQGD
Sbjct  582   SKAYDRVEWGFLRKLLLTMGFDGRWVNLIMEFVSSVTYSFIINGSVCGSVVPARGLRQGD  641

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF++  +  S +I++ V++ Q  G K +R GP ISHLFF DD + F  A+  + +
Sbjct  642   PLSPYLFIMVADAFSKMIQRKVQDKQLHGAKASRSGPEISHLFFADDSLLFTRANRQECT  701

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             ++   LN++   SGQ+++Y KS + +S+  SV  +  +++ L +  V+   +YLG+PSI 
Sbjct  702   IIVDILNQYELASGQKINYEKSEVSYSRGVSVSQKDELTNILNMRQVDRHEKYLGIPSIS  761

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+  +  L+ RI  +L GWK + LS  G+  L++SV+ AIP Y M     P  ++ +
Sbjct  762   GRSKKAIFDSLIDRIWKKLQGWKEKLLSRAGKEVLLKSVIQAIPTYLMGVYKFPVFIIQK  821

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             ++     F WGSS   RK +  +W  +   K  G +G + L   N AL  +  W+L  + 
Sbjct  822   IQSAMARFWWGSSDTQRKIHWKNWDSMCNLKCFGGMGFKDLTIFNDALLGRQAWRLTREP  881

Query  2340  DGLCVKIMEAK  2372
               L  ++M+AK
Sbjct  882   QSLLGRVMKAK  892


 Score = 93.6 bits (231),  Expect(2) = 5e-97, Method: Compositional matrix adjust.
 Identities = 82/314 (26%), Positives = 134/314 (43%), Gaps = 28/314 (9%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             + F+D +    L DLGY G  YTW +G S       RLDR LC+  W    PD    H  
Sbjct  158   INFRDTLDTLALRDLGYVGTWYTWERGRSPSTCIRERLDRYLCSNSWLDLYPDSVPEHTI  217

Query  394   MVNSYHTL------------GESRRFRFNAAW*THPNYQE*VSSTWKSDVS--LEANKSN  531
                S H+             G++RR  F  +W      +  V  +W++     +    ++
Sbjct  218   RYKSDHSAIVLRSQRAGRPRGKTRRLHFETSWLLDDECEAVVRESWENSEGEVMTGRVAS  277

Query  532   LSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeil---  702
             + + L  W+     N+ ++       I   +++LSV Q   + +   +    L++ L   
Sbjct  278   MGQCLVRWSTKKFKNLSKQ-------IETAEKALSVAQNNPISESACQECVLLEKKLDEL  330

Query  703   -YQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEP  879
               + E  W+ RSR   +  GD+NT+++H   + RK  + V+ L D  G W  + D I   
Sbjct  331   HAKHEAYWYLRSRVAEVKDGDKNTKYFHHKASQRKKRNFVKGLFDGLGTWREEADHIENI  390

Query  880   FHAFYMDLF--SEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKD-LEAVFEMAQFKAP  1050
             F +++  +F  S  S   LE +     P +     L +   F+  + L A+ +M   KAP
Sbjct  391   FTSYFSSIFTSSNPSDLSLEAVMSVIEPVVTEEHNLKLLEPFSKDEILAALQQMHPCKAP  450

Query  1051  SSDGFQTSFYQNSW  1092
               DG    FYQ  W
Sbjct  451   GPDGMHVIFYQRFW  464



>ref|XP_010694802.1| PREDICTED: uncharacterized protein LOC104907559 [Beta vulgaris 
subsp. vulgaris]
Length=1336

 Score =   310 bits (793),  Expect(3) = 6e-97, Method: Compositional matrix adjust.
 Identities = 159/431 (37%), Positives = 249/431 (58%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             KF   V D ++KF  +++         N T I L+P  P P  +  FR I LC V YK++
Sbjct  435   KFWHIVGDDIVKFVQEWWRGETQIETLNKTCIVLIPKCPAPCKMGDFRPISLCTVIYKII  494

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDL  1439
             +K M  RLK  +  LI   Q++FV GR IT+N ++  E+ + ++ K  GK GLM  K+D+
Sbjct  495   SKMMANRLKIYLSDLISAHQSAFVPGRLITDNAMIAFEIFHHMKRKGDGKNGLMAFKLDM  554

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYD + WSF+   + K GF  DW+R +M C+S+   A   + R+    +  RG+RQGD
Sbjct  555   SKAYDCVEWSFLERVMLKLGFCVDWVRRVMECLSSVTYAFKLNGRVEGHIIPSRGLRQGD  614

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  E  S L+ ++  +G+  G ++ R GP ISHLFF DD + F  A+L + S
Sbjct  615   PLSPYLFLLCAEAFSALLSKAADDGRIHGARVCRSGPRISHLFFADDSILFSRATLQECS  674

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             VV + L+ +   SGQ++++ KS + FSK+     + AI S  G+  V    +YLG+P++ 
Sbjct  675   VVAEILSTYERASGQKINFDKSEVSFSKHVDTNRRVAIRSLFGVREVEKHEKYLGLPTVI  734

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+  ++ L  R+  +L GWK + LS  G+  L+++++ +IP Y M    +P  +L+ 
Sbjct  735   GRSKKVIFSVLKERVWKKLQGWKEKLLSRAGKEVLLKAIIQSIPTYMMSLFAVPDCILNE  794

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             +  +   F WG+    RK + +SW+K+   K  G +G + L   NQAL AK GW+L+   
Sbjct  795   INAMCSRFWWGARGTERKMHWVSWEKLCLPKSYGGMGFRDLKVFNQALLAKQGWRLLCDT  854

Query  2340  DGLCVKIMEAK  2372
             + L   +M+A+
Sbjct  855   NSLAHLVMKAR  865


 Score = 71.6 bits (174),  Expect(3) = 6e-97, Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 119/297 (40%), Gaps = 38/297 (13%)
 Frame = +1

Query  253   DLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHT--LGES  426
             DLGY G  +TW +G  + +    RLDR L +  W    P   V + P+  S H   L E+
Sbjct  162   DLGYRGGTFTWRRGNDASSMIRERLDRFLASDGWDELFPHARVRNFPIYRSDHAPILLET  221

Query  427   ----------RRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQLDDWNKHTIGN  576
                       RRF F A W ++P+          S+V         +  L  W     G+
Sbjct  222   EEEGQRRRNGRRFHFEALWLSNPDV---------SNVG-----GVCADALRGWAAGAFGD  267

Query  577   IFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQ----EELLWF*RSREE  744
             I +R       I   +  L V+          +  +E+ + L +     E  W  R+R  
Sbjct  268   IKKR-------IKSKEEELQVWHSQAPDGRMLEKCKEIVKELDELNRLHESYWHARARAN  320

Query  745   WIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTT  924
              +  GDRNT  +H   + RK  + +R+LKD+ GEW    + +      ++ ++FS     
Sbjct  321   EMRDGDRNTAHFHHKASQRKKRNMIRKLKDDTGEWKEKEEDVSRIITDYFSNIFSSSLPR  380

Query  925   QLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSFYQNSW  1092
               +         +      A+ A    +++  A+F+M   KAP  DG    FYQ  W
Sbjct  381   DFDAALAGLTAKVTDEANEALVASPNSEEVRGALFQMHPNKAPGVDGMHALFYQKFW  437


 Score = 25.8 bits (55),  Expect(3) = 6e-97, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 24/44 (55%), Gaps = 2/44 (5%)
 Frame = +2

Query  2387  SAKSGM--SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             SA+ G   S VW+ I  +  +LL+G K  V +  S   W DSW+
Sbjct  874   SARRGFDPSYVWRSIWGAKALLLEGLKWRVGDGNSINVWEDSWL  917



>ref|XP_010666306.1| PREDICTED: uncharacterized protein LOC104883473 [Beta vulgaris 
subsp. vulgaris]
Length=1322

 Score =   290 bits (742),  Expect(3) = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/431 (36%), Positives = 243/431 (56%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             KF   +   +I F  D++S        N T I L+P   NP  +  FR I LC V YK+L
Sbjct  421   KFWHILGPDIITFVQDWWSGLVDLTVINRTCIVLIPKCENPQSMKDFRPISLCTVLYKIL  480

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDL  1439
             +K +  RLK  +  +I P Q++FV  R IT+N LV  E+ ++++ K + +  +  +K+D+
Sbjct  481   SKTLANRLKVILPSIISPNQSAFVPRRLITDNALVAFEIFHAMKRKDANRDVICALKLDM  540

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+   ++K GF  DWI  +M+C+S        +  +       RG+RQGD
Sbjct  541   SKAYDRVEWCFLERVMEKLGFCADWISRVMACISGVSFTFKVNGVVEGSLSPSRGLRQGD  600

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             P+SP LF+L  +  S LI ++ +  +  G +I R  P +SHLFF DD + F +AS+ + S
Sbjct  601   PISPYLFLLCADAFSTLITKATEEKKIHGARICRGAPMVSHLFFADDSILFTKASVQECS  660

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             VV   ++++   SGQ+++  K+ + FS+N   + + AI   LG+  V    +YLG+P++ 
Sbjct  661   VVADIISKYERASGQKVNLSKTEVVFSRNVESDRRDAIVRVLGVNEVERQEKYLGLPTVI  720

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+ ++A +  RI  +L GWK + LS  G+  LI+SV  AIP Y M    LP G++  
Sbjct  721   GRSKKVTFACIKERIWKKLQGWKEKLLSRPGKEILIKSVAQAIPTYMMSVFCLPSGLIDE  780

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             +  +   F WGS+ G RK +  SW  +   K  G LG + L   NQAL AK  W+L  ++
Sbjct  781   IHAMLARFWWGSNGGERKMHWHSWDAMCLPKSMGGLGFRDLHCFNQALLAKQAWRLCQRD  840

Query  2340  DGLCVKIMEAK  2372
               L  ++++A+
Sbjct  841   ATLLSQVLQAR  851


 Score = 93.2 bits (230),  Expect(3) = 2e-96, Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 132/308 (43%), Gaps = 22/308 (7%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             F++ I    + DLG+ G  +TW +G S       RLDR L +  W    P  EV  LP  
Sbjct  121   FREAIDDCAIKDLGFKGNKFTWQRGNSPSTLIRERLDRMLADDAWCDLFPSWEVQILPRY  180

Query  400   NSYHT-------LGESRR-----FRFNAAW*THPNYQE*VSSTWKSD--VSLEANKSNLS  537
              S H        L +S R     F+F A W +     + V   W       +    + +S
Sbjct  181   RSDHAPLLLKTGLNDSYRRGNKLFKFEALWLSKEECGKVVEEAWSGSRGADIAERLAGVS  240

Query  538   KQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEEL  717
               L  W  H  G++ +RK R L +++ +Q+         +++       ELDEI   EE 
Sbjct  241   GDLTKWATHCFGDLKKRKKRALEKLNILQQR---APDARVLEQCHAASTELDEICRLEES  297

Query  718   LWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYM  897
              W  R+R   I  GD+NT+++H   + RK  + ++ L D  G W    D I E    ++ 
Sbjct  298   YWHARARANEIRDGDKNTKYFHHKASQRKKRNAIKGLLDENGVWKKGKDEINEVVQRYFG  357

Query  898   DLFSEDSTTQLEDLNDAFFPPLHTSQWLAI---NAHFTVKDLEAVFEMAQFKAPSSDGFQ  1068
             DLF+ +   ++E       P +      A+    A   V+D  A+F M   KAP  DG  
Sbjct  358   DLFATEGPNEMEAALTGISPCVSNEMNQALIKSPAGDEVRD--ALFAMHPNKAPGIDGLH  415

Query  1069  TSFYQNSW  1092
               F+Q  W
Sbjct  416   ALFFQKFW  423


 Score = 21.9 bits (45),  Expect(3) = 2e-96, Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI-GKQATLLSRIRYD  2551
             S  W+ +  S  +LL+G K  V +      W ++WI G+ +  +   R+D
Sbjct  868   SFTWRSVWSSKSLLLEGLKWCVGSGSRINVWTEAWILGEGSHHVPTPRHD  917


 Score = 61.2 bits (147),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 80/203 (39%), Gaps = 8/203 (4%)
 Frame = +2

Query  2786  RVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQR  2965
             R+W  +  +  P ++  F+W A           ARR       C +C    E I H +  
Sbjct  1003  RLWKEVWRIGGPPKLGHFIWWACKGSLAVKESLARRHICESTVCAVCGASVESIHHALFE  1062

Query  2966  CPIANSVWESLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWRN  3145
             C  A ++WE + P+    L +   T+ F E    L       + R T     W  W  RN
Sbjct  1063  CSFAKAIWE-VSPF--VALLNMAPTSSFAELFIWLRDKLSSDDLR-TVCSLAWASWYCRN  1118

Query  3146  DLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGWVKAN  3325
               +F   ++  +         V++  +    AK ++    ++C  ++ W RP  G +KAN
Sbjct  1119  KFIFEQQSVEASVVASNFVKLVDDYGL---YAKKVLRGSTTMCTSEVSWQRPPAGLIKAN  1175

Query  3326  IDGSSIPSNSIARCGGFIRDDQG  3394
              D    P+  I   G  +RD  G
Sbjct  1176  FDAHVSPNGEIG-LGVVVRDSSG  1197



>ref|XP_010039097.1| PREDICTED: uncharacterized protein LOC104427753 [Eucalyptus grandis]
Length=1506

 Score =   316 bits (810),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 157/425 (37%), Positives = 260/425 (61%), Gaps = 1/425 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             +K  +IK   DFF++G +P   N  ++ LVP + +P  ++Q+  I LCN +YK+++K M 
Sbjct  599   IKADVIKTVRDFFTSGIMPRSLNRMILVLVPKVHHPESIDQYIPISLCNFAYKIISKVMA  658

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAYD  1454
              RLK  +  LI     +FV  RQI +N++V QEVL+  +  KS K   +++K D++KAYD
Sbjct  659   NRLKPWLPNLISKEHAAFVKDRQIQDNIMVVQEVLHQFKVRKSKKKFNLLLKTDMQKAYD  718

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             R+ W F+++ + + GF+  W+R +M+C++T+ L++ F+      F   RG+RQGDPLSP 
Sbjct  719   RVEWDFLQAYMLQLGFNDRWVRLVMACITTTSLSVRFNGEQLASFQPSRGLRQGDPLSPY  778

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             +F+L    LS LI Q+V+ GQ +G+K  R  P +SHLFF DD VFF +A++ +A  +   
Sbjct  779   IFILLANALSTLITQAVEMGQLQGIKFNRACPTLSHLFFADDSVFFLKATISEAQNLANI  838

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             LN++C  +GQ ++  KS ++FSKN  + +QQ I+S   +P++N  G+YLG+PS  GR K+
Sbjct  839   LNQYCLATGQIINRNKSGLYFSKNCPLSLQQNIASEFRMPMMNRYGKYLGIPSDWGRSKR  898

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
             + ++ ++++  A+L GWK R LS  G+  L++SV+ A+P Y M    LP  +   +E+  
Sbjct  899   EMFSWILAKANAKLDGWKERLLSKSGKEILLKSVVQALPQYAMSIFKLPLSLCRLIEKKI  958

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
               F W ++ G    +  +W  +  SKD G +G + L   N+A+  K  W L  + + L  
Sbjct  959   SVFWWSNNNGKTGIHWQNWTSLKLSKDSGGMGFRDLVSFNKAMLGKQAWHLFQQPNALWS  1018

Query  2355  KIMEA  2369
             ++ + 
Sbjct  1019  QLFKG  1023


 Score = 67.4 bits (163),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 75/264 (28%), Positives = 113/264 (43%), Gaps = 35/264 (13%)
 Frame = +1

Query  373   VEVLHLPMVNSYHT----------LGESRRFRFNAAW*THPNYQE*VSSTWK----SDVS  510
             VEVL LP + S H           +   + F + A W      +E +  +W        S
Sbjct  344   VEVLALPALGSDHCPLLLTTSTSPVKRKKTFTYEAFWNQDQQCKEIIQHSWNISRADKTS  403

Query  511   LEANKSNLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSV-----YQkldlikldrk  675
             L A    +S +L  W+K    N          RI+ +Q  L       Y + D  +L   
Sbjct  404   LAAKLQTVSHELARWSKSKFSNGH-------LRIAHLQHQLQTLMNRKYYQSDDKELAHS  456

Query  676   lrreldeilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWIS  855
             +R E+ +I  QEE  W  RSR  W+  GD+N++F+HA+T  R+  + +  LKD    WI 
Sbjct  457   IRDEIQQIWQQEEQFWAMRSRINWLRWGDKNSKFFHASTVQRRQRNRICLLKDELQHWIR  516

Query  856   DGDGILEPFHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHF--TVKDLE---A  1020
             + + + E    F+ +L+   S        +  FP + T     IN H   TV + E   A
Sbjct  517   EPEQLKELTLGFFSNLYKSVSYCNFGPFLNQ-FPEVVTKD---INDHLLRTVTEDEVYQA  572

Query  1021  VFEMAQFKAPSSDGFQTSFYQNSW  1092
              F++   KAP  DG    F+Q  W
Sbjct  573   TFQLGASKAPGPDGLNGLFFQQHW  596


 Score = 59.7 bits (143),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 84/192 (44%), Gaps = 21/192 (11%)
 Frame = +2

Query  2786  RVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGIC-RNLPEDIDHIMQ  2962
             ++W  I  +K   +IR F+WLA H+   T      R  +    C +C +N+PE ++H+  
Sbjct  1174  KLWRTIWHMKTAPKIRVFMWLACHNALATKANLFHRHISPSPVCSLCTQNMPETVEHLFF  1233

Query  2963  RCPIANSVWE------SLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMW  3124
              C   + +W        ++P   +R         FD  ++  ++ ++   +       +W
Sbjct  1234  FCTWTSKIWAHPHIRVQILPTSVQR---------FDAWVAARATDSKAFHEFEVITNLLW  1284

Query  3125  WLWKWRNDLVFSGTNINLAARIKWIRDQVEEINI-SFSKAKGLIAPIESICWRQLKWIRP  3301
              +W+ RN+ ++   + +    I+ + D + +  I           PI S+   Q +W  P
Sbjct  1285  QIWRQRNNFIYRNQSPD---PIQAVEDALAQSRIYKVVDPTPHRFPISSLSPDQ-RWKPP  1340

Query  3302  QVGWVKANIDGS  3337
               G +K NIDG+
Sbjct  1341  DKGSLKCNIDGA  1352



>ref|XP_010690177.1| PREDICTED: uncharacterized protein LOC104903764 [Beta vulgaris 
subsp. vulgaris]
Length=1254

 Score =   278 bits (710),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/431 (34%), Positives = 242/431 (56%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             KF   +   +I F  +++      +  N T I L+P    P  +  FR I LCNV YK++
Sbjct  424   KFWHVIGQDVISFVQNWWEGNRDLSEINKTCIVLIPKCAEPKCMGDFRPISLCNVLYKIV  483

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKS-GKGGLMVIKIDL  1439
             +K M  +LK  +  +I   Q++FV  R IT+N LV  E+ ++++ ++ G  G + +K+D+
Sbjct  484   SKVMANKLKQFLGDIISLQQSAFVPKRLITDNALVAFEIFHAMKRRTEGAEGSIALKLDM  543

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+   + K GFS  WI  I   + ++      + R+  + + +RG+RQGD
Sbjct  544   SKAYDRVEWDFLVCVMSKLGFSDAWIHRIRMLLESTSFTFKINGRVDGFLVPKRGLRQGD  603

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             P+SP LF+L  +  S LI+++ +     G+ + R  P +SHLFF DD + F +A+L + S
Sbjct  604   PISPYLFLLCADAFSMLIDKAARERAIHGVMVCRGAPRVSHLFFADDSILFAKATLQECS  663

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              V   ++ +   SGQ+++  K+ + FS N   E ++ I  +LG+  V+   +YLG+P+I 
Sbjct  664   RVADIISTYERASGQKVNLSKTEVAFSTNVPAERRKDIVETLGVREVDRHEKYLGLPTII  723

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+  +A L  RI  +L GWK + LS  G+  +I++V  AIP Y M    +P G++  
Sbjct  724   GRSKKAVFACLKERIWKKLQGWKEKLLSRPGKEIMIKAVAQAIPTYMMSIFKIPDGLIDE  783

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             +  L   F WGS+  +RK +   W+ +   K  G LG + L   N AL AK GW+L++  
Sbjct  784   IHSLFARFWWGSTGSHRKLHWHKWEDLCLPKAMGGLGFRDLKSFNAALLAKQGWRLIHGT  843

Query  2340  DGLCVKIMEAK  2372
               L  KI++A+
Sbjct  844   GTLLHKILKAR  854


 Score =   105 bits (262),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 81/307 (26%), Positives = 142/307 (46%), Gaps = 18/307 (6%)
 Frame = +1

Query  217   GFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPM  396
              F++ I    + DLG+ G  +TW +G SS      RLDR +    W+   P   V+HLP+
Sbjct  123   AFREAIDDCAMSDLGFHGSCFTWKRGNSSATLIRERLDRFMGCARWREVFPWWHVIHLPI  182

Query  397   VNSYHT------------LGESRRFRFNAAW*THPNYQE*VSSTWKSDVS--LEANKSNL  534
               S H             +   R F+F + W +  + ++ V+ +W+  +   +E   +++
Sbjct  183   YKSDHAPILLKAGLRDPRISGGRSFKFESLWLSRDDCEQVVAESWRGGLGEDIERRIASV  242

Query  535   SKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEE  714
             +  L  W   T GNI ++     +++   Q +L       +    ++L  +LDE+   EE
Sbjct  243   ATDLSKWAASTFGNIKKKIKVTESQLKAAQNNLP---DAAMFDRCKELSAKLDELHRMEE  299

Query  715   LLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFY  894
               WF R+R   +  GD+NT ++H   + R+  + +  L D    W +D D I E  HA++
Sbjct  300   SYWFARARANELRDGDKNTSYFHHKASQRRKRNRISGLWDANNTWQTDDDSIKEIIHAYF  359

Query  895   MDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQT  1071
              DLF+  S T   D        + ++    ++A    +++  A+F+M   KAP  DG   
Sbjct  360   DDLFTGGSPTGFADATAGLRSCVTSNMNQVLDAVPNGEEIRLALFQMHPNKAPGPDGMHA  419

Query  1072  SFYQNSW  1092
              F+Q  W
Sbjct  420   LFFQKFW  426



>gb|AAD37021.1| putative non-LTR retrolelement reverse transcriptase [Arabidopsis 
thaliana]
Length=732

 Score =   335 bits (860),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 168/443 (38%), Positives = 258/443 (58%), Gaps = 39/443 (9%)
 Frame = +3

Query  1065  PNQLLPKFM----GTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSI  1232
             P+   P F       V DS+ +F  DFF++G LP G ND ++ L+  +  P  + QFR I
Sbjct  9     PDGFQPVFYQDCWDIVGDSVSRFVLDFFASGKLPEGTNDAIVVLIAKVLKPERITQFRPI  68

Query  1233  GLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKG  1412
              LCNV +K +TK + +RLK  +  LI P Q SF+ GR   +N+++ QE ++S+R K G+ 
Sbjct  69    SLCNVLFKTITKTLVMRLKRVISKLIRPAQASFISGRLAADNIVIMQEAVHSMRRKKGRK  128

Query  1413  GLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFM  1592
             G M++K+DLEKAYDR+ W F+  TL+       WI  IM CV+   +++ ++        
Sbjct  129   GWMLLKLDLEKAYDRIRWEFLEDTLRAVRLPEKWIVWIMQCVTEPSMSLLWN--------  180

Query  1593  LERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFF  1772
                                        E S+    WK + +++ GP +SH+ F DDL+ F
Sbjct  181   ---------------------------EHSIARKDWKPISLSQGGPKLSHICFADDLILF  213

Query  1773  GEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLG  1952
              EAS+ Q  V+++ L  FC  SGQ++S  KS IFFS+N S ++ + IS   GI    +LG
Sbjct  214   AEASVAQIRVIRRVLERFCVASGQKVSLEKSKIFFSENVSRDLGKLISDESGISSTRELG  273

Query  1953  RYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSS  2132
             +YLG+P +  R+ +D++ D++ ++  RL GWK R LS  GR TL ++VLS+IP +TM + 
Sbjct  274   KYLGMPVLQRRINKDTFGDILEKLTTRLAGWKGRFLSLAGRVTLTKAVLSSIPVHTMSTI  333

Query  2133  LLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAK  2312
              LP+  L  L+++SR FLWGSS   RK +LISWK+V + + +G LGI++   MN+AL +K
Sbjct  334   ALPKSTLDGLDKVSRSFLWGSSVTQRKQHLISWKRVCKPRSEGGLGIRKAQDMNKALLSK  393

Query  2313  LGWKLMNKEDGLCVKIMEAKVQL  2381
             +GW+L+     L  +IM    ++
Sbjct  394   VGWRLIQDYHSLWARIMRCNYRV  416


 Score = 59.7 bits (143),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 39/74 (53%), Gaps = 4/74 (5%)
 Frame = +2

Query  2780  YRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIM  2959
             + RVW    S+  P R+R FLWL      MTN +R RR  ++   C +C+   E I H++
Sbjct  565   FDRVW----SVTAPERVRLFLWLVAQQAIMTNQERHRRHLSTTTICQVCKGAKESIIHVL  620

Query  2960  QRCPIANSVWESLI  3001
             + CP    +W  LI
Sbjct  621   RDCPAMEGIWLRLI  634



>ref|XP_009118875.1| PREDICTED: uncharacterized protein LOC103843847 [Brassica rapa]
Length=1319

 Score =   313 bits (803),  Expect(2) = 6e-96, Method: Compositional matrix adjust.
 Identities = 166/427 (39%), Positives = 246/427 (58%), Gaps = 1/427 (0%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             TV   +++   DFF T  LP   N+T I L+P +P+P  V ++R I LCNV YK+++K +
Sbjct  438   TVGPEIVREIQDFFITDRLPERINETHIRLIPKVPSPQQVTEYRPIALCNVYYKIISKIL  497

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAY  1451
             T RL+  +  ++   Q++FV GR I++NVL+  EVL+ L+ S + K   M +K D+ KAY
Sbjct  498   TKRLQPLLSNIVSENQSAFVPGRMISDNVLITHEVLHYLKNSDAEKRCAMAVKTDMSKAY  557

Query  1452  DRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSP  1631
             DRL W FIR   Q+ GF P WI  I+ CVST   +   +          RGIRQGDPLSP
Sbjct  558   DRLEWEFIRLVFQRLGFHPKWISWIIQCVSTVTYSFLINGSPRGRVTPSRGIRQGDPLSP  617

Query  1632  LLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKK  1811
              +F+L  E LS L  ++ + G  KG+K++R  P I+HL F DD +FF  AS   A  + K
Sbjct  618   YIFILCSEVLSGLCSKAQEEGSLKGIKVSRGTPRINHLLFADDTMFFLRASKDSAEALTK  677

Query  1812  CLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLK  1991
              L  +   SGQ ++  KS I FS+ T   ++  +  +L I     +G+YLG+P   GR K
Sbjct  678   VLKLYEEASGQSINANKSSITFSRKTPAALKTVVHDTLSIQKEGGVGKYLGLPEHFGRKK  737

Query  1992  QDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERL  2171
              D ++ ++ RI+ +  GW NR LS  G+ T+++SVLS +P + M    LP  +  R++  
Sbjct  738   CDLFSSIIDRIKQKAKGWSNRFLSTAGKMTMLKSVLSLVPSHAMSCFQLPVSLCKRIQST  797

Query  2172  SRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLC  2351
                F W  S G +K + I+W K+   KDQG L  + +   N+A  AKL W+++N  D L 
Sbjct  798   LTRFWWDDSMGRKKMSWIAWNKLIRPKDQGGLDFRDIQSFNEAYLAKLAWRIINNPDKLI  857

Query  2352  VKIMEAK  2372
              +I+  K
Sbjct  858   GRILLGK  864


 Score = 68.6 bits (166),  Expect(2) = 6e-96, Method: Compositional matrix adjust.
 Identities = 78/306 (25%), Positives = 124/306 (41%), Gaps = 32/306 (10%)
 Frame = +1

Query  235   FREG-LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHL-------  390
             + EG L DL +SG   +W +G         RLDRA  N  W    P+    +L       
Sbjct  143   YSEGDLYDLRHSGDCLSW-RGTRGDYLVRCRLDRAAANSYWAELFPNARSQYLTYEGSDH  201

Query  391   -PMVNSYHTLGESRR--FRFNAAW*THPNYQE*VSSTWKSDV--SLEANKSNLSKQLDDW  555
              P+++ +    + RR  FR++     +P  +  +   W S    S+      +   L  W
Sbjct  202   KPILSFFEPDKKKRRGLFRYDRRLKNNPEAKVLIKQAWDSAPYSSVNDRIKEVRTALIQW  261

Query  556   NKHTIGN----IFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLW  723
             +K    N    I +++  + A ++       +  ++     D             EE  W
Sbjct  262   SKQQYKNSREQIEQKRFELEAALTDPTNDTELISRVSNELNDAYN---------SEEEYW  312

Query  724   F*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDL  903
               RSR  W+  GDRNT F+HA    RK A+    ++D  G  +   D I      ++ +L
Sbjct  313   RQRSRLLWLSLGDRNTGFFHATAKNRKRANAFTVIEDAEGNMVYQEDQIGRVIVEYFHEL  372

Query  904   FSEDSTTQLEDLNDAFFPPLH---TSQWLAINAHFTVKDLEAVFEMAQFKAPSSDGFQTS  1074
             F      + E +  A  P +      Q +A+ A   +K  EA+F +   KAP  DGF  S
Sbjct  373   FKTIDGNREETVMHALSPMVSAETNEQLIAVPAAVEIK--EALFSIHADKAPGPDGFSAS  430

Query  1075  FYQNSW  1092
             FY  +W
Sbjct  431   FYHTNW  436



>ref|XP_009103763.1| PREDICTED: uncharacterized protein LOC103829818 [Brassica rapa]
Length=1304

 Score =   313 bits (801),  Expect(2) = 8e-96, Method: Compositional matrix adjust.
 Identities = 166/427 (39%), Positives = 246/427 (58%), Gaps = 1/427 (0%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             TV   +++   DFF T  LP   N+T I L+P +P+P  V ++R I LCNV YK+++K +
Sbjct  438   TVGPEIVREIQDFFITDRLPERINETHIRLIPKVPSPQQVTEYRPIALCNVYYKIISKIL  497

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAY  1451
             T RL+  +  ++   Q++FV GR I++NVL+  EVL+ L+ S + K   M +K D+ KAY
Sbjct  498   TKRLQPLLSNIVSENQSAFVPGRMISDNVLITHEVLHYLKNSDAEKRCAMAVKTDMSKAY  557

Query  1452  DRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSP  1631
             DRL W FIR   Q+ GF P WI  I+ CVST   +   +          RGIRQGDPLSP
Sbjct  558   DRLEWEFIRLVFQRLGFHPKWISWIIQCVSTVTYSFLINGSPRGRVTPSRGIRQGDPLSP  617

Query  1632  LLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKK  1811
              +F+L  E LS L  ++ + G  KG+K++R  P I+HL F DD +FF  AS   A  + K
Sbjct  618   YIFILCSEVLSGLCSKAQEEGSLKGIKVSRGTPRINHLLFADDTMFFLRASKDSAEALTK  677

Query  1812  CLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLK  1991
              L  +   SGQ ++  KS I FS+ T   ++  +  +L I     +G+YLG+P   GR K
Sbjct  678   VLKLYEEASGQSINADKSSITFSRKTPAALKTVVHDTLSIQKEGGVGKYLGLPEHFGRKK  737

Query  1992  QDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERL  2171
              D ++ ++ RI+ +  GW NR LS  G+ T+++SVLS +P + M    LP  +  R++  
Sbjct  738   CDLFSSIIDRIKQKAKGWSNRFLSTAGKMTMLKSVLSLVPSHAMSCFQLPVSLCKRIQST  797

Query  2172  SRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLC  2351
                F W  S G +K + I+W K+   KDQG L  + +   N+A  AKL W+++N  D L 
Sbjct  798   LTRFWWDDSMGRKKMSWIAWNKLIRPKDQGGLDFRDIQSFNEAYLAKLAWRIINNPDKLI  857

Query  2352  VKIMEAK  2372
              +I+  K
Sbjct  858   GRILLGK  864


 Score = 68.9 bits (167),  Expect(2) = 8e-96, Method: Compositional matrix adjust.
 Identities = 78/306 (25%), Positives = 124/306 (41%), Gaps = 32/306 (10%)
 Frame = +1

Query  235   FREG-LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHL-------  390
             + EG L DL +SG   +W +G         RLDRA  N  W    P+    +L       
Sbjct  143   YSEGDLYDLRHSGDCLSW-RGTRGDYLVRCRLDRAAANSYWAELFPNARSQYLTYEGSDH  201

Query  391   -PMVNSYHTLGESRR--FRFNAAW*THPNYQE*VSSTWKSDV--SLEANKSNLSKQLDDW  555
              P+++ +    + RR  FR++     +P  +  +   W S    S+      +   L  W
Sbjct  202   KPILSFFEPDKKKRRGLFRYDRRLKNNPEAKVLIKQAWDSAPYSSVNDRIKEVRTALIQW  261

Query  556   NKHTIGN----IFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLW  723
             +K    N    I +++  + A ++       +  ++     D             EE  W
Sbjct  262   SKQQYKNSREQIEQKRFELEAALTDPTNDTELISRVSNELNDAYN---------SEEEYW  312

Query  724   F*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDL  903
               RSR  W+  GDRNT F+HA    RK A+    ++D  G  +   D I      ++ +L
Sbjct  313   RQRSRLLWLSLGDRNTGFFHATAKNRKRANAFTVIEDAEGNMVYQEDQIGRVIVEYFHEL  372

Query  904   FSEDSTTQLEDLNDAFFPPLH---TSQWLAINAHFTVKDLEAVFEMAQFKAPSSDGFQTS  1074
             F      + E +  A  P +      Q +A+ A   +K  EA+F +   KAP  DGF  S
Sbjct  373   FKTIDGNREETVMHALSPMVSAETNEQLIAVPAAVEIK--EALFSIHADKAPGPDGFSAS  430

Query  1075  FYQNSW  1092
             FY  +W
Sbjct  431   FYHTNW  436



>ref|XP_010501912.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104779243 
[Camelina sativa]
Length=1023

 Score =   244 bits (623),  Expect(2) = 5e-95, Method: Compositional matrix adjust.
 Identities = 122/322 (38%), Positives = 192/322 (60%), Gaps = 30/322 (9%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             V +S+++F   FF T  LP G ND ++ +V                              
Sbjct  261   VGESVMQFVIQFFETWELPPGTNDALLVMV------------------------------  290

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
             LRLK  M  LIGP   SF+ GR   +N++V QE ++S++ K G+ G M++K+DLEKAYD 
Sbjct  291   LRLKGLMCKLIGPGHASFIPGRLSLDNIVVVQEAVHSMKRKKGRKGWMLMKLDLEKAYDS  350

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             + W F+  TLQ AG S  W+R IM CV+   + + ++   ++ F   RG+RQGDPLSP L
Sbjct  351   IRWDFLEDTLQAAGLSEVWVRWIMQCVTGPMMHVLWNGERTEGFKASRGLRQGDPLSPYL  410

Query  1638  FVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCL  1817
             FVL +ERL H I+++    +WK +++ + GP +SH+ F DDL+ F EA + Q  V+++ L
Sbjct  411   FVLCLERLCHHIDKATARKEWKPIRLLQGGPFLSHICFADDLILFVEALVAQIRVIRRVL  470

Query  1818  NEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQD  1997
              +FC  SGQ++S  KS IFFS N + E+   IS+  GI    +LG+YL +P +  R+ ++
Sbjct  471   EKFCCASGQKVSLEKSKIFFSTNVTRELATRISNESGIRSTTELGKYLEMPILQKRMNKE  530

Query  1998  SYADLMSRIQARLTGWKNRTLS  2063
             ++ ++++R+ ++LTGW+  + S
Sbjct  531   TFNEVLARVSSKLTGWRRDSHS  552


 Score =   134 bits (338),  Expect(2) = 5e-95, Method: Compositional matrix adjust.
 Identities = 98/305 (32%), Positives = 141/305 (46%), Gaps = 71/305 (23%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             L F +WI  E LID+GY+G  +TW +G     F   RLDR LC  + +++  +  V HLP
Sbjct  13    LEFGEWINAESLIDMGYTGNNFTWRRGKEQRFFVVKRLDRVLCCAQARLQWMEASVTHLP  72

Query  394   MVNSYHT------LGESRR------FRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLS  537
              + S HT        E++R      FRF AAW  H +++E + S+W+SDV+     +   
Sbjct  73    FLASDHTPVRLQLCPETKRDPRRRLFRFEAAWLIHSSFKELLVSSWRSDVTTPVVLNARR  132

Query  538   KQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEEL  717
               L  WNK   G++ RRK          Q SL                +ELD +L  EE 
Sbjct  133   DALKKWNKEVFGDVNRRK----------QDSL---------------LKELDHVLEHEET  167

Query  718   LWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYM  897
             LWF +S E+WI  GDRNT+F+H +T +R+  + +  LK + G WI+D             
Sbjct  168   LWFQKSLEKWITKGDRNTQFFHISTVIRRRRNCIESLKGDDGRWITDQ------------  215

Query  898   DLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLEAVFEMAQFKAPSSDGFQTSF  1077
                        +++      P+  S+              A+  M QFKAP  DGFQ   
Sbjct  216   -----------QEVEQLAMQPIGGSEVEV-----------ALRSMGQFKAPGPDGFQPIS  253

Query  1078  YQNSW  1092
             YQ +W
Sbjct  254   YQQNW  258



>ref|XP_009140200.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1086

 Score =   316 bits (809),  Expect(3) = 1e-94, Method: Compositional matrix adjust.
 Identities = 166/422 (39%), Positives = 247/422 (59%), Gaps = 1/422 (0%)
 Frame = +3

Query  1110  LIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLK  1289
             +++    FF T  LP   N+T I L+P I +P +V  +R I LCNV YK+++K +T RL+
Sbjct  216   IVREVQGFFETSKLPPSINETFIRLIPKIQSPKVVADYRPIALCNVYYKIISKILTKRLQ  275

Query  1290  SAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAYDRLSW  1466
               +  LI   Q++FV GR I++NVL+  EVL  L+ SK+ K   M +K D+ KAYDRL W
Sbjct  276   PLLPTLISENQSAFVPGRAISDNVLITHEVLYFLQNSKAEKRCSMAVKADMSKAYDRLEW  335

Query  1467  SFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVL  1646
              FIR  L+K GF   WI  I+ CVS+   A   +          RGIRQGDPLSP +F+L
Sbjct  336   EFIRLVLEKLGFHSRWIAWILECVSSVTYAFLINGSPRGKVSPSRGIRQGDPLSPYIFIL  395

Query  1647  YVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEF  1826
               E LS L  ++ + GQ  G+++ R  P ++HL F DD +FF +A+   AS +K  L ++
Sbjct  396   CSEVLSGLCNRAQETGQLTGIRVARGCPQVNHLLFADDTMFFVKANKENASALKAILQQY  455

Query  1827  CSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYA  2006
              S SGQ ++  KS I FS+   + ++  I   L IP    +G+YLG+P   GR K+D + 
Sbjct  456   ESASGQAINTNKSSITFSRKAPLSLKTMIKDCLHIPKEGGVGKYLGLPEHFGRKKRDLFT  515

Query  2007  DLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFL  2186
              ++ RI+ + +GW N+ LS  G+  +++SVL+ +P Y+M    LP+ +  R++     F 
Sbjct  516   SIVDRIKVKSSGWSNKFLSTAGKMVMLKSVLTPVPSYSMTCFKLPRSLCKRIQSAVTRFW  575

Query  2187  WGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIME  2366
             W    GNRK   +SW K+T+SK  G LG +  +  N A  AKLGW++ N   GL  +++ 
Sbjct  576   WDGRSGNRKMAWVSWDKMTKSKQDGGLGFRDFESFNDAYLAKLGWRIHNNPSGLLSRVLT  635

Query  2367  AK  2372
              K
Sbjct  636   GK  637


 Score = 61.6 bits (148),  Expect(3) = 1e-94, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 65/134 (49%), Gaps = 8/134 (6%)
 Frame = +1

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             EE  W  RSR  W+  GDRN+ F+HAAT  RK A+ +  ++D  G  +     I +    
Sbjct  78    EEAYWRQRSRLLWLRLGDRNSGFFHAATKNRKRANALTVIEDGSGNPVFQEGEIAQVIVK  137

Query  889   FYMDLFSEDST--TQLEDLNDAFFPPLHTS----QWLAINAHFTVKDLEAVFEMAQFKAP  1050
             ++  LF+  S   + +ED+ D    P+ +S    + + I     +K   AVF +   KAP
Sbjct  138   YFETLFTTLSGERSAIEDVVDKALKPMVSSSENEKLIRIPTPEEIKT--AVFSIHADKAP  195

Query  1051  SSDGFQTSFYQNSW  1092
               DGF   F+   W
Sbjct  196   GPDGFSAGFFHAHW  209


 Score = 22.3 bits (46),  Expect(3) = 1e-94, Method: Compositional matrix adjust.
 Identities = 10/42 (24%), Positives = 21/42 (50%), Gaps = 0/42 (0%)
 Frame = +2

Query  2387  SAKSGMSNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             + +S  S+ W+G+L    +++  +   + N  S   W D W+
Sbjct  648   AHRSAESHGWRGVLIGRDLMMSNAGWALGNGESINIWSDPWL  689



>ref|XP_010430691.1| PREDICTED: uncharacterized protein LOC104714925 [Camelina sativa]
Length=1239

 Score =   289 bits (739),  Expect(3) = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/440 (35%), Positives = 241/440 (55%), Gaps = 1/440 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             VK  L+   + FF  G    G N T ICL+P +  P  + + R I LCNV YK+++K M 
Sbjct  349   VKGDLVSLVNGFFEEGVFDRGLNTTHICLIPKVAKPTRMTELRPISLCNVGYKIISKIMC  408

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDLEKAYD  1454
              RLK  +  LI   Q++FV GR I++N+L+ QE+ + LR+  S KG  M IK D+ KAYD
Sbjct  409   QRLKKFLPDLISETQSAFVPGRLISDNILIAQEMFHGLRTNPSCKGKFMTIKTDMSKAYD  468

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             R+ W FI   L K GF   WIR IM CVS+    +  + + +   + ERG+RQGDPLSP 
Sbjct  469   RVEWVFIEKLLYKMGFDEKWIRWIMFCVSSVEYKVLLNGQPNGLIIPERGLRQGDPLSPY  528

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LF+L  E L   I ++  +    G+K+  + P I+HL F DD +FF + +  Q  V+ K 
Sbjct  529   LFILCTEVLIANIRKAEVDKLITGIKVANQCPPITHLLFADDSLFFCKVAKDQCEVILKI  588

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L  + ++SGQ++++ KS + F    + + +  I   LGI     +G YLG+P   G  K 
Sbjct  589   LRNYEAVSGQQINFAKSSVQFGHKVAEQTKMEIQGILGITTQGGMGSYLGLPESLGGSKT  648

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
               ++ +  R+Q R TGW  + LS  G+  +++S+ +A+P + M    LP+ + S+L    
Sbjct  649   KVFSFVRERLQGRTTGWSAKLLSKGGKEVMVKSIATAVPTFVMSCFRLPKTITSKLTSAV  708

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
              +F W S       + ++W K+  +K  G LG + +D  N AL AK  W+L+   D L  
Sbjct  709   ANFWWSSDGRTGGMHWLAWDKLCCTKQMGGLGFRNVDDFNSALLAKQLWRLIEFPDSLFA  768

Query  2355  KIMEAKVQLPSLPSQACQMY  2414
             ++ + +    S P +  + Y
Sbjct  769   RVFKGRYYRNSNPMEPIRSY  788


 Score = 87.4 bits (215),  Expect(3) = 2e-94, Method: Compositional matrix adjust.
 Identities = 85/315 (27%), Positives = 131/315 (42%), Gaps = 34/315 (11%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             L F   I   G +D  Y G   +W +G        +RLDRAL N +W    PD  + +LP
Sbjct  44    LAFNGMIQDCGFLDFPYLGDCLSW-RGWRDKKPIRSRLDRALGNEDWHELFPDTVLEYLP  102

Query  394   MVNSYH-----TLGE-----SRRFRFNAAW*THPNYQE*VSSTW-----KSDVSLEANKS  528
             M+ S H      +G       RRF F+  W       E + + W     +   +      
Sbjct  103   MIASDHKPIVVNIGAKRPRGKRRFTFDPRWIGKDGLMEAIEAGWVGGSPQISPNFMDKIV  162

Query  529   NLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrrelde--il  702
             N  + +  W K+ +   F R       I  ++  LSV Q  D   L              
Sbjct  163   NCRRAISQWRKNQVP--FGRD-----TIEDLKSQLSVAQADDATPLSVITDLNARLWEAY  215

Query  703   YQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPF  882
               EE+ W+ +SR +W+  GD+N+R++HA T  R++ + +  L D    W ++   I    
Sbjct  216   KDEEVYWYLKSRNKWMQMGDQNSRYFHALTKQRRARNRITCLFDKNEIWSTEDVDICNIA  275

Query  883   HAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFT--VKDLE---AVFEMAQFKA  1047
              +++ DLF+    T  +++     P +        NA  T  V +LE   A+F M   KA
Sbjct  276   VSYFADLFTTLHPTNFDEVLGEVRPVITAEA----NAQLTAPVTELEVRAALFMMHPDKA  331

Query  1048  PSSDGFQTSFYQNSW  1092
             P  DG    FYQ +W
Sbjct  332   PGPDGMTALFYQKAW  346


 Score = 22.3 bits (46),  Expect(3) = 2e-94, Method: Compositional matrix adjust.
 Identities = 11/36 (31%), Positives = 17/36 (47%), Gaps = 0/36 (0%)
 Frame = +2

Query  2414  WKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQ  2521
             W+ I+ +  ++ KG    V +  S   W D WI  Q
Sbjct  794   WRSIVSACSLVQKGLIIRVGSGESISIWTDPWILAQ  829



>ref|XP_010412448.1| PREDICTED: uncharacterized protein LOC104698743 [Camelina sativa]
Length=1329

 Score =   296 bits (758),  Expect(2) = 3e-94, Method: Compositional matrix adjust.
 Identities = 161/440 (37%), Positives = 241/440 (55%), Gaps = 1/440 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             VK  L+   + FF  G    G N T ICL+P +  P  + + R I LCNV YK+++K M 
Sbjct  430   VKGDLVSLVNGFFEEGVFDRGLNTTHICLIPKVAKPTRMTELRPISLCNVGYKIISKIMC  489

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDLEKAYD  1454
              RLK  +  LI   Q++FV GR I++N+L+ QE+ + LR+  S KG  M IK D+ KAYD
Sbjct  490   QRLKKLLPDLISETQSAFVPGRLISDNILIAQEMFHGLRTNPSCKGKFMAIKTDMSKAYD  549

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             R+ W FI   L K GF   WIR IM CVS+    +  + + +   + ERG+RQGDPLSP 
Sbjct  550   RVEWEFIDKLLHKMGFDEKWIRWIMFCVSSVEYKVLLNGQPNGLIIPERGLRQGDPLSPY  609

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LF+L  E L   I ++       G+K+  K P I+HL F DD +FF + +  Q   + + 
Sbjct  610   LFILCTEVLIANIRKAEAEKLITGIKVANKCPPITHLLFADDSLFFCKVAKDQCEAILRI  669

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L  + + SGQ++++ KS I F    + + +  I   LGI     +G YLG+P   G  K 
Sbjct  670   LRNYEAASGQQINFAKSSIQFGHTVAEQTKLEIQGVLGITAQGGMGSYLGLPESLGGSKT  729

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
               ++ +  R+Q R TGW  R LS  G+  +I+S+ +A+P + M    LP+ + S+L    
Sbjct  730   KVFSFVRERLQGRTTGWSARLLSKGGKEVMIKSIATAVPTFVMSCFRLPKTITSKLSSAV  789

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
              +F W S       + ++W+K+  SK QG LG + +D  N AL AK  W+L+   D L  
Sbjct  790   ANFWWSSDGRTGGMHWLAWEKLCCSKQQGGLGFRNVDDFNSALLAKQLWRLIEYPDSLFA  849

Query  2355  KIMEAKVQLPSLPSQACQMY  2414
             +I++ +    S P +  + Y
Sbjct  850   RILKGRYYRNSDPMEPIRSY  869


 Score = 80.5 bits (197),  Expect(2) = 3e-94, Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 129/311 (41%), Gaps = 26/311 (8%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             L F   I   G ++  + G   +W +G         RLDRAL N +W    PD  + +LP
Sbjct  125   LPFNGMIQDCGFLEFPFLGDCLSW-RGWRDKKPIRCRLDRALGNEDWHDLFPDTVLEYLP  183

Query  394   MVNSYH-----TLGESR-----RFRFNAAW*THPNYQE*VSSTW-----KSDVSLEANKS  528
             M+ S H      +G  R     RF F+  W       E + + W     +S  +      
Sbjct  184   MIASDHKPVVVNIGAKRPRGKRRFMFDPRWIGKEGLMEAIEAGWVGGTPQSSPNFLDKIV  243

Query  529   NLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrrelde--il  702
                + +  W K  +   F R+      I  ++  LSV Q  D   L              
Sbjct  244   ICRRAISRWRKDHVP--FGRE-----TIEDLKCQLSVAQADDATPLSVIADLNARLWEAY  296

Query  703   YQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPF  882
               EE+ W+ +SR +W+  GD+N++++HA T  R++ + +  L D    W ++ + I    
Sbjct  297   KDEEVYWYLKSRNKWMQMGDQNSKYFHALTKQRRARNRIIGLYDKNEIWSTEDEDICNIA  356

Query  883   HAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSD  1059
              +++ DLF+    T  +++     P +       + A  T  ++  A+F M   KAP  D
Sbjct  357   VSYFADLFTTLHPTNFDEVLREVHPVITAEANAQLTARVTESEVRAALFMMHPDKAPGPD  416

Query  1060  GFQTSFYQNSW  1092
             G    FYQ +W
Sbjct  417   GMTALFYQKAW  427



>ref|XP_008382376.1| PREDICTED: uncharacterized protein LOC103445169 [Malus domestica]
Length=1330

 Score =   288 bits (737),  Expect(3) = 3e-94, Method: Compositional matrix adjust.
 Identities = 154/408 (38%), Positives = 233/408 (57%), Gaps = 1/408 (0%)
 Frame = +3

Query  1152  PNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSF  1331
             P   N T I L+P + NP +V+Q R I LCN SYK+L+K +  RLK  +  +I P Q +F
Sbjct  434   PRKLNSTHIVLIPKVQNPEMVSQXRXISLCNYSYKILSKVLANRLKPILTEIISPMQNAF  493

Query  1332  VLGRQITNNVLVYQEVLNSLRSKSGKGGLMV-IKIDLEKAYDRLSWSFIRSTLQKAGFSP  1508
             V GRQI +N+ +  EV + L+    K    V IK+D++KAYDR+ W F+ + ++  GF  
Sbjct  494   VAGRQIQDNIGIAHEVFHFLKIXKAKRRFEVGIKLDMQKAYDRVEWDFLDAVMEXMGFGS  553

Query  1509  DWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVK  1688
              W + IM CVS+   A+  + +  + F   RG+RQGDPLSP LF+L  E LS +I+ +V 
Sbjct  554   SWRKLIMGCVSSVNFAVLLNGQPGEKFAPSRGLRQGDPLSPYLFLLVGEVLSKMIQGAVX  613

Query  1689  NGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*  1868
               Q  G+K+   GP ISH+FF DD + F +A     + +   L ++C+ SGQ ++  KS 
Sbjct  614   XRQLDGVKLNGAGPVISHIFFADDTLIFLKADRKNCNNLVVLLQDYCNASGQAINMQKSS  673

Query  1869  IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWK  2048
             +FF  N    + + + + LG+ +V++ G YLGVP+I G+LK+   A +  RI  +L GWK
Sbjct  674   VFFGNNVQSFLSEELGNILGMTVVDNPGSYLGVPTIWGQLKKLGLAYVKGRILGKLQGWK  733

Query  2049  NRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLIS  2228
                LS  G+  LI++V+ AIP Y M     P  +   L+ L   F W  S   RK + +S
Sbjct  734   QXMLSRAGKEVLIKAVVQAIPAYPMNIFKFPATLCKELDALIAKFWWDDSGVRRKIHWVS  793

Query  2229  WKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
              + +   K  G +G +     N AL AK  W+L+ + D L  ++M+A+
Sbjct  794   METLGLPKHLGGMGFRNFQEFNDALLAKQCWRLIAEPDSLWAQVMKAR  841


 Score = 88.2 bits (217),  Expect(3) = 3e-94, Method: Compositional matrix adjust.
 Identities = 77/300 (26%), Positives = 131/300 (44%), Gaps = 31/300 (10%)
 Frame = +1

Query  247   LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYH-----  411
             L+DL ++GPA+TW +G+ + +    RLD+ LCN  W+   P+  V H   + S H     
Sbjct  121   LLDLDFNGPAFTW-RGMRNGSLVEERLDKGLCNRIWQDVWPNTTVTHGTXLGSDHCPIII  179

Query  412   -TLGESRR----FRFNAAW*THPNYQE*VSSTW------KSDVSLEANKSNLSKQLDDWN  558
              T  ++RR    FRF A W    + +E V  +W       + V      ++   QL  W+
Sbjct  180   QTEPDARRGRKLFRFEAXWAKEVDCKEVVRKSWDCREEGGAQVRWLKKINDCRSQLIRWS  239

Query  559   KHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSR  738
             ++       +   +L ++  +Q++   ++   L K              QEE  W  RSR
Sbjct  240   RNKFKMRSYQIDYLLEQLGELQKNWGPHRXEILEKSRLIDTLWA-----QEESFWHQRSR  294

Query  739   EEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDS  918
              +W+  GD NT+F+H  T   +  + V +++++ G+W+ + + +       ++  F  + 
Sbjct  295   VKWLKEGDANTKFFHQTTLQXRRRNKVLKIRNSTGDWVDNPNQVRXLVDEHFLTSFRSEG  354

Query  919   TTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-----AVFEMAQFKAPSSDGFQTSFYQ  1083
                     D    P+ T +   +NA      LE     A   M   KAP  DGFQ  FY 
Sbjct  355   DRNWGTTLDC-LTPMVTGE---MNAALMXPVLEEEIKXAALNMGGLKAPGPDGFQGVFYH  410


 Score = 21.6 bits (44),  Expect(3) = 3e-94, Method: Compositional matrix adjust.
 Identities = 10/43 (23%), Positives = 21/43 (49%), Gaps = 1/43 (2%)
 Frame = +2

Query  2387  SAKSGMSN-VWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             ++K G ++  W  +L    ++LKG+   +        W+D W+
Sbjct  851   ASKGGRASWAWSSLLVGRDLILKGAHWQIMGGEEVRLWVDRWL  893


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 77/190 (41%), Gaps = 2/190 (1%)
 Frame = +2

Query  2774  STYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDH  2953
             S    +W  I  +KVP ++R FLW + H+   T     +R  +      IC    E I H
Sbjct  993   SVPELLWKGIWRIKVPAKVRNFLWSSLHNALATVAVLFQRRSSLTPIXPICLCQEESIVH  1052

Query  2954  IMQRCPIANSVWE-SLIPYDHRRL*DQDYTNWF-DEGISELSSGNRKHEQRVTFAVTMWW  3127
             +   CP   S+W    + Y+        +  W  D   S L S   K   R   A T W 
Sbjct  1053  LFLSCPWVISIWSGGALKYNILVGSLSSWGAWLHDVFTSNLGSSASKEWVRTYVAFTCWH  1112

Query  3128  LWKWRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQV  3307
             +WK R D VF+  +I  +  +  I   V E  I+ S  +   A       +  +W  P  
Sbjct  1113  IWKSRCDYVFNQVHIIPSKILMGIDLXVAEFLIARSTPEISRAVDHGRVRQPCRWTPPVS  1172

Query  3308  GWVKANIDGS  3337
              +VK N+D S
Sbjct  1173  PFVKLNVDAS  1182



>gb|ABA98491.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1621

 Score =   286 bits (732),  Expect(2) = 3e-94, Method: Compositional matrix adjust.
 Identities = 151/411 (37%), Positives = 238/411 (58%), Gaps = 1/411 (0%)
 Frame = +3

Query  1143  GHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQ  1322
             G +P G ND  I L+P +  P L+   R I LCNV YK+++K +  RLK  +  +I P Q
Sbjct  734   GAIPEGWNDITIVLIPKVKKPELIKDLRPISLCNVCYKLVSKVLANRLKKILPDVISPAQ  793

Query  1323  TSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAG  1499
             ++FV GR I++N+L+  E+ + +R+K SG+ G    K+D+ KAYDR+ WSF+   + K G
Sbjct  794   SAFVPGRLISDNILIADEMTHYMRNKRSGQVGYAAFKLDMSKAYDRVEWSFLHDMILKLG  853

Query  1500  FSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQ  1679
             F  DW+  IM CVST    I  +  LS+ F   RG+RQGDPLSP LF+L  E  S L+ +
Sbjct  854   FHTDWVNLIMKCVSTVTYRIRVNGELSESFSPGRGLRQGDPLSPYLFLLCAEGFSALLSK  913

Query  1680  SVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYM  1859
             + + G+  G++I +  P +SHL F DD +    A+  +A  ++  L  +   SGQ ++  
Sbjct  914   TEEEGRLHGIRICQGAPSVSHLLFADDSLILCRANGGEAQQLQTILQIYEECSGQVINKD  973

Query  1860  KS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLT  2039
             KS + FS NTS   ++A+ ++L +       RYLG+P   GR +   ++ L  RI  R+ 
Sbjct  974   KSAVMFSPNTSSLEKRAVMAALNMQRETTNERYLGLPVFVGRSRTKIFSYLKERIWQRIQ  1033

Query  2040  GWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCN  2219
             GWK + LS  G+  LI++V  AIP + M    L + +  ++ ++   + W + + + K +
Sbjct  1034  GWKEKLLSRAGKEILIKAVAQAIPTFAMGCFELTKDLCDQISKMIAKYWWSNQEKDNKMH  1093

Query  2220  LISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
              +SW K+T  K+ G LG + +   N A+ AK GW+L+   D LC +++ AK
Sbjct  1094  WLSWNKLTLPKNMGGLGFRDIYIFNLAMLAKQGWRLIQDPDSLCSRVLRAK  1144


 Score = 90.1 bits (222),  Expect(2) = 3e-94, Method: Compositional matrix adjust.
 Identities = 77/318 (24%), Positives = 132/318 (42%), Gaps = 51/318 (16%)
 Frame = +1

Query  244   GLIDLGYSGPAYTWM-QGLSSPNFKGARLDRALCNIEWKIRSPDVEVL--------HLPM  396
             GL DLG+ G A+TW     S   +   RLDRA+ N EW+   P   V+        H P+
Sbjct  415   GLDDLGFEGDAFTWRNHSHSQEGYIRERLDRAVANPEWRAMFPAARVINGDPRHSDHRPV  474

Query  397   VNSYHTLGESRR-------FRFNAAW*THPNYQE*VSSTWKSDVSLE-----ANKSNLSK  540
             +       +  R       FRF AAW     ++E V   W     L+     A+ + ++ 
Sbjct  475   IIELEGKNKGVRGRNGHNDFRFEAAWLEEEKFKEVVKEAWDVSAGLQGLPVHASLAGVAA  534

Query  541   QLDDWNKHTIGN-------------IFRRK*RVLARISGVQRSLSVYQkldlikldrklr  681
              L  W+ + +G+               RR+   ++R   V+  +  Y+   L +      
Sbjct  535   GLSSWSSNVLGDLEKRVKKVKKELETCRRQ--PISRDQVVREEVLRYRLEKLEQ------  586

Query  682   reldeilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDG  861
                     Q ++ W  R+   W+  GDRNT F+HA+ + R+  + + +L+   G W+   
Sbjct  587   --------QVDIYWKQRAHTNWLNKGDRNTSFFHASCSERRRRNRINKLRREDGSWVERE  638

Query  862   DGILEPFHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQ  1038
             +        F+  LF+ +     + L D     +  +   ++ A FT +++ EA+  +  
Sbjct  639   EDKRAMIIEFFKQLFTSNGGQNSQKLLDVVDRKVSGAMNESLRAEFTREEVKEALDAIGD  698

Query  1039  FKAPSSDGFQTSFYQNSW  1092
              KAP  DG    FY+  W
Sbjct  699   LKAPGPDGMPAGFYKACW  716


 Score = 60.5 bits (145),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/202 (28%), Positives = 86/202 (43%), Gaps = 15/202 (7%)
 Frame = +2

Query  2792  WNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCP  2971
             W  +  L VP +I+ FLW   H+          RG   +  C +C    ED  H+  +C 
Sbjct  1302  WKKLWKLGVPGKIKHFLWRMCHNTLALRANLHHRGMDVDTRCVMCGRYNEDAGHLFFKCK  1361

Query  2972  IANSVWESLIPYDHRRL*DQDYTNWFDEGISELSSGN-RKHEQRVTFAVTMWWLWKWRND  3148
                 VW++L   + R + +Q  +     G + L S   R   +R +  V +W  WK RN+
Sbjct  1362  PVKKVWQALNLEELRSMLEQQTS-----GKNVLQSIYCRPENERTSAIVCLWQWWKERNE  1416

Query  3149  LVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGWVKANI  3328
             +   G   + A     I  Q  E      K K   +P    C     W RP + +VK N 
Sbjct  1417  VREGGIPRSPAELSHLIMSQAGEFVRMNVKEK---SPRTGEC---AVWRRPPLNFVKINT  1470

Query  3329  DGSSIPSNSIARCG-GFIRDDQ  3391
             DG+   S+++ + G GF+  DQ
Sbjct  1471  DGAY--SSNMKQGGWGFVIKDQ  1490



>ref|XP_010506884.1| PREDICTED: uncharacterized protein LOC104783422 [Camelina sativa]
Length=1248

 Score =   296 bits (757),  Expect(2) = 4e-94, Method: Compositional matrix adjust.
 Identities = 161/440 (37%), Positives = 241/440 (55%), Gaps = 1/440 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             VK  L+   + FF  G    G N T ICL+P +  P  + + R I LCNV YK+++K M 
Sbjct  349   VKGDLVSLVNGFFEEGVFDRGLNTTHICLIPKVAKPTRMTELRPISLCNVGYKIISKIMC  408

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDLEKAYD  1454
              RLK  +  LI   Q++FV GR I++N+L+ QE+ + LR+  S KG  M IK D+ KAYD
Sbjct  409   QRLKKLLPDLISETQSAFVPGRLISDNILIAQEMFHGLRTNPSCKGKFMAIKTDMSKAYD  468

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             R+ W FI   L K GF   WIR IM CVS+    +  + + +   + ERG+RQGDPLSP 
Sbjct  469   RVEWEFIDKLLHKMGFDEKWIRWIMFCVSSVEYKVLLNGQPNGLIIPERGLRQGDPLSPY  528

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LF+L  E L   I ++       G+K+  K P I+HL F DD +FF + +  Q   + + 
Sbjct  529   LFILCTEVLIANIRKAEAEKLITGIKVANKCPPITHLLFADDSLFFCKVAKDQCEAILRI  588

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L  + + SGQ++++ KS I F    + + +  I   LGI     +G YLG+P   G  K 
Sbjct  589   LRNYEAASGQQINFAKSSIQFGHTVAEQTKLEIQGVLGITAQGGMGSYLGLPESLGGSKT  648

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
               ++ +  R+Q R TGW  R LS  G+  +I+S+ +A+P + M    LP+ + S+L    
Sbjct  649   KVFSFVRERLQGRTTGWSARLLSKGGKEVMIKSIATAVPTFVMSCFRLPKTITSKLSSAV  708

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
              +F W S       + ++W+K+  SK QG LG + +D  N AL AK  W+L+   D L  
Sbjct  709   ANFWWSSDGRTGGMHWLAWEKLCCSKQQGGLGFRNVDDFNSALLAKQLWRLIEYPDSLFA  768

Query  2355  KIMEAKVQLPSLPSQACQMY  2414
             +I++ +    S P +  + Y
Sbjct  769   RILKGRYYRNSDPMEPIRSY  788


 Score = 80.5 bits (197),  Expect(2) = 4e-94, Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 129/311 (41%), Gaps = 26/311 (8%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             L F   I   G ++  + G   +W +G         RLDRAL N +W    PD  + +LP
Sbjct  44    LPFNGMIQDCGFLEFPFLGDCLSW-RGWRDKKPIRCRLDRALGNEDWHDLFPDTVLEYLP  102

Query  394   MVNSYH-----TLGESR-----RFRFNAAW*THPNYQE*VSSTW-----KSDVSLEANKS  528
             M+ S H      +G  R     RF F+  W       E + + W     +S  +      
Sbjct  103   MIASDHKPVVVNIGAKRPRGKRRFMFDPRWIGKEGLMEAIEAGWVGGTPQSSPNFLDKIV  162

Query  529   NLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrrelde--il  702
                + +  W K  +   F R+      I  ++  LSV Q  D   L              
Sbjct  163   ICRRAISRWRKDHVP--FGRE-----TIEDLKCQLSVAQADDATPLSVIADLNARLWEAY  215

Query  703   YQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPF  882
               EE+ W+ +SR +W+  GD+N++++HA T  R++ + +  L D    W ++ + I    
Sbjct  216   KDEEVYWYLKSRNKWMQMGDQNSKYFHALTKQRRARNRIIGLYDKNEIWSTEDEDICNIA  275

Query  883   HAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSD  1059
              +++ DLF+    T  +++     P +       + A  T  ++  A+F M   KAP  D
Sbjct  276   VSYFADLFTTLHPTNFDEVLREVHPVITAEANAQLTARVTESEVRAALFMMHPDKAPGPD  335

Query  1060  GFQTSFYQNSW  1092
             G    FYQ +W
Sbjct  336   GMTALFYQKAW  346



>ref|XP_010451822.1| PREDICTED: uncharacterized protein LOC104734004 [Camelina sativa]
Length=1120

 Score =   296 bits (757),  Expect(2) = 6e-94, Method: Compositional matrix adjust.
 Identities = 161/440 (37%), Positives = 241/440 (55%), Gaps = 1/440 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             VK  L+   + FF  G    G N T ICL+P +  P  + + R I LCNV YK+++K M 
Sbjct  349   VKGDLVSLVNGFFEEGVFDRGLNTTHICLIPKVAKPTRMTELRPISLCNVGYKIISKIMC  408

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDLEKAYD  1454
              RLK  +  LI   Q++FV GR I++N+L+ QE+ + LR+  S KG  M IK D+ KAYD
Sbjct  409   QRLKKLLPDLISETQSAFVPGRLISDNILIAQEMFHGLRTNPSCKGKFMAIKTDMSKAYD  468

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             R+ W FI   L K GF   WIR IM CVS+    +  + + +   + ERG+RQGDPLSP 
Sbjct  469   RVEWEFIDKLLHKMGFDEKWIRWIMFCVSSVEYKVLLNGQPNGLIIPERGLRQGDPLSPY  528

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LF+L  E L   I ++       G+K+  K P I+HL F DD +FF + +  Q   + + 
Sbjct  529   LFILCTEVLIANIRKAEAEKLITGIKVANKCPPITHLLFADDSLFFCKVAKDQCEAILRI  588

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L  + + SGQ++++ KS I F    + + +  I   LGI     +G YLG+P   G  K 
Sbjct  589   LRNYEAASGQQINFAKSSIQFGHTVAEQTKLEIQGVLGITAQGGMGSYLGLPESLGGSKT  648

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
               ++ +  R+Q R TGW  R LS  G+  +I+S+ +A+P + M    LP+ + S+L    
Sbjct  649   KVFSFVRERLQGRTTGWSARLLSKGGKEVMIKSIATAVPTFVMSCFRLPKTITSKLSSAV  708

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
              +F W S       + ++W+K+  SK QG LG + +D  N AL AK  W+L+   D L  
Sbjct  709   ANFWWSSDGRTGGMHWLAWEKLCCSKQQGGLGFRNVDDFNSALLAKQLWRLIEYPDSLFA  768

Query  2355  KIMEAKVQLPSLPSQACQMY  2414
             +I++ +    S P +  + Y
Sbjct  769   RILKGRYYRNSDPMEPIRSY  788


 Score = 79.7 bits (195),  Expect(2) = 6e-94, Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 133/311 (43%), Gaps = 26/311 (8%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             L F   I   G ++  + G   +W +G         RLDRAL N +W    PD  + +LP
Sbjct  44    LPFNGMIQDCGFLEFPFLGDCLSW-RGWRDKKPIRCRLDRALGNEDWHDLFPDTVLEYLP  102

Query  394   MVNSYH-----TLGESR-----RFRFNAAW*THPNYQE*VSSTWKSDVSLEA----NKSN  531
             M+ S H      +G  R     RF F+  W       E + + W       +    +K  
Sbjct  103   MIASDHKPVVVNIGAKRPRGKRRFMFDPRWIGKEGLMEAIEAGWVGGTPQSSPNFLDKIV  162

Query  532   LSKQ-LDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrrelde-ilY  705
             + ++ +  W K  +   F R+      I  ++  LSV Q  D   L             Y
Sbjct  163   ICRRAISRWRKDHVP--FGRE-----TIEDLKCQLSVAQADDATPLSVIADLNARLWEAY  215

Query  706   Q-EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPF  882
             + EE+ W+ +SR +W+  GD+N++++HA T  R++ + +  L D    W ++ + I    
Sbjct  216   KDEEVYWYLKSRNKWMQMGDQNSKYFHALTKQRRARNRIIGLYDKNEIWSTEDEDICNIA  275

Query  883   HAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSD  1059
              +++ DLF+    T  +++     P +       + A  T  ++  A+F M   KAP  D
Sbjct  276   VSYFADLFTTLHPTNFDEVLREVHPVITAEANAQLTARVTESEVRAALFMMHPDKAPGPD  335

Query  1060  GFQTSFYQNSW  1092
             G    FYQ +W
Sbjct  336   GMTALFYQKAW  346



>ref|XP_010670096.1| PREDICTED: uncharacterized protein LOC104887198 [Beta vulgaris 
subsp. vulgaris]
Length=1298

 Score =   282 bits (721),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 149/431 (35%), Positives = 245/431 (57%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             KF   V   +I F  +++         N T + L+P   NP  + +FR I  CNV YK++
Sbjct  424   KFWHIVGKDIILFVKNWWRALVGLEEVNKTCVVLIPKCANPKRMTEFRPISCCNVLYKII  483

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDL  1439
             +K M  +LK  +  LI   Q++FV  R IT+N L+  E+ ++++ K  G+ G   +K+D+
Sbjct  484   SKTMANKLKPLLGDLISENQSAFVPKRLITDNALIALEIFHAMKRKGEGRDGSFALKLDM  543

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
             +KAYDR+ WSF+   L K GFS  W+  IM C+++       + ++S   +  RG+RQGD
Sbjct  544   KKAYDRVEWSFLEKVLYKLGFSGAWVTKIMYCLASVSFTFKINRKVSGSVIPSRGLRQGD  603

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             P+SP LF++  +  S L+ ++ +  +  G KI    P ISHLFF DD + F +A++ Q S
Sbjct  604   PISPYLFLIVADAFSALLTKAAQEKRIHGAKICNGAPRISHLFFADDSILFAKATVRQCS  663

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             V+ + ++++   SGQ ++  K+ + FSK      +Q I ++LG+  V    +YLG+P+I 
Sbjct  664   VITEIISQYERASGQSVNLDKTDVVFSKCVDANRRQEIVATLGVKEVVQHAKYLGLPTII  723

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+  +A L  RI  ++ GWK ++LS  G+  L+++V+ AI  Y M    +P+G+++ 
Sbjct  724   GRSKKVIFASLKERIWKKIQGWKEKSLSRPGKEVLLKAVVQAILTYMMSVFKIPEGLINE  783

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             +  L   F WGS+   RK +  SW ++ + K  G +G   L   NQAL AK  W+L    
Sbjct  784   IHTLMARFWWGSTDTQRKMHWSSWAELCKPKAMGGMGFCNLHVFNQALLAKKIWRLHTNP  843

Query  2340  DGLCVKIMEAK  2372
               L  K+++A+
Sbjct  844   TSLLHKLLKAR  854


 Score = 91.3 bits (225),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 81/301 (27%), Positives = 138/301 (46%), Gaps = 26/301 (9%)
 Frame = +1

Query  247   LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHL--------PMVN  402
             L DLGY G  +TW +G +       RLDR L + +W    P V V H+        P++ 
Sbjct  133   LCDLGYKGCQFTWKRGNNPSTLVRERLDRFLADGQWCDMFPKVTVCHMAQYRSDHAPILL  192

Query  403   SY---HTLGESRR-FRFNAAW*THPNYQE*VSSTWKSDV--SLEANKSNLSKQLDDWNKH  564
             S    H  G +++ FRF A W + P     V   W +    ++     N +++L  W   
Sbjct  193   STWSPHDRGRNKKLFRFEALWLSKPECANVVEQAWTNCTGENVVERVGNCAERLSQWAAV  252

Query  565   TIGNIFRRK*RVLARISGVQRSLSV----YQkldlikldrklrreldeilYQEELLWF*R  732
             + GNI ++       I   +  L +    Y    +++L  +L +ELDE+  QEE  WF R
Sbjct  253   SFGNIKKK-------IKDTEEKLRLNQTRYPDAAMLQLCSELSKELDELHQQEESYWFAR  305

Query  733   SREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSE  912
             +R   +  GD+NT ++H   + R+  +++  L D    W    + + E   +++ +LFS 
Sbjct  306   ARANDLRDGDKNTTYFHRKASQRRHYNSIDGLFDENNRWRDKEEDLEELVSSYFDNLFST  365

Query  913   DSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSFYQNS  1089
             +  T +E   +     +       +N   T ++++ A+F+M   KAP  DG    F+Q  
Sbjct  366   EGPTNIEQALEGLETRITEDMNKMLNTEPTDEEIKGALFQMHPNKAPGPDGMHALFFQKF  425

Query  1090  W  1092
             W
Sbjct  426   W  426



>ref|XP_008351830.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1106

 Score =   295 bits (756),  Expect(3) = 3e-93, Method: Compositional matrix adjust.
 Identities = 161/430 (37%), Positives = 247/430 (57%), Gaps = 3/430 (1%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             TV + ++K    F+ +G L    N T + L+P +  P  + QFR I LCNV YK+L K +
Sbjct  185   TVGEDVVKIIKAFWHSGTLLRQLNHTNLVLIPKVRCPKNMAQFRPIALCNVIYKILAKVL  244

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL--RSKSGKGGLMVIKIDLEKA  1448
             T RLK  M  +IG  Q++FV G+QI +N+LV  EVL+SL  + +  + G M IK+D+ KA
Sbjct  245   TNRLKLVMPKVIGDNQSAFVAGKQIQDNILVVHEVLHSLLHQRREDQAG-MAIKLDMAKA  303

Query  1449  YDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLS  1628
             YDR+ W+F+ + + K GFSP + + I +C+ST   +I  +   + + + +RG+RQGDPLS
Sbjct  304   YDRVEWNFLIAIMSKLGFSPIFCKWIKACISTVSFSIVVNGTPTGFIVPQRGLRQGDPLS  363

Query  1629  PLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVK  1808
             P LF+L  E LS L+ + ++     G K T  G  I+HLFF DD V FG A++ +A  V 
Sbjct  364   PFLFLLCTEGLSVLLRKGLEQDALHGFKFTDTGTPITHLFFADDSVVFGNATVDEARAVA  423

Query  1809  KCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRL  1988
             + L  +   SGQ ++  KS +FFS  T    ++ I  +LGI      G+YLG+ +  G  
Sbjct  424   EALKVYACGSGQEVNLTKSSVFFSPKTPNRTKRDIEGTLGIQCKQGFGKYLGLQADFGHS  483

Query  1989  KQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLER  2168
             K+  +A++  +++ARL GW  + LS  G+  LI+SV  A+P Y M    LP GV   +E+
Sbjct  484   KKAVFAEVRDKVEARLAGWTEQFLSQAGKEVLIKSVAMALPNYAMSCFKLPIGVCRDIEK  543

Query  2169  LSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGL  2348
               R F W  +      + +SW ++++ K  G LG + +   N AL AK+GW+L      L
Sbjct  544   AIRKFWWKGNDQRHGIHWVSWDRISKRKMSGGLGFKDIQCFNLALLAKIGWRLTCYPTSL  603

Query  2349  CVKIMEAKVQ  2378
                +++ K  
Sbjct  604   LATVLKDKYH  613


 Score = 75.1 bits (183),  Expect(3) = 3e-93, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 69/132 (52%), Gaps = 7/132 (5%)
 Frame = +1

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             EEL W  +SR +W+  GD+NT+F+HA T  R+S + +R + D+ G W  +   I +    
Sbjct  55    EELYWKTKSRNQWLNEGDKNTKFFHAQTLKRRSRNQIRGIVDSQGVWQEEDKKIADTAVG  114

Query  889   FYMDLFSEDSTTQLEDL---NDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSS  1056
             ++ +LF      Q+ED+    DA   P   +   A+    T  ++  AV ++   +AP  
Sbjct  115   YFSELFQSSRPGQIEDIVRNVDARISPEDNN---ALTGPVTTAEIVLAVSQIPPSRAPGP  171

Query  1057  DGFQTSFYQNSW  1092
             DGF   FYQ+ W
Sbjct  172   DGFSGCFYQDHW  183


 Score = 23.9 bits (50),  Expect(3) = 3e-93, Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 31/75 (41%), Gaps = 15/75 (20%)
 Frame = +2

Query  2414  WKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQATLLSRIRYDPFDRVIR*SL*VLG  2593
             WKGI ++  +LL+G +  V N +      D W  K +T     R  P++ +         
Sbjct  631   WKGIYEARKVLLQGIRWRVGNGQRINIRDDPWFPKPSTF----RVCPYENL---------  677

Query  2594  PRIGVAVGETFEPAS  2638
                   V E  EPAS
Sbjct  678   --DATMVCELIEPAS  690


 Score = 64.7 bits (156),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 53/224 (24%), Positives = 94/224 (42%), Gaps = 11/224 (5%)
 Frame = +2

Query  2774  STYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDH  2953
             +  ++VW+ I  L+VP +I+ F+W   ++         +R    +  CG+C  + E  +H
Sbjct  764   TQLKKVWSRIWRLQVPNKIKFFIWRCCNNALAVRRNIQKRHMRVDNVCGVCNAVDETENH  823

Query  2954  IMQRCPIANSVW-ESLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWL  3130
             +  RC  ++  W  S +  +   L   D+ + + +  + +       E    FA  +W +
Sbjct  824   LFFRCRFSHIFWFSSPLHLNSHVLEGYDFLDSWGKFQAGMKGKENAEEICQEFAFGLWRI  883

Query  3131  WKWRNDLVFSGT--NINLAARIKW---IRDQVEEINISFSKAKGLIAPIESICWRQLKWI  3295
             WK RND VF G     N    + W   I  +     +  +    ++ P+ +     L W 
Sbjct  884   WKNRNDAVFKGLYRQPNEVMDLWWKNIIEFREASTCLGDTARSTVVTPLSATARPSLHWQ  943

Query  3296  RPQVGWVKANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNIG  3427
             RP+ G +K N D +   +   A  G   RD     L G +H  G
Sbjct  944   RPRYGTIKINTDAAWCKATLRAGVGWVGRD-----LAGVLHAAG  982



>ref|XP_008387639.1| PREDICTED: uncharacterized protein LOC103450094 [Malus domestica]
Length=1306

 Score =   306 bits (785),  Expect(2) = 5e-93, Method: Compositional matrix adjust.
 Identities = 151/404 (37%), Positives = 236/404 (58%), Gaps = 1/404 (0%)
 Frame = +3

Query  1164  NDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGR  1343
             N T + L+P +P P LV+Q+R I LCN S+K+L+K +  RL+  + +LI P Q  F+  R
Sbjct  459   NSTYLVLIPKVPTPELVSQYRPISLCNFSFKILSKVLANRLQPLLPLLISPMQNXFIADR  518

Query  1344  QITNNVLVYQEVLNSLRSKSGKGGL-MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIR  1520
             QI  N+ +  E+ + L+ +  K    M +K+D++KAYDR+ W F+ + L K GFS DW  
Sbjct  519   QIQENLGLAHELFHFLKLRKTKQKFEMCVKLDMQKAYDRVEWDFLEAVLLKLGFSRDWTN  578

Query  1521  NIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQW  1700
              +M+CV T + AI  +    KWF    GIRQGDPLSP LF++  + LS +I++ V + + 
Sbjct  579   LVMNCVRTVKFAILLNGXPGKWFSPSXGIRQGDPLSPYLFLMVSDVLSRMIQRGVDDXRL  638

Query  1701  KGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFS  1880
              G+ +  +GPCISHLFF DD +   +A+      +   LN++C  SGQ ++  K  ++F 
Sbjct  639   NGIHMNPRGPCISHLFFXDDTLICLQATQRNGENIMHILNQYCLASGQMMNXQKXSVYFG  698

Query  1881  KNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTL  2060
             +NT  +++  + S LG+P V+D G YLG+P+I GR K+ S A +   +  ++ GWK   L
Sbjct  699   RNTPAQVRSQLGSLLGMPSVSDPGVYLGLPAIXGRSKRSSLAFVKXXVXGKIQGWKQSAL  758

Query  2061  SFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKV  2240
             SF G+  L+++V+ AIP Y M     P  V   L+ +S  FLWG   G+R  + ++W  +
Sbjct  759   SFAGKEVLLKAVVQAIPTYXMNLFKFPVAVCKDLDSMSAGFLWGDCGGHRXIHWVNWDTL  818

Query  2241  TESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
                K +G LG +     N AL  K  W L+   + L  + ++A+
Sbjct  819   GRPKYEGGLGFRNFQDFNDALLVKQCWXLILNPNSLWAQTLKAR  862


 Score = 66.2 bits (160),  Expect(2) = 5e-93, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 62/130 (48%), Gaps = 5/130 (4%)
 Frame = +1

Query  706   QEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFH  885
             QEEL W  R R  W+  GD NT F+H  T  R+  +++ RLKD  G+ + DG  +     
Sbjct  305   QEELYWLXRFRVNWLRDGDANTAFFHRTTLQRRRVNSIVRLKDVDGQXVDDGRRVFTLVD  364

Query  886   AFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE---AVFEMAQFKAPSS  1056
               +  L++   +    ++ +   P    S+ +  +    V + E   AV +M   KAP  
Sbjct  365   DHFQSLYTSXGSRDWGNILNCLEP--MVSELMNADLIKPVSEEEIKAAVHQMGGLKAPGP  422

Query  1057  DGFQTSFYQN  1086
             DGFQ  FY +
Sbjct  423   DGFQGIFYHS  432


 Score = 58.2 bits (139),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 85/217 (39%), Gaps = 13/217 (6%)
 Frame = +2

Query  2792  WNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCP  2971
             W  I   K P +IR FLW A  +   T     +R   S   C IC+   E +  ++ RCP
Sbjct  1020  WKAIWHAKAPPKIRHFLWRAVSEALATVGGLFKRRSASSPMCPICKTQEESVLXLLLRCP  1079

Query  2972  IANSVWESLIPYDHRRL*D--QDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWRN  3145
                 +W    P   RR+ +      +W    I+   +   +         +  ++WK R 
Sbjct  1080  WVEPIWXG-GPLGXRRVGEGVSSXHHWLSVLINXTPNLQDRSRLLSVIXFSCXYIWKXRC  1138

Query  3146  DLVFSGTNI---NLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGWV  3316
             +  F  + +    +   I +      E+ +  S+++   +PI        +W  P   ++
Sbjct  1139  NFXFKASALAXSQVLHSISFSLGSFLEVQVPLSRSRP--SPI-----LDPRWXPPSAPFI  1191

Query  3317  KANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNIG  3427
             K N+D S    + +AR    +RD  G  +     +IG
Sbjct  1192  KVNVDASWCQFDGMARLAAVLRDHNGLFVAAHKWSIG  1228



>ref|XP_010041058.1| PREDICTED: uncharacterized protein LOC104429964 [Eucalyptus grandis]
Length=1350

 Score =   299 bits (766),  Expect(2) = 6e-93, Method: Compositional matrix adjust.
 Identities = 148/429 (34%), Positives = 251/429 (59%), Gaps = 1/429 (0%)
 Frame = +3

Query  1092  GTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKA  1271
              T++D +      FF +G +P   N T + LVP IP P  ++ +R I LCN +YK++++ 
Sbjct  470   ATLEDVVFNSVHQFFLSGKMPLALNQTAVTLVPKIPLPQSLDHYRPISLCNFAYKIISRV  529

Query  1272  MTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRS-KSGKGGLMVIKIDLEKA  1448
             +  RLK  +  LI P Q++FV G QI +N+LV QEV++ +++ K  +    +I++D++KA
Sbjct  530   LANRLKPILPQLISPEQSTFVSGHQIQDNILVVQEVIHQIKTRKHWRHYPAIIRMDMQKA  589

Query  1449  YDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLS  1628
             +DR+ W F+ + L K GF P W++ I  C+ST  ++I F+ +   +F   RGIRQGDPLS
Sbjct  590   FDRVEWDFLMAYLHKIGFHPQWVQWIFQCISTVSISIKFNGQQLDYFRPTRGIRQGDPLS  649

Query  1629  PLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVK  1808
             P LF+L    LS+LI +++  GQ  G+K+ R  P +S+LFF +D +FF   +      + 
Sbjct  650   PYLFILLTNLLSNLIHRAIDMGQLTGVKLNRFSPTLSNLFFANDAIFFVNGTTTDCHTLA  709

Query  1809  KCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRL  1988
               L+++C  SGQ ++  KS IF SK+    ++  ++S L IP++  +GRYLG+P   G  
Sbjct  710   SILSQYCLASGQSINRNKSGIFLSKDCPSPLKANLASELRIPVLERMGRYLGIPIDWGCS  769

Query  1989  KQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLER  2168
             K++ ++ ++ ++ ++L GWK   +S  G+  LI++V+ AIP Y M    +P  +   +E+
Sbjct  770   KRELFSWILGKVNSKLEGWKENLISKGGKEVLIKTVVQAIPQYAMSVFKIPFSICKSIEK  829

Query  2169  LSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGL  2348
              +  F W +       +   W  + E K +G LG + L   N+A+  K  W+L+ +   L
Sbjct  830   QTARFWWQNDCRKTGIHWKQWVVLKEPKAKGGLGFRDLAAFNKAMLGKQAWRLIQQPSSL  889

Query  2349  CVKIMEAKV  2375
               K+++  V
Sbjct  890   WSKLLKWSV  898


 Score = 73.2 bits (178),  Expect(2) = 6e-93, Method: Compositional matrix adjust.
 Identities = 68/260 (26%), Positives = 116/260 (45%), Gaps = 24/260 (9%)
 Frame = +1

Query  322   RLDRALCNIEWKIRSPDVEVLHLPMVNSYHTLGESRRFRFNAAW*THPNYQE*VSSTWKS  501
             RLDR+L N +W++  PD  V  LP V S H+         N    T P       ++   
Sbjct  233   RLDRSLRNFDWRLAFPDAVVSALPTVGSDHS-----PLLLN----TQP-------TSAHH  276

Query  502   DVSLEANKSNLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklr  681
             D+     K +L+  L  W++ T  N  +R   +  ++  +   L +            L+
Sbjct  277   DLPYLLKKVSLA--LSSWSRRTFSNANKRIYELQYKLQQITNQLDI---PYERHEVTTLK  331

Query  682   reldeilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDG  861
              E+ ++  QEE  W  RSR +W+  G++NT+F+HA T  R+  + +  L D    W+ D 
Sbjct  332   SEIQQLWQQEEQFWAMRSRIKWLQWGNKNTKFFHATTIQRRQCNRITMLLDEELGWVRDE  391

Query  862   DGILEPFHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQW-LAINAHFTVKDLE-AVFEMA  1035
               + +    ++ +L+          + D   P L T +  +A+ A  T  ++    F++ 
Sbjct  392   TILKDKTQLYFSNLYQSVGFRDYGPILDQ-CPCLVTPEMNMALTARVTKAEVHTTTFQLG  450

Query  1036  QFKAPSSDGFQTSFYQNSWA  1095
               KAP  DG    FYQ++WA
Sbjct  451   GNKAPGPDGLNGLFYQSNWA  470


 Score = 62.8 bits (151),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 96/236 (41%), Gaps = 31/236 (13%)
 Frame = +2

Query  2756  HYSRGLSTYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICR-N  2932
             H S        +W  I  L +P +++ F W   H+   T     RR  +    C +C  +
Sbjct  1001  HASSSYQAPPHLWKRIWKLHLPLKLKVFCWNVCHNALPTKDNLCRRRISPNPLCPLCHTH  1060

Query  2933  LPEDIDHIMQRCPIANSVWE------SLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHE  3094
              PE I+H+   CP  + +W       SL     RR+         DE ++ L   ++K  
Sbjct  1061  QPETIEHLFLFCPWTSDIWSHPSIGLSLADTSIRRI---------DEWLASL-IFDKKLV  1110

Query  3095  QRVTFAVTM-WWLWKWRNDLVFSG-----TNINLAARIKWIRDQVEEINISFSKAKGLIA  3256
               + F + + W LWK RN  +FS      +++ LAA  ++   Q+   ++     +G I 
Sbjct  1111  PALEFIIAVCWQLWKARNSAIFSNRRLDPSSVVLAATAQFRSAQLSHPSLLRHSHQGEIL  1170

Query  3257  PIESICWRQLKWIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNI  3424
                +  WR      P  G ++ NIDG+ I  N         RD  G    GF  ++
Sbjct  1171  ---ARFWRA-----PPPGSIRINIDGAFISGNLTGSIAVICRDHSGLLKDGFTRSV  1218



>ref|XP_009114416.1| PREDICTED: uncharacterized protein LOC103839673 [Brassica rapa]
Length=1267

 Score =   281 bits (720),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/440 (34%), Positives = 241/440 (55%), Gaps = 1/440 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             +K  L++  + F  TG L    N T IC++P    P  + + R I LCNV YK+++K + 
Sbjct  408   IKTDLVELVNKFLLTGELDTRLNITNICMIPKTERPTRMTELRPISLCNVGYKIISKVLC  467

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRS-KSGKGGLMVIKIDLEKAYD  1454
              RLK  +  LI   Q++FV GR I++N+L+ QE+ + LR+ K+ +G  M IK D+ KAYD
Sbjct  468   QRLKICLPSLISETQSAFVAGRLISDNILIAQEMFHGLRANKACQGKFMAIKTDMSKAYD  527

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             RL W FI++ L K GF   W++ +M+C+S+ +  +  + +     + +RG+RQGDPLSP 
Sbjct  528   RLEWDFIQAILLKMGFDTHWVKLMMACISSVQYRVLLNGQPRGLIIPQRGLRQGDPLSPY  587

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LF+L  E L   I+++ +  Q  GMK+ R  P ISHL F DD +FF +A   +   + + 
Sbjct  588   LFILCTEALIANIKKAERENQLTGMKVARACPSISHLLFADDSLFFCKAQEAECQTILRI  647

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L ++ ++SGQ +++ KS I F        +Q +   LGI  V  +G YLG+P   G  K 
Sbjct  648   LQDYAAVSGQLINFQKSSIQFGHKIEDSRRQMMRDILGIQNVGGMGTYLGLPENMGGSKI  707

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
               +  +  R+ +R+ GW  R  +  G+  +I+SV++A+P + M    LP+    ++  + 
Sbjct  708   QIFGFVQDRVSSRVNGWTFRYFTKGGKEVVIKSVVTAMPNHVMSCYRLPKANTKKITSVV  767

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
               F W      R  +  SW KV   KDQG LG + +   N A+  K  W+L+ K + L  
Sbjct  768   ARFWWSPGGSTRGMHWKSWDKVCAPKDQGGLGFKDIMDFNTAMLGKQLWRLIEKPNTLFA  827

Query  2355  KIMEAKVQLPSLPSQACQMY  2414
             ++ + +    + P    + Y
Sbjct  828   RVFKGRYYRNASPLDPIRSY  847


 Score = 88.6 bits (218),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 92/315 (29%), Positives = 142/315 (45%), Gaps = 34/315 (11%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWM----QGLSSPNFKGARLDRALCNIEWKIRSPDVEVLH  387
             F   I   GL++    G   +W     +G+ +   +  RLDRAL N EW    P     +
Sbjct  101   FNTMIRNGGLLEFPARGNKLSWQGRRGKGVGAVMVR-CRLDRALANEEWHTLFPCSYTEY  159

Query  388   LPMVNSYHT-----LGES--RR---FRFNAAW*THPNYQE*VSSTWKSDVSLEANK----  525
             L +V S H      LG+   RR   F+F+  W       E ++S WK     +       
Sbjct  160   LRVVASDHRPVVAFLGDKVVRRKGQFKFDKRWIGQDGLLEAITSGWKEQNGSQPEPFVTK  219

Query  526   -SNLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikl--drklrrelde  696
              SN   ++  W K      F ++     +I+ +Q++L   Q  +         + R+L E
Sbjct  220   ISNCRHEIAKWRKDN--PPFGKE-----KINELQKALEEVQMDNNRSQEDILDVSRKLQE  272

Query  697   ilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILE  876
                 EE  WF +SR  W  SGDRNT FYHA T  R+  + +  L D  G WI+D +G+ +
Sbjct  273   AYKDEENYWFQKSRNMWYSSGDRNTEFYHALTRQRRVRNRIVGLHDVDGNWITDDEGVEK  332

Query  877   PFHAFYMDLFSEDSTTQLEDLNDAFFPPL--HTSQWLAINAHFTVKDL-EAVFEMAQFKA  1047
                 ++ +LF+  S T  ++      P +   T+ WL   A  T +++ +A+F M   KA
Sbjct  333   VAVNYFDELFTTTSPTAFDNFLSEIQPSISTQTNGWLLRLA--TEEEIRQALFMMHPGKA  390

Query  1048  PSSDGFQTSFYQNSW  1092
             P  DG    F+Q+SW
Sbjct  391   PGPDGMTALFFQHSW  405



>ref|XP_010513001.1| PREDICTED: uncharacterized protein LOC104788939 [Camelina sativa]
Length=1583

 Score =   287 bits (735),  Expect(2) = 3e-92, Method: Compositional matrix adjust.
 Identities = 154/445 (35%), Positives = 247/445 (56%), Gaps = 1/445 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             K  G VK  L+   + F   G    G N T ICL+P +  P  + + R I LCNV YK++
Sbjct  750   KAWGIVKTDLVDLVNRFLVEGVFDKGLNRTHICLIPKVAKPTRMAELRPISLCNVGYKII  809

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDL  1439
             +K +  RLK  +  LI   Q++FV GR I++N+L+ QE+ + LR+  S KG  M IK D+
Sbjct  810   SKVLCQRLKGVLPGLISETQSAFVPGRLISDNILIAQEMFHDLRTNPSCKGKFMAIKTDM  869

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+ + LQK GF+  W+  IM C+++    +  + + +   + ERG+RQGD
Sbjct  870   SKAYDRVEWDFVAALLQKMGFAESWVSWIMVCITSVEYRVLINGQPNGLIVPERGLRQGD  929

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  E L   I ++ ++    G+K+  K P I+HL F DD +FF +A   Q  
Sbjct  930   PLSPYLFILCTEVLIANIRKAERDKLITGIKVANKCPPITHLLFADDSLFFCKADRGQCQ  989

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             V+   L ++ S+SGQ++++ KS + F      + +  +   LGI  +  +G YLG+P   
Sbjct  990   VILDILKKYESVSGQQINFSKSSVQFGHKIDDQTKTELQGVLGIMTLGGMGSYLGLPESL  1049

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             G  K   ++    RIQ+R  GW    LS  GR  +I+SV +A+P + M    LP+ + S+
Sbjct  1050  GGAKTKVFSFARERIQSRTNGWTANLLSKGGREVMIKSVATAVPTFVMSCFRLPKTITSK  1109

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             L     +F W ++  +   + ++W+K+  SK  G LG + +D  N AL AK  W+L++  
Sbjct  1110  LTSAVANFWWSTNGQSGGMHWLAWEKLCVSKQLGGLGFRNVDDFNSALLAKQLWRLIDAP  1169

Query  2340  DGLCVKIMEAKVQLPSLPSQACQMY  2414
             + L  ++ +++    + P    + Y
Sbjct  1170  ESLFARVFKSRYYRNTNPLDPIRSY  1194


 Score = 82.8 bits (203),  Expect(2) = 3e-92, Method: Compositional matrix adjust.
 Identities = 80/321 (25%), Positives = 130/321 (40%), Gaps = 44/321 (14%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             L F   I   G +D  + G   +W +G         RLDRAL N +W    PD    +LP
Sbjct  450   LAFNGMIRDCGFLDFPFIGDCLSW-RGWRDKKPIRCRLDRALGNEDWHDLFPDTVTEYLP  508

Query  394   MVNSYHT-----LGE-----SRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANK-----S  528
             M+ S H      +G      +R F F+  W       + ++S W   +   ++       
Sbjct  509   MIASDHKPLVVKIGAKRPRGNRSFMFDRRWIGKTGLMDAIASGWDGGLDQVSDTFTYKIV  568

Query  529   NLSKQLDDWNK-------HTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrre  687
             N  K +  W K        TI ++ R+    LA  S    ++S  Q              
Sbjct  569   NCRKTISQWRKSQVPYGRETIDDLKRQLEVALADDSIPPATISDLQSRLRQAYG------  622

Query  688   ldeilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDG  867
                    EE+ W+ +SR +W+  GD+N++++HA T  R++ + +  L +    W ++  G
Sbjct  623   ------DEEIYWYQKSRSKWMRLGDKNSKYFHALTKQRRARNRINGLFNKDDIWSTEDVG  676

Query  868   ILEPFHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-----AVFEM  1032
             I     +++ DLF+  + T  E++       + T      N   T    E     A+F M
Sbjct  677   ICNTAVSYFEDLFTSTNPTNFEEV----LREVQTVITAEDNERLTRPATEAEVKSALFMM  732

Query  1033  AQFKAPSSDGFQTSFYQNSWA  1095
                KAP SDG    F+Q +W 
Sbjct  733   HPDKAPGSDGMTALFFQKAWG  753


 Score = 80.9 bits (198),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 77/311 (25%), Positives = 128/311 (41%), Gaps = 44/311 (14%)
 Frame = +1

Query  244   GLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHT---  414
             G +D  + G   +W +G         RLDRAL N +W    PD    +LPM+ S H    
Sbjct  6     GFLDFPFIGDCLSW-RGWRDKKPIRCRLDRALGNEDWHDLFPDTVTEYLPMIASDHKPLV  64

Query  415   --LGE-----SRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANK-----SNLSKQLDDWN  558
               +G      +R F F+  W       + ++S W   +   ++       N  K +  W 
Sbjct  65    VKIGAKRPRGNRSFMFDRRWIGKTGLMDAIASGWDGGLDQVSDTFTYKIVNCRKTISQWR  124

Query  559   K-------HTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEEL  717
             K        TI ++ R+    LA  S    ++S  Q                     EE+
Sbjct  125   KSQVPYGRETIDDLKRQLEVALADDSIPPATISDLQSRLRQAYG------------DEEI  172

Query  718   LWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYM  897
              W+ +SR +W+  GD+N++++HA T  R++ + +  L +    W ++  GI     +++ 
Sbjct  173   YWYQKSRSKWMRLGDKNSKYFHALTKQRRARNRINGLFNKDDIWSTEDVGICNTAVSYFE  232

Query  898   DLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFT-----VKDLEAVFEMAQFKAPSSDG  1062
             DLF+  + T  E++       + T      N   T     V+   A+F M   KAP SDG
Sbjct  233   DLFTSTNPTNFEEV----LREVQTVITAEDNERLTRPATEVEVKSALFMMHPDKAPGSDG  288

Query  1063  FQTSFYQNSWA  1095
                 F+Q +W 
Sbjct  289   MTALFFQKAWG  299



>ref|XP_009129032.1| PREDICTED: uncharacterized protein LOC103853884 [Brassica rapa]
Length=1091

 Score =   307 bits (787),  Expect(3) = 3e-92, Method: Compositional matrix adjust.
 Identities = 162/426 (38%), Positives = 252/426 (59%), Gaps = 1/426 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             V  ++IK    FF +G+L    N T + L+P I     V  +R I LCN+ YK+++K ++
Sbjct  209   VGPAVIKEIQMFFISGNLAPDVNMTHVRLIPKIQGAAKVEDYRPIALCNIYYKIISKLLS  268

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAYD  1454
             LRLK+ +  +I   Q++F+ GR I +NVL+  E+L+ L+ SK+ K   M +K D+ KAYD
Sbjct  269   LRLKTVLSSIISENQSAFIPGRAIADNVLITHELLHFLKASKAEKNCTMAVKTDMSKAYD  328

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             RL WSFI   L + GFSP W R +M C++T   +   +  +    +  RGIRQGDPLSP 
Sbjct  329   RLEWSFIDQVLGRLGFSPIWTRWMMQCIATVSYSYLINDTVYGNVIPYRGIRQGDPLSPY  388

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             +F+L  E LS + + + ++G  +G+++ R  P ++HL F DD +FF +A+      +   
Sbjct  389   VFILCSEVLSGMCKNASRSGALQGVRVARGSPRVNHLLFADDTMFFTQANQKSCETLMSI  448

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L E+  +SGQ+++  K  I FS  TS  I++   S LGIP    LG+YLG+P   GR K+
Sbjct  449   LQEYERVSGQKINKAKISITFSSKTSPTIRENAKSILGIPKEGGLGKYLGLPEHFGRRKR  508

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
             D +  ++ RI+ +   W  + LS  G+ T++QS+LSAIP YTM   LLP  +  R++ + 
Sbjct  509   DLFTSIVDRIRQKAISWSTKRLSRAGKLTMLQSILSAIPTYTMSCFLLPVSLCKRIQSVL  568

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
               F W  + G RK   ++W K+T+ K  G LG++ +   NQAL AKL W+++   + L  
Sbjct  569   TRFWWDGNDGKRKICWVAWDKMTKPKALGGLGLKDIQRFNQALLAKLAWRIITVPNSLLA  628

Query  2355  KIMEAK  2372
             +I+  K
Sbjct  629   RILMGK  634


 Score = 58.2 bits (139),  Expect(3) = 3e-92, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 64/132 (48%), Gaps = 5/132 (4%)
 Frame = +1

Query  706   QEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFH  885
             +EE  W  RSR+ W+  GD NT ++HA +  R + + +  +++  G  + + + I E   
Sbjct  77    KEEEFWKQRSRQLWLSLGDSNTGYFHAVSKGRSAKNRMSVIENKEGRPVYEEEQIAEVIA  136

Query  886   AFYMDLFSEDSTTQLEDLNDAFFPPL---HTSQWLAINAHFTVKDLEAVFEMAQFKAPSS  1056
             ++Y DLF        + + +A  P +   H  +   I     +K   A F +   KAP  
Sbjct  137   SYYTDLFKSIDYDGSQTIAEALRPCITDAHNEKLTEIPQAQEIK--MATFTIHADKAPGP  194

Query  1057  DGFQTSFYQNSW  1092
             DGF  +F+ ++W
Sbjct  195   DGFSAAFFHSNW  206


 Score = 25.8 bits (55),  Expect(3) = 3e-92, Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 19/36 (53%), Gaps = 0/36 (0%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             S+ W+ IL    +L     + + N ++T  W DSWI
Sbjct  651   SHGWRSILHGRDLLKTNLGRAIGNGQTTRVWQDSWI  686



>ref|XP_010686122.1| PREDICTED: uncharacterized protein LOC104900404 [Beta vulgaris 
subsp. vulgaris]
Length=1546

 Score =   293 bits (750),  Expect(3) = 9e-92, Method: Compositional matrix adjust.
 Identities = 150/431 (35%), Positives = 251/431 (58%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             +F   + D +  F S+   +   P+  N T I L+P + NP LV++FR I LCNV YK+ 
Sbjct  653   RFWHIIGDEVFHFVSNILHSYCCPSSVNCTNIALIPKVKNPTLVSEFRPISLCNVLYKIA  712

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDL  1439
             +KA+ LRLK  +  ++   Q++FV GR IT+N L+  E+ +S++ ++  + GL+ +K+D+
Sbjct  713   SKALVLRLKQFLPDIVTENQSAFVPGRLITDNSLIALEIFHSMKKRNNSRKGLIAMKLDM  772

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+R  L   GF   W+  +MSC+S+   +   + R        RG+RQGD
Sbjct  773   SKAYDRVEWGFLRKLLLTMGFDGRWVNLVMSCISSVSYSFLINGRAGGSVTPSRGLRQGD  832

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  +  S +I+Q V + +  G K +R GP ISHL F DD + F  A+  +  
Sbjct  833   PLSPFLFILVADAFSQMIQQKVLSKELHGAKASRSGPEISHLLFADDSLLFTRATRQECL  892

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              +   LN++ + SGQ+++Y KS + FSK  +   ++++S  L +  V+   +YLG+P++ 
Sbjct  893   KIVDILNKYEAASGQKINYEKSEVSFSKGVNCVQRESLSGILQMRQVDRHQKYLGIPTLW  952

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+  + DL+ R+  +L GWK + LS  G+  LI++V+ ++P Y M     P  ++  
Sbjct  953   GRSKKGMFRDLLDRVWKKLRGWKEKLLSRAGKEVLIKAVIQSLPTYLMGVYKFPVVIIQE  1012

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             +      F WG     RK + +SW+K+++ K  G +G + L   N AL  +  W+L++ +
Sbjct  1013  IHSAMARFWWGGKGMERKMHWVSWEKMSKPKCLGGMGFKDLSVFNDALLGRQVWRLLHYK  1072

Query  2340  DGLCVKIMEAK  2372
             + L  +++ AK
Sbjct  1073  NSLLSRVLSAK  1083


 Score = 72.4 bits (176),  Expect(3) = 9e-92, Method: Compositional matrix adjust.
 Identities = 82/309 (27%), Positives = 132/309 (43%), Gaps = 20/309 (6%)
 Frame = +1

Query  217   GFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPM  396
             GF++ I   GL DL   G  YTW +G S       RLDR L +  W    P+  V HL  
Sbjct  350   GFREVIDTCGLRDLRAVGQWYTWERGDSPETRIRERLDRFLVSQTWLQLFPEAVVEHLVR  409

Query  397   VNSYHTL------------GESRRFRFNAAW*THPNYQE*VSSTWKSDVS--LEANKSNL  534
               S H                 R+F+F   W      +  V   W   V   +++    +
Sbjct  410   YKSDHAAIVLKTQAPKMKQCHMRQFKFETKWLLEEGCEATVREAWDGSVGDPIQSRLGVV  469

Query  535   SKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEE  714
             ++ L  W+K   G++ ++  RV  ++   Q+           K   +L +ELD +  + E
Sbjct  470   ARGLVGWSKAGSGDLAKKIDRVEKQLHNAQKE---EISETTCKKCGELEKELDSLNAKLE  526

Query  715   LLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFY  894
               W+ RSR   I  GDRNT ++H   + RK  + ++ L D  GEW  + + +      ++
Sbjct  527   AHWYMRSRVAEIKDGDRNTSYFHHKASQRKKRNRIKGLFDEHGEWREEEEELERLVQKYF  586

Query  895   MDLF-SEDSTTQLEDLNDAFFPPLHTSQW--LAINAHFTVKDLEAVFEMAQFKAPSSDGF  1065
              ++F S D +T   D    F     T+++  + +  +   +  EA+ +M   KAP  DG 
Sbjct  587   REIFTSSDPSTGAMDEVLQFVKKSVTTEFNDILLKPYSKEEIHEALKQMHPCKAPGPDGL  646

Query  1066  QTSFYQNSW  1092
                FYQ  W
Sbjct  647   HAIFYQRFW  655


 Score = 24.6 bits (52),  Expect(3) = 9e-92, Method: Composition-based stats.
 Identities = 13/46 (28%), Positives = 22/46 (48%), Gaps = 2/46 (4%)
 Frame = +2

Query  2390  AKSGMSNV--WKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQ  2521
             A+ G SN   W+ I  +  ++ +G    V   R+   W D W+G +
Sbjct  1093  ARLGFSNSFSWRSIWSAKSLVQEGLMWRVGGGRNINIWSDPWVGDE  1138



>ref|XP_009116295.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=782

 Score =   264 bits (675),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 156/418 (37%), Positives = 238/418 (57%), Gaps = 17/418 (4%)
 Frame = +3

Query  1572  RLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFF  1751
             R +K F   RG+RQGDPLSP LFVL +ERL HLIE++V+  +WK +K++R GP +SH+ F
Sbjct  37    RKTKSFKPSRGLRQGDPLSPYLFVLCMERLCHLIEEAVEEKRWKPIKLSRGGPELSHICF  96

Query  1752  VDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGI  1931
              DDL+ F EAS+ Q  V++K L +FC  SGQ++S  KS IFFS N + E  + IS + GI
Sbjct  97    ADDLILFAEASVTQVRVIRKVLEKFCKASGQKVSLPKSKIFFSNNVTTERGERISRASGI  156

Query  1932  PIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIP  2111
                 DLG+YLG+P +  R+ +D++ +++ ++ + L+GWK +TLS  GR T  ++VLS+IP
Sbjct  157   AATRDLGKYLGMPILQKRINKDTFGEVLEKVASLLSGWKKQTLSLAGRVTTTKAVLSSIP  216

Query  2112  CYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*M  2291
              +TM +  LP   L +L+ LSR F+WGS +     +L+SW+K+ + K +G LGI+    M
Sbjct  217   VHTMSTINLPVSTLEKLDSLSRSFVWGSGQ-----HLVSWEKICKPKAEGGLGIRGSRDM  271

Query  2292  NQALFAKLGWKLMNKEDGLCVKIMEAKVQLPSLP--------SQACQMYGRVFLSRRQSF  2447
             N+AL AK+GW+L+   + L  +++ +K  + S+         S     +  V L  R+  
Sbjct  272   NKALIAKVGWRLLRDTESLWARVLRSKYNVGSIHDLSWTGRRSNGSSTWSSVVLGIREVV  331

Query  2448  *KGAKSW*RTTDQHC-FGSIHG*ENKPLC*VALGMIPSTE*YAKVFEYWVPESGWLWEKL  2624
               G  SW     +   F +     N+PL  V +G +P       V E WV   GW    +
Sbjct  332   MTG-HSWAIGNGRDIKFWTDRWLSNQPLSSVTIGELPEGYEDVTVREMWVVGGGWDLAHI  390

Query  2625  SNLLLEECLSMLAAFNLLDDCELENGLG*DVAYSGKFSVKSTYDITV--GAFRRTEEY  2792
             +  + +E    LAA  +    + E+ L      +G+ +VKS Y +     A R   EY
Sbjct  391   APFVTDETRLELAAVVVDTVNDSEDRLAWSQTKNGQLTVKSAYALITRDDAPRPNMEY  448


 Score =   103 bits (257),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 64/216 (30%), Positives = 106/216 (49%), Gaps = 8/216 (4%)
 Frame = +2

Query  2780  YRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIM  2959
             +RR+W+ +     P R++ FLWL  +   MTN +R R   +    C +C+   E I H++
Sbjct  450   FRRMWHVV----PPERVKMFLWLVGNQAIMTNAERYRWHLSGTDVCQVCKGGIETILHVL  505

Query  2960  QRCPIANSVWESLIPYDHRR-L*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWK  3136
             + CP    +W+  +P   R+         W  + +S+  +G R+     TFA+ +WW WK
Sbjct  506   RDCPAMRGIWDLFVPAVKRQTFFSMPLLEWLYKNLSDNGTG-REIPWPTTFALAVWWGWK  564

Query  3137  WRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGWV  3316
             WR   +F G N     R+ ++R+  +E+ ++    KG    ++      + W  PQ GW+
Sbjct  565   WRCGNIF-GKNSLWRNRVGFLRNLAKEVMLANEAEKG-NPNVDHRTEIMVGWAPPQSGWM  622

Query  3317  KANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNI  3424
             K N DGSS  +      GG +R+ +G    GF  NI
Sbjct  623   KLNTDGSSHGNPGPETAGGVLRNGEGEWCGGFALNI  658



>ref|XP_010495131.1| PREDICTED: uncharacterized protein LOC104772187 [Camelina sativa]
Length=1814

 Score =   293 bits (750),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 160/468 (34%), Positives = 259/468 (55%), Gaps = 12/468 (3%)
 Frame = +3

Query  1068  NQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNV  1247
             +Q   ++   V   +++    FF++GHLP+  N T ICL+P + NP  +   R I LC+V
Sbjct  897   SQFFKEYWDVVGPQVVQEVQQFFASGHLPSDWNFTQICLIPKVQNPTRMTNLRPISLCSV  956

Query  1248  SYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMV  1424
              YK ++K +  RLK  +  ++   Q +FV GR IT+N+L+  E++++L++K+G     + 
Sbjct  957   LYKTVSKVLCQRLKRFLPKIVSDTQGAFVSGRLITDNILLAHELVHALQTKAGCNEEFLA  1016

Query  1425  IKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERG  1604
             IK D+ KAYDR+ W+F+   L + GF   W+  IMSCV +   ++  + +   +   ERG
Sbjct  1017  IKTDMSKAYDRVEWNFLEELLIRLGFDIKWVNWIMSCVRSVTFSVLINGKEHGFIKPERG  1076

Query  1605  IRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEAS  1784
             IRQGDPLSP LF+L  E L H++ ++ + G+  G+K+T + P I HL F DD +F   AS
Sbjct  1077  IRQGDPLSPFLFILCAEALVHVMNKAEQEGRLTGLKLTPECPSIQHLLFADDSLFLCRAS  1136

Query  1785  LHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLG  1964
             L + S + +CL  +   SGQ ++  KS I F K     +++ I    GI      G+YLG
Sbjct  1137  LLECSNLLQCLRLYGDASGQEINLQKSSITFGKKLDPYMRRVIGLFTGIEQEGGAGKYLG  1196

Query  1965  VPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQ  2144
             +P      K+D  A +  R+ +RL GW  +TLS  G+  L+++V  A+P Y M    L +
Sbjct  1197  LPECFSGSKKDMLAYITDRLTSRLRGWFEKTLSLGGKEVLLKAVALALPVYAMSCFRLSK  1256

Query  2145  GVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWK  2324
                 ++     +F W + +  +K + +SW+K+ +SKDQG LG + +   NQAL AK  W 
Sbjct  1257  HQCKKITSAMANFWWNAVEEKQKMHWVSWEKMCKSKDQGGLGFRDIGRFNQALLAKQAWC  1316

Query  2325  LMNKEDGLCVKIMEAK---------VQLPSLPSQACQ--MYGRVFLSR  2435
             L++    L  ++ +A+           L   PS A +  ++GR  L +
Sbjct  1317  LLDGPSSLLARVYKARYFPSTSFMEANLGPRPSYAWRSILFGRELLEK  1364


 Score = 74.3 bits (181),  Expect(2) = 2e-91, Method: Composition-based stats.
 Identities = 77/274 (28%), Positives = 122/274 (45%), Gaps = 25/274 (9%)
 Frame = +1

Query  325   LDRALCNIEWKIRSPDVEVLHLPMVNSYH----------TLGESRRFRFNAAW*THPNYQ  474
             LDRAL N  W    P V+  ++  + S H           +  S RF FN  W + P++ 
Sbjct  638   LDRALGNEAWFQLFPRVQGEYMERIGSDHRALLLRLANDNVSRSGRFIFNKRWISKPDFA  697

Query  475   E*VSSTWKSDVSLEANKSNLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSV--YQk  648
               V S W   V+    ++++  ++ +  +   G    +      RI  V+  L     + 
Sbjct  698   AVVQSGWNKGVT--TGQTSVMSRIAECRRTISGWKRSQNLNSKVRIQQVREQLDAEGTKI  755

Query  649   ldlikldrklrreldeilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRL  828
                 +L R LR EL E    EEL W  RSRE+W+  GDRNT+F+H +   R+  + +  L
Sbjct  756   HPNFQLMRDLRWELAENYRAEELYWKERSREQWLQGGDRNTKFFHGSVQRRRIQNKILSL  815

Query  829   KDNFG-EWISDGDGILEPFHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFT-  1002
              D  G E  S+G    E   A++  +F+  + + + +  D   P +  S    +NA    
Sbjct  816   FDENGVEQFSEGSK-GEVAVAYFRKMFTSSNPSAIMEALDGMVPRVTDS----MNAELIR  870

Query  1003  -VKDLE---AVFEMAQFKAPSSDGFQTSFYQNSW  1092
              V  LE   AVF +   K P +DG  + F++  W
Sbjct  871   PVSALEIKNAVFSIKGEKTPGADGMSSQFFKEYW  904



>ref|XP_010451785.1| PREDICTED: uncharacterized protein LOC104733961 [Camelina sativa]
Length=1297

 Score =   271 bits (693),  Expect(3) = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/427 (34%), Positives = 232/427 (54%), Gaps = 20/427 (5%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             TVK  L      FF  G      N T ICL+P +  P  ++++R I LCNV YK+++K +
Sbjct  476   TVKADLKLSVDSFFQGGSFDKRLNRTNICLIPKVEKPTRMSEWRPISLCNVGYKIISKIL  535

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDLEKAY  1451
               RL+  +  L+   Q++FV GR I++N+L+ QE+ + LR+  S KG  M IK+D+ KAY
Sbjct  536   CQRLRKFLPALVSETQSAFVEGRLISDNILIAQEMFHGLRTNPSCKGKFMAIKMDMSKAY  595

Query  1452  DRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSP  1631
             DR+ W F+   ++K GF   WI  IM CV++   ++  + +     +  RG+RQGDPLSP
Sbjct  596   DRVEWPFLEHLMRKFGFCDKWISWIMWCVTSVEYSVLLNGQSKGSIIPSRGLRQGDPLSP  655

Query  1632  LLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKK  1811
              LF+L  E                   ++   P ISHL F DD +FF  A+  Q  V+  
Sbjct  656   YLFILCTE-------------------VSTACPAISHLLFADDSLFFCRATKEQCEVILG  696

Query  1812  CLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLK  1991
              L ++  +SGQR+++ KS + F    ++++++ +   LGI  +  +  YLG+P   G  K
Sbjct  697   ILRQYERVSGQRINFQKSSVQFGHTVAIDVREDLKGILGITTLGGMNSYLGIPESLGGSK  756

Query  1992  QDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERL  2171
                ++ +  R+Q R  GW  R LS  G+  +I+SV +A+P + M    +P+ V  +L   
Sbjct  757   TKIFSFVQDRLQKRAGGWPARLLSRGGKEVMIKSVATAVPTFVMSCFRIPKTVTRKLTSA  816

Query  2172  SRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLC  2351
               +F W S+   R  + I+W K+   K +G LG + LD  N AL AK  W+L++  D L 
Sbjct  817   ISNFWWSSTGETRGLHWIAWDKLCTDKREGGLGFRCLDDFNTALLAKQLWRLISAPDSLF  876

Query  2352  VKIMEAK  2372
              K+++ +
Sbjct  877   AKVLKGR  883


 Score = 66.6 bits (161),  Expect(3) = 2e-91, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 70/133 (53%), Gaps = 9/133 (7%)
 Frame = +1

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             EE+ W+ +SR  W+  GD+NT ++HA T +R++ + +  + D  G W ++   + +   +
Sbjct  346   EEIYWYQKSRSRWMRFGDQNTSYFHAQTKIRRAKNRIVGMHDESGLWTTEETQVQDIAIS  405

Query  889   FYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHF----TVKDL-EAVFEMAQFKAPS  1053
             ++ ++F+    + +ED    F   ++ S    IN       T +++ EA+F M   KAP 
Sbjct  406   YFQEMFTSTDPSDIED----FLGEINMSITGEINESLIRSVTEQEIKEALFMMHPDKAPG  461

Query  1054  SDGFQTSFYQNSW  1092
              DG    FYQ +W
Sbjct  462   PDGMTALFYQRAW  474


 Score = 50.8 bits (120),  Expect(3) = 2e-91, Method: Compositional matrix adjust.
 Identities = 55/252 (22%), Positives = 86/252 (34%), Gaps = 60/252 (24%)
 Frame = +2

Query  2414  WKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQATLLSRIRYDPFDRVIR*SL*VLG  2593
             W+ ++ +  ++ KG  K V +  S L W D WI  Q+   +     P D  +R    +  
Sbjct  903   WRSMISARSLVNKGLIKRVGSGASILVWTDPWIPAQSPRPALRSGSPIDPTLRVETFIDR  962

Query  2594  PRIG---VAVGETFEPAS*GVLEYVGGVQLIR*L*A*KWPGLGRGLFW*ILC*INL*HYS  2764
                      +  +FEP    ++  +    L               L W         H +
Sbjct  963   ASQSWDLALLSASFEPEDVALISAIPLGNLF----------TPDSLGW---------HLT  1003

Query  2765  RGLSTYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPED  2944
             +       VW     ++ P ++R FLW A   C  T     RRG   ++ C IC    E 
Sbjct  1004  KTGVYTAHVWQ----IRCPPKLRHFLWQAVTGCMATTANLRRRGLGCDIECAICGGEEET  1059

Query  2945  IDHIMQRCPIANSVWESLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMW  3124
             I+H +  CP A     S+           D   W                        +W
Sbjct  1060  INHALFLCPPARQDIPSI-----------DVFPWI-----------------------LW  1085

Query  3125  WLWKWRNDLVFS  3160
             ++WK RND +FS
Sbjct  1086  YIWKARNDKLFS  1097



>ref|XP_010513742.1| PREDICTED: uncharacterized protein LOC104789794 [Camelina sativa]
Length=1787

 Score =   297 bits (760),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 161/469 (34%), Positives = 263/469 (56%), Gaps = 14/469 (3%)
 Frame = +3

Query  1068  NQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNV  1247
             +Q   ++   V   +++    FF++GHLP+  N T ICL+P + NP  +   R I LC+V
Sbjct  870   SQFFKEYWDVVGPQVVQEVQQFFASGHLPSDWNFTQICLIPKVQNPTRMTNLRPISLCSV  929

Query  1248  SYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMV  1424
              YK ++K +  RLK  +  ++   Q +FV GR IT+N+L+  E++++L++K+G     + 
Sbjct  930   LYKTVSKVLCQRLKRFLPKIVSDTQGAFVSGRLITDNILLAHELVHALQTKAGCNEEFLA  989

Query  1425  IKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERG  1604
             IK D+ KAYDR+ W+F+   L + GF   W+  IMSCV +   ++  + +   +   ERG
Sbjct  990   IKTDMSKAYDRVEWNFLEELLIRLGFDIKWVNWIMSCVRSVTFSVLINGKEHGFIKPERG  1049

Query  1605  IRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEAS  1784
             IRQGDPLSP LF+L  E L H++ ++ + G+  G+K+T + P I HL F DD +F   AS
Sbjct  1050  IRQGDPLSPFLFILCAEALVHVMNKAEQEGRLTGLKLTPECPSIQHLLFADDSLFLCRAS  1109

Query  1785  LHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLG  1964
             L + S + +CL  +   SGQ ++  KS I F K     +++ I    GI      G+YLG
Sbjct  1110  LLECSNLLQCLRLYGDASGQEINLQKSSITFGKKLDPYMRRVIGLFTGIEQEGGAGKYLG  1169

Query  1965  VPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQ  2144
             +P      K+D  A +  R+ +RL GW  +TLS  G+  L+++V  A+P Y M    L +
Sbjct  1170  LPECFSGSKKDMLAYITDRLTSRLRGWFEKTLSLGGKEVLLKAVALALPVYAMSCFRLSK  1229

Query  2145  GVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWK  2324
                 ++  +  +F W + +  +K + +SW+K+ +SKDQG LG + +   NQAL AK  W+
Sbjct  1230  HQCKKITSVMANFWWNAVEEKQKMHWVSWEKMCKSKDQGGLGFRDIGRFNQALLAKQAWR  1289

Query  2325  LMNKEDGLCVKIMEAKVQLPSL----------PSQACQ--MYGRVFLSR  2435
             L++    L  ++ +A+   PS+          PS A +  ++GR  L +
Sbjct  1290  LLDAPSSLLARVYKARY-FPSISFMEANLGPRPSYAWRSILFGRELLEK  1337


 Score = 68.9 bits (167),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 122/279 (44%), Gaps = 35/279 (13%)
 Frame = +1

Query  325   LDRALCNIEWKIRSPDVEVLHLPMVNSYH----------TLGESRRFRFNAAW*THPNYQ  474
             LDRAL N  W    P V+  ++  + S H           +  S RF FN  W + P++ 
Sbjct  611   LDRALGNEAWFQLFPRVQGEYMERIGSDHRALLLRLANDNVSRSGRFIFNKRWISKPDFA  670

Query  475   E*VSSTWKSDV-----SLEANKSNLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSV  639
               V S W   V     S+ +  +   + +  W +    N+  +      RI  V+  L  
Sbjct  671   AVVQSGWNKGVTTGQTSVMSRIAECRRTISGWKRSQ--NLNSK-----VRIQQVREQLDA  723

Query  640   --YQkldlikldrklrreldeilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSAS  813
                +     +L R LR EL E    EEL W  RSRE+W+  GDRNT+F+H +   R+  +
Sbjct  724   EGTKIHPNFQLMRDLRWELAENYRAEELYWKERSREQWLQGGDRNTKFFHGSVQRRRIQN  783

Query  814   TVRRLKDNFG-EWISDGDGILEPFHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAIN  990
              +  L D  G E  S+G    E   A++  +F+  + + + +  D   P +  S    +N
Sbjct  784   KILSLFDENGVEQFSEGSKG-EVAVAYFRKMFTSSNPSAIMEALDGMVPRVTDS----MN  838

Query  991   AHFT--VKDLE---AVFEMAQFKAPSSDGFQTSFYQNSW  1092
             A     V  LE   AVF +   K P +DG  + F++  W
Sbjct  839   AELIRPVSALEIKNAVFSIKGEKTPGADGMSSQFFKEYW  877



>ref|XP_009124968.1| PREDICTED: uncharacterized protein LOC103850017 [Brassica rapa]
Length=1053

 Score =   298 bits (763),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 161/426 (38%), Positives = 238/426 (56%), Gaps = 1/426 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             V   L+    + F TG +P G N T +CL+P I  P  V+ +R I LCNV YK+ +K + 
Sbjct  169   VGPDLVVEIQEAFRTGTIPKGINGTHVCLIPKIKTPQRVSDYRPIALCNVYYKIYSKILQ  228

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAYD  1454
              RL+  +  +I   Q++FV GR I +N+L+  EVL++L+ SK+ K   + +K D+ KAYD
Sbjct  229   RRLQPLLEKIISENQSAFVPGRAIGDNILITHEVLHTLKTSKAAKRVSLAVKTDMSKAYD  288

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             RL W FI + L++ GF   WI  IM C+ST   +   +          RGIRQGDPLSP 
Sbjct  289   RLEWDFISTVLERLGFHHLWIGLIMQCISTVTYSFLINGSPRGKVTPSRGIRQGDPLSPY  348

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             +F+L  E LS L  ++   G+ +G K+ R  P I+HL F DD +FF  A       +K  
Sbjct  349   IFILCSEVLSGLCSKAQVEGRMRGFKVARGSPRINHLLFADDTMFFLNADKGSTEELKAI  408

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L+ +   SGQ ++  KS I FS+    E++Q + S L I     +G+YLG+P   GR K+
Sbjct  409   LSRYEKASGQSINKEKSSITFSRKAPRELKQRVHSELQIQNEGGVGKYLGLPEHFGRRKR  468

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
             D +  ++ RI+ +  GW  R LS  G+  ++QSVL+ IP + M    LP  +  R+E   
Sbjct  469   DLFTSIIERIKQKAEGWSTRFLSPAGKLVMLQSVLTPIPSHAMSCFKLPVSLCQRIETAL  528

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
             + F W    G RK   ISW K+T  K  G LG++ +   N+A  AK+ W+L+ K  GL  
Sbjct  529   KRFWWDDRTGKRKMAWISWPKLTLPKSNGGLGVRDIQAFNEAYLAKISWRLLEKPHGLLG  588

Query  2355  KIMEAK  2372
             + + +K
Sbjct  589   RTLLSK  594


 Score = 66.2 bits (160),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 63/130 (48%), Gaps = 1/130 (1%)
 Frame = +1

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             EE  W  RSR  W+  GDRN+ F+HAAT  RK A+    L+D  G  +   + I +    
Sbjct  38    EEAFWKQRSRLLWLQLGDRNSGFFHAATKNRKRANAFTVLEDTDGNMVYKEEDIAKTVVE  97

Query  889   FYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGF  1065
             +Y  +F+       + +  A  P +       + A  T  ++ EA+F +   KAP  DGF
Sbjct  98    YYKMMFTSVKGDCADTVRYALQPLITQEDNEVLIAIPTAAEIKEALFAVNAEKAPGPDGF  157

Query  1066  QTSFYQNSWA  1095
               SFYQ  WA
Sbjct  158   SASFYQAHWA  167



>ref|XP_010674616.1| PREDICTED: uncharacterized protein LOC104890737 [Beta vulgaris 
subsp. vulgaris]
Length=1149

 Score =   312 bits (799),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 194/572 (34%), Positives = 305/572 (53%), Gaps = 11/572 (2%)
 Frame = +3

Query  1065  PNQLLPKFM----GTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSI  1232
             P+ + P F       +  S+  F +   + G +P   N + ICL+P    P  +N FR I
Sbjct  238   PDDIQPIFYQQCWADLHHSITDFVNKCLTNGFIPENINKSFICLIPKKTAPITINDFRPI  297

Query  1233  GLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKG  1412
             GLCN   K+LTK + +RL+  M  L  P QTSFV GR I  N+++ +EV + ++    K 
Sbjct  298   GLCNTILKILTKTIAMRLRPFMVNLTSPLQTSFVKGRTIDENIIILKEVAHLVKRIKRKK  357

Query  1413  GLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFM  1592
              +M +KIDL KA+D L WSFIR TL    F    +  IMS ++T  +++ ++  +++ F 
Sbjct  358   SIMALKIDLTKAFDCLEWSFIRETLIGFKFPKKLVATIMSVITTPSISVLWNGEITQEFK  417

Query  1593  LERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFF  1772
               RGIRQGDPLSP +FVL +ERLS LI+Q +    WK + IT K   +SHLF+ DD+  F
Sbjct  418   PSRGIRQGDPLSPYIFVLCMERLSLLIQQKLDLKLWKPLMIT-KDIGLSHLFYADDVFSF  476

Query  1773  GEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLG  1952
             G+AS     ++ + LN+F   SG  L+ +KS I   K     ++Q++SS  G+ I +D G
Sbjct  477   GQASCANLDLMMEVLNDFGMQSGLFLNRLKSTIIVPKKLDHNVRQSLSSFSGLAISSDFG  536

Query  1953  RYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSS  2132
             +YLGV     +LK+  Y DL+ +   R+ GW+ + L+  GR TLI+SVL++ P Y MQ++
Sbjct  537   KYLGVHISPNKLKRSDYLDLLDKTTDRIRGWQAKLLNMAGRCTLIKSVLNSYPLYVMQTN  596

Query  2133  LLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAK  2312
             +LP GVL+ +++  + FLW         +  SW +V +   +G LGI+ L   N    AK
Sbjct  597   ILPIGVLNDIQKNVKRFLWNKVGQRHYISRTSWDQVCKPMIEGGLGIRDLRHWNLCFMAK  656

Query  2313  LGWKLMNKEDGLCVKIMEAKVQ-----LPSLPSQACQMYGRVFLSRRQSF*KGAKSW*RT  2477
             LGW  + +   L V+I+++K       +  +P+ +     R  L  R    +G       
Sbjct  657   LGWTFLTQPSKLWVRILKSKNCKGSNFMDVIPNVSHSTIWRDILKGRDMLRQGLILNVGN  716

Query  2478  TDQHCFGSIHG*ENKPLC*VALGMIPSTE*YAKVFEYWVPESGWLWEKLSNLLLEECLSM  2657
              +       H    +PL  +   +IP    + +V  + +    W    ++NLL +E +  
Sbjct  717   GEDISLWFHHWVGKEPLYKLKDLVIPEDIAHWRV-AHIIHNKEWNITHIANLLPQEIVDE  775

Query  2658  LAAFNLLDDCELENGLG*DVAYSGKFSVKSTY  2753
             + A  L    E+++GL       G+FS+K+ Y
Sbjct  776   ICAIPLTKFDEVKDGLRWLFTTDGEFSIKTAY  807


 Score = 52.4 bits (124),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 91/225 (40%), Gaps = 21/225 (9%)
 Frame = +2

Query  2762  SRGLSTYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPE  2941
             SR + + ++ W+ +  +++P++ R   W   H+   T     +R    +  C  C    E
Sbjct  815   SRRIQSLKK-WSKLWRIEIPFKYRMLFWNVVHEILPTAVNLQKRIHAFDTTCQCCLLATE  873

Query  2942  DIDHIMQRCPIANSVWESLIPYDHRR-------L*DQDYTNWFDEGISELSSGNRKHEQR  3100
                H+ + C  AN +W+      H           + D+ +W +  +      ++  E  
Sbjct  874   THLHLFRNCLHANLLWKFFFQNCHLARAIDIHCFFNNDWEDWINFNL------DQSLEWL  927

Query  3101  VTFAVTMWWLWKWRNDLVFSGTNINLAARIK-WIRDQVEEINISFSKAKGLIAPIESICW  3277
               F + +W +WK RN +VF       +++   +  D +   N +F     +   ++ I  
Sbjct  928   QMFVIALWHIWKNRNKVVFERAMARSSSQFNHFFLDYLHNKN-AFQNQDKVAPNVQQITI  986

Query  3278  RQLKWIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQGC*LKGF  3412
                 W  P  G++K N DGS   +N  A  GG IR   G    GF
Sbjct  987   ----WKPPVHGYLKLNTDGSW-KANDKASGGGVIRRTDGSWFMGF  1026


 Score = 63.2 bits (152),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 92/173 (53%), Gaps = 5/173 (3%)
 Frame = +1

Query  586   RK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREEWIVSGDR  765
             +K R+ AR++G+Q+ L+      L+ L+++L  +L+ I   E+ +W  ++  +W  +GD 
Sbjct  81    QKNRIYARLNGIQKVLAFRNSSFLLNLEKQLLNDLNHIHLVEKRIWAQKAGFDWRRNGDL  140

Query  766   NTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTTQLEDLND  945
             NTR++H    ++KS      L++  G+W  D   + +     + ++ S + +  L  LN 
Sbjct  141   NTRYFHVIAKIKKSKGKFHALQNLNGDWEFDDRVLKDLARLTFRNILSTNHSFSL--LNC  198

Query  946   AFFP--PLHTSQWLAINAHFTVKDLEAVFE-MAQFKAPSSDGFQTSFYQNSWA  1095
             +F P   L T + L++ +  ++++L  V + M   K+P  D  Q  FYQ  WA
Sbjct  199   SFNPLMTLSTEEALSLASPVSIEELNIVVKSMYPIKSPGPDDIQPIFYQQCWA  251



>ref|XP_008367994.1| PREDICTED: uncharacterized protein LOC103431605 [Malus domestica]
Length=1647

 Score =   262 bits (669),  Expect(3) = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/412 (35%), Positives = 230/412 (56%), Gaps = 1/412 (0%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             TV   +IK    F+ +G L    N T + L+  +  P  ++Q+  I LCNV YK++ K +
Sbjct  465   TVGPDVIKIVKAFWHSGTLLRKLNHTNLVLIXKMKCPKNMSQYXPIALCNVIYKIIAKVL  524

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGLMVIKIDLEKAY  1451
               RLK  M  +IG  Q++FV  +QI +N+LV  E L+SL   KSG    M IK+D+ KAY
Sbjct  525   XNRLKRVMPKVIGENQSAFVAXKQIQDNILVVHEALHSLIHQKSGDHPGMAIKLDMAKAY  584

Query  1452  DRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSP  1631
             DR+ W F+   +   GF+P + + I  C+S+   ++  +   +  F   RG+RQGD LSP
Sbjct  585   DRIEWXFLLGMMCSLGFAPLFXKWIKECISSVSFSVLINGSPTGXFRPNRGLRQGDXLSP  644

Query  1632  LLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKK  1811
              LF+L  E L  LI + ++ G   G KI+  G  ++HLFF DD V FG AS+ +A  + +
Sbjct  645   FLFLLCTEGLXMLIRRGLERGVLHGFKISXAGAPLTHLFFADDSVVFGNASVEEAESIVE  704

Query  1812  CLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLK  1991
              L  +   SGQ ++  K  +FF  NTS +++  I  SL I      G+YLG+ +  G  K
Sbjct  705   VLKTYARGSGQEINLTKXSVFFGANTSKKMRANIVDSLMIQSKXGFGKYLGLQADFGHSK  764

Query  1992  QDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERL  2171
             +  + ++  +I+A ++GW  + LS  G+  L+++V  A+P Y M    LP GV   +ER 
Sbjct  765   KAVFXEIRDKIEAXMSGWAEQFLSQAGKEILVKTVAMALPNYAMSCFKLPIGVCRDVERA  824

Query  2172  SRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKL  2327
              R++ W  ++  +  + IS  ++ + K  G LG + +  +N A  AK+GW++
Sbjct  825   IRNYWWRGNEQRKGIHWISXDRLMKQKKAGGLGFKDIQCVNLAFLAKIGWRI  876


 Score = 99.8 bits (247),  Expect(3) = 2e-90, Method: Compositional matrix adjust.
 Identities = 79/313 (25%), Positives = 135/313 (43%), Gaps = 33/313 (11%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             F+++  RE L+DLGY G  +TW     S   +  RLDR +  + W    P+ ++ H+ + 
Sbjct  162   FRNFXAREELMDLGYEGYPFTWRNNRESMPIQ-QRLDRGMATMGWYEMYPNTKIKHVLLE  220

Query  400   NSYHTL----------GESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQLD  549
              S H L           + R+F F+  W      +  V   W+  +     K + + +  
Sbjct  221   GSDHXLLLLSTEKELNRKGRQFSFDGRWSKSEECRTLVGEEWRDKI-----KGSHAFRFC  275

Query  550   DWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrkl-----------rrelde  696
             D  KH      RR+ +V  +  G   +  + Q  + I++                +E   
Sbjct  276   DKLKH-----LRRRLKVWYKGRGXNSAKMILQLKEEIRVAYISNEFASKEVKQKEKEXIA  330

Query  697   ilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILE  876
                Q E  W  +SR +W+  GD+NT+F+HA T  R+  +T+R ++D  G W     GI +
Sbjct  331   AHXQXETYWKVKSRNQWLREGDKNTKFFHAQTLKRRRFNTIRGIEDGRGIWQZSLKGIGD  390

Query  877   PFHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKD-LEAVFEMAQFKAPS  1053
                 ++ DLF       +E++       L       + A  T  + +EA +++   +AP 
Sbjct  391   TAIEYFSDLFQSCKPNLVEEIQSCIESRLSIEDNXGLTAMVTXCEIMEAAYQIPXXRAPG  450

Query  1054  SDGFQTSFYQNSW  1092
              DGF   FYQ+ W
Sbjct  451   PDGFSGCFYQDHW  463


 Score = 24.3 bits (51),  Expect(3) = 2e-90, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 0/55 (0%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQATLLSRIRYDPFDRVI  2569
             S  WKG+ ++  +L  G +  V N +S     D W  K AT   R R +  + ++
Sbjct  908   SXGWKGLFEARKVLNLGLRWRVGNGKSINIREDPWFPKPATFKVRPRNNLVETMV  962


 Score = 65.9 bits (159),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 88/198 (44%), Gaps = 20/198 (10%)
 Frame = +2

Query  2783  RRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQ  2962
             + VWN I  L+VP++IR F+W   ++         RR    +  CG+C  + E  +H+  
Sbjct  1047  KMVWNNIWRLQVPHKIRIFIWRCCNNALAVRRNLKRRHMRVDNVCGVCXAVNETENHLFF  1106

Query  2963  RCPIANSVWE-SLIPYDHRRL*DQDY----TNWFDEGISELSSGNRKHEQRVTFAVTMWW  3127
             RC I++  W  S +  +   L  +D+     N+ D+    + + +  H+    FA  +W 
Sbjct  1107  RCEISHVFWFCSPLHLNSHVLEGRDFLESWCNFCDQVKDRIDADDIXHD----FAFGLWR  1162

Query  3128  LWKWRNDLVFSGTNINLAARIKWIRDQVEEINISFS--------KAKGLIAPIESICWRQ  3283
             LWK RND+VF G        ++  +    E   S +        +    I   + IC   
Sbjct  1163  LWKNRNDVVFKGIYRQPLDILEAWKKSTGEYKASLAPDXEDHSLRMPKXIXVSDRIC---  1219

Query  3284  LKWIRPQVGWVKANIDGS  3337
              KW RP+ G +K N D +
Sbjct  1220  TKWKRPRFGTIKINTDAA  1237



>ref|XP_010693383.1| PREDICTED: uncharacterized protein LOC104906342 [Beta vulgaris 
subsp. vulgaris]
Length=1157

 Score =   296 bits (757),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 152/431 (35%), Positives = 248/431 (58%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             KF   V D +     +    G +P   N T I ++P I +P  ++++R I LCNV YK++
Sbjct  265   KFWHIVGDDVAGLVINILHGGEMPEHFNRTNIVMIPKIKDPTELSKYRPISLCNVIYKLV  324

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDL  1439
             +KA+ +RLK+ +  L+   Q++FV GRQIT+NVL+  E+ ++++ ++  + G++ +K+D+
Sbjct  325   SKAIVIRLKTILPDLVTENQSAFVPGRQITDNVLIAMELFHTMKQRNKCRRGIIAMKLDM  384

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F++  L   GF   W+  IM+CV+T + +   + ++       RG+RQGD
Sbjct  385   SKAYDRVEWGFLKKLLLTMGFDGRWVNLIMNCVTTVQYSFVINGQVRGAVSPSRGLRQGD  444

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  +  S ++  +V+  +  G K +R GP ISHL F DD + F  A+  +  
Sbjct  445   PLSPYLFILVADAFSKMLLNAVQEKRIHGAKASRSGPVISHLLFADDSLLFARATRQECL  504

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              V    N++   SGQ+++Y KS + FSK    E ++ +   L +  V+  G+YLG+ ++ 
Sbjct  505   AVVDLFNKYEEASGQKINYEKSEVSFSKGVRFEQKEELLGLLNMRQVDRHGKYLGITTVA  564

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             G+ K+  +  ++ RI  +L GWK + LS  G+  L++SV+ AIP Y M     P  V S 
Sbjct  565   GQSKKAIFTAILDRIWKKLRGWKEKLLSRAGKEVLLKSVIQAIPTYLMGIYKFPVSVTST  624

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             +      F WG S G R+ +  +WK + E K  G LG + L+  N AL  +  W++MN E
Sbjct  625   ISSAMAQFFWGQSGGGRRIHWKNWKAMCELKCLGGLGFKDLEIFNDALLGRQAWRIMNGE  684

Query  2340  DGLCVKIMEAK  2372
               L  K+M+AK
Sbjct  685   HTLLGKVMKAK  695


 Score = 67.8 bits (164),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 56/234 (24%), Positives = 104/234 (44%), Gaps = 16/234 (7%)
 Frame = +1

Query  418   GESRRFRFNAAW*THPNYQE*VSSTWKSDVS--LEANKSNLSKQLDDWNKHTIGNIFRRK  591
             G  R FRF  AW      +  V   W   V   +      ++  L  W+  ++ N+ ++ 
Sbjct  41    GSRRTFRFETAWLLEEGCESVVKQAWDGSVGAGVMERIGGVAGGLVSWSSKSLHNLGKQ-  99

Query  592   *RVLARISGVQRSLSVYQkldlikldrklrreldeil----YQEELLWF*RSREEWIVSG  759
                   I   +++L   Q+  +   +      L+  L     ++E  WF RSR   +  G
Sbjct  100   ------IKNTEKALKEAQQRRISPANCLTCNNLEAKLDDLNCKQEAYWFMRSRASEVRDG  153

Query  760   DRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLF--SEDSTTQLE  933
             D+NT+++H   + R++ + ++ L D+ G W  D D + E    +Y DLF  +E +T Q++
Sbjct  154   DKNTKYFHHKASHRRTRNRMKGLLDSEGVWHEDEDKMQEIVEKYYHDLFTSTEPTTAQMQ  213

Query  934   DLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQTSFYQNSW  1092
             ++       +       ++  +T  ++ EA+ +M   KAP  DG    F+Q  W
Sbjct  214   EVLKHMERVISPEINEVLSRPYTKAEIFEALQQMHPSKAPGPDGMHAIFFQKFW  267



>ref|XP_006480844.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=768

 Score =   295 bits (756),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 164/460 (36%), Positives = 255/460 (55%), Gaps = 19/460 (4%)
 Frame = +3

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
             M IK+DLEKAYDRLSW+FI  TL +       I+ IM C++++ + I +   L+  F   
Sbjct  1     MAIKVDLEKAYDRLSWNFIYETLTELALPIGLIQLIMECITSTSMNILWHGELTDDFSPS  60

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP +FVL VERLSH I QS+    WK ++++R G  +SHLFF DDL+ F E
Sbjct  61    RGVRQGDPLSPYIFVLCVERLSHGIYQSIHQDHWKPIRLSRLGTPLSHLFFTDDLLLFAE  120

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A+  QA  +   L +FC  SG +++  K+ ++FSKN    +   I   LG  +  DLG+Y
Sbjct  121   ATSGQAQCINSVLGDFCLSSGTKVNQSKTHVYFSKNVPDAVATRIWRDLGYTVTKDLGKY  180

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG+P +H R+ Q +Y  ++ +   +L GW    LS  GR TL QSVL A+P Y MQ++ L
Sbjct  181   LGMPLLHSRVSQQTYQGILDKTDQKLLGWAASQLSLAGRITLTQSVLQAVPIYAMQTTNL  240

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P  + ++L+++ R FLW  +   RK +L+SW  + + K  G LG +RLD MN+AL  K+ 
Sbjct  241   PGSIKTKLDQICRRFLWSGNDELRKMSLVSWHNICQPKMAGGLGFKRLDIMNEALLLKVA  300

Query  2319  WKLMNKEDGLCVKIMEAKVQLP------SLP----SQACQMYGRVF-LSRRQSF*KGAKS  2465
             W L+ + + LCV+++  K  +P      +LP    S   +  GRV+  ++R         
Sbjct  301   WHLITEPNKLCVQVLSTKYGVPPLEIPHTLPTRYGSHLWKSVGRVWDYAKRGIRWIVGNG  360

Query  2466  W*RTTDQHCFGSIHG*ENKPLC*VALGMIPSTE*YAKVF--EYWVPESGWLWEKLSNLLL  2639
             W       C+ +       PL    L + P     + ++  ++   +  W W K S++L 
Sbjct  361   WKVKFWWDCWAT------TPLTLADLAIHPIPPDLSDLYVADFVSTDGSWNWPKFSHILP  414

Query  2640  EECLSMLAAFNLLDDCELENGLG*DVAYSGKFSVKSTYDI  2759
              + + ++A+ +    C   + +    +  G F+VKS YD+
Sbjct  415   HQAVMIIASIHPPSACNGVDQVYWAASPQGDFTVKSAYDL  454


 Score = 68.2 bits (165),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 90/226 (40%), Gaps = 35/226 (15%)
 Frame = +2

Query  2792  WNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCP  2971
             W    S K P  I+ F+WL  H+   T  + A R    E  C  C    E+  H++  CP
Sbjct  467   WKIAWSWKGPQSIKIFIWLVLHNRLKTRAELATRRLNIEPSCERCGAGLENTIHVLHDCP  526

Query  2972  IANSVWESLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWRNDL  3151
                                           S+ S+       RV F V +W LW WRN  
Sbjct  527   Y-----------------------------SKASTSLGTKLWRVIFGVAIWRLWFWRNRF  557

Query  3152  VFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGWVKANID  3331
             +F+  +   +A    I+ +  EI    S    L A  +S   + ++W  P   WVK N D
Sbjct  558   IFTKDHWESSAIALDIKVRAAEIQQCNS---SLTATDKSRVEKWIRWGAPTWPWVKLNTD  614

Query  3332  GSSIPSNSIARCGGFIRDDQGC*LKGFMHNIGLNQRVSS*PRLWGL  3469
             G+  PS+  A  G  IRD +G    G+  N+G     S+   LWGL
Sbjct  615   GAKKPSDH-AGAGELIRDYKGVWQIGYCANLGFCSVTSA--ELWGL  657



>ref|XP_008340956.1| PREDICTED: uncharacterized protein LOC103403885 [Malus domestica]
Length=1256

 Score =   271 bits (694),  Expect(3) = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/427 (34%), Positives = 235/427 (55%), Gaps = 1/427 (0%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
              V + +I+    F  +G L    N T I L+P + NP  + + R I LCNV YK++ K +
Sbjct  413   VVGEDIIRMVQAFHHSGRLLKKVNHTHIVLIPKVKNPKRMTELRPIALCNVVYKIIAKVL  472

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDLEKAY  1451
             + RL + M  +I   Q++FV GRQI +N+L+  E+L+SL+    G+ G M +K+D+ KAY
Sbjct  473   SRRLTNVMDRIISGNQSAFVPGRQIHDNILIVHEILHSLKQGVEGENGRMAVKLDMAKAY  532

Query  1452  DRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSP  1631
             DR+ W F+   ++   F P +   I  C+S+   ++  +   S +F  +RG+RQGDPLSP
Sbjct  533   DRVEWHFLLDVMRNMXFHPSFCAWIRECISSVSYSVLINGVPSGFFRPQRGLRQGDPLSP  592

Query  1632  LLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKK  1811
              LF++  E LS  I  + + G   G+++      ISHLFF DD V F +A  ++   V +
Sbjct  593   FLFLICAEALSAYIRANERAGLISGVRVAPGAHAISHLFFADDSVVFCKADENEVGTVIR  652

Query  1812  CLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLK  1991
              L  +   SGQ ++  KS IFF K    + ++ I S + I   +  G+YLG+ +  G  K
Sbjct  653   ILENYGRESGQIINLAKSSIFFGKWCYKKTKKRIVSRMNIQARDGFGKYLGIQADFGHSK  712

Query  1992  QDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERL  2171
             +  +  +   +++R+ GW  + LS  G+  LI+SV  A+  + M    LP  +   +ER+
Sbjct  713   KAVFESVRRGMESRIDGWAEQFLSPAGKEVLIKSVXMAMXNHVMACFKLPVTLCKEMERV  772

Query  2172  SRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLC  2351
                F W +    R C  ++W K+TESK  G LG + L   N A+ AK+GW++M+K + + 
Sbjct  773   IAXFFWRNQPNTRGCYWVAWDKLTESKKMGGLGFRDLVGFNLAMLAKIGWRVMDKPESML  832

Query  2352  VKIMEAK  2372
               ++  K
Sbjct  833   SMVLRDK  839


 Score = 90.9 bits (224),  Expect(3) = 2e-90, Method: Compositional matrix adjust.
 Identities = 73/308 (24%), Positives = 135/308 (44%), Gaps = 23/308 (7%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             F++++    L+DLG+ G  +TW +          RLDR +    W    P  ++LH+ + 
Sbjct  110   FREFLAANELLDLGFEGYPFTW-RNKRDEGLIQQRLDRGVATAGWVTLFPHAKILHVELE  168

Query  400   NSYHTL------GE----SRRFRFNAAW*THPNYQE*VSSTWKSDV------SLEANKSN  531
              S H++      G+     RRF +++ W   P  +E +   W+  V       +      
Sbjct  169   GSDHSMLVLSSEGKFQRVPRRFMYDSRWGKTPECREIIKDAWRVSVVGSVAFKVSEKLKG  228

Query  532   LSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQE  711
               +QL +W + T  N  RR   ++     +++ L    +       R   + L   L +E
Sbjct  229   TRRQLGEWKRVTKPNSQRR---IVELREEIRKGL--MDENVRHDYLRGKEKALAVALKEE  283

Query  712   ELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAF  891
             EL W  +SR  W+  GD+NT+F+HA T  R+  + +  L+D  G W  D   + +    +
Sbjct  284   ELYWKVKSRNTWLREGDKNTKFFHAQTVQRRRNNQIVGLEDIHGVWHKDPTCVQQIVLHY  343

Query  892   YMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQ  1068
             +  LF    +    ++       +   Q   +   F+ +++ +A F++   K+P  DGF 
Sbjct  344   FNTLFHSGGSRLEGEVAGCVEIKVDGRQNAELIRLFSAEEIRDAAFQIPATKSPGPDGFT  403

Query  1069  TSFYQNSW  1092
               F+Q+ W
Sbjct  404   AGFFQDHW  411


 Score = 22.3 bits (46),  Expect(3) = 2e-90, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 20/39 (51%), Gaps = 1/39 (3%)
 Frame = +2

Query  2414  WKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQATL  2530
             WKGIL    I+L+G +  V N   T+   D W+ K  + 
Sbjct  859   WKGILLGRQIMLRGLRWRVGNG-ETVRVADPWVPKPHSF  896



>ref|XP_004298219.1| PREDICTED: uncharacterized protein LOC101304768 [Fragaria vesca 
subsp. vesca]
Length=1687

 Score =   266 bits (680),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 145/404 (36%), Positives = 238/404 (59%), Gaps = 1/404 (0%)
 Frame = +3

Query  1164  NDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGR  1343
             N T++ L+P I NP  V  FR I LCNV YK+++KAM  R+K  +  +I  +Q++FV GR
Sbjct  489   NHTLLALIPKIENPQGVADFRPISLCNVLYKLISKAMVNRMKVLLPEVISCYQSAFVPGR  548

Query  1344  QITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIR  1520
              I +NV+   EV++S+R+K +G     V+K+D+ KAYDR+ W F+R+ + K GFS  W+ 
Sbjct  549   CIHDNVVTAFEVIHSIRNKQTGTHPYCVLKLDISKAYDRVEWIFLRNIMLKLGFSERWVE  608

Query  1521  NIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQW  1700
              +M CV +   +I ++ +      L RG+RQGDPLSP LF+L  E L+ L +   + G  
Sbjct  609   LVMKCVESVSFSILWNGKAMGMINLSRGLRQGDPLSPYLFLLCSEGLTSLFQNVEREGLV  668

Query  1701  KGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFS  1880
              G K++   P ISH+ F DD + FG A + + +++K+CL  +   +GQ++++ KS + F 
Sbjct  669   HGAKVSEGSPPISHILFADDSMLFGRAEMQELTLLKQCLLLYERAAGQKVNFQKSAVAFG  728

Query  1881  KNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTL  2060
                  E +  I++ LG+ +V    +YLG+P++ GR K++ +  +  R+   L GW++R L
Sbjct  729   PGLLEEQKSLIATFLGVLVVPFHEKYLGLPTVAGRNKKEMFKRIHERLDQHLQGWQSRLL  788

Query  2061  SFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKV  2240
             S  G++ LI++V  AIP YTM    L +GV    +    ++ WGS       +   W  +
Sbjct  789   SKAGKTILIKAVAQAIPSYTMSVFKLSKGVCRIYQSKVANYWWGSGGKKNGIHWCKWDLL  848

Query  2241  TESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
               +K  G LG + ++  NQAL AK  W+++ +   L  ++++AK
Sbjct  849   CRNKMDGGLGFRDIECFNQALLAKTVWRIVMQPTSLANRVLQAK  892


 Score = 96.7 bits (239),  Expect(2) = 4e-90, Method: Composition-based stats.
 Identities = 82/314 (26%), Positives = 132/314 (42%), Gaps = 33/314 (11%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             F++ +   GL ++ +SGP +TW +G         RLDR   N E  +  P     H+ + 
Sbjct  161   FREAVDECGLQEVEFSGPTFTWKRGTLL-----ERLDRCFINEEAGVLFPRFHEAHVDVG  215

Query  400   NSYH----------TLGES------RRFRFNAAW*THPNYQE*VSSTWKSD----VSLEA  519
              S H            G        RRF+F   W      ++ V+  W+SD     ++ A
Sbjct  216   ASDHLSLVLFSEGLNCGRKGGWKGLRRFQFEPFWAKEQESKQVVADAWQSDGNQLNNVRA  275

Query  520   NKSNLSKQLDDWNKHTIGNIFRRK*RVLARISGV--QRSLSVYQkldlikldrklrreld  693
               + +SK+L  WN++  G I ++  ++   +       S  V Q      +    +    
Sbjct  276   KLAGVSKELQRWNENKFGLIPKKIRQLNKELEQCPFDSSDEVVQNRRNAIVAELNKSLEI  335

Query  694   eilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGIL  873
                  EE +W  RSR  W+  GDRNT+F+H     R   + V  +  + GEWI     I 
Sbjct  336   -----EESIWRQRSRINWLQEGDRNTKFFHGFAKGRGRKNRVLGIMSSTGEWIEQETEIQ  390

Query  874   EPFHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAP  1050
             + F+  +  LF+ +    +E + D     +       +N  FT  D+ EA+ +M   K+P
Sbjct  391   QAFNTHFSQLFTSEGCDHMELVLDTVQRKVTDDMNAKLNKPFTKLDIDEALKQMGPDKSP  450

Query  1051  SSDGFQTSFYQNSW  1092
               DGF   FYQ  W
Sbjct  451   GEDGFSARFYQAYW  464



>ref|XP_009126346.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103851256 
[Brassica rapa]
Length=1690

 Score =   291 bits (744),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 160/457 (35%), Positives = 257/457 (56%), Gaps = 12/457 (3%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             T+  S+I    +FFSTG L    N T + L+P       V+++R I LCNV YK+++K +
Sbjct  427   TIGQSIITEIQEFFSTGVLSPTLNVTHVRLIPKTLGAKRVDEYRPIALCNVYYKVISKLL  486

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAY  1451
             +LRLK  +  +I   Q++F+ GR IT+NVL+  EVL  L+ S++ K   M +K+D+ KAY
Sbjct  487   SLRLKPILCSIISENQSAFIPGRAITDNVLITHEVLQFLKTSQAKKQCAMAVKMDMSKAY  546

Query  1452  DRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSP  1631
             DR+ W FI   +++ GF   WI  IM C+++   +   +  +       RGIRQGDP+SP
Sbjct  547   DRVEWEFIAQVMKRLGFHEKWINWIMQCITSVSYSYLINDSVYGLVKPHRGIRQGDPISP  606

Query  1632  LLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKK  1811
              LF+L  E LS L  ++   G  +G+++ R  P ++HL F DD + F  ++      + +
Sbjct  607   YLFILCGEVLSGLCRKAELEGSMRGVRVARGCPRVNHLLFADDTMIFCNSTSESCLALLR  666

Query  1812  CLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLK  1991
              L ++ S+SGQ+++  KS I FS  T  E++QA    LGI     +G+YLG+P   GR K
Sbjct  667   ILRDYESVSGQKVNIAKSAINFSSKTPPEVKQAAKDLLGIQKEGGMGKYLGLPEHFGRKK  726

Query  1992  QDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERL  2171
             +D +  ++ RI+ R   W  R LS  G+ T++++VL+AIP Y M   +LPQ + +R++  
Sbjct  727   KDLFTSIVDRIRQRAANWSTRFLSRAGKLTMLKAVLTAIPTYAMSCFILPQSLCNRIQSS  786

Query  2172  SRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLC  2351
                F W  S   +    ++W K+T  K  G LG++ +   NQAL AK+ W+++     L 
Sbjct  787   LTRFWWDKSPDKKNMCWVAWGKLTRPKKAGGLGLRDIQRFNQALLAKVAWRILTSPHCLL  846

Query  2352  VKIMEAK---------VQLPSLPSQACQ--MYGRVFL  2429
              +++  K         VQ P++ S   +  ++GR  L
Sbjct  847   ARVLTGKYCHKKSFLDVQTPAVCSHGWRSILHGRDLL  883


 Score = 71.6 bits (174),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 70/306 (23%), Positives = 130/306 (42%), Gaps = 20/306 (7%)
 Frame = +1

Query  217   GFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPM  396
              F+ ++    L DL +SG  ++W +G    +    RLDRA+ N EW    P     +L  
Sbjct  126   AFRTFLSENDLFDLKHSGNPFSW-RGKRGAHLVRCRLDRAMSNPEWMELFPSCRCQYLKF  184

Query  397   VNSYHT-----LGESRR-----FRFNAAW*THPNYQE*VSSTWKSD--VSLEANKSNLSK  540
               S H      L  +R+     FR++         +E V+  W++   + +EA    + +
Sbjct  185   EGSDHRPILSYLDTTRKKGHNLFRYDRRLKDQKEIKELVAEIWQNCTYLGVEARLVLVRR  244

Query  541   QLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELL  720
              +  W K     +F+   +       V+    + +        + + + + +    EE  
Sbjct  245   AICKWCK-----LFQENSKQTIENLRVELDDQMTKDDPDEDRIQDINKLILKAYNSEEAY  299

Query  721   WF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMD  900
             W  RSR  W+  GD N+ ++HA T  RK+ + +  +++  G  + + D I     ++Y +
Sbjct  300   WKQRSRLLWLTLGDSNSGYFHAVTKTRKARNRLTVMENKDGIPVYEEDQISALVCSYYDN  359

Query  901   LFSEDSTTQLEDLNDAFFPPLHTSQW--LAINAHFTVKDLEAVFEMAQFKAPSSDGFQTS  1074
             LF+ +   ++         P  T +W  L        +  EA+F +   KAP  DGF  S
Sbjct  360   LFTANQRGEISSTISQALKPCVTQEWNELLTRDPSPAEIKEALFAIHADKAPGPDGFSAS  419

Query  1075  FYQNSW  1092
             F+ ++W
Sbjct  420   FFHSNW  425



>ref|XP_010480950.1| PREDICTED: uncharacterized protein LOC104759762 [Camelina sativa]
Length=1598

 Score =   280 bits (716),  Expect(3) = 1e-89, Method: Compositional matrix adjust.
 Identities = 149/426 (35%), Positives = 238/426 (56%), Gaps = 1/426 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             +KD +      FF TG +P G N T +CL+P I  P  +   R I LC+V YK+++K + 
Sbjct  682   IKDQVNTEVLRFFDTGIIPEGWNHTHLCLLPKIQTPKRMTDLRPISLCSVIYKIVSKILV  741

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDLEKAYD  1454
              RLK  +  ++ P Q +FV  R I++N+L+  E+ +SL S  +     M++K D+ KAYD
Sbjct  742   HRLKKHLPTIVSPTQAAFVSERLISDNILIAHEIAHSLHSNPTVSQEFMMVKKDMSKAYD  801

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             R+ W F++  LQ  GF   WI   M CVS+   ++  +         ERGIRQGDPLSP 
Sbjct  802   RVEWIFLKDMLQALGFHDRWIFWTMGCVSSVSYSVIMNGEPFGLIKPERGIRQGDPLSPF  861

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LFVL  E L HL +Q+   G   G++    GP I+HL F DD +FF +A+  + + + +C
Sbjct  862   LFVLCTEALIHLFDQATMAGHITGIQFHHSGPQINHLLFADDSLFFCKANRTECAEMMRC  921

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L ++  +SGQ ++  KS I F   ++    + I    GI +    G+YLG+P      KQ
Sbjct  922   LQKYEWMSGQVINKEKSAITFGSKSNNLDWEWIKEKSGICLEGGAGKYLGLPECLSGSKQ  981

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
                  +  R+ +RLTGW  + LS  G+  L++S+  A+P Y M    LP+G++ ++  + 
Sbjct  982   QLLGFIKDRLHSRLTGWYAKNLSQGGKEVLLKSIALALPVYAMSCYKLPKGIIKKMISVM  1041

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
              D+ W +++  +K + +S++K+T  K  G  G + L+  NQAL AK  W+L++  D L  
Sbjct  1042  MDYWWSNTQDKKKIHWLSYEKMTLPKSAGGFGFKDLEIFNQALLAKQAWRLLHDTDCLFS  1101

Query  2355  KIMEAK  2372
             +  +++
Sbjct  1102  RFFKSR  1107


 Score = 71.2 bits (173),  Expect(3) = 1e-89, Method: Compositional matrix adjust.
 Identities = 78/328 (24%), Positives = 138/328 (42%), Gaps = 63/328 (19%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPD-----VEVL  384
             FQ+ +    + +LG SG  +TW  G+    +   +LDR   N  W    P      +E L
Sbjct  378   FQELLANCDMAELGSSGNGFTW-GGVRDKQWIQCKLDRCFGNPAWFSLFPSSRQCFLEKL  436

Query  385   ---HLP-MVN-SYHTLGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKS------N  531
                H P +VN S H      +F F+  W   P++ E +   W    +++ N S      N
Sbjct  437   GSDHKPVLVNFSCHKELHKSQFWFDKRWAEDPSFMEVIKKAWNEKKTMDNNSSVMVRFEN  496

Query  532   LSKQLDDWNKH--TIGNIFRRK*R------------VLARISGVQRSLSVYQkldlikld  669
               K +  W K   T   I  ++ R               RI+ ++R L++          
Sbjct  497   CRKAIGSWKKRVWTSSEIRIKRLRKELATQDASLHPCFTRINAIKRELAI----------  546

Query  670   rklrreldeilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFG--  843
                         +EE+ W  +S E+W++ GDRNT+F+ A+    +  +++  L D+ G  
Sbjct  547   ---------AFREEEVYWRQKSTEKWLLHGDRNTKFFQASVKAARIKNSLPFLVDDKGTE  597

Query  844   --EWISDGDGILEPFHAFYMDLFSEDSTTQLEDLNDAFFPPL--HTSQWLAINAHFTVKD  1011
                 +  G+  ++    ++ DLF     + + +L   F P +  H +Q L+ N   T+ +
Sbjct  598   HFSELEKGEVAIK----YFTDLFKSSGPSPISELLINFQPRVSNHMNQDLSRN--ITIAE  651

Query  1012  L-EAVFEMAQFKAPSSDGFQTSFYQNSW  1092
             + +A F ++   AP  DG    F++  W
Sbjct  652   IKQAAFSISNESAPGHDGLTGFFFKTYW  679


 Score = 32.0 bits (71),  Expect(3) = 1e-89, Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +2

Query  2414  WKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             W+ I+    +L KG K+++ N ++TL W+D+W+
Sbjct  1127  WRSIIFGRQLLSKGLKRVIGNGKNTLVWIDNWL  1159



>emb|CCA66050.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1357

 Score =   293 bits (750),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 151/431 (35%), Positives = 248/431 (58%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             +F   + D +  F S        P   N T I L+P + +P +V++FR I LCNV YK+ 
Sbjct  465   RFWHIIGDEVFNFVSSILHNYSCPGNVNCTNIALIPKVKSPTVVSEFRPISLCNVLYKIA  524

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDL  1439
             +KA+ LRLK  +  +    Q++FV GR I++N L+  E+ ++++ ++  + GLM +K+D+
Sbjct  525   SKAIVLRLKRFLPCIATENQSAFVPGRLISDNSLIALEIFHTMKKRNNSRKGLMAMKLDM  584

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+R  L   GF   W+  +MSCV+T   +   + R+       RG+RQGD
Sbjct  585   SKAYDRVEWGFLRKLLLTMGFDGRWVNLVMSCVATVSYSFIINGRVCGSVTPSRGLRQGD  644

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  +  S +++Q V + +  G K +R GP ISHL F DD + F  A+  +  
Sbjct  645   PLSPFLFILVADAFSQMVKQKVVSKEIHGAKASRNGPEISHLLFADDSLLFTRATRQECL  704

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              +   LN++ + SGQ+++Y KS + FS+  S E ++ + + L +  V+   +YLG+P++ 
Sbjct  705   TIVDILNKYEAASGQKINYEKSEVSFSRGVSCEKKEELITLLHMRQVDRHQKYLGIPALC  764

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+  + +L+ R+  +L GWK + LS  G+  LI++V+ A+P Y M    LP  V+  
Sbjct  765   GRSKKVLFRELLDRMWKKLRGWKEKLLSRAGKEVLIKAVIQALPTYLMGVYKLPVAVIQE  824

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             +      F WG     RK + +SW+K+ + K  G +G + L   N AL  K  W+L++ +
Sbjct  825   IHSAMARFWWGGKGDERKMHWLSWEKMCKPKCMGGMGFKDLAVFNDALLGKQVWRLLHNK  884

Query  2340  DGLCVKIMEAK  2372
             + L  ++M AK
Sbjct  885   ESLLSRVMSAK  895


 Score = 68.2 bits (165),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 80/326 (25%), Positives = 130/326 (40%), Gaps = 51/326 (16%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             +GF++ +    L DL + G  +TW +G S  +    RLDR + +  W    P+  + H  
Sbjct  160   VGFRNVMDDCSLGDLRFVGQWHTWERGRSPESRIRERLDRFIVSRSWLHLFPEAFIDHQV  219

Query  394   MVNSYHTL---------GESRR----FRFNAAW*THPNYQE*VSSTWKSDVS--LEANKS  528
                S H           G  RR    F F   W      +E V   W +     +     
Sbjct  220   RYCSDHAAIVLRCLGNEGMPRRRAGGFWFETFWLLDDTCEEVVRGAWNAAEGGRICEKLG  279

Query  529   NLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlik----ldrklrrelde  696
              ++++L  W+K T G++ ++       I  V++ L   Q              L RELDE
Sbjct  280   AVARELQGWSKKTFGSLRKK-------IEAVEKKLHAAQGEATSIDSWERCVGLERELDE  332

Query  697   ilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILE  876
             +  + E  W+ RSR   +  GDRNT ++H   + RK  + +  + D  G W ++G+ I  
Sbjct  333   LHAKNEAYWYLRSRVAEVKDGDRNTSYFHHKASQRKKRNLIHGIFDGGGRWQTEGEEIEC  392

Query  877   PFHAFYMDLF--SEDSTTQLEDL------------NDAFFPPLHTSQWLAINAHFTVKDL  1014
                 ++ ++F  SE S+   +++            ND    P    +  A          
Sbjct  393   VVERYFQEIFTSSEPSSNDFQEVLQHVKRSVTQEYNDILLKPYSKEEIFA----------  442

Query  1015  EAVFEMAQFKAPSSDGFQTSFYQNSW  1092
              A+ +M   KAP  DG    FYQ  W
Sbjct  443   -ALSDMHPCKAPGPDGMHAIFYQRFW  467


 Score = 61.2 bits (147),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 59/212 (28%), Positives = 83/212 (39%), Gaps = 16/212 (8%)
 Frame = +2

Query  2771  LSTYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDID  2950
             L  + RVWN + SL V  ++R FLW A            RR    E  C  C    E   
Sbjct  1032  LDDFHRVWNILWSLNVSPKVRHFLWRACTSSLPVRKVLQRRHLIDEAGCPCCAREDETQF  1091

Query  2951  HIMQRCPIANSVWESLIPYDHRRL*DQDYTNWFDEGISEL----SSGNRKHEQRVTFAVT  3118
             H+  RCP++  +WE L  Y              DE + +     S  + K  Q+  +   
Sbjct  1092  HLFYRCPMSLKLWEELGSYIL-------LPGIEDEAMCDTLVRWSQMDAKVVQKGCY--I  1142

Query  3119  MWWLWKWRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIR  3298
             +W +W  RN  VF  T+       + I  QVE+ N    K  G +    S      +W  
Sbjct  1143  LWNVWVERNRRVFEHTSQPATVVGQRIMRQVEDFNNYAVKIYGGMR--SSAALSPSRWYA  1200

Query  3299  PQVGWVKANIDGSSIPSNSIARCGGFIRDDQG  3394
             P VG +K N D +S+        G   RD +G
Sbjct  1201  PPVGAIKLNTD-ASLAEEGWVGLGVIARDSEG  1231



>ref|XP_007226707.1| hypothetical protein PRUPE_ppa020120mg [Prunus persica]
 gb|EMJ27906.1| hypothetical protein PRUPE_ppa020120mg [Prunus persica]
Length=1011

 Score =   274 bits (700),  Expect(3) = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/394 (38%), Positives = 228/394 (58%), Gaps = 11/394 (3%)
 Frame = +3

Query  1194  IPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQ  1373
             + +P  ++Q R I LCNV +K+ TK +  RLK  +  +I P Q++F+ GR I++N ++  
Sbjct  398   VKHPKDMSQLRPISLCNVLFKIATKVLANRLKLILHKIISPSQSAFISGRLISDNTILAA  457

Query  1374  EVLNSLRSKSGKGG-LMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSR  1550
             E+++ LR +       MV+K+D+ KAYDR+ WSF+ + ++K GF+  WI+ +++C+ST  
Sbjct  458   EIIHYLRRRRRGKKGFMVLKMDMSKAYDRIEWSFLEAIMRKLGFAEQWIQLMLTCISTVS  517

Query  1551  LAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGP  1730
              +   +     +    RG+ QGDPLSP LF+L  E L+ LI Q  + G  KG+ I R  P
Sbjct  518   YSFVINGTPHGFLHPSRGLHQGDPLSPYLFLLCAEGLTELIAQKEREGFLKGVSICRGAP  577

Query  1731  CISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQA  1910
              ISHLFF DD V F  A++        C+      SGQ++++ KS + FSKN     Q  
Sbjct  578   AISHLFFADDSVLFARANM------ADCMRA----SGQQVNFQKSAVCFSKNVHRGDQLM  627

Query  1911  ISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQ  2090
             ++  +GIP V+   +YLG+P +  + K  S+  L  R+  +L  WK + LS  G+  LI+
Sbjct  628   LAQFMGIPCVDHHSQYLGLPMVLDKKKGASFNHLKERLWKKLQTWKGKLLSGAGKEILIK  687

Query  2091  SVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLG  2270
              V  AIP YTM   LLP+ V   L +L   F W SS  N+K + ++W ++   K++G LG
Sbjct  688   VVAQAIPIYTMSYFLLPKYVCEDLNKLVAQFWWNSSTENKKIHWMAWDRLCAPKEEGGLG  747

Query  2271  IQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
              + L   N AL AK GW+L+   D L  K+++AK
Sbjct  748   FRNLHAFNLALLAKQGWRLLQNPDSLITKVLKAK  781


 Score = 84.7 bits (208),  Expect(3) = 2e-89, Method: Compositional matrix adjust.
 Identities = 82/309 (27%), Positives = 125/309 (40%), Gaps = 64/309 (21%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             L F+D I    L D+G+ G  +TW    +       RLDR L N EW+   P   V HL 
Sbjct  131   LAFRDAISDCHLDDMGFEGATFTWFS--TRNGGIKERLDRVLANCEWRSLFPQATVHHLE  188

Query  394   MVNSYH---------TLGESRR---FRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLS  537
               +S H         T+   RR   FRF + W  H + +  +++ W +  +       L 
Sbjct  189   PCSSDHLPILLEASPTMKPWRRRSFFRFESMWTQHEDCESIIANAWNTSFT-----GTLM  243

Query  538   KQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEEL  717
              Q+  +  H +             +S +   LS                       +EE 
Sbjct  244   YQVSTY--HLL-------------MSQLDSLLS-----------------------REEA  265

Query  718   LWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYM  897
              W  RS+  W+  GDRNTRF+H   + RK  + V+ L+DN G W  D  G+      ++ 
Sbjct  266   FWKQRSKVSWLKEGDRNTRFFHQRASNRKQRNYVKGLRDNTGRWREDEQGLQYVVLDYFT  325

Query  898   DLFSEDSTTQLEDLNDA----FFPPLHTSQWLAINAHFTVKDLEAVFEMAQFKAPSSDGF  1065
              LF+  ++    +  DA      P ++    L +  +   +  EAVF+M   KAP  DG 
Sbjct  326   HLFTSSASGSEGESIDAVESRVTPDMNN---LLLTDYCDAEIHEAVFQMYPTKAPGPDGM  382

Query  1066  QTSFYQNSW  1092
                F+Q  W
Sbjct  383   PPIFFQKYW  391


 Score = 23.5 bits (49),  Expect(3) = 2e-89, Method: Compositional matrix adjust.
 Identities = 10/38 (26%), Positives = 22/38 (58%), Gaps = 0/38 (0%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGK  2518
             S VWK + ++  ++++GS+  V +  +   W D W+ +
Sbjct  798   SVVWKSLYEARTVIIQGSRWQVGSGDTIGIWEDRWLPQ  835



>ref|XP_010445339.1| PREDICTED: uncharacterized protein LOC104727990 [Camelina sativa]
Length=1030

 Score =   285 bits (728),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/417 (36%), Positives = 243/417 (58%), Gaps = 3/417 (1%)
 Frame = +3

Query  1128  DFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRML  1307
             DFF++G LP   N T + L+P I +P  V  +R I LC++ YK++ K ++ RL+S ++  
Sbjct  237   DFFTSGSLPAHSNHTHVRLIPNITSPKRVADYRPIALCSIFYKIIAKIISKRLQSILQTC  296

Query  1308  IGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAYDRLSWSFIRST  1484
             I   Q++FV GR IT+NVL+  E L+ L+ S + +   + +K D+ KAY+RL WSFI   
Sbjct  297   ISQNQSAFVPGRAITDNVLITHEALHYLKQSMAQERVYLAVKTDMSKAYERLEWSFIEEV  356

Query  1485  LQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLS  1664
             L + GF P W    M C+++   +   + +        RGIRQGDPLSP +F+L  E LS
Sbjct  357   LTRMGFHPHWTNIFMQCITSVSYSYLLNGQAKGMVKPSRGIRQGDPLSPYIFILCSEVLS  416

Query  1665  HLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQ  1844
              L  ++  +G+  G+++ +  P ++HL F DD +FF ++       +K+ L+++ + SGQ
Sbjct  417   GLCNKAQVHGKLHGIRVAKGSPRVNHLLFADDTMFFCKSDKTCVRQLKEILHKYEAASGQ  476

Query  1845  RLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRI  2024
             +++  KS I FS+ T  +I++ +   LGI      G+YLG+P + GR K+D +  ++ RI
Sbjct  477   KINQDKSSITFSRKTKNDIKERVKQELGINKTGGQGKYLGLPELFGRKKKDLFTMIVDRI  536

Query  2025  QARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKG  2204
             + R   W ++ LS  G+ TL++SVL A+P YTM    LP  + SR++     F W     
Sbjct  537   KQRALSWSSKFLSSTGKLTLLKSVLGAMPSYTMSCFKLPNSLCSRIQSALTRFWWDEKPD  596

Query  2205  NRKCNLISWKKVTES-KDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
              RK   I+W K+T+S KD G LG + L   N AL AK+ W+++ +   L  K++  K
Sbjct  597   KRKMCWIAWDKMTKSFKDSG-LGFRDLQCYNDALLAKISWRILTQPSCLLAKVLTGK  652


 Score = 75.1 bits (183),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 108/244 (44%), Gaps = 52/244 (21%)
 Frame = +1

Query  385   HLPMVNSYHTLGESRR--FRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQ--LDD  552
             H P+V+S+  + + R+  FR++      P  ++ +  TW +     + +   S Q  LDD
Sbjct  25    HRPLVSSFDPVRKRRKGLFRYDRRLRHIPEVKKLICDTWNACPDAGSTRRGKSPQALLDD  84

Query  553   WNKHTIGNIFRRK*RVLARISGVQRSLSV-YQkldlikldrklrreldeilYQEELLWF*  729
              N                      R L++ YQ                    +EE +W  
Sbjct  85    LN----------------------RKLTIAYQ--------------------KEEEIWKQ  102

Query  730   RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFS  909
             RSR+ W+  GD+N  F+HAAT  RK+ + +  L+   G+ I +   I++   ++Y +LF+
Sbjct  103   RSRQLWLALGDKNFGFFHAATKSRKAINNISVLESEQGDAIYEEQEIVDTISSYYQELFT  162

Query  910   EDSTTQLEDLNDAFFPPL---HTSQWLAINAHFTVKDLEAVFEMAQFKAPSSDGFQTSFY  1080
               + T+   + DA  P +      + L I +   VK+  A F++   K P  DGF  SFY
Sbjct  163   STARTRSTTVRDALTPCITEAMNEELLKIPSPTEVKN--ACFDIHPDKVPGPDGFSASFY  220

Query  1081  QNSW  1092
             Q +W
Sbjct  221   QPNW  224



>ref|XP_010474119.1| PREDICTED: uncharacterized protein LOC104753583 [Camelina sativa]
Length=1162

 Score =   293 bits (749),  Expect(2) = 8e-89, Method: Compositional matrix adjust.
 Identities = 158/428 (37%), Positives = 240/428 (56%), Gaps = 1/428 (0%)
 Frame = +3

Query  1092  GTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKA  1271
               + D +I     FF +G LP   N T I L+P IP    V+ +R I LC+V YK++ K 
Sbjct  316   NNIGDMVIAEVHSFFISGSLPQKINHTHIRLIPKIPTAQKVSDYRPIALCSVYYKIIAKL  375

Query  1272  MTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDLEKA  1448
             +  RL+  +   I   Q++FV  R I+NNVL+  EVL+ L++    K   M +K D+ KA
Sbjct  376   LAKRLQPVLHTCISENQSAFVPQRAISNNVLITHEVLHYLKTSGAVKRCFMAVKTDMSKA  435

Query  1449  YDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLS  1628
             YDRL W FI+  L + GF   WI+ IM CVST   +   + +     + +RGIRQGDPLS
Sbjct  436   YDRLEWDFIKVALDQMGFHQTWIKWIMQCVSTVSYSFLINDQAKGLVLPQRGIRQGDPLS  495

Query  1629  PLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVK  1808
             P LF++  E LS L  ++  NGQ  G ++ +  P ++HL F DD +FF  A       +K
Sbjct  496   PYLFIICSEVLSRLCLKAQSNGQLVGARVAKGSPRVNHLLFADDTMFFIRADPASCHTLK  555

Query  1809  KCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRL  1988
             + L+++   S Q+++  KS I FS  T  ++++     L I      G+YLG+P + GR 
Sbjct  556   RILHKYEVASCQKINQAKSSITFSSKTPRDMKEQAKHILDIHKEGGQGKYLGLPELFGRK  615

Query  1989  KQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLER  2168
             K+D +A ++ RI+ +   W +R L   G+ T+++SVLS +P YTM   LLP  +  R++ 
Sbjct  616   KKDLFASIVDRIKQKAISWSSRFLLTAGKLTMLKSVLSVMPTYTMSCFLLPGSLCKRIQS  675

Query  2169  LSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGL  2348
                 F W +S   +K + I+W K+T+    G LGI+ +   N+AL AKL W+L+ K   L
Sbjct  676   ALTRFWWDTSSEKKKMSWIAWTKITKPVKHGGLGIRDVTHFNKALLAKLSWRLLTKPHTL  735

Query  2349  CVKIMEAK  2372
               K++  K
Sbjct  736   FSKVLLGK  743


 Score = 65.9 bits (159),  Expect(2) = 8e-89, Method: Compositional matrix adjust.
 Identities = 67/297 (23%), Positives = 130/297 (44%), Gaps = 23/297 (8%)
 Frame = +1

Query  247   LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHL--------PMVN  402
             L DL +SG   +W +G    +    RLDR++ N +W +  P     +L        P+V 
Sbjct  27    LYDLKHSGNFLSW-RGKRHSHVVRCRLDRSMVNSDWVMAYPSGRSEYLWFEGSDYRPLVT  85

Query  403   SYHTLGESRR--FRFNAAW*THPNYQE*VSSTWKSDVSLEAN-KSNLSK-QLDDWNKHTI  570
             S+  + +  +  FR++  +  +P     +   W        + + +L +  +  W+K  +
Sbjct  86    SFDPIKKHHKSLFRYDRRFKDNPEVCNIILKAWNLQPGAPVDHRLHLCRLAIIQWSKTQM  145

Query  571   GNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREEWI  750
              N    K  +L+    ++ ++              L + L     +EE  W  RSR+ W+
Sbjct  146   LN---SKKEILSLSEQLEEAMC--DDEASQSTIDGLNQSLLSAYKREEEYWKQRSRQLWL  200

Query  751   VSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTTQL  930
                D+NT ++HAAT  R++ + +  ++ + G  + +   I E    ++ D+F+     + 
Sbjct  201   TLRDKNTGYFHAATKNRRAINNISVIESSLGAKMYEEKEITEVISNYFQDIFTSHEGDRQ  260

Query  931   EDLNDAFFP---PLHTSQWLAINAHFTVKDLEAVFEMAQFKAPSSDGFQTSFYQNSW  1092
               + +A  P   P      + I +   +K  +A F +   KAP  DGF  SF+Q++W
Sbjct  261   SAIQEALTPCVTPEMNEALIDIPSATEIK--QACFNIHADKAPDPDGFSASFFQSNW  315



>gb|EEC79647.1| hypothetical protein OsI_20882 [Oryza sativa Indica Group]
Length=1784

 Score =   327 bits (839),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 169/438 (39%), Positives = 253/438 (58%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP +   +  G +K+ +++    FF TG +P G NDT I L+P I  P  +  FR I LC
Sbjct  1154  FPARFYQRHWGFMKNDIVRAVKLFFDTGVMPEGVNDTAIVLIPKIEQPMELRDFRPISLC  1213

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGL  1418
             NV YK+++K +  RL+  +  L+ P Q++FVLGR IT+N ++  E  +S+ +++  +   
Sbjct  1214  NVIYKVVSKCLVNRLRPILDELVSPCQSAFVLGRMITDNAILAFECFHSIQKNRKPESAA  1273

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
                K+DL KAYDR+ W F+  +L K GF+  W+R IM C++T R ++ F+  L   F   
Sbjct  1274  CAYKLDLSKAYDRVDWGFLEQSLYKLGFAHRWVRWIMVCITTVRYSVKFNGTLLSTFAPS  1333

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP LF+   + LS L+E  V  G    +KI R+ P ISHL F DD + F +
Sbjct  1334  RGLRQGDPLSPFLFLFIADGLSLLLEDKVAQGALSPVKICRQAPGISHLLFADDTLLFFK  1393

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A   QA  VK+ ++++ S +GQ ++  K  I F +++  + + AI  +L I   +   RY
Sbjct  1394  ADNVQAQAVKEVISDYASATGQLINPAKCSIMFGESSPPQTRDAIRVTLQIANSSFEDRY  1453

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG P+  GR+ +  +  L  RI  RL  W    LS  G+  LI+SV+ AIP Y M    L
Sbjct  1454  LGFPTPEGRMCKGKFQSLQERIWKRLIIWGENLLSSGGKEVLIKSVIQAIPVYVMGIFKL  1513

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P+ V   L +L+R+F WG  KG RK +  SW+ +T  K  G LG +     NQAL A+  
Sbjct  1514  PESVCEELTKLTRNFWWGVEKGKRKTHWKSWECLTRPKSNGGLGFRDFRLFNQALLARQA  1573

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W+L+   D LC ++++AK
Sbjct  1574  WRLIVNPDSLCARVLKAK  1591


 Score =   327 bits (838),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 169/438 (39%), Positives = 252/438 (58%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP +   +  G +K+ +++    FF TG +P G NDT I L+P I  P  +  FR I LC
Sbjct  456   FPARFYQRHWGFMKNDIVRAVKLFFDTGVMPEGVNDTAIVLIPKIEQPMELRDFRPISLC  515

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGL  1418
             NV YK+++K +  RL+  +  L+ P Q++FVLGR IT+N ++  E  +S+ +++  +   
Sbjct  516   NVIYKVVSKCLVNRLRPILDELVSPCQSAFVLGRMITDNAILAFECFHSIQKNRKPESAA  575

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
                K+DL KAYDR+ W F+  +L K GF+  W+R IM C++T R ++ F+  L   F   
Sbjct  576   CAYKLDLSKAYDRVDWGFLEQSLYKLGFAHRWVRWIMVCITTVRYSVKFNGTLLSTFAPS  635

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP LF+   + LS L+E  V  G    +KI R+ P ISHL F DD + F +
Sbjct  636   RGLRQGDPLSPFLFLFIADGLSLLLEDKVAQGALSPVKICRQAPGISHLLFADDTLLFFK  695

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A   QA  VK+ ++++ S +GQ ++  K  I F +++  + + AI  +L I       RY
Sbjct  696   ADNVQAQAVKEVISDYASATGQLINPAKCSIMFGESSPPQTRDAIRVTLQIANSGFEDRY  755

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG P+  GR+ +  +  L  RI  RL  W    LS  G+  LI+SV+ AIP Y M    L
Sbjct  756   LGFPTPEGRMCKGKFQSLQERIWKRLIIWGENLLSSGGKEVLIKSVIQAIPVYVMGIFKL  815

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P+ V   L +L+R+F WG  KG RK +  SW+ +T  K  G LG +     NQAL A+  
Sbjct  816   PESVCEELTKLTRNFWWGVEKGKRKTHWKSWECLTRPKSNGGLGFRDFRLFNQALLARQA  875

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W+L+   D LC ++++AK
Sbjct  876   WRLIVNPDSLCARVLKAK  893


 Score = 87.0 bits (214),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 82/312 (26%), Positives = 134/312 (43%), Gaps = 25/312 (8%)
 Frame = +1

Query  217   GFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWK--IRSPDVEVL--  384
              F+D +    L DLG+ G  YT+       N    RLDR + +  W+   RS  VE L  
Sbjct  161   AFRDVLQTYELHDLGFKGLPYTYDNKREGINNVRVRLDRVVADDGWRDMFRSSQVEHLIS  220

Query  385   ----HLPMVNSY--HTLGESRR--FRFNAAW*THPNYQE*VSSTW-----KSDVS-LEAN  522
                 H P+V  +   T   +RR    +   W       E +  +W     KSD++ +   
Sbjct  221   PCSNHCPVVLKFCVDTNQPARRKCLHYEIFWEREAELVEVIDESWAALGDKSDLADISRA  280

Query  523   KSNLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeil  702
              S +  +L  W++    N+ R   +      G +R   + +     +  R     L E+L
Sbjct  281   LSQVMAKLHSWSRRKCKNVGREIEK------GRKRLAELIESGADSRSIRSASDNLHELL  334

Query  703   YQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPF  882
             Y+EE+LW  RSR  W+  GDRNTRF+H+    R   + + +LKD  G   S    + +  
Sbjct  335   YREEMLWLQRSRVNWLKEGDRNTRFFHSKAVWRAKKNRITKLKDREGTVHSTTAKLEDMA  394

Query  883   HAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSD  1059
               ++ ++FS D       +       +  +    + + F  +++  A+F++   KAP  D
Sbjct  395   TEYFKEVFSADPLLDQSKVTRLIQRKVSPAMNETLCSEFKEEEISNAMFQIGPLKAPGPD  454

Query  1060  GFQTSFYQNSWA  1095
             GF   FYQ  W 
Sbjct  455   GFPARFYQRHWG  466


 Score = 68.2 bits (165),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 63/132 (48%), Gaps = 1/132 (1%)
 Frame = +1

Query  703   YQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPF  882
             Y+EE+LW  RSR  W+  GDRNTRF+H+    R   + + +LKD  G   S    + +  
Sbjct  1033  YREEMLWLQRSRVNWLKEGDRNTRFFHSKAVWRAKKNRITKLKDREGTVHSTTAKLEDMA  1092

Query  883   HAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSD  1059
               ++ ++FS D       +       +  +    + + F  +++  A+F++   KA   D
Sbjct  1093  TEYFKEVFSADPLLDQSKVTRLIQRKVSPAMNETLCSEFKEEEISNAMFQIGPLKALGPD  1152

Query  1060  GFQTSFYQNSWA  1095
             GF   FYQ  W 
Sbjct  1153  GFPARFYQRHWG  1164



>ref|XP_009123679.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1072

 Score =   287 bits (734),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 158/464 (34%), Positives = 251/464 (54%), Gaps = 8/464 (2%)
 Frame = +3

Query  1086  FMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLT  1265
             +   V + + +    FF+T  L    N+T I L+P    P  V  +R I LCN  YK++ 
Sbjct  181   YWHIVGEDVTRDIRSFFTTNSLQAQQNETHIRLIPKTTGPKSVADYRPIALCNTHYKIIA  240

Query  1266  KAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGL-MVIKIDLE  1442
             K +T RLK  +  LI   Q++FV GR IT+NVL+  E L+ LR+   K    M +K D+ 
Sbjct  241   KILTRRLKPLLPALISNTQSAFVAGRAITDNVLITHETLHYLRTSDAKKYCSMAVKTDMS  300

Query  1443  KAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDP  1622
             KAYDR+ WSF+R  L+  GF P WI  IM C+ +       +          RG+RQGDP
Sbjct  301   KAYDRIEWSFVREVLKLLGFDPIWISWIMCCIESVSYTFLINGSPQGSVKPSRGLRQGDP  360

Query  1623  LSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASV  1802
             LSP +F+L  E LS L E+   +G   G+++ R  P I+HL F DD +FF ++     S 
Sbjct  361   LSPHIFILCTEVLSALCEKGQADGSLPGVRVARGCPAINHLLFADDTMFFCKSKASCVSA  420

Query  1803  VKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHG  1982
             + K L+ + ++SGQR++  KS I FS  T  E++  +  ++ I     +G+YLG+P   G
Sbjct  421   LMKILSTYEAVSGQRINPQKSAITFSAKTPPEVRARVKEAMAIEAEGGIGKYLGLPENFG  480

Query  1983  RLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRL  2162
             R K+D +A ++ RI+ +   W  + LS  G+  +++SVL+A+PCYTM    +P  +  ++
Sbjct  481   RKKRDIFAAIVDRIRQKSHSWSTKFLSSAGKQIMLKSVLAAMPCYTMSCFKIPLSLCKQI  540

Query  2163  ERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKED  2342
             + L   F W ++   +K   ++W  +   K  G LG + ++  N AL AK+GW+++ +  
Sbjct  541   QSLLTRFWWDANPEKKKMCWVAWSTLALPKYAGGLGFRDVETFNDALLAKIGWRVIKEPQ  600

Query  2343  GLCVKIMEAKVQLP------SLPSQACQMYGRVFLSRRQSF*KG  2456
              L  +++  K          S+P+ A   + R  L+ R+   KG
Sbjct  601   SLLARVLLGKYARDASFLNCSVPASASHGW-RSILAGREILRKG  643


 Score = 69.3 bits (168),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 67/131 (51%), Gaps = 5/131 (4%)
 Frame = +1

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             EE  W  RSR +W+  GDRNT F+HAAT  R++ +++  ++D+ G  + +   I      
Sbjct  54    EEQFWRQRSRIQWLKQGDRNTGFFHAATRNRRTINSIPVIEDDQGAVVYEEQEISRVISD  113

Query  889   FYMDLFSED---STTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLEAVFEMAQFKAPSSD  1059
             ++  +F+ +   S TQL+ L      P       AI     +K  EA+  +   KAP  D
Sbjct  114   YFQKIFTSNGNHSFTQLQGLLTCKVTPEMNQMLTAIPRDSEIK--EAMASINGGKAPGPD  171

Query  1060  GFQTSFYQNSW  1092
             GF  +FYQ+ W
Sbjct  172   GFSATFYQSYW  182



>ref|XP_010666976.1| PREDICTED: uncharacterized protein LOC104884079 [Beta vulgaris 
subsp. vulgaris]
Length=1268

 Score =   285 bits (728),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 150/431 (35%), Positives = 241/431 (56%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             +F   + D +  F        H P   N T I L+P + +P +  +FR I LCNV YK++
Sbjct  376   RFWHIIGDDISDFVCGILHGHHFPADLNCTNIALIPKVKDPKVAAEFRPIALCNVLYKLV  435

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKS-GKGGLMVIKIDL  1439
             +KA+ LRLK  +  ++  +Q++FV GR IT+N L+  EV + ++ +S  + G + +K+D+
Sbjct  436   SKAIVLRLKDFLPDIVTEYQSAFVPGRLITDNALIAMEVFHLMKHRSRSRRGTIAMKLDM  495

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+R  L   GF   W+  IM CVS+   +   + R+    +  RG+RQGD
Sbjct  496   SKAYDRVEWGFLRKMLLTMGFDGRWVNLIMWCVSSVSYSFIINGRVRGSVVPNRGLRQGD  555

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  +  S +I++ V+  +  G K +R  P ISHL F DD + F  A+  +  
Sbjct  556   PLSPYLFILVADIFSKMIQKKVQEKRLHGAKASRSEPEISHLLFADDSLLFTRATRQECF  615

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              +   LN +    GQ+++Y KS + FSK   VE ++A+   L +  V    +YLG+P + 
Sbjct  616   EIVDILNRYELAFGQKINYEKSEVSFSKGVRVEQKEALMGILKMRQVEKHEKYLGIPFVA  675

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+  +A L+ RI  +L GWK + LS  G+  L+++V+ AIP Y M    LP  ++ +
Sbjct  676   GRSKKLIFASLLDRIWKKLQGWKEKLLSRAGKEVLLKAVIQAIPTYLMGGYKLPTMIIQK  735

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             ++     F WGSS   RK +  +W+ +   K  G +G + L   N AL  +  W+L++  
Sbjct  736   IQAAMARFWWGSSDTKRKIHWKNWEAMCTLKCLGGMGFKDLGVFNDALLGRQAWRLIHAP  795

Query  2340  DGLCVKIMEAK  2372
               L  ++++AK
Sbjct  796   QSLLSRVLKAK  806


 Score = 71.6 bits (174),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 76/307 (25%), Positives = 121/307 (39%), Gaps = 65/307 (21%)
 Frame = +1

Query  217   GFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPD--VEVL--  384
              F+D +    L +LG+  P YTW +GLS       RLDR + N+ W    P+  VE L  
Sbjct  122   AFRDLLDDCALRNLGFDNPRYTWERGLSVTTRIRERLDRFVSNLAWTQIFPNHGVENLLR  181

Query  385   ----HLPMVNSYHTL----GESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSK  540
                 H P+V          G+ R FRF   W      +E V   W      EA+  +   
Sbjct  182   YKSDHSPIVTRLKAAATERGKRRGFRFETCWLLDAGCEEAVKEAW------EASSGD---  232

Query  541   QLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELL  720
                                       + R LS+  +L+                 ++E  
Sbjct  233   -------------------------KITRRLSLLDELNE----------------KQEAY  251

Query  721   WF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMD  900
             W+ RSR   +  GD+NT+++H   + RK  + V+ L+++ G W S+ + I   F  ++  
Sbjct  252   WYLRSRVAEVKDGDKNTQYFHHKASQRKKRNFVKGLQNDDGVWCSEIEEIEIFFANYFST  311

Query  901   LFS--EDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLEAVF-EMAQFKAPSSDGFQT  1071
             +F+    S   L+ +     P +      A+   +T  ++ A   +M   KAP  DG   
Sbjct  312   IFTSCNPSDVNLQHVLQYISPIVSDDCNCALLRPYTKDEIYAALSQMHPCKAPGPDGMHA  371

Query  1072  SFYQNSW  1092
              FYQ  W
Sbjct  372   IFYQRFW  378



>ref|XP_009102116.1| PREDICTED: uncharacterized protein LOC103828254 [Brassica rapa]
Length=1131

 Score =   277 bits (709),  Expect(3) = 9e-88, Method: Compositional matrix adjust.
 Identities = 143/431 (33%), Positives = 240/431 (56%), Gaps = 1/431 (0%)
 Frame = +3

Query  1125  SDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRM  1304
             ++F  +G + +  N T IC++P +  P  + + R I LCNV YK+++K +  RLK  +  
Sbjct  299   NNFLVSGDMDSRLNITNICMIPKVERPTRMAELRPISLCNVGYKIISKVLCQRLKICLPH  358

Query  1305  LIGPFQTSFVLGRQITNNVLVYQEVLNSLRS-KSGKGGLMVIKIDLEKAYDRLSWSFIRS  1481
             LI   Q++FV GR I++N+L+ QE+ + LR+ KS +   M IK D+ KAYDR+ WSFI +
Sbjct  359   LISETQSAFVAGRLISDNILIAQEMFHGLRTNKSCQNKFMAIKTDMSKAYDRIEWSFIEA  418

Query  1482  TLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERL  1661
              L K GF P W++ +  C+S+ +  +  + +     + +RG+RQGDPLSP LF++  E L
Sbjct  419   LLTKMGFDPHWVKLMQECISSVQYRVLLNGQPRGLIIPKRGLRQGDPLSPYLFIMCTEAL  478

Query  1662  SHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSG  1841
                I+++ +  Q  GMK+ R  P +SHL F DD +FF +A+  +   + + L ++ ++SG
Sbjct  479   IMNIKKAERMKQLTGMKVARACPAVSHLLFADDSLFFCKANKEECHTILRILKDYEAVSG  538

Query  1842  QRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSR  2021
             Q++++ KS I F        +Q +   LGI  +  +G YLG+P   G  K   +  +  R
Sbjct  539   QQINFQKSSIQFGHKIEESSRQELRDILGIQNLGGMGSYLGLPESLGGSKVQVFGFVQDR  598

Query  2022  IQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSK  2201
             +  R+ GW  R  +  G+  +I+SV++A+P + M    LP+  + +L      F W    
Sbjct  599   LNNRVNGWTFRFFTKGGKEVIIKSVITALPNHVMSVYRLPKATVKKLTSAVAQFWWNPGG  658

Query  2202  GNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAKVQL  2381
               R  +  SW K+ E KD G LG + L+  N A+  K  W+L+ K + L  ++ + +   
Sbjct  659   STRGMHWKSWDKLCEHKDNGGLGFKDLNDFNTAMLGKQLWRLIEKPNSLFSRVFKGRYYR  718

Query  2382  PSLPSQACQMY  2414
              + P +  + Y
Sbjct  719   NASPLEPIRSY  729


 Score = 77.4 bits (189),  Expect(3) = 9e-88, Method: Compositional matrix adjust.
 Identities = 78/278 (28%), Positives = 126/278 (45%), Gaps = 26/278 (9%)
 Frame = +1

Query  319   ARLDRALCNIEWKIRSPDVEVLHLPMVNSYH----------TLGESR-RFRFNAAW*THP  465
              RLDRAL N EW    P     +L MV S H            G  R +FRF+  W    
Sbjct  18    CRLDRALANEEWHTLFPYSYTEYLRMVGSDHRPVVAFLDDKVPGRKRGQFRFDKRWIGQE  77

Query  466   NYQE*VSSTWKSDVSLEANKSNLSKQLDDWNKHTIGNIFRRK*RVLAR--ISGVQRSLSV  639
                E + S W  +   E    + + ++++  +H I + +R+  +   +  I  +Q +L  
Sbjct  78    GLMESIVSGWTEN--QEGISGDFTTKINNC-RHEI-STWRKNNQPYGKDKIFNLQNALEE  133

Query  640   YQk--ldlikldrklrreldeilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSAS  813
              Q       +   ++ R+L E    EE  W  +SR  W  SGD NT+FYHA T  R+  +
Sbjct  134   VQTDNNRSQEEIIEISRKLQEAYRDEEEYWHQKSRNMWYSSGDLNTKFYHALTKQRRIRN  193

Query  814   TVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTTQ----LEDLNDAFFPPLHTSQWL  981
              +  L D  G WIS+ +G+ +    ++  LFS  +  +    LE++  +  P ++    L
Sbjct  194   KIVGLHDEEGNWISEENGVEKVAVDYFTGLFSSSNPREFDSFLEEIGPSISPQMNQ---L  250

Query  982   AINAHFTVKDLEAVFEMAQFKAPSSDGFQTSFYQNSWA  1095
              +      +  +A+F M   KAP  DG    F+Q+SW+
Sbjct  251   LLRRATEEEVRQALFMMHPEKAPGPDGMTALFFQHSWS  288


 Score = 21.9 bits (45),  Expect(3) = 9e-88, Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 0/33 (0%)
 Frame = +2

Query  2414  WKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             W+ I  +  ++ KG  K V    S   W D WI
Sbjct  735   WRSITSARSLVCKGLIKRVGTGSSISVWNDPWI  767



>ref|XP_009112590.1| PREDICTED: uncharacterized protein LOC103837948 [Brassica rapa]
Length=1415

 Score =   288 bits (737),  Expect(2) = 9e-88, Method: Compositional matrix adjust.
 Identities = 162/453 (36%), Positives = 248/453 (55%), Gaps = 7/453 (2%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             V   ++K    FF    LP   N+T I L+P IPNP  V+ +R I LCNV YK+ +K +T
Sbjct  531   VGPDIVKEVQGFFRGEPLPELINETNIRLIPKIPNPQKVSDYRPIALCNVYYKIFSKLLT  590

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAYD  1454
              RL+  +  LI   Q++FV GR I +N+L+  EVL+ L  S++ +   M +K D+ KAYD
Sbjct  591   RRLQPLLSKLISVNQSAFVPGRAIGDNILITHEVLHYLNTSQAEQRCAMAVKTDMSKAYD  650

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             RL W FI   + + GF  D+++ +M C+S+   +   +       +  RGIRQGDPLSP 
Sbjct  651   RLEWEFISLVMVRLGFHQDFVKCVMQCISSVTYSFLINGLPRGKVVPSRGIRQGDPLSPY  710

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             +F++  E LS L  Q+ ++G  +G+++ R  P I+HL F DD +FF E +    S +   
Sbjct  711   IFIMCSEVLSGLCNQAKEDGSLQGIRVARGCPRINHLLFADDTMFFLETTQGNCSALTDI  770

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L ++ S SGQ +S  KS I FS+ T   I++ +   L I      G+YLG+P   GR K 
Sbjct  771   LTKYESASGQTISKEKSAITFSRRTPAAIKEMVKEELQIQKEGGTGKYLGLPEQFGRRKH  830

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
             D ++ ++ RI+ +  GW N+ LS  G+  ++QSVLSA P Y+M    LP  +  R++   
Sbjct  831   DIFSSIVDRIKQKARGWSNKFLSSAGKMVMLQSVLSAAPSYSMSHFALPVSLCKRIQSTV  890

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
               F W +++  RK   +SW  + + K  G LG +     N AL AKL W+L+   D L  
Sbjct  891   TRFWWDNNEHTRKMAWVSWDSMAKPKALGGLGFRDFQVYNVALLAKLSWRLVQNPDCLLG  950

Query  2355  KIM------EAKVQLPSLPSQACQMYGRVFLSR  2435
             +++      E+ V   + PS     +  V + R
Sbjct  951   QVLLGKYCTESNVLTATGPSNMSHGWRSVLVGR  983


 Score = 66.6 bits (161),  Expect(2) = 9e-88, Method: Compositional matrix adjust.
 Identities = 74/308 (24%), Positives = 126/308 (41%), Gaps = 35/308 (11%)
 Frame = +1

Query  235   FREG-LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSP---------DVEVL  384
             F EG L DL +SG   +W +G    +    RLDRA  N  W  R P         D+   
Sbjct  234   FSEGDLFDLQHSGDPLSW-RGQRGDHLVRCRLDRAAANTLWAERFPTARCQYLEADLTSD  292

Query  385   HLPMVNSY--HTLGESRRFRFNAAW*THPNYQE*VSSTWKS--DVSLEANKSNLSKQLDD  552
             H P+++ +          FR++     +   ++ +S+ W+     S+    ++    +  
Sbjct  293   HKPLLSFFDKGGRRRRGNFRYDRRLCKNEEARKMISNAWRGAGQASVRDKLASTRSAISA  352

Query  553   WNKHTIGN----IFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELL  720
             WNK    N    I ++K  + A +S     + + Q +                   EE  
Sbjct  353   WNKTQHRNSQEVIQQQKTALNAALSSPVNDIDLIQVIAAKLNAAYSA---------EEEY  403

Query  721   WF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMD  900
             W  RSR  W+  GDRNT ++HA T  RK  +    ++   G+ +   + I++    ++  
Sbjct  404   WRQRSRALWLKLGDRNTGYFHATTKNRKRINGFSVIEREDGQMVHKEEEIVQVIGDYFQK  463

Query  901   LFSEDSTTQLEDLNDAFFPPLHTSQ----WLAINAHFTVKDLEAVFEMAQFKAPSSDGFQ  1068
             +FS     + ED+ +    PL T +     +A+     ++D  A F +   KAP  DGF 
Sbjct  464   MFS-SLPGEREDIVNRALQPLLTGEENDSLIAVPTSGEIRD--AAFSINAEKAPGPDGFS  520

Query  1069  TSFYQNSW  1092
               F+   W
Sbjct  521   AGFFHTHW  528



>ref|XP_008351907.1| PREDICTED: uncharacterized protein LOC103415345 [Malus domestica]
Length=1736

 Score =   277 bits (708),  Expect(3) = 9e-88, Method: Compositional matrix adjust.
 Identities = 142/427 (33%), Positives = 238/427 (56%), Gaps = 1/427 (0%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             TV   ++     FF +G +  G N T I L+P + NP  +  FR I LCNV YK+++K +
Sbjct  856   TVGAVVLGMVKSFFVSGRMLEGVNHTNIVLIPKVXNPRNMGHFRPISLCNVVYKIISKVL  915

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKG-GLMVIKIDLEKAY  1451
             T RLK  +  +I P Q++FV GRQI++N+LV  ++L+ ++     G   M +K+D+ KAY
Sbjct  916   TNRLKRVLPKVISPNQSAFVAGRQISDNILVVHZLLHXMQHGKEDGVDYMXMKLDMAKAY  975

Query  1452  DRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSP  1631
             DR+ W+F+ + L + GF   + + +M+CV T    +  +   + +    RGI+QGD LSP
Sbjct  976   DRVEWAFLNAMLLQLGFDDMFCQWVMACVKTVSYXVVVNGETTGYIKPRRGIQQGDXLSP  1035

Query  1632  LLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKK  1811
              LF++  E  + L+    + G+ +GM +T     +SH+FF DD V F  A+  +A  +K 
Sbjct  1036  FLFLICAEGFTSLLHNXEEMGRLRGMSVTEXADPLSHVFFADDXVLFCRATXGEAHTIKG  1095

Query  1812  CLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLK  1991
              L ++   SGQ ++  KS + FS   S  +++ +S  LGI      G+YLG+    G  K
Sbjct  1096  LLQQYAVGSGQFINLDKSSVHFSMGCSKALKEQLSQILGIKHQEGFGKYLGIQXDFGASK  1155

Query  1992  QDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERL  2171
             +  + ++ +R+  R+ GW  + LS  G+  LI+SV +A+P YTM    LP  +   +E++
Sbjct  1156  KKVFEEVRNRLDERINGWAEQFLSMAGKEVLIKSVAAALPXYTMSCFQLPIHLAKEIEQV  1215

Query  2172  SRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLC  2351
                F W   +  +  + ++W KV   K  G LG + +   N A+ AK+GW+L++      
Sbjct  1216  IARFWWRDQRTKKGIHWMTWNKVAXKKVYGGLGFREIIDFNLAMLAKVGWRLISNXGSJL  1275

Query  2352  VKIMEAK  2372
              ++++AK
Sbjct  1276  ARVLQAK  1282


 Score = 77.4 bits (189),  Expect(3) = 9e-88, Method: Composition-based stats.
 Identities = 76/308 (25%), Positives = 121/308 (39%), Gaps = 23/308 (7%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             F++++    L+DL + G  Y W +      F   RLD  L   EW        V H+   
Sbjct  553   FRNFVVHASLLDLXFEGYPYXW-RNRREEXFIQERLDXVLATHEWVHNYQXAVVKHVVXX  611

Query  400   NSYHTL----------GESRRFRFNAAW*THPNYQE*VSSTWKS------DVSLEANKSN  531
              S H +             +RF ++  W   P   E V + W           +  N   
Sbjct  612   GSDHAMLVLSTEVDQPRRKKRFMYDPRWSXDPKCDEVVRACWGGLHGRPHAYXIMQNLRM  671

Query  532   LSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQE  711
             +   L    K    N  R + + + R+    R  +  Q +      R+L  EL   L +E
Sbjct  672   VKHGLITXQK----NEGRNEQKEICRLKXALRE-AYQQPVYDGNXIRRLEEELTXALXRE  726

Query  712   ELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAF  891
             E+ W  +SR +W+  GD+NTRF+HA T  R   +    L+   G W +D   I      +
Sbjct  727   EIFWRTKSRVQWLKEGDKNTRFFHAQTLKRXRXNMJXGLEAGDGTWCTDATQINSIAVDY  786

Query  892   YMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQ  1068
             +  LF+ D   Q  +        +       + A  T  ++E A+++M   K+P  DGF 
Sbjct  787   FTSLFTMDRPLQFGEXLQCVPTRVGEVDNAMLVAPVTDGEIEAAIYQMHPTKSPGPDGFN  846

Query  1069  TSFYQNSW  1092
               FY + W
Sbjct  847   AGFYHHHW  854


 Score = 21.9 bits (45),  Expect(3) = 9e-88, Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 17/38 (45%), Gaps = 0/38 (0%)
 Frame = +2

Query  2399  GMSNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             G S  WKGIL+   IL  G +  V +        D W+
Sbjct  1297  GTSWGWKGILQGRKILKAGVRWRVGDXTCIQIGKDPWL  1334



>gb|EAZ20803.1| hypothetical protein OsJ_36426 [Oryza sativa Japonica Group]
Length=787

 Score =   313 bits (803),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 160/438 (37%), Positives = 253/438 (58%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP +   +  G +K+ ++K   +FF+TG +P G N+T I L+P +  P  +  +R I LC
Sbjct  315   FPARFFQRNWGLLKEEVVKAVKEFFNTGVMPAGVNETAIVLIPKVDQPIELRDYRPISLC  374

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGL  1418
             NV YK+++K +  RL+  +  LI P Q++FV GR IT+N L+  E  +S+ ++K      
Sbjct  375   NVLYKVVSKCLVNRLRPILDELISPNQSAFVPGRMITDNALIAFECFHSIQKNKKLSSAT  434

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
                K+DL KAYDR+ W F+  ++ K GF+  W+  IMSC+++ R ++ F+  L   F   
Sbjct  435   CAYKLDLSKAYDRVDWKFLEQSMYKLGFAHCWVNWIMSCITSVRYSVKFNGTLLSTFAPS  494

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP LF+  V+ LS L+E+ V  G    + I R+ P IS+L F DD + F +
Sbjct  495   RGLRQGDPLSPFLFLFVVDGLSLLLEERVAQGALSPVHICRRAPGISNLLFTDDTLLFFK  554

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A+  QA+VV   L ++   +GQ ++  K  I F + +  ++Q+++ S L +   +   +Y
Sbjct  555   ATSEQANVVMNVLADYAWCTGQLINQEKCSIMFGEASPPDVQESVRSVLQVGSTSFDDKY  614

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG P+  GR+ +  +  L  ++  R+  W    LS  G+  LI++VL AI  Y M    L
Sbjct  615   LGFPTPEGRMNKGKFQSLQEKLCKRIMQWGENFLSSGGKEILIKAVLQAITVYVMGIFKL  674

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P  +   L +L+R+F WGS KG RK +  SW  +T+ K  G LG +     NQAL A+  
Sbjct  675   PDSICDELTKLTRNFWWGSEKGKRKAHWKSWDCITKPKHCGGLGFRDFRLFNQALLARQA  734

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W+L+     LCV++++AK
Sbjct  735   WRLIENPHSLCVQVLKAK  752


 Score = 77.0 bits (188),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 125/311 (40%), Gaps = 49/311 (16%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             F+D +    L  LG+SG  YT+       N    RLDRAL + +W+    +  V HL   
Sbjct  45    FRDVLQTCDLHALGFSGVPYTYDNRREGRNNIRVRLDRALADNDWREMFGNARVSHLTST  104

Query  400   NSYHTLG------------ESRRFRFNAAW*THPNYQE*VSSTWKSDVS------LEANK  525
              S H                ++   +   W   P+ QE ++  W   VS      +    
Sbjct  105   RSDHCPISVCFSPEDCRPFHTKCLHYEICWEREPSLQEVITDAWSEGVSKSDLGEISTAL  164

Query  526   SNLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilY  705
               +  +L  W+K  + N+ +   +   R++      S+        L R+    L+E+LY
Sbjct  165   HRVMTRLHSWSKVKVKNVGKELEKARKRLT------SLLVSDAESSLVRQALDHLNELLY  218

Query  706   QEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFH  885
             +EE+LW  RSR  W+  GDRNTRF+H+    R   + +  L+D  G  +     ++E   
Sbjct  219   REEMLWLQRSRINWLKEGDRNTRFFHSKGVWRAKKNKISALRDASGT-VHHLTNVMEQMA  277

Query  886   A-FYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLEAVFEMAQFKAPSSDG  1062
               ++  LFS D             P L  S+   +             ++   KAP  DG
Sbjct  278   TDYFKTLFSAD-------------PNLDHSRVTTLIQE----------KIGPLKAPGPDG  314

Query  1063  FQTSFYQNSWA  1095
             F   F+Q +W 
Sbjct  315   FPARFFQRNWG  325



>ref|XP_010673997.1| PREDICTED: uncharacterized protein LOC104890275 [Beta vulgaris 
subsp. vulgaris]
Length=1098

 Score =   318 bits (814),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 177/472 (38%), Positives = 272/472 (58%), Gaps = 8/472 (2%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP     K+   V +S+I+    FF +G +    N T + L+P I NP   N FR I LC
Sbjct  216   FPPFFFQKYWTLVGNSVIRAVQAFFHSGKILKEINHTFLALIPKIDNPSSANHFRPISLC  275

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLM  1421
             +  YK+++K +T RLK  M  +I P Q +F+  R I +N+L+  E+  S ++KSG  G +
Sbjct  276   STIYKIISKIITNRLKEVMSQIIHPLQGAFIPDRLIQDNILIAHEIFQSFKTKSGSNGWI  335

Query  1422  VIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLER  1601
              IK+D+EKAYDRL W++I STL K GF P WI  I  CVS++  ++  +    + F   R
Sbjct  336   AIKLDMEKAYDRLEWNYIFSTLDKLGFCPQWIGWIKECVSSTSFSVLVNGLPGEKFSSSR  395

Query  1602  GIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWK--GMKITRKGPCISHLFFVDDLVFFG  1775
             GIRQGDPLSP LF+L  E L+ L+  S  +G  K  G+ I + G  I  L F DD + F 
Sbjct  396   GIRQGDPLSPYLFILCAELLARLLS-SAASGPTKPIGVPIGKTGMRIPFLTFADDTMIFA  454

Query  1776  EASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGR  1955
             +A+ +   ++++ L+++CS+SGQ ++Y KS    + N     +   +S L +   NDLG 
Sbjct  455   KATNYSCLIIRQILDKYCSMSGQLVNYHKSSFQCTANIPEAEKCNFASILQMQETNDLGD  514

Query  1956  YLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSL  2135
             YLG P IH ++ +++++ ++S+  ++L  WK   LS  GRS L+QS L+A   Y MQS L
Sbjct  515   YLGCPIIHSKVTKETFSSVVSKTTSQLPKWKANALSQAGRSVLLQSNLAAKASYQMQSFL  574

Query  2136  LPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKL  2315
             LP+ +L  L+R  R+F W     N+  NLI W ++ + K  G LG ++ +  NQAL  KL
Sbjct  575   LPKSILVNLDRTYRNFFWNKETTNKSPNLIGWDRICKPKSAGGLGFRKAEANNQALQMKL  634

Query  2316  GWKLMNKEDGLCVKIMEAK-VQLPSL----PSQACQMYGRVFLSRRQSF*KG  2456
              W+++  ++ L VK++  + ++  S+     S++     R  LS R  F KG
Sbjct  635   LWRIVKNDNNLWVKLVRKRYIKNKSIFSIKASKSASWQWRNLLSLRDIFKKG  686


 Score = 56.6 bits (135),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 65/251 (26%), Positives = 102/251 (41%), Gaps = 17/251 (7%)
 Frame = +2

Query  2792  WNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCP  2971
             +N+I  L +P +I+ FLW A +D   T  +  +        C  C N  E I HI   CP
Sbjct  798   FNWIWKLNIPPKIKNFLWKACNDGIPTKLRLEKSHIFLPQQCVFCNNAGESIGHICFACP  857

Query  2972  IANSVWESLI-----PYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWK  3136
                 ++  L      P     L + D T+ F   +    S + K E  + F+   W++W 
Sbjct  858   FTLDIFSHLKASFDWPSPPSCLANIDLTS-FRSVLEACLSLSSKSEISL-FSFVWWFVWF  915

Query  3137  WRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLK--------W  3292
             +RN LVF+   ++       I +     + + +  +    PI +   ++ K        W
Sbjct  916   FRNKLVFNDEVVSSRKASFIISNFATSWSKALNSEEMGSKPILAANTKRDKPRTGPGSVW  975

Query  3293  IRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNIGLNQRVSS*PRLWGLT  3472
               P  G+ K N DGS + +N  A  G  IRD  G  L     ++G N  +      WGL 
Sbjct  976   SPPAPGFCKLNFDGSKL-NNGNAALGFVIRDSSGDALMAGARSLGSNISILQ-AEAWGLK  1033

Query  3473  T*FFKTDSLDI  3505
                    SL+I
Sbjct  1034  EGLSAALSLNI  1044


 Score = 54.7 bits (130),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 88/197 (45%), Gaps = 28/197 (14%)
 Frame = +1

Query  553   WNKHTIGNIFRRK*RVLARISGVQRSL--SVYQkldlikldrklrreldeilYQEELLWF  726
             WNK   GNIFR+  +V  R+  +Q  L  +        K D  L++    + +  E  W 
Sbjct  42    WNKSQFGNIFRQLRKVDERLQEIQSFLLANPSNLTYQTKQDLFLKKRSSLLSFSNE-FWK  100

Query  727   *RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLF  906
              +S+ ++++ GD N+ +YH   ++R++ + ++ +  + GE I++   I +     +   F
Sbjct  101   QKSKTDYLILGDSNSSYYHTHASIRRNRNQIKEIVSSTGEVITNPVAISQELSNAFKARF  160

Query  907   SEDSTTQ-------------LEDLNDAFF-PPLHTSQWLAINAHFTVKDLEAVFEMAQFK  1044
             S DS+               + + N+AF   P+   +  A           A F++A  K
Sbjct  161   SSDSSVYFHPDYDFSLLDNIISEENNAFLTSPVSGDEIKA-----------ATFDLAPDK  209

Query  1045  APSSDGFQTSFYQNSWA  1095
             +P  DGF   F+Q  W 
Sbjct  210   SPGPDGFPPFFFQKYWT  226



>ref|XP_010684763.1| PREDICTED: uncharacterized protein LOC104899296 [Beta vulgaris 
subsp. vulgaris]
Length=1107

 Score =   317 bits (813),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 177/472 (38%), Positives = 272/472 (58%), Gaps = 8/472 (2%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP     K+   V +S+I+    FF +G +    N T + L+P I NP   N FR I LC
Sbjct  216   FPPFFFQKYWTLVGNSVIRAVQAFFHSGKILKEINHTFLALIPKIDNPSSANHFRPISLC  275

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLM  1421
             +  YK+++K +T RLK  M  +I P Q +F+  R I +N+L+  E+  S ++KSG  G +
Sbjct  276   STIYKIISKIITNRLKEVMSQIIHPLQGAFIPDRLIQDNILIAHEIFQSFKTKSGSNGWI  335

Query  1422  VIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLER  1601
              IK+D+EKAYDRL W++I STL K GF P WI  I  CVS++  ++  +    + F   R
Sbjct  336   AIKLDMEKAYDRLEWNYIFSTLDKLGFCPQWIGWIKECVSSTSFSVLVNGLPGEKFSSSR  395

Query  1602  GIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWK--GMKITRKGPCISHLFFVDDLVFFG  1775
             GIRQGDPLSP LF+L  E L+ L+  S  +G  K  G+ I + G  I  L F DD + F 
Sbjct  396   GIRQGDPLSPYLFILCAELLARLLS-SAASGPTKPIGVPIGKTGMRIPFLTFADDTMIFA  454

Query  1776  EASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGR  1955
             +A+ +   ++++ L+++CS+SGQ ++Y KS    + N     +   +S L +   NDLG 
Sbjct  455   KATNYSCLIIRQILDKYCSMSGQLVNYHKSSFQCTANIPEAEKCNFASILQMQETNDLGD  514

Query  1956  YLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSL  2135
             YLG P IH ++ +++++ ++S+  ++L  WK   LS  GRS L+QS L+A   Y MQS L
Sbjct  515   YLGCPIIHSKVTKETFSSVVSKTTSQLPKWKANALSQAGRSVLLQSNLAAKASYQMQSFL  574

Query  2136  LPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKL  2315
             LP+ +L  L+R  R+F W     N+  NLI W ++ + K  G LG ++ +  NQAL  KL
Sbjct  575   LPKSILVNLDRTYRNFFWNKETTNKSPNLIGWDRICKPKSAGGLGFRKAEANNQALQMKL  634

Query  2316  GWKLMNKEDGLCVKIMEAK-VQLPSL----PSQACQMYGRVFLSRRQSF*KG  2456
              W+++  ++ L VK++  + ++  S+     S++     R  LS R  F KG
Sbjct  635   LWRIVKNDNNLWVKLVRKRYIKNKSIFSIKASKSASWQWRNLLSLRDIFKKG  686


 Score = 56.2 bits (134),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 65/251 (26%), Positives = 102/251 (41%), Gaps = 17/251 (7%)
 Frame = +2

Query  2792  WNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCP  2971
             +N+I  L +P +I+ FLW A +D   T  +  +        C  C N  E I HI   CP
Sbjct  798   FNWIWKLNIPPKIKNFLWKACNDGIPTKLRLEKSHIFLPQQCVFCNNAGESIGHICFACP  857

Query  2972  IANSVWESLI-----PYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWK  3136
                 ++  L      P     L + D T+ F   +    S + K E  + F+   W++W 
Sbjct  858   FTLDIFSHLKASFDWPSPPSCLANIDLTS-FRSVLEACLSLSSKSEISL-FSFVWWFVWF  915

Query  3137  WRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLK--------W  3292
             +RN LVF+   ++       I +     + + +  +    PI +   ++ K        W
Sbjct  916   FRNKLVFNDEVVSSRKASFIISNFATSWSKALNSEEMGSKPILAANTKRDKPRTGPGSVW  975

Query  3293  IRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNIGLNQRVSS*PRLWGLT  3472
               P  G+ K N DGS + +N  A  G  IRD  G  L     ++G N  +      WGL 
Sbjct  976   SPPAPGFCKLNFDGSKL-NNGNAALGFVIRDSSGDALMAGARSLGSNISILQ-AEAWGLK  1033

Query  3473  T*FFKTDSLDI  3505
                    SL+I
Sbjct  1034  EGLSAALSLNI  1044


 Score = 54.7 bits (130),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 88/197 (45%), Gaps = 28/197 (14%)
 Frame = +1

Query  553   WNKHTIGNIFRRK*RVLARISGVQRSL--SVYQkldlikldrklrreldeilYQEELLWF  726
             WNK   GNIFR+  +V  R+  +Q  L  +        K D  L++    + +  E  W 
Sbjct  42    WNKSQFGNIFRQLRKVDERLQEIQSFLLANPSNLTYQTKQDLFLKKRSSLLSFSNE-FWK  100

Query  727   *RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLF  906
              +S+ ++++ GD N+ +YH   ++R++ + ++ +  + GE I++   I +     +   F
Sbjct  101   QKSKTDYLILGDSNSSYYHTHASIRRNRNQIKEIVSSTGEVITNPVAISQELSNAFKARF  160

Query  907   SEDSTTQ-------------LEDLNDAFF-PPLHTSQWLAINAHFTVKDLEAVFEMAQFK  1044
             S DS+               + + N+AF   P+   +  A           A F++A  K
Sbjct  161   SSDSSVYFHPDYDFSLLDNIISEENNAFLTSPVSGDEIKA-----------ATFDLAPDK  209

Query  1045  APSSDGFQTSFYQNSWA  1095
             +P  DGF   F+Q  W 
Sbjct  210   SPGPDGFPPFFFQKYWT  226



>ref|XP_010484806.1| PREDICTED: uncharacterized protein LOC104763089 [Camelina sativa]
Length=1130

 Score =   317 bits (813),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 159/395 (40%), Positives = 240/395 (61%), Gaps = 36/395 (9%)
 Frame = +3

Query  1065  PNQLLPKFM----GTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSI  1232
             P+   P F       V  S+ +F  DFF TG LP   ND ++ L+  +  P  + QFR I
Sbjct  368   PDGFQPIFYQHCWDMVGTSVTRFVLDFFETGVLPRELNDALVVLIAKVVKPENMAQFRPI  427

Query  1233  GLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKG  1412
              LCNV +K++TK M LRLK+ M  LIGP Q SF+  R  T+N+++ QE ++S+R K+G+ 
Sbjct  428   SLCNVLFKIITKMMVLRLKTVMPKLIGPAQASFIPVRLSTDNIVIVQEAVHSMRRKNGRK  487

Query  1413  GLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFM  1592
             G M++K+DLEKAYDR+ W F+  TL+ AG S +W   I+ CV    + + ++   +  F 
Sbjct  488   GWMLLKLDLEKAYDRVRWDFLEDTLKVAGLSTEWRNWILQCVVGPSMTVLWNGEKTIPFT  547

Query  1593  LERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFF  1772
               RG+RQGDPLSP LFV+ +ERL HLIE SV + +WK + ++R GP +SH+ F DDL+ F
Sbjct  548   PSRGLRQGDPLSPYLFVMCLERLCHLIEISVNSKEWKPISLSRGGPKLSHICFADDLILF  607

Query  1773  GEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLG  1952
              EA   Q  +++K +  FC  SGQ+                                DLG
Sbjct  608   AEAYAAQIRIIRKVMESFCVASGQK--------------------------------DLG  635

Query  1953  RYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSS  2132
             +YLG+P +H R+K++++  ++ R+ +RL+GWK R LSF  R TL ++VLS+IP + M + 
Sbjct  636   KYLGMPILHKRIKKETFRQVIERVNSRLSGWKGRFLSFAERLTLTKAVLSSIPVHAMSTI  695

Query  2133  LLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKK  2237
              LP+  L++L+++S+ FLWGS+   RK +L++W +
Sbjct  696   SLPKHTLNKLDQISKSFLWGSTLAKRKQHLVAWSR  730


 Score = 82.4 bits (202),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 75/156 (48%), Gaps = 12/156 (8%)
 Frame = +1

Query  214  LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
            L F +WI    LID+G+ G  Y W +G  +  F    LDR LC  + +++  +  V HLP
Sbjct  140  LSFGEWINANSLIDMGFKGNRYNWRRGRVAETFIAKLLDRILCCPQARLKWQEAVVSHLP  199

Query  394  MVNSYHTL------------GESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLS  537
             + S H               + R FRF AAW +H  ++E VS++W  ++        L+
Sbjct  200  FMASDHAPLYLQLCPEVKGNPQRRPFRFEAAWLSHRGFKELVSTSWNGELVTPEALQRLT  259

Query  538  KQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQ  645
              L  WN+   G+I RRK  ++  I  +Q  L + Q
Sbjct  260  TILQKWNREVFGDINRRKDTLIHDIKVLQDQLDLNQ  295


 Score = 60.1 bits (144),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 52/108 (48%), Gaps = 20/108 (19%)
 Frame = +2

Query  3107  FAVTMWWLWKWRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQL  3286
             F V +WW WKWR   +F  T     AR    RD+V           G + P   +  R +
Sbjct  921   FVVVIWWAWKWRCGNIFEST-----ARC---RDRV----------GGRVRPNRGM--RMI  960

Query  3287  KWIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNIGL  3430
              W  P VGWVK N DG+S  +  +A  GG +RD  G  + GF  NIG+
Sbjct  961   AWSPPSVGWVKLNTDGASHGNPGLATAGGVLRDSDGAWIGGFAFNIGI  1008



>ref|XP_008356060.1| PREDICTED: uncharacterized protein LOC103419743 [Malus domestica]
Length=1341

 Score =   211 bits (538),  Expect(3) = 9e-87, Method: Compositional matrix adjust.
 Identities = 136/430 (32%), Positives = 198/430 (46%), Gaps = 68/430 (16%)
 Frame = +3

Query  1086  FMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLT  1265
             F  T+ D +     D+      P   N T I LVP + NP  V QFR I LCN SYK+++
Sbjct  515   FWNTLLDDVNCIVQDYMQGACSPKRLNSTYIVLVPKVKNPVSVGQFRPISLCNYSYKIVS  574

Query  1266  KAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGL-MVIKIDLE  1442
             K +  RLK  +  LI P Q++FV GRQI +N+ +  E+ + L  +  K    M IK+D+ 
Sbjct  575   KVLANRLKPILPDLISPMQSAFVSGRQIQDNIGIAHEMFHFLHXRKAKYKFEMGIKLDMH  634

Query  1443  KAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDP  1622
             KAYDR+ W F+ + +++ GF   W   +M CV T   A+  + +  + F   RGIRQGDP
Sbjct  635   KAYDRVEWDFLEAVMERMGFCSLWRNLVMGCVKTVDFAVILNGQPGRKFTPSRGIRQGDP  694

Query  1623  LSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASV  1802
             LSP LF+L                      +  +  C+          FFG      A+V
Sbjct  695   LSPYLFIL----------------------VNVQKSCM----------FFG------ANV  716

Query  1803  VKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHG  1982
                   E C++ G                             +P   + G YLG+PS  G
Sbjct  717   PNSLSAELCTVMG-----------------------------MPSAENPGLYLGLPSSWG  747

Query  1983  RLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRL  2162
             R K+ S A +  RI  ++  WK  TLS  G+  +I++VL AIP Y M     P  + S +
Sbjct  748   RSKKQSLAFVKGRILEKIQXWKQNTLSQAGKEVMIKAVLQAIPAYPMNXFKFPATLCSEM  807

Query  2163  ERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKED  2342
             + L   F WG   G ++ + +S   +   K  G +G +     N AL AK  W L+   D
Sbjct  808   DSLIAAFWWGQKGGEKRIHWVSKDLLGLPKQAGGMGFRGFKEFNDALLAKQCWXLIQDPD  867

Query  2343  GLCVKIMEAK  2372
              L  KI++A+
Sbjct  868   SLWAKILKAR  877


 Score = 97.8 bits (242),  Expect(3) = 9e-87, Method: Compositional matrix adjust.
 Identities = 83/306 (27%), Positives = 136/306 (44%), Gaps = 37/306 (12%)
 Frame = +1

Query  247   LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHTL---  417
             L+D+ + GP +TW +G+ +      RLDR L N  W+   P+  V+H P++ S H     
Sbjct  224   LMDMEFKGPPFTW-RGMRNGQLVEERLDRVLSNKLWQECWPNSLVIHEPVIGSDHCPLII  282

Query  418   -------GESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEA------NKSNLSKQLDDWN  558
                       + FRF A W      +E V S W+   S +              QL  W+
Sbjct  283   QSQPHGHKPKKVFRFEAFWAKEEKCKEIVESCWRRQYSGDGIARWQKKMHQCRSQLSCWS  342

Query  559   KHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSR  738
             ++   +       +L ++  +Q     Y      +  ++L   +  +   EE  W  RSR
Sbjct  343   RNAFKSRGIELDCLLNQLGDLQ-----YNWNQNFEQIQELTVSIGRLWEIEESYWLQRSR  397

Query  739   EEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDS  918
              +W+  GD NT F+H +T  R+  + V +L+D    W+ + D I   F   Y++LF   +
Sbjct  398   VKWLQEGDANTAFFHQSTLQRRRRNCVVKLQDGRQGWVENQDSIRHTFEDHYINLF---T  454

Query  919   TTQLEDLNDAFFPPLHTSQWLA---INAHFT----VKDLE-AVFEMAQFKAPSSDGFQTS  1074
             ++ L D   +    LH  Q +    +N   T    V++++ A F+M   KAP  +GFQ  
Sbjct  455   SSGLRDWGQS----LHCIQHMVSDQMNEELTRPVGVEEIKLAAFQMGGLKAPGPNGFQGI  510

Query  1075  FYQNSW  1092
             FYQ  W
Sbjct  511   FYQTFW  516


 Score = 63.5 bits (153),  Expect(3) = 9e-87, Method: Compositional matrix adjust.
 Identities = 85/356 (24%), Positives = 129/356 (36%), Gaps = 42/356 (12%)
 Frame = +2

Query  2414  WKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGK--QATLLSRIRYDPFDRVIR*SL*V  2587
             W  +L    +LL+G+   + N R+T  W+D WI    +   L  I   P  R +R     
Sbjct  897   WSSLLVGREVLLQGAHWQIMNGRTTRVWMDMWIPSIPEGHPLP-ISAVPVSRNLR-----  950

Query  2588  LGPRIGVAVG-------------ETFEPAS*GVLEYVGGVQLIR*L*A*KWPGLGRGLF-  2725
             +G  I  + G             E F      +L+   G  L+       WPG   G++ 
Sbjct  951   VGTLISDSSGTWDLDFLQPFISPEDFS----AILDTCIGDPLLEDRLV--WPGTRNGIYT  1004

Query  2726  ------W*ILC*INL*HYSRGLST----YRRVWNYI*SLKVPYRIRTFLWLARHDCHMTN  2875
                   W   C  ++    RG S+    + +VW  I  L  P +IR F+W A H    T 
Sbjct  1005  VKSGYHWKKAC--SMPFTGRGTSSSYLIHSKVWKAIWKLATPPKIRNFMWRALHRALATM  1062

Query  2876  TKRARRGFTSEVFCGICRNLPEDIDHIMQRCPIANSVW-ESLIPYDHRRL*DQDYTNWFD  3052
                  R  +    C IC    E ++H+   CP    +W    + Y   R        W  
Sbjct  1063  DVLFIRRCSPSPLCPICHAQEESVEHLFFLCPWVEPIWFGGSLSYRVNRESFSSLXAWLA  1122

Query  3053  EGI-SELSSGNRKHEQRVTFAVTMWWLWKWRNDLVFSGTNINLAARIKWIRDQVEEINIS  3229
                 ++L S +         A T W +WK R  L+F+    +    I  I + V     +
Sbjct  1123  SFFEAQLGSKDEIMRLLSYAAFTCWHIWKARCALIFNQKKPSPQQLILAISNSVGSFLEA  1182

Query  3230  FSKAKGLIAPIESICWRQLKWIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQGC  3397
                  GL+     +     +W  P   + K N+D S    +     G  IRD  GC
Sbjct  1183  SCAPMGLVRSSPPVSPSLDRWSPPYAPFWKVNVDASWTMLSKRGFXGXVIRDHXGC  1238



>ref|XP_009113016.1| PREDICTED: uncharacterized protein LOC103838337 [Brassica rapa]
Length=1257

 Score =   286 bits (732),  Expect(3) = 2e-86, Method: Compositional matrix adjust.
 Identities = 160/427 (37%), Positives = 243/427 (57%), Gaps = 2/427 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             V  ++IK    FFSTG L    N+T + L+P       V  +R I LCNV +K+++K ++
Sbjct  374   VGPAIIKEVQLFFSTGTLRPSQNNTHVRLIPKKTGAKRVADYRPIALCNVFFKIISKILS  433

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAYD  1454
             LRLK  + ++I    ++F+ GR IT+NVL+  EVL  L+ SK+ K   M +K D+ KAYD
Sbjct  434   LRLKPVLNIIISENHSAFIPGRAITDNVLITHEVLQFLKHSKAEKNCTMAVKTDMSKAYD  493

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             R+ W FI   LQ+ GFS  W   I+ CVST   +   +  +       RGIRQGDPLSP 
Sbjct  494   RIEWKFIEKVLQRLGFSDIWTNWILQCVSTVSYSYLINETVLGSVKPHRGIRQGDPLSPY  553

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LF+L  + LS L  ++ ++G  +G+++ R  P ++HL F DD +FF  AS    S +K  
Sbjct  554   LFILCGQVLSGLCSKAERDGTLQGIRVARGSPRVNHLLFADDTMFFCNASPESCSKLKSI  613

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L ++   SGQ+++  KS I FS  T  + + A  + LGI      G+YLG+P   GR K+
Sbjct  614   LLDYEKASGQKINSEKSSITFSSKTPEDKKSAAKTLLGIDKEGGTGKYLGLPEYFGRKKR  673

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
             D +  ++ RI+ R + W  R LS  G+ T+++SVL +IP Y M    LP  +  R++ + 
Sbjct  674   DMFTSVVDRIRQRASSWATRRLSKAGKLTMLKSVLLSIPTYPMSCFELPASLCKRIQSVL  733

Query  2175  RDFLWGSSKGN-RKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLC  2351
               F W   + N +K   I+W K+T+ K  G LG++ +   NQAL AK  W+++   D L 
Sbjct  734   TRFWWDDPQSNSKKMCWIAWSKMTKPKAGGGLGLRDIQLFNQALLAKQAWRILTAPDCLL  793

Query  2352  VKIMEAK  2372
              +++  K
Sbjct  794   ARVLLGK  800


 Score = 61.2 bits (147),  Expect(3) = 2e-86, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 62/135 (46%), Gaps = 11/135 (8%)
 Frame = +1

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             EE  W  RSR+ W++ GD NT ++HA T  RK+ + +  ++D+ G    + D I      
Sbjct  243   EEAFWRQRSRQLWLILGDANTAYFHAVTKGRKAKNRLSVMEDDSGVPWFEEDQIASVVCK  302

Query  889   FYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKD------LEAVFEMAQFKAP  1050
             +Y  LF    T+   D     +  L       IN   T KD       EA F +   KAP
Sbjct  303   YYNSLF----TSSHHDGQSTVWEALQPCITQQINEELT-KDPSPEEIREATFAIHPDKAP  357

Query  1051  SSDGFQTSFYQNSWA  1095
               DGF  SF+Q +W 
Sbjct  358   GPDGFSVSFFQANWC  372


 Score = 25.0 bits (53),  Expect(3) = 2e-86, Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 19/43 (44%), Gaps = 0/43 (0%)
 Frame = +2

Query  2402  MSNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQATL  2530
              S+ W+ IL    +L     K + N   T  W DSW+  Q  +
Sbjct  816   CSHGWRSILHGRDLLKGNVGKAIGNGEDTKVWNDSWLALQENI  858



>gb|AAP54692.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1585

 Score =   273 bits (699),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 146/428 (34%), Positives = 236/428 (55%), Gaps = 20/428 (5%)
 Frame = +3

Query  1092  GTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKA  1271
             G +K+ +++   +FF +G +  G NDT I L+P I  P  +  FR I LCNV YK+L+K 
Sbjct  877   GCIKNDIVRAVKEFFHSGIMLEGVNDTAIVLIPKIEQPRDLRDFRPISLCNVIYKVLSKC  936

Query  1272  MTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGLMVIKIDLEKA  1448
             +  RL+  +  LI   Q++FV  R IT+N L+  E  + + R+K+ +      K+DL KA
Sbjct  937   LVNRLRPFLDELISKNQSAFVPRRMITDNALLAFECFHFIQRNKNPRSAACAYKLDLSKA  996

Query  1449  YDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLS  1628
             YDR+ W F+  ++ K GFS  W+  +M+C+ST               + ++G R      
Sbjct  997   YDRVDWRFLEQSMYKWGFSHCWVSWVMTCIST---------------VCDKGTR----CD  1037

Query  1629  PLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVK  1808
             P LF+   + LS L+E+ V+ G    +++  + P ISHL F DD + F +A L Q+  +K
Sbjct  1038  PFLFLFVADGLSLLLEEKVEQGAISPIRVCHQAPGISHLLFADDTLLFFKADLSQSQAIK  1097

Query  1809  KCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRL  1988
             +    + + +GQ ++  K  I F  +  +  + AI++ L I       +YLG+P+  GR+
Sbjct  1098  EVFGSYATSTGQLINPTKCSILFGNSLPIASRDAITNCLQIASTEFEDKYLGLPTPGGRM  1157

Query  1989  KQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLER  2168
              +  +  L  RI  ++  W    LS  G+  LI++V+ AIP Y M    LP+ V   L  
Sbjct  1158  HKGRFQSLRERIWKKILQWGENYLSSGGKEVLIKAVIQAIPVYVMGIFKLPESVCEDLTS  1217

Query  2169  LSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGL  2348
             L+R+F WG+ KG RK +  +WK +T+SK  G LG + +   NQAL A+  W+L++  D L
Sbjct  1218  LTRNFWWGAEKGKRKTHWKAWKSLTKSKSLGGLGFKDIRLFNQALLARQAWRLIDNPDSL  1277

Query  2349  CVKIMEAK  2372
             C ++++AK
Sbjct  1278  CARVLKAK  1285


 Score = 77.4 bits (189),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 72/293 (25%), Positives = 122/293 (42%), Gaps = 39/293 (13%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             F+D +    L DLG SG  +T+       N    RLDRAL + EW+      +V HL   
Sbjct  623   FRDVLDTCELHDLGISGLPHTYDNRRGGWNNVKVRLDRALADDEWRDLFSQYQVQHLVSP  682

Query  400   NSYHTLGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQLDDWNKHTIGNI  579
              S H                               + L+ + S   +    W+K    NI
Sbjct  683   CSNHC-----------------------------PIVLKLHGSVPDQS---WSKKKYKNI  710

Query  580   FRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREEWIVSG  759
              R   +   ++S      ++ +        R+    ++E+LY+EE+LW  RSR  W+  G
Sbjct  711   GRELEKTRKKLS------NLLEAGTDKAAIRQTSDYMNELLYREEMLWLQRSRVNWLKEG  764

Query  760   DRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTTQLEDL  939
             DRNT+F+H   A R   + + +L+D  G +      + +    ++ D+F+ D       +
Sbjct  765   DRNTKFFHNRVAWRAKKNKITKLRDAAGTFHRSKMVMEQMATQYFKDMFTADPNLDHSPV  824

Query  940   NDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQTSFYQNSWA  1095
                  P +       + + F+  ++  A+F++   KAP +DGF   FYQ +W 
Sbjct  825   TRLIQPKVTEEMNNRLCSEFSEDEIANALFQIGPLKAPGTDGFLARFYQRNWG  877



>gb|AAO00713.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1557

 Score =   273 bits (698),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 146/428 (34%), Positives = 236/428 (55%), Gaps = 20/428 (5%)
 Frame = +3

Query  1092  GTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKA  1271
             G +K+ +++   +FF +G +  G NDT I L+P I  P  +  FR I LCNV YK+L+K 
Sbjct  849   GCIKNDIVRAVKEFFHSGIMLEGVNDTAIVLIPKIEQPRDLRDFRPISLCNVIYKVLSKC  908

Query  1272  MTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGLMVIKIDLEKA  1448
             +  RL+  +  LI   Q++FV  R IT+N L+  E  + + R+K+ +      K+DL KA
Sbjct  909   LVNRLRPFLDELISKNQSAFVPRRMITDNALLAFECFHFIQRNKNPRSAACAYKLDLSKA  968

Query  1449  YDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLS  1628
             YDR+ W F+  ++ K GFS  W+  +M+C+ST               + ++G R      
Sbjct  969   YDRVDWRFLEQSMYKWGFSHCWVSWVMTCIST---------------VCDKGTR----CD  1009

Query  1629  PLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVK  1808
             P LF+   + LS L+E+ V+ G    +++  + P ISHL F DD + F +A L Q+  +K
Sbjct  1010  PFLFLFVADGLSLLLEEKVEQGAISPIRVCHQAPGISHLLFADDTLLFFKADLSQSQAIK  1069

Query  1809  KCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRL  1988
             +    + + +GQ ++  K  I F  +  +  + AI++ L I       +YLG+P+  GR+
Sbjct  1070  EVFGSYATSTGQLINPTKCSILFGNSLPIASRDAITNCLQIASTEFEDKYLGLPTPGGRM  1129

Query  1989  KQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLER  2168
              +  +  L  RI  ++  W    LS  G+  LI++V+ AIP Y M    LP+ V   L  
Sbjct  1130  HKGRFQSLRERIWKKILQWGENYLSSGGKEVLIKAVIQAIPVYVMGIFKLPESVCEDLTS  1189

Query  2169  LSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGL  2348
             L+R+F WG+ KG RK +  +WK +T+SK  G LG + +   NQAL A+  W+L++  D L
Sbjct  1190  LTRNFWWGAEKGKRKTHWKAWKSLTKSKSLGGLGFKDIRLFNQALLARQAWRLIDNPDSL  1249

Query  2349  CVKIMEAK  2372
             C ++++AK
Sbjct  1250  CARVLKAK  1257


 Score = 77.0 bits (188),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 122/294 (41%), Gaps = 39/294 (13%)
 Frame = +1

Query  217   GFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPM  396
              F+D +    L DLG SG  +T+       N    RLDRAL + EW+      +V HL  
Sbjct  594   AFRDVLDTCELHDLGISGLPHTYDNRRGGWNNVKVRLDRALADDEWRDLFSQYQVQHLVS  653

Query  397   VNSYHTLGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQLDDWNKHTIGN  576
               S H                               + L+ + S   +    W+K    N
Sbjct  654   PCSNHC-----------------------------PIVLKLHGSVPDQS---WSKKKYKN  681

Query  577   IFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREEWIVS  756
             I R   +   ++S      ++ +        R+    ++E+LY+EE+LW  RSR  W+  
Sbjct  682   IGRELEKTRKKLS------NLLEAGTDKAAIRQTSDYMNELLYREEMLWLQRSRVNWLKE  735

Query  757   GDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTTQLED  936
             GDRNT+F+H   A R   + + +L+D  G +      + +    ++ D+F+ D       
Sbjct  736   GDRNTKFFHNRVAWRAKKNKITKLRDAAGTFHRSKMVMEQMATQYFKDMFTADPNLDHSP  795

Query  937   LNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQTSFYQNSWA  1095
             +     P +       + + F+  ++  A+F++   KAP +DGF   FYQ +W 
Sbjct  796   VTRLIQPKVTEEMNNRLCSEFSEDEIANALFQIGPLKAPGTDGFLARFYQRNWG  849



>ref|NP_001057661.2| Os06g0484800 [Oryza sativa Japonica Group]
 gb|EAZ37043.1| hypothetical protein OsJ_21387 [Oryza sativa Japonica Group]
 dbj|BAF19575.2| Os06g0484800 [Oryza sativa Japonica Group]
Length=935

 Score =   266 bits (680),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 149/427 (35%), Positives = 241/427 (56%), Gaps = 4/427 (1%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             +KD L+    DF+ TG++P   N T I L+P          FR I LCNV YK+L K++ 
Sbjct  284   IKDDLMTLVQDFYQTGNIPPELNKTNIVLIPKKNRSISPKDFRPISLCNVPYKILAKSIA  343

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
              R+K  +   I   Q +F+ GR+I NN+++ QE+++S    S      +IKIDL KA+DR
Sbjct  344   NRIKGKLPDFICDSQHAFIPGRRIANNIIIAQEIVHSFGLNSYPHHAFLIKIDLSKAFDR  403

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             L W FI + LQ+ GF   +I  ++SC+++S  +++ + +    F   RGIRQG PLSP L
Sbjct  404   LEWDFIANALQRKGFHHHFINLVLSCINSSSFSVNINGQTYGAFNANRGIRQGCPLSPYL  463

Query  1638  FVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCL  1817
             F   +  LS  + ++++N    G+K++  G  I  L + DDL+  G A++ +A+ +K  +
Sbjct  464   FCFALNELSDQLNEALQNHNINGIKLSVSGAVIHSLLYADDLIITGTATVEEANQIKSII  523

Query  1818  NEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVP-SIHGRLKQ  1994
             ++FC  SGQ  ++ KS I FSK+    I+  IS    +PI++   R+LG P  +  R K 
Sbjct  524   DKFCRKSGQTPNWDKSGILFSKHIPSHIKNYISQIFPVPILDSNVRHLGHPLFVTNRNKS  583

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
               Y  ++ + +A+LT  K   LS  GR TLI+SV S++P Y M + LL + +L+++  + 
Sbjct  584   IIYKFIIDKFRAKLTTLKANKLSHAGRLTLIKSVFSSLPVYYMATILLSKNLLNKITAII  643

Query  2175  RDFLW-GSSKGNRKCNLI--SWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDG  2345
             R F W G  +G  K  L   SWK++    D+G L I+ +  +N++L     W+L+     
Sbjct  644   RKFWWTGVREGQDKNPLCLKSWKEICRPLDEGGLEIRDIQAVNKSLILNSAWRLITNPHE  703

Query  2346  LCVKIME  2366
                +I++
Sbjct  704   QMAQILK  710


 Score = 83.6 bits (205),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 126/299 (42%), Gaps = 36/299 (12%)
 Frame = +1

Query  256   LGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHT-------  414
             +GY+GPAYTW            RLDR L N+EW    P+  V H+P++   H        
Sbjct  1     MGYNGPAYTWTNKRKGNEVIFERLDRCLANVEWCHHFPNTNVYHIPLIYGDHAPILVLLN  60

Query  415   ---LGESRRFRFNAAW*THPNYQE*VSSTWK-SDVSLEANKSNLSKQLDDWNKHTIGNIF  582
                    R F+F   W    ++     ++W   + S  +    LSK L  W+K       
Sbjct  61    PNFRKPKRSFKFENWWLLEEDFNTVAKNSWNDCNGSFVSKTKFLSKNLSTWSK-------  113

Query  583   RRK*RVLARISGVQRSLSVYQkldlikldrklrreldei--lYQEELLWF*RSR--EEWI  750
              +K  +  +I   +  +   Q            +EL     L  E+L  F R R  ++WI
Sbjct  114   -KKKPIQDQIVSTEEDIKQIQASQDRHNLVDKEKELIAKYDLLLEKLSEFHRQRAKKDWI  172

Query  751   VSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTTQL  930
               GDRNT F+  A   R+  + +  +  N   +I++ D I + F  ++ DLF  D T   
Sbjct  173   KDGDRNTSFFQQAAIKRRRKNRIASIVSN-DVYITNPDDIAQIFINYFSDLFCSDRT---  228

Query  931   EDLNDAFFPPLHTSQWLAINAHFTVKDLEAVFE----MAQFKAPSSDGFQTSFYQNSWA  1095
              D  + + P   + Q +     + + D E ++     M +  +P  DG   +FY+++W+
Sbjct  229   -DRPNTYLPNTTSPQEM----DWQIPDEEEIWSIIKGMRKNASPGPDGLNAAFYRSAWS  282



>ref|XP_010039996.1| PREDICTED: uncharacterized protein LOC104428743 [Eucalyptus grandis]
Length=1237

 Score =   316 bits (810),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 156/404 (39%), Positives = 256/404 (63%), Gaps = 1/404 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             +K ++IK   DFF+ G +P   N T++ LVP + +   ++Q+R I LCN +YK+++K M 
Sbjct  339   IKANVIKTVRDFFTLGIMPRALNRTILVLVPKVHHLESIDQYRPISLCNFAYKIISKVMA  398

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAYD  1454
              RLK  +  LI   Q +FV  RQI +N++V QEVL+  +  KS K   +++K D++KAYD
Sbjct  399   NRLKPWLPNLISKEQAAFVKDRQIQDNIMVVQEVLHQFKVRKSKKKFNLLLKTDMQKAYD  458

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             R+ W F+++ + + GF+  W+R +M+C++T+ L++ F+      F   RG+RQGDPLSP 
Sbjct  459   RVEWDFLQAYMLQLGFNDRWVRLVMACITTTSLSVRFNGEQLASFQPSRGLRQGDPLSPY  518

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             +F+L    LS LI Q+V+ GQ +G+K  R  P +SHLFF DD VFF +A++ +A  +   
Sbjct  519   IFILLANALSTLITQAVEMGQLQGIKFNRACPTLSHLFFADDSVFFLKATISEAQNLANI  578

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             LN++C  +GQ ++  KS ++FSKN S+ +QQ I+S   +P++N  G+YLG+PS  GR K+
Sbjct  579   LNQYCQATGQIINRNKSGLYFSKNCSLSLQQNIASEFRMPVMNRYGKYLGIPSDWGRSKR  638

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
             + ++ +++++ A+L GWK R LS  G+  L++SV+ A+P Y M    LP  +   +E+  
Sbjct  639   EMFSWILAKVNAKLDGWKERLLSRSGKEILLKSVIQALPQYAMSIFKLPLSLCRLIEKKI  698

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALF  2306
              +F W ++ G    +  +W  +  SKD G +G + L   N+A+ 
Sbjct  699   SEFWWSNNNGKTGIHWQNWTSLKLSKDSGGMGFRDLVSFNKAML  742



>ref|XP_009130050.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1128

 Score =   285 bits (729),  Expect(3) = 4e-86, Method: Compositional matrix adjust.
 Identities = 150/431 (35%), Positives = 246/431 (57%), Gaps = 2/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             ++   +K  +++    FF TG L    N T ICL+P I  P  +  FR I LCNV+YK++
Sbjct  217   QYWDDLKTDIVREVQQFFETGVLDKQLNHTNICLIPKIYPPSGMTDFRPIALCNVAYKVI  276

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKG-GLMVIKIDL  1439
             +K +  RLK  +  LI   Q +F+ GR IT+N+++  EV + L+++  +    M +K D+
Sbjct  277   SKVLINRLKIHLHSLITENQQAFIPGRVITDNIIIAHEVFHCLKARKRQATSYMAVKTDI  336

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDRL W F+  T+++ GF   WI+ IM+CV+T   ++  +     +    RGIRQGD
Sbjct  337   TKAYDRLEWGFLEETMRRMGFHVKWIQWIMACVNTVSFSVLINGSPEGYLEPGRGIRQGD  396

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  E LSH++ +++ +    G+KI+ + P ++HL F DD +FF  A+     
Sbjct  397   PLSPYLFILCAEVLSHMMNRAMVDRSLLGVKISLQAPPVNHLLFADDSLFFSLANARACK  456

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              +KK L ++   SGQ ++ MKS I F    S  ++  + + LGI     +G+YLG+P   
Sbjct  457   KLKKILGDYERASGQAVNLMKSSITFGHKISDVVRTQMRNILGIHNEGGIGKYLGMPEQF  516

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
              R K D +  ++ +++A   GW  + LS  G+  L++S+  A+P ++M    LP+ V   
Sbjct  517   TRRKSDMFTYIVDKVKAVTQGWSQKYLSPGGKEVLLKSIALAMPIFSMNVFRLPKEVCDE  576

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             + R+   F WGS + N+  +   WK+V+  K +G LG + L+  NQAL  K  W+++   
Sbjct  577   INRVLARFWWGSGE-NKGMHWYDWKRVSLPKSEGGLGFRDLEKFNQALLGKQVWRILQNP  635

Query  2340  DGLCVKIMEAK  2372
               L  +I++A+
Sbjct  636   GCLMARILKAR  646


 Score = 62.0 bits (149),  Expect(3) = 4e-86, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 67/136 (49%), Gaps = 11/136 (8%)
 Frame = +1

Query  706   QEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFH  885
             +EE+ W  +SR +W+ SGDRNT ++HA T  ++  + +  L+D  G       GI     
Sbjct  88    EEEVYWQQKSRVQWLRSGDRNTTYFHAITKGKRYRNNISSLQDMAGVTHRGQRGIGRVAQ  147

Query  886   AFYMDLFSEDSTTQLEDLNDAFFP--PLHTSQWLAINAHFTVKDLE-----AVFEMAQFK  1044
              ++ +LF+  S+     L DA F   P+  ++   IN   T +  E     A+F++   +
Sbjct  148   EYFCNLFT--SSPPDLGLYDAVFEGFPIRVTE--DINTDLTREVTEEEIKQAMFDIGSHR  203

Query  1045  APSSDGFQTSFYQNSW  1092
             AP  DGF   FY   W
Sbjct  204   APGPDGFSAVFYHQYW  219


 Score = 23.9 bits (50),  Expect(3) = 4e-86, Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 21/51 (41%), Gaps = 0/51 (0%)
 Frame = +2

Query  2393  KSGMSNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQATLLSRIR  2545
             K+  S  WK IL    ++ +G + ++ +      W D WI        R R
Sbjct  659   KTKASYAWKSILYGRDLVKQGMRYIIGDGSLINTWTDPWIPDHTPRAPRPR  709


 Score = 64.7 bits (156),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 105/230 (46%), Gaps = 24/230 (10%)
 Frame = +2

Query  2774  STYRRVWNYI*SLKVPYRIRTFLW--LARHDCHMTNTKRARRGFTSEVFCGICRNLPEDI  2947
             S  +++WN     K+P +I  F+W  L+R      N KR  R    +  C  C N  E  
Sbjct  796   SLKKKIWN----TKLPSKIHHFIWKVLSRSIASGANLKR--RHIMPDAQCRRCCNGDETD  849

Query  2948  DHIMQRCPIANSVWES-----LIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFA  3112
              H++  C  A  +W +      I  D R   ++      +  +   +S + +H   + F 
Sbjct  850   KHLLFDCIYAQQIWRASGISNTILTDPRASLEEK----IEVCLQCCTSIHLRHLTNLPFW  905

Query  3113  VTMWWLWKWRNDLVFSGTNINLAARIKWIRDQVEE----INISFSKAKGLIAPIESICWR  3280
             + +W +WK RN L+F    I+    ++  R   +E      ++ S  +  I+  +++   
Sbjct  906   L-LWRIWKSRNLLIFQNKQIDGRHVLQQARRDAQEWSTHSTLNVSSGRPNISSQQTLMQN  964

Query  3281  QLKWIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNIGL  3430
             Q +W RP VGW+K N+D S + + + ++ G  IRD+ G   KG    IG+
Sbjct  965   Q-RWKRPPVGWLKCNVDASFVNAETPSKAGWIIRDENGT-YKGAGQGIGV  1012



>gb|AAB82639.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1374

 Score =   271 bits (693),  Expect(3) = 7e-86, Method: Compositional matrix adjust.
 Identities = 149/444 (34%), Positives = 241/444 (54%), Gaps = 1/444 (0%)
 Frame = +3

Query  1074  LLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSY  1253
             L  +F  T+ D + +    FF +G +  G N T ICL+P I     +  FR I LCNV Y
Sbjct  455   LYQQFWETMGDQITEMVQAFFRSGSIEEGMNKTNICLIPKILKAEKMTDFRPISLCNVIY  514

Query  1254  KMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIK  1430
             K++ K M  RLK  +  LI   Q +FV GR I++N+L+  E+L++L S +      + IK
Sbjct  515   KVIGKLMANRLKKILPSLISETQAAFVKGRLISDNILIAHELLHALSSNNKCSEEFIAIK  574

Query  1431  IDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIR  1610
              D+ KAYDR+ W F+   ++  GF+  WIR IM CV + R  +  +       +  RG+R
Sbjct  575   TDISKAYDRVEWPFLEKAMRGLGFADHWIRLIMECVKSVRYQVLINGTPHGEIIPSRGLR  634

Query  1611  QGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLH  1790
             QGDPLSP LFV+  E L  +++ + +  Q  G+K+ R  P ISHL F DD +F+ + +  
Sbjct  635   QGDPLSPYLFVICTEMLVKMLQSAEQKNQITGLKVARGAPPISHLLFADDSMFYCKVNDE  694

Query  1791  QASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVP  1970
                 + + + E+   SGQR++Y+KS I+F K+ S E +  +   LGI      G YLG+P
Sbjct  695   ALGQIIRIIEEYSLASGQRVNYLKSSIYFGKHISEERRCLVKRKLGIEREGGEGVYLGLP  754

Query  1971  SIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGV  2150
                   K  + + L  R+  ++ GW++  LS  G+  L+++V  A+P YTM    +P+ +
Sbjct  755   ESFQGSKVATLSYLKDRLGKKVLGWQSNFLSPGGKEILLKAVAMALPTYTMSCFKIPKTI  814

Query  2151  LSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLM  2330
               ++E +  +F W + K  R  +  +W  ++  K  G LG + ++  N AL  K  W+++
Sbjct  815   CQQIESVMAEFWWKNKKEGRGLHWKAWCHLSRPKAVGGLGFKEIEAFNIALLGKQLWRMI  874

Query  2331  NKEDGLCVKIMEAKVQLPSLPSQA  2402
              ++D L  K+ +++    S P  A
Sbjct  875   TEKDSLMAKVFKSRYFSKSDPLNA  898


 Score = 72.0 bits (175),  Expect(3) = 7e-86, Method: Compositional matrix adjust.
 Identities = 80/314 (25%), Positives = 146/314 (46%), Gaps = 32/314 (10%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             L F+  +   GL ++ +SG  ++W  G  +      RLDR + N  W    P  +  +L 
Sbjct  158   LEFRQMLNSCGLWEVNHSGYQFSWY-GNRNDELVQCRLDRTVANQAWMELFPQAKATYLQ  216

Query  394   MVNSYHT------LGESRR----FRFNAAW*THPNYQE*VSSTW-----KSDVSLEANKS  528
              + S H+      +G++ R    F+++  W     +++ + + W     K++  +    +
Sbjct  217   KICSDHSPLINNLVGDNWRKWAGFKYDKRWVQREGFKDLLCNFWSQQSTKTNALMMEKIA  276

Query  529   NLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSL--SVYQkldlikldrklrreldeil  702
             +  +++  W + +       K     RI  +Q  L  +  Q     +   +L++EL +  
Sbjct  277   SCRREISKWKRVS-------KPSSAVRIQELQFKLDAATKQIPFDRRELARLKKELSQEY  329

Query  703   YQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFG-EWISDGDGILEP  879
               EE  W  +SR  W+ +GDRNT+++HAAT  R++ + +++L D  G EW SD D +   
Sbjct  330   NNEEQFWQEKSRIMWMRNGDRNTKYFHAATKNRRAQNRIQKLIDEEGREWTSDED-LGRV  388

Query  880   FHAFYMDLF-SEDSTTQLEDLNDAFFPPLHTSQW-LAINAHFTVKDLE-AVFEMAQFKAP  1050
               A++  LF SED    +E+L +    PL + Q    + A  T ++++ A F +   K P
Sbjct  389   AEAYFKKLFASEDVGYTVEELEN--LTPLVSDQMNNNLLAPITKEEVQRATFSINPHKCP  446

Query  1051  SSDGFQTSFYQNSW  1092
               DG     YQ  W
Sbjct  447   GPDGMNGFLYQQFW  460


 Score = 27.3 bits (59),  Expect(3) = 7e-86, Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 21/39 (54%), Gaps = 0/39 (0%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQ  2521
             S  WK I ++  ++ +G + ++ N  +   W D WIG +
Sbjct  905   SFAWKSIYEAQVLIKQGIRAVIGNGETINVWTDPWIGAK  943


 Score = 64.3 bits (155),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 77/195 (39%), Gaps = 6/195 (3%)
 Frame = +2

Query  2789  VWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRC  2968
             ++  I  L VP +I  FLW   ++C    +  A R    E  C  C +  E ++H++ +C
Sbjct  1050  IFQQIWKLDVPPKIHHFLWRCVNNCLSVASNLAYRHLAREKSCVRCPSHGETVNHLLFKC  1109

Query  2969  PIANSVWE-SLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWRN  3145
             P A   W  S +P        +         +S   S   + +        +W LWK RN
Sbjct  1110  PFARLTWAISPLPAPPGGEWAESLFRNMHHVLSVHKSQPEESDHHALIPWILWRLWKNRN  1169

Query  3146  DLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGWVKAN  3325
             DLVF G        I    + ++  N        + +     C   +KW  P  GWVK N
Sbjct  1170  DLVFKGREFTAPQVILKATEDMDAWNNRKEPQPQVTSSTRDRC---VKWQPPSHGWVKCN  1226

Query  3326  IDGSSIPSNSIARCG  3370
              DG+   S  +  CG
Sbjct  1227  TDGAW--SKDLGNCG  1239



>ref|XP_009124289.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103849230 
[Brassica rapa]
Length=1774

 Score =   262 bits (669),  Expect(3) = 9e-86, Method: Compositional matrix adjust.
 Identities = 150/438 (34%), Positives = 228/438 (52%), Gaps = 28/438 (6%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             KF   VK+ L +  + F   G + +G NDT ICL+P    P  + QFR I LCNVSYK++
Sbjct  437   KFWDIVKEDLTRMVNQFLFEGTVTSGLNDTNICLIPKTTRPNEMAQFRPISLCNVSYKII  496

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDL  1439
             +K                       GR+I       QE+ ++LR+K SG+   M IK D+
Sbjct  497   SK-----------------------GRKIRQP----QELFHALRTKPSGRNNRMAIKTDM  529

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ WSFI + L+K GFS  WI  +M C+++ +  +  +       +  RG+RQGD
Sbjct  530   SKAYDRMEWSFIEAVLRKMGFSETWIGWVMRCITSVKYKVLMNGEPRGNIIPGRGLRQGD  589

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             P SP +F+L  E L  L+  +   G+  GM++TR  P +SHL F DD +FF +A   +  
Sbjct  590   PXSPFIFILCTEALVSLLNHAEIQGKITGMRVTRACPSVSHLLFADDSLFFCKAEPRECE  649

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              V K + ++   SGQ +++ KS + F K  +V ++Q +   LGI     +G YLG+P   
Sbjct  650   EVMKVVRKYGKASGQCINFDKSSLLFGKRINVAMRQELKDVLGIQNEGGMGTYLGIPEDI  709

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
                K   +A L  ++  R+ GW  R LS  G+  LI+S+L A+P Y M + LLP  +   
Sbjct  710   SGSKCKLFAFLKEKLMHRVNGWTGRWLSKGGKEVLIKSILLALPTYVMSTFLLPLEICEN  769

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             L      F W S+   R  +   W+KV   +++G +G + +   N AL AK  W+L+   
Sbjct  770   LASAIAQFWWSSNPPKRGIHWAKWEKVCLPREEGGIGFRMIHEFNLALLAKQLWRLVQFP  829

Query  2340  DGLCVKIMEAKVQLPSLP  2393
             D L  +++  +    S P
Sbjct  830   DSLVARVLRGRYYRLSSP  847


 Score = 85.1 bits (209),  Expect(3) = 9e-86, Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 138/314 (44%), Gaps = 31/314 (10%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             L F+  +   G+++  ++G   +W+   +  +    RLDRA+ N +W  + P   V ++ 
Sbjct  136   LPFKQMLNDCGMLEFLFTGDMLSWVGKRAGGSTVRCRLDRAVGNSDWHEKFPHSTVKYMR  195

Query  394   MVNSYH----------TLGESRRFRFNAAW*THPNYQE*VSSTWKSD-----VSLEANKS  528
             +  S H              SR+F+F+  W  +   ++ +   WKS       ++  + S
Sbjct  196   LWGSDHRPILADILIKPTRRSRKFKFDKRWLDNEELRQIILEGWKSPDLPPHATIMEHIS  255

Query  529   NLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQ  708
             +  K L DW +    N  +    +  ++ G+      Y   +          +      +
Sbjct  256   SCRKALSDWRRQHNVNSAKLVEELKEKVEGL------YADDNATTEQIAAALKELSDALK  309

Query  709   -EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFH  885
              EEL W  +SR  W+  GD+NT+F+HA T  R++ + + +L D  G  + D +G++    
Sbjct  310   AEELFWKQKSRVFWLREGDKNTKFFHALTKQRRARNKITQLLDENGNAVEDEEGLVAIAT  369

Query  886   AFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-----AVFEMAQFKAP  1050
             +++  +F    ++  ED+ DA    + TS   A+N + T    E     A+F M   KAP
Sbjct  370   SYFRQIF---ESSNPEDIEDA-LSQVSTSITGAMNDNLTAPVSEWEIKLALFAMHPEKAP  425

Query  1051  SSDGFQTSFYQNSW  1092
               DG    FYQ  W
Sbjct  426   GPDGMTALFYQKFW  439


 Score = 22.7 bits (47),  Expect(3) = 9e-86, Method: Compositional matrix adjust.
 Identities = 10/36 (28%), Positives = 17/36 (47%), Gaps = 0/36 (0%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             S VW  I  +  +LL G ++ + +      W D W+
Sbjct  857   SYVWTSISAARKLLLLGIRQKIHSGHEVKVWEDPWV  892


 Score = 71.2 bits (173),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 74/140 (53%), Gaps = 11/140 (8%)
 Frame = +3

Query  2049  NRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLIS  2228
             ++ LS  G+  L++SV  A+P + M    LP+ V ++L     DF W S    +K + ++
Sbjct  1277  SKALSQVGKEILLKSVGLALPIFAMSCFKLPKDVCAKLTSAMIDFWWSSGNNRKKISWVA  1336

Query  2229  WKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAKV---------QL  2381
             W+K+ + K+ G LG + L+  NQ+L AK  W++ +K + L  +I+  +           +
Sbjct  1337  WQKLCKDKEAGGLGFKELEKFNQSLLAKQAWRIWDKPESLVARILRHRYFRNSGFLDSGV  1396

Query  2382  PSLPSQACQ--MYGRVFLSR  2435
              S PS A +  ++GR  L R
Sbjct  1397  GSRPSYAWRSILHGRDLLKR  1416



>ref|XP_010674085.1| PREDICTED: uncharacterized protein LOC104890338 [Beta vulgaris 
subsp. vulgaris]
Length=1568

 Score =   274 bits (700),  Expect(3) = 9e-86, Method: Compositional matrix adjust.
 Identities = 156/433 (36%), Positives = 243/433 (56%), Gaps = 6/433 (1%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             VK  + +   +F+++ HLP GCN   I L+P + NP  +  +R I +    YK++ K M 
Sbjct  650   VKHDIYEIVHNFWASAHLPKGCNTAYITLIPKVENPTSLKDYRPISMVGSIYKIIAKVMA  709

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
              RL+  +  LIGP Q+S++ GRQI +  LV  EV++S + KSG   ++  K+D  KAYD 
Sbjct  710   RRLQKVVNSLIGPLQSSYIEGRQILDGALVAGEVIDSYK-KSGNEAIL-FKLDFHKAYDS  767

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             +SWSF++ TL++  F P W   IM+CV+T+  +I  +      F L+RG+RQGDPLSP L
Sbjct  768   ISWSFLKWTLEQMKFPPKWCEWIMTCVTTASASILINGSPCTPFKLKRGLRQGDPLSPFL  827

Query  1638  FVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCL  1817
             FVL  E L+ +I ++V+ G W G+++ + G  ++HL + DD + F EA +     +KK L
Sbjct  828   FVLIGEVLNQVIAKAVEKGLWSGVEVCKNGLKVTHLQYADDTLIFSEAKMESLKNIKKAL  887

Query  1818  NEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ-  1994
               F   SG ++++ KS I    NTS E     +SSL   I N    YLG+P I G L + 
Sbjct  888   ILFHLASGLQVNFHKSSI-IGMNTSKEWILEAASSLLCKIGNIPFTYLGLP-IGGNLSRL  945

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
              ++  ++ +I  +L  WK + LS  GR TLI+S L+ +P Y M    +P+GV+ ++ +++
Sbjct  946   QAWDPIIDKISHKLASWKGKMLSIGGRITLIKSSLANLPLYYMSLFSIPKGVVEKMNKIT  1005

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGL-C  2351
             R FLW  S   R   L++W  +   K  G L I  +   N A+ +K  W+ +       C
Sbjct  1006  RQFLWSGSMEKRSLPLVAWNIIQLPKSLGGLSIGNIIHKNIAMLSKWIWRFLQDPSPFWC  1065

Query  2352  VKIMEAKVQLPSL  2390
               I E     P++
Sbjct  1066  AVIREKYKYAPNI  1078


 Score = 72.8 bits (177),  Expect(3) = 9e-86, Method: Compositional matrix adjust.
 Identities = 76/306 (25%), Positives = 137/306 (45%), Gaps = 24/306 (8%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVL-----  384
             F+ ++    L+++  +   +TW +  S      + LDR   + EW  + P ++V      
Sbjct  351   FKQFVQESHLLEIPSTCGGFTWFRSNSK-----SILDRLFVHSEWISKFPALKVTLLQRG  405

Query  385   ---HLPM-VNSYHTLGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKS--NLSKQL  546
                H P+ V+S       + FRF   W T P   + V++ W+   +L   +    + KQL
Sbjct  406   LSDHCPLLVHSKELNWGPKPFRFQNCWLTDPRCLKIVNNVWQKSAALHTVEKLREVKKQL  465

Query  547   DDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreld-eilYQEELLW  723
               WN    GNI     R+   I  + R  ++    D    +RK  +      + ++E+ W
Sbjct  466   KTWNHDEFGNIDSSIKRLEEEIQKLDRINNLRDLDDQELEERKKAQSELWMWIKRKEMYW  525

Query  724   F*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDL  903
                SR  W+  GDRNT+F+HA  + ++  + +  + D  G+ I +   I     AF+  +
Sbjct  526   AQNSRITWLKEGDRNTKFFHAIASNKRRKNFIASI-DIGGQIIDEPSRIKFEATAFFKSI  584

Query  904   FSEDSTTQ--LEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTS  1074
             F E+   +   E+LN   F  +   Q   +   F+ ++++ AV   +  KAP  DGF   
Sbjct  585   FKEEHVRRPVFENLN---FKHVSQEQASQLTLPFSCEEIDSAVASCSVDKAPGPDGFNFK  641

Query  1075  FYQNSW  1092
             F +++W
Sbjct  642   FIKSAW  647


 Score = 22.7 bits (47),  Expect(3) = 9e-86, Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 13/25 (52%), Gaps = 0/25 (0%)
 Frame = +2

Query  2441  ILLKGSKKLVKNDRSTLFWLDSWIG  2515
             IL  G +K +     T FWLD W+ 
Sbjct  1108  ILCNGIRKNIGRGSQTRFWLDPWLS  1132



>ref|XP_010684019.1| PREDICTED: uncharacterized protein LOC104898622 [Beta vulgaris 
subsp. vulgaris]
Length=1162

 Score =   285 bits (728),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 152/431 (35%), Positives = 246/431 (57%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             +F   + D +  F S+       P+  N+T I L+P + NP     FR I LCNV YK++
Sbjct  383   RFWHIIGDDVTLFVSNILHGILSPSCVNNTNIALIPKVKNPTKAADFRPIALCNVLYKLV  442

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKS-GKGGLMVIKIDL  1439
             +K++ +R+K  +  +I   Q++FV GR IT+N L+  EV +S++++S  + G + +K+D+
Sbjct  443   SKSLVIRMKDFLPQMISEQQSAFVPGRLITDNALIAMEVFHSMKNRSRSQRGTIAMKLDM  502

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+R  L   GF   W+   M+CVS+   +   +  +    +  RG+RQGD
Sbjct  503   SKAYDRVEWGFLRKLLLTMGFDGRWVNLSMNCVSSVTYSFIINGGVCGSVVPARGLRQGD  562

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF++  +  S +I++ V++ Q  G K +R GP ISHLFF DD + F  A+  + +
Sbjct  563   PLSPYLFIMIADAFSKMIQKKVQDKQIHGAKASRSGPDISHLFFADDKLLFTRATRQECT  622

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             V+   LN +   SGQ+++Y KS + FSK  S   ++ ++S L +  V+   +YLG+PSI 
Sbjct  623   VIVDILNLYELASGQKINYEKSEVSFSKGVSSTQREELTSILNMRQVDKHEKYLGIPSIS  682

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
              R K+  +  L  RI  +L GWK + LS  G+  L++SV+  IP Y M    +P  ++ +
Sbjct  683   SRSKKAIFDSLTDRIWKKLQGWKEKLLSRAGKEILLKSVIQVIPTYLMGVYKIPCMIIQK  742

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             ++     F WGSS   RK +  SW  +   K  G +G + L   N AL  +  W+L+ + 
Sbjct  743   IQSAMARFWWGSSNSQRKVHWKSWDSLCSPKCLGGMGFKDLKVFNDALLGRQAWRLIREP  802

Query  2340  DGLCVKIMEAK  2372
             + L  ++M+AK
Sbjct  803   NLLFGRVMKAK  813


 Score = 63.5 bits (153),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 71/307 (23%), Positives = 112/307 (36%), Gaps = 65/307 (21%)
 Frame = +1

Query  235   FRE-----GLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             FRE      L DLGY G  +TW +G S       RLDR + +  W    P   V H    
Sbjct  123   FRETMDNLALRDLGYVGTWHTWERGTSPSTCIRERLDRFISSDSWFTLYPHTSVEHTLRY  182

Query  400   NSYH-------------TLGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSK  540
              S H             T  + RR+ F   W    N +  V + W + +           
Sbjct  183   KSDHSAIVIKPQKFSRPTKRKKRRY-FETCWLLDENCEAVVRTAWDASIGTS--------  233

Query  541   QLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELL  720
                                V  R+  + ++L  +   +                + +   
Sbjct  234   -------------------VTGRVESMGQALLTWSAEN----------------FTKIAY  258

Query  721   WF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMD  900
             W+ RSR   +  GDRNT+++H     R+  + V+ L D  G W  D D I   F +++  
Sbjct  259   WYLRSRVAEVKDGDRNTKYFHHKATQRRKRNYVKGLFDEQGTWWDDADNIENIFTSYFDS  318

Query  901   LF--SEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQT  1071
             +F  S  S +  +++     P +  +    +   FT  ++  A+ +M   KAP  DG   
Sbjct  319   IFTSSNPSDSDFDEVLQFIDPVVSAACNQQLLRPFTKDEIYAAIQQMHPCKAPGHDGMHA  378

Query  1072  SFYQNSW  1092
              FYQ  W
Sbjct  379   IFYQRFW  385



>pir||T00833 RNA-directed DNA polymerase homolog T13L16.7 - Arabidopsis thaliana 
(fragment)
Length=1365

 Score =   290 bits (741),  Expect(3) = 1e-85, Method: Compositional matrix adjust.
 Identities = 151/426 (35%), Positives = 248/426 (58%), Gaps = 1/426 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             VK  ++     FF TG LP   N T ICL+P I +P  ++  R I LC+V YK+++K +T
Sbjct  462   VKHQILTEIFGFFETGVLPQDWNHTHICLIPKITSPQRMSDLRPISLCSVLYKIISKILT  521

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDLEKAYD  1454
              RLK  +  ++   Q++FV  R I++N+LV  E+++SLR+        M  K D+ KAYD
Sbjct  522   QRLKKHLPAIVSTTQSAFVPQRLISDNILVAHEMIHSLRTNDRISKEHMAFKTDMSKAYD  581

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             R+ W F+ + +   GF+  WI  IM+CV++   ++  + +     +  RGIRQGDPLSP 
Sbjct  582   RVEWPFLETMMTALGFNNKWISWIMNCVTSVSYSVLINGQPYGHIIPTRGIRQGDPLSPA  641

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LFVL  E L H++ ++ + G+  G++   K   ++HL F DD +   +A+  +   + +C
Sbjct  642   LFVLCTEALIHILNKAEQAGKITGIQFQDKKVSVNHLLFADDTLLMCKATKQECEELMQC  701

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L+++  LSGQ ++  KS I F KN  ++I+  I S  GI +    G+YLG+P      K+
Sbjct  702   LSQYGQLSGQMINLNKSAITFGKNVDIQIKDWIKSRSGISLEGGTGKYLGLPECLSGSKR  761

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
             D +  +  ++Q+RLTGW  +TLS  G+  L++S+  A+P Y M    LP+ +  +L  + 
Sbjct  762   DLFGFIKEKLQSRLTGWYAKTLSQGGKEVLLKSIALALPVYVMSCFKLPKNLCQKLTTVM  821

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
              DF W S +  RK + +SW+++T  KDQG  G + L   NQAL AK  W+++ ++  L  
Sbjct  822   MDFWWNSMQQKRKIHWLSWQRLTLPKDQGGFGFKDLQCFNQALLAKQAWRVLQEKGSLFS  881

Query  2355  KIMEAK  2372
             ++ +++
Sbjct  882   RVFQSR  887


 Score = 49.3 bits (116),  Expect(3) = 1e-85, Method: Compositional matrix adjust.
 Identities = 70/309 (23%), Positives = 126/309 (41%), Gaps = 26/309 (8%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVL-----  384
             F+  +    + +LG +G ++TW  G  +  +   +LDR   N  W    P+         
Sbjct  159   FEHMLLNCSMHELGSTGNSFTW-GGNRNDQWVQCKLDRCFGNPAWFSIFPNAHQWFLEKF  217

Query  385   ---HLPMVNSYHTLGESRR--FRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLS----  537
                H P++  +    E  R  FR++      P   E +  +W S +S   + S  S    
Sbjct  218   GSDHRPVLVKFTNDNELFRGQFRYDKRLDDDPYCIEVIHRSWNSAMSQGTHSSFFSLIEC  277

Query  538   -KQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEE  714
              + +  W KH+     + + + L +    ++S+ +            ++ +L      EE
Sbjct  278   RRAISVW-KHSSDTNAQSRIKRLRKDLDAEKSIQI----PCWPRIEYIKDQLSLAYGDEE  332

Query  715   LLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFY  894
             L W  +SR++W+  GD+NT F+HA     +  + +  L D   +  +      +   +F+
Sbjct  333   LFWRQKSRQKWLAGGDKNTGFFHATVHSERLKNELSFLLDENDQEFTRNSDKGKIASSFF  392

Query  895   MDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE---AVFEMAQFKAPSSDGF  1065
              +LF+  ST  L   N         +  +  N    V +LE   AVF + +  AP  DGF
Sbjct  393   ENLFT--STYILTHNNHLEGLQAKVTSEMNHNLIQEVTELEVYNAVFSINKESAPGPDGF  450

Query  1066  QTSFYQNSW  1092
                F+Q  W
Sbjct  451   TALFFQQHW  459


 Score = 30.0 bits (66),  Expect(3) = 1e-85, Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI--GKQATLLSRIRY  2548
             S  W+ IL    +L++G + ++ N + T  W D W+  G     L+R R+
Sbjct  904   SYAWRSILFGRELLMQGLRTVIGNGQKTFVWTDKWLHDGSNRRPLNRRRF  953


 Score = 61.6 bits (148),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 84/208 (40%), Gaps = 11/208 (5%)
 Frame = +2

Query  2774  STYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDH  2953
             S + ++WN    L    +IR FLW A H       +   RG  S+  C +C    E I+H
Sbjct  1040  SLFDKIWN----LHTAPKIRIFLWKALHGAIPVEDRLRTRGIRSDDGCLMCDTENETINH  1095

Query  2954  IMQRCPIANSVWE-SLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWL  3130
             I+  CP+A  VW  + +        +  YTN     I      +  H  R      +W+L
Sbjct  1096  ILFECPLARQVWAITHLSSAGSEFSNSVYTN-MSRLIDLTQQNDLPHHLRFVSPWILWFL  1154

Query  3131  WKWRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVG  3310
             WK RN L+F G      +    + D+  E    +  A+  +   E    +  KW  P  G
Sbjct  1155  WKNRNALLFEGK----GSITTTLVDKAYEAYHEWFSAQTHMQNDEKHL-KITKWCPPLPG  1209

Query  3311  WVKANIDGSSIPSNSIARCGGFIRDDQG  3394
              +K NI  +    +  +     +RD QG
Sbjct  1210  ELKCNIGFAWSKQHHFSGASWVVRDSQG  1237



>gb|ABA97040.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1913

 Score =   318 bits (814),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 168/448 (38%), Positives = 248/448 (55%), Gaps = 1/448 (0%)
 Frame = +3

Query  1032  GAI*GS*LGRFPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*L  1211
             G I    L  FP +   +    +K  ++     FF T  +P G NDT I L+P +  P  
Sbjct  1016  GPIKAPGLDGFPARFFQRNWDAIKKDVVSAVKSFFETSIMPEGVNDTAIVLIPKVDQPME  1075

Query  1212  VNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL  1391
             +  FR I LCNV YK+++K +  RL+  +  L+   Q++FV GR IT+N L+  E  + +
Sbjct  1076  LKDFRPISLCNVIYKIVSKCLVNRLRPILDELVSQNQSAFVPGRMITDNALLAFECFHFI  1135

Query  1392  -RSKSGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFD  1568
              R+K+        K+DL KAYDR+ W F+  T+ K GF+P WI+ IM+C+S+ R +I F+
Sbjct  1136  QRNKNANKAACAYKLDLSKAYDRVDWVFLEQTMCKLGFAPRWIKWIMTCLSSVRYSIKFN  1195

Query  1569  SRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLF  1748
               L   F   RG+RQGDPLSP LF+   +  S L+E+ V  G    +KI R    ISHL 
Sbjct  1196  GTLLDTFAPSRGLRQGDPLSPFLFLFVADGFSRLMEERVAAGDITPVKICRGALGISHLL  1255

Query  1749  FVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLG  1928
             FVDD + F +A   QA ++K  LNE+   +GQ ++  K  I F   +  E Q AI + L 
Sbjct  1256  FVDDTLLFFKADCEQARLIKGVLNEYALGTGQLVNPNKCSILFDDTSHAETQDAIKNLLQ  1315

Query  1929  IPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAI  2108
             I   N   +YLG P+  GRL +  +  L  ++  R+  W    LS  G+  +++ V+ AI
Sbjct  1316  IVCHNFEDKYLGFPTPEGRLNKGKFQSLQEKMWKRIILWGENYLSSGGKEIMLKVVIQAI  1375

Query  2109  PCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*  2288
             P Y M    LP+ V   L +L+R+F WG+ KG RK +  +W  +T+ K  G L  +    
Sbjct  1376  PVYVMSIFRLPESVCEDLNKLARNFWWGADKGKRKTHWRAWSCLTKPKHNGGLAFRDFRL  1435

Query  2289  MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
              NQAL A+  W+L++K D LC ++M+AK
Sbjct  1436  FNQALLARQAWRLLDKPDSLCARVMKAK  1463


 Score = 77.8 bits (190),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 99/222 (45%), Gaps = 23/222 (10%)
 Frame = +2

Query  2783  RRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQ  2962
             +++W+ I    VP +++ F W A ++C      + +R       C IC N  ED+ H + 
Sbjct  1613  QKIWDLIWKCNVPQKVKVFCWRAANNCLANQENKKKRNLERSEICCICGNETEDVSHALS  1672

Query  2963  RCPIANSVWESLIPYDHRRL---*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLW  3133
             RCP A  +WE++       L    +    +WF + I      N   E+R+   + +W +W
Sbjct  1673  RCPHAVHLWEAMKAAGSLSLNVAGNATGGSWFFDQIE-----NTPAEERMMLCMMLWRIW  1727

Query  3134  KWRNDLVFSGTNINLAARIKWIRDQVEEI-------NISFSKAKGLI-API----ESICW  3277
               RN+L        +A   +++      +       +    + K ++  P     E+   
Sbjct  1728  FVRNELYHGKVPPPIAVSKRFLESYCSSLLEIKQHPHADVVRGKHVVQQPTRMRSEANHL  1787

Query  3278  RQL---KWIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQG  3394
             R++   +W +PQ+GW+K N+DGS   ++S    G  +RD  G
Sbjct  1788  RRVVPARWEKPQMGWMKLNVDGSYDSNSSKGGIGVVLRDSVG  1829



>ref|XP_010445598.1| PREDICTED: uncharacterized protein LOC104728296 [Camelina sativa]
 ref|XP_010462868.1| PREDICTED: uncharacterized protein LOC104743494 [Camelina sativa]
 ref|XP_010480424.1| PREDICTED: uncharacterized protein LOC104759164 [Camelina sativa]
Length=1208

 Score =   275 bits (702),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/431 (34%), Positives = 234/431 (54%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             +F  ++K  L+    +FF +G      N+T ICL+P +  P  + +FR I LCNVSYK++
Sbjct  359   RFWSSLKGDLVALVREFFRSGRFDPCLNETNICLIPKVDRPQRMAEFRPISLCNVSYKII  418

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKS-GKGGLMVIKIDL  1439
             +K +  RLK  +  L+   Q++FV GR IT+N+LV QE+ + L + +  K   +  K D+
Sbjct  419   SKILCFRLKRFLPSLVSETQSAFVSGRLITDNILVAQEMFHGLNTNNRCKSEFLAFKTDM  478

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W+F+ + + K GF  +WI  IM CVS+    +  + +   +   +RG+RQGD
Sbjct  479   SKAYDRVEWAFLEAVMVKLGFDRNWISWIMWCVSSVSYQVLLNGQPRGFIKPQRGLRQGD  538

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  E L   I+++ +  +  G+ I R  P ISHL F DD +FF +A   +  
Sbjct  539   PLSPYLFILCTEVLIANIKKAEREKKVTGITIARDSPTISHLLFADDSLFFCKAEATECQ  598

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              V + +  +   SGQ ++  KS I F K    EI+  + S +GI     +G YLG+P   
Sbjct  599   TVMEIIRNYGKASGQEVNLEKSSIMFGKKVPTEIRDQLKSVIGITKEGGMGSYLGIPESL  658

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
                K   +  +  R+  R+ GW  + LS  G+  +I+SV  A+P + M    LPQ + S+
Sbjct  659   QGSKNKVFGYVKDRLDDRVNGWNAKLLSKGGKEIMIKSVALALPTHVMSCYKLPQELTSK  718

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             L      F W S+      + ++W K+ + K  G LG + L+  N A+ AK  W+L+   
Sbjct  719   LTSAISTFWWKSNDKAHGLHWVAWDKLCKDKCDGGLGFRALEQFNDAMLAKQYWRLIQHP  778

Query  2340  DGLCVKIMEAK  2372
               L  ++++ +
Sbjct  779   TSLMARVLKGR  789


 Score = 71.6 bits (174),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 68/308 (22%), Positives = 120/308 (39%), Gaps = 21/308 (7%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             F   I   G+++    G   +W     +      RLDRAL N +W+   P+ +V +L M+
Sbjct  60    FNSMIRHCGMLEFPCYGEHLSWRGNRCNNQVVRCRLDRALGNEDWQGFFPNSKVDYLDMI  119

Query  400   NSYHT----------LGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANK-----SNL  534
              S H           +  +R+FRF+  W         V S W   ++           N 
Sbjct  120   GSDHCPILATCLKTHIKRNRQFRFDKCWLGKDGLSGAVESGWNRTINFRPTGFVDKIKNC  179

Query  535   SKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEE  714
                +  W K+ I +  R    + A +   +   S+ Q+       +            EE
Sbjct  180   RNSISWWRKNNIFSGPRLISSLKAALQEAKMDDSISQEEIRGIERKLKEAYR-----DEE  234

Query  715   LLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFY  894
             L W  +SR+ W+  GD+NT+F+ A+T  R+  + +  L D    W     G+      ++
Sbjct  235   LYWQQKSRKFWLRVGDKNTKFFQASTKQRRVRNRIIGLFDTDNVWNESASGMENIATKYF  294

Query  895   MDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQT  1071
              DLF       + ++     P +  +    +    +  ++ +A+F M   K P  DG   
Sbjct  295   EDLFRNSDAQGVSEMLQEVTPLISDTMNRDLIRDISEAEVRKALFAMHPEKTPGPDGMTA  354

Query  1072  SFYQNSWA  1095
              F+Q  W+
Sbjct  355   LFFQRFWS  362



>gb|EEC84753.1| hypothetical protein OsI_31756 [Oryza sativa Indica Group]
Length=1350

 Score =   314 bits (804),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 163/438 (37%), Positives = 249/438 (57%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP     +  G +K  +++   +FF +G +P G NDT I L+P I  P  +   R IGLC
Sbjct  650   FPAHFYQRNWGGLKSDIVRAVKEFFRSGIMPVGVNDTAIVLIPKIDQPTELKDLRPIGLC  709

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGL  1418
             NV YK+++K +  RLK  +  LI   Q++FV GR IT+N L+  E  + + ++K+     
Sbjct  710   NVIYKVVSKCLVNRLKPLLDELISVNQSAFVPGRMITDNALLAFEYFHYIQKNKNPNKAA  769

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
                K+DL KAYDR+ W F+   + K GF+  W+R IM C++T R ++ F+  L   F   
Sbjct  770   SAYKLDLSKAYDRVDWGFLEQAMYKLGFAHRWVRWIMECITTVRYSVKFNGTLLDSFAPS  829

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+ QGDPLSP LF+   + LS L+++ V+ G    + I    P ISHL F DD + F +
Sbjct  830   RGLCQGDPLSPFLFLFLADGLSLLLDEKVQQGVLSPIHICHSAPGISHLLFADDTLLFLK  889

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A   QA V+++ LN++ + +GQ+++  K  I F  ++S  +Q+AI  +L I       +Y
Sbjct  890   AVPEQAEVIREVLNDYATATGQQINPSKCSIMFGDSSSELVQEAIRDTLQIANNVFEDKY  949

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG P+  GRLK+  +  +  RI  RL  W    LS  G+  LI++++ AIP Y M    L
Sbjct  950   LGFPTPDGRLKKGKFQSIQERIWKRLIQWGENYLSSGGKEILIKALIQAIPVYVMGIFKL  1009

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P+ V   L R++R F WG  KG RK +  +W  +T+ K+ G LG +     NQAL A+  
Sbjct  1010  PESVCDELTRITRGFWWGGEKGARKTHWKAWDTLTKPKNCGGLGFRDFRLFNQALLARQA  1069

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W+L++  D LC  +++AK
Sbjct  1070  WRLIDSPDSLCAMVLKAK  1087


 Score = 65.9 bits (159),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 123/312 (39%), Gaps = 71/312 (23%)
 Frame = +1

Query  217   GFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPM  396
              F+D +    L DLG+ G  +T+       N    RLDRA+ +  W+    + ++ HL  
Sbjct  401   AFRDALHSCELHDLGFRGLPHTYDNKREGWNNVKVRLDRAVADGNWRDVFSNAQLSHLVS  460

Query  397   VNSYH------------TLGESRRFRFNAAW*THPNYQE*VSSTW-----KSDVSLEANK  525
               S H            T G  +  ++   W       E +   W     K D+  E NK
Sbjct  461   PCSDHCPIVLQLSGDSRTQGRKKCLQYEIFWEREAAISEVIGEAWSEYGTKEDLG-EINK  519

Query  526   S--NLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldei  699
             +   +   L  W++    N+ R   R   R+S      ++ +        R++   ++++
Sbjct  520   ALGKVMIALHSWSRTKCKNVGRELERARKRLS------NLLEANADGATVRQVTDNMNDL  573

Query  700   lYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEP  879
             LY+EE+LW  RSR  W+  GDRNT+F+H+        S + RL                 
Sbjct  574   LYREEMLWLQRSRVSWLKEGDRNTKFFHS------RVSKITRL-----------------  610

Query  880   FHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLEAVFEMAQFKAPSSD  1059
                F   + ++ +    ED          T + +AI          A+F++   KAP  D
Sbjct  611   ---FQTKVSAKMNDKLCEDF---------TEEEVAI----------AMFQIGPIKAPGPD  648

Query  1060  GFQTSFYQNSWA  1095
             GF   FYQ +W 
Sbjct  649   GFPAHFYQRNWG  660



>ref|XP_009135908.1| PREDICTED: uncharacterized protein LOC103860050 [Brassica rapa]
Length=1207

 Score =   294 bits (752),  Expect(3) = 4e-85, Method: Compositional matrix adjust.
 Identities = 159/423 (38%), Positives = 246/423 (58%), Gaps = 1/423 (0%)
 Frame = +3

Query  1107  SLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRL  1286
             ++IK   +FF TG +P+  N T I L+P I +P +V+ +R I LCNV YK+++K ++LRL
Sbjct  331   AMIKEIQEFFRTGSMPHSINATHIRLIPKITSPKVVSDYRPIALCNVYYKVISKLLSLRL  390

Query  1287  KSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRS-KSGKGGLMVIKIDLEKAYDRLS  1463
             K  +   I   Q++F+ GR I++NVL+  E L+ L++ KS K   M IK D+ KAYDRL 
Sbjct  391   KPVLHCAISENQSAFIPGRAISDNVLITHEFLHYLKTTKSKKRSSMAIKSDMSKAYDRLE  450

Query  1464  WSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFV  1643
             WSFI   L   GF   +   IM+CVS+   +   +  +    + +RGIRQGDPLSP LF+
Sbjct  451   WSFIECVLSTLGFHEVFTTWIMNCVSSVSYSFLINDAVLGRVVPQRGIRQGDPLSPYLFI  510

Query  1644  LYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNE  1823
             L  E LS L  ++ ++G   G+KI +  P ++HL F DD +FF        + +K  L  
Sbjct  511   LCSEVLSGLCSKAQQDGTLPGIKIAKNSPSVNHLLFADDTMFFIPTDRRSCAKLKHILTL  570

Query  1824  FCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSY  2003
             + S SGQR++  KS I F+K T+  ++  +   LGI     +G+YLG+P   GR K+D +
Sbjct  571   YESASGQRINTDKSSISFAKKTTSLVRNEVKDILGITKEGGVGKYLGLPEHFGRKKRDLF  630

Query  2004  ADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDF  2183
             A ++ RI  +   W  R LS  G+  ++++VL+A+P + M   LLP G+   ++     F
Sbjct  631   ASIIDRIVVKAVSWSTRFLSSAGKMVMLKAVLTAVPSFAMTCFLLPVGLCKMIQSALTRF  690

Query  2184  LWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIM  2363
              W S+ G +K   +SW K+T+ K  G LG + +   N AL AKL W+++   + L  +++
Sbjct  691   WWDSNTGKKKMCWLSWDKLTKPKSLGGLGFKDIQTFNIALLAKLPWRMLTNPNCLLSRVL  750

Query  2364  EAK  2372
               K
Sbjct  751   LGK  753


 Score = 50.4 bits (119),  Expect(3) = 4e-85, Method: Compositional matrix adjust.
 Identities = 69/280 (25%), Positives = 112/280 (40%), Gaps = 26/280 (9%)
 Frame = +1

Query  304   PNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYH----------TLGESRRFRFNAAW  453
             P     RLDRA+ N +W    P     +L    S H           L   R FR++   
Sbjct  55    PLVVHCRLDRAVSNSDWSDMFPTARSHYLLFEGSDHRPLLSVFDPTKLKSQRLFRYDRRL  114

Query  454   *THPNYQE*VSSTWK--SDVSLEANKSNLSKQLDDWNKHTIGNIFRRK*RVLARISGVQR  627
               +      V  TW    ++++    SN  K +  W+K    N  +        I  ++ 
Sbjct  115   RHNSEVTILVEKTWNRYKNLNVMERLSNCRKAISKWSKDQFLNSKKA-------IDNLKM  167

Query  628   SL-SVYQkldlikldrklrreldeilYQ-EELLWF*RSREEWIVSGDRNTRFYHAATAVR  801
             SL S   K                  Y+ EE  W  RSR+ W+  GDRNT ++HAA   R
Sbjct  168   SLDSELSKPLADDPLISSLNLALLQAYKAEEEYWRQRSRQMWLSLGDRNTGYFHAAARGR  227

Query  802   KSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQ--  975
             ++ +    ++   G  + +   I E   A++ ++FS  S+   + ++ A    +   Q  
Sbjct  228   RARNRFSMIETAEGTAVFEEKQIAEVIAAYFTEIFSSSSSDCTDTVHSALKSKITAEQNE  287

Query  976   -WLAINAHFTVKDLEAVFEMAQFKAPSSDGFQTSFYQNSW  1092
               +     F ++   A+F +   KAP  DGF  SF+Q +W
Sbjct  288   MLIMPPTDFEIR--AALFSIHPDKAPGPDGFSASFFQTNW  325


 Score = 23.5 bits (49),  Expect(3) = 4e-85, Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 21/53 (40%), Gaps = 3/53 (6%)
 Frame = +2

Query  2399  GMSNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQATLLSRIRYDPF  2557
             G S+ W GIL    +L     + V        W D+WI   + +   I Y P 
Sbjct  768   GASHGWTGILAGRDLLASHIGRAVGEGTEIKVWTDAWISTTSRI---IPYGPL  817



>ref|XP_008356436.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1089

 Score =   273 bits (697),  Expect(3) = 5e-85, Method: Compositional matrix adjust.
 Identities = 151/413 (37%), Positives = 234/413 (57%), Gaps = 5/413 (1%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             V + ++K    F+ +G L    N T + L+P +  P  + Q+  I LCNV YK+L K +T
Sbjct  169   VGEDVVKIXQAFWHSGTLLXKLNHTNLVLIPKVKCPKNMAQYXPIALCNVIYKILAKVLT  228

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL--RSKSGKGGLMVIKIDLEKAY  1451
              RLK  M  +IG  Q++FV G+QI +N+L   EVL+SL  + +  + G M IK+D+ KAY
Sbjct  229   NRLKLVMPKVIGDNQSAFVAGKQIQDNILXVHEVLHSLLHQRREDQAG-MAIKLDMAKAY  287

Query  1452  DRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSP  1631
             DR+ W F+ + +   GF+P + + I  C+ST   +I  +   + + + + G+RQGDPLSP
Sbjct  288   DRVEWDFLITXMAXMGFAPLFCKWIKECISTVSFSILINGTPTGYILPQXGLRQGDPLSP  347

Query  1632  LLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKK  1811
              LF+L  E  S L+ + ++ G   G + T  G  ++HL F DD V FG  ++ +A  V +
Sbjct  348   FLFLLCTEGXSMLLRKGLEQGALHGFRFTPNGIPLTHLLFADDXVVFGNXTVDEAKAVVE  407

Query  1812  CLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLK  1991
              L  +   SGQ ++  KS +FFS  TS  I+  I  +LGI      G+YLG+ +  G  K
Sbjct  408   VLKVYARGSGQEINLTKSSVFFSPKTSNRIKMEIEETLGIQCKQGFGKYLGLQADFGLSK  467

Query  1992  QDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERL  2171
             +  +A++  ++ ARL GW  + LS  G+  LI++V  A+P Y M    LP GV   +E+ 
Sbjct  468   KVVFAEVRDKVXARLXGWTEQFLSQXGKEVLIKAVAMALPNYAMSCFKLPIGVCRDVEKA  527

Query  2172  SRDFLWGSSKGNRK-CNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKL  2327
               +F W      RK  + +SW++VT+ K  G LG + +   N A  AK+GW+L
Sbjct  528   IXNF-WXKGNDQRKXVHWVSWERVTKQKKSGGLGFKDIQCFNLAFLAKIGWRL  579


 Score = 71.2 bits (173),  Expect(3) = 5e-85, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 68/130 (52%), Gaps = 1/130 (1%)
 Frame = +1

Query  706   QEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFH  885
             +EE+ W  +SR +W+  GD+NT+F+HA T  R+  + +R ++D+ G W      I +   
Sbjct  37    EEEVYWKVKSRVQWLKEGDKNTKFFHAQTLKRRRLNLIRGIEDSHGVWHEQDKEINDTAI  96

Query  886   AFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKD-LEAVFEMAQFKAPSSDG  1062
             A++ DLF     +Q+E++       +     +A+ A  +  + L AV ++    A   DG
Sbjct  97    AYFADLFQSSRPSQIENIERNVEARITQEDNIALTAPVSSGEILLAVSQIPPSXAXGPDG  156

Query  1063  FQTSFYQNSW  1092
             F   FYQ+ W
Sbjct  157   FSGCFYQDHW  166


 Score = 23.1 bits (48),  Expect(3) = 5e-85, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 19/46 (41%), Gaps = 0/46 (0%)
 Frame = +2

Query  2414  WKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQATLLSRIRYD  2551
             WKGI  +  +L  G +  V N        D W  K +T   R R D
Sbjct  614   WKGIFXAXKVLQNGIRWRVGNGXCINIREDXWFPKPSTFRIRPRED  659


 Score = 56.2 bits (134),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/212 (24%), Positives = 85/212 (40%), Gaps = 12/212 (6%)
 Frame = +2

Query  2786  RVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQR  2965
             +VW+ I  L+V  +I+ F+W    +     +   RR    +  CG+C  L E  + +  R
Sbjct  751   QVWSRIWRLQVXNKIKXFIWRCCSNALAXRSNLQRRHMRVDNVCGVCNALDETENXLFFR  810

Query  2966  CPIANSVWE-SLIPYDHRRL*DQDYT---NWFDEGISELSSGNRKHEQRVTFAVTMWWLW  3133
             C  ++  W  S +  +   L   D+      F E +    + +   ++   FA  +W LW
Sbjct  811   CKFSHLFWFCSPLHLNSHELEXVDFLESWGXFHECVKGRENADEICQE---FAFGLWRLW  867

Query  3134  KWRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKG-----LIAPIESICWRQLKWIR  3298
             K RND VF+G +      +   R  + E   + +  +G      +    +       W R
Sbjct  868   KNRNDXVFNGLHRQPLEVVDLWRKNINEFRDALASVEGDDWXKEVGSFAAAARPIXXWQR  927

Query  3299  PQVGWVKANIDGSSIPSNSIARCGGFIRDDQG  3394
             P+ G +K N D +       A  G   RD  G
Sbjct  928   PKYGTIKINTDVAXCKETHCAGVGWVGRDFAG  959



>gb|AAT58873.1| hypothetical protein [Oryza sativa Japonica Group]
Length=1264

 Score =   268 bits (685),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 147/445 (33%), Positives = 242/445 (54%), Gaps = 2/445 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
              P     KF+    D +        + G +P G NDTV+ L+P    P  +   R I LC
Sbjct  799   IPAIFYKKFLSLAGDKVKDEVLAVLNGGDMPQGWNDTVVVLIPKTKQPDTLKDLRPISLC  858

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGL  1418
             NV+YK+++K +  RLK  +  +I P Q++FV  R IT NVL+  E+ + L + K GK G+
Sbjct  859   NVAYKLISKVIVNRLKVVLLEIISPSQSAFVPRRLITYNVLLAYELTHYLNQRKKGKNGV  918

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
               IK+D+ KAYDR+ W F+R  + + GF   W+  +M CV++    I  +   S     +
Sbjct  919   AAIKLDMSKAYDRVEWDFLRHMMLRLGFHDQWVNLVMKCVTSVTYRIKINGEHSDQIYPQ  978

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP LF++  E LS L++++  +G+ +G+K+ R  P I+HLFF DD +    
Sbjct  979   RGLRQGDPLSPYLFIICAEGLSALLQKAQADGKIEGIKVCRDTPRINHLFFADDSLVLMR  1038

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A  + A  +++ LN +   SGQ ++  KS + FS NT    +  + S+L I       RY
Sbjct  1039  AGQNDAQELRRVLNIYEVASGQVINKDKSSVLFSPNTLQSDRMEVRSALCINQEAKNERY  1098

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG+P   G+ ++ ++  +  ++  R+ GW+ + LS  G+  L+++V  AIP Y M    L
Sbjct  1099  LGLPVSIGKSRRKAFEYIKRKVWLRIQGWQEKLLSKAGKEILVKAVAQAIPTYAMSCFDL  1158

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
              +G+   +  +   + W  +    K + +SW+K+T  K  G  G + L   N A+ A+  
Sbjct  1159  TKGLCDEINSMISKWWWSQNDKENKIHWLSWEKMTLPKKLGGPGFRDLHLFNMAMLARQA  1218

Query  2319  WKLMNKEDGLCVKI-MEAKVQLPSL  2390
             W+L+   D LC ++ ++ K++   L
Sbjct  1219  WRLLLNVDSLCGQVFVDEKIEHTGL  1243


 Score = 77.4 bits (189),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 139/306 (45%), Gaps = 34/306 (11%)
 Frame = +1

Query  247   LIDLGYSGPAYTWM--QGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHT--  414
             L DLG+ G A+TW     L+S N+   RLDRA+ N  W+ R P V V++    +S H   
Sbjct  509   LHDLGFVGDAFTWRNHHHLAS-NYIKERLDRAVANGAWRARFPLVRVINGDPRHSDHRSV  567

Query  415   ---LGESRRF----------RFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLS------  537
                 G + +           +F A W      Q  V   W++  +LE  ++ L       
Sbjct  568   IVETGATEKQQWGQPLEIMQKFEARWLEEEECQARVEEAWEN--ALEGGQTRLMEIQSRV  625

Query  538   -KQLDDWNKHTIGNIFRRK*RVLARISGVQRS-LSVYQkldlikldrklrreldeilYQE  711
              K+L  W++  +G + +R   +   +   +R  +S  Q      L  KL R LD    Q+
Sbjct  626   LKELWAWDRTVLGELKKRVKNLRKELEKCRREPISNRQVNREHLLRYKLERLLD----QQ  681

Query  712   ELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAF  891
              + W  R+   W+  GDRNT+F+HA  + +K  +T+++L+D  G  ++ G+ +       
Sbjct  682   HIYWKQRAHSTWLTKGDRNTKFFHAQASEKKKRNTIQKLQDGHGGLVA-GNQLKSFISNQ  740

Query  892   YMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQ  1068
             Y  LF  +  +Q++ +       +       + A +  +++  A+ +M   KAP +DG  
Sbjct  741   YQQLFRSNGCSQMDAVLQCVQARVTPEMREGLAAPYQREEVWVALKDMGDLKAPGADGIP  800

Query  1069  TSFYQN  1086
               FY+ 
Sbjct  801   AIFYKK  806



>emb|CCA66180.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1383

 Score =   254 bits (649),  Expect(3) = 8e-85, Method: Compositional matrix adjust.
 Identities = 146/430 (34%), Positives = 237/430 (55%), Gaps = 3/430 (1%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             +K  +    +DF+ TG LP GCN   I L+P I NP  +  +R I +    YK++ K + 
Sbjct  464   IKTDIYGIVNDFWETGCLPQGCNTAYIALIPKIDNPSSLKDYRPISMVGFIYKIVAKLLA  523

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
              RL+S +  LI P Q+S+V GRQI +  LV  E++ S + ++ +   +++K+D  KAYD 
Sbjct  524   KRLQSVISSLISPLQSSYVKGRQILDGALVASEIIESCKKRNIEA--ILLKLDFHKAYDS  581

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             +SW+F++ TL +  F   W   I +CV+++  +I  +   +  F L RG+RQGDPLSP L
Sbjct  582   VSWNFLQWTLDQMNFPVKWCEWIKTCVTSASASILVNGSPTPPFKLHRGLRQGDPLSPFL  641

Query  1638  FVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCL  1817
             FVL  E LS +I ++     W+G+    +G  I+HL + DD + F EA+ +    ++K L
Sbjct  642   FVLVGEVLSQMISKATSLQLWRGIPACSRGSEITHLQYADDTLMFCEANTNSLKNIQKTL  701

Query  1818  NEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQD  1997
               F  +SG ++++ KS +     TS  IQ+A ++SL   I      YLG+P      +  
Sbjct  702   IIFQLVSGLQVNFHKSSLMGLNVTSSWIQEA-ANSLMCKIGTIPFSYLGLPIGDNPARIR  760

Query  1998  SYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSR  2177
             ++  ++ +++ +L  WK + LS  GR TLI++ LS +P Y M    +P+GV+ ++ +L R
Sbjct  761   TWDPIIDKLEKKLASWKGKLLSLGGRLTLIKASLSNLPLYYMSLFPVPKGVIEKINKLMR  820

Query  2178  DFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVK  2357
              FLW    G R  +++SW  V + K  G LGI  +   N +L  K  W+L      +   
Sbjct  821   AFLWCGDFGKRPFSMVSWSIVQQPKTSGGLGIGNILHKNLSLLFKWIWRLFENPSSMWGS  880

Query  2358  IMEAKVQLPS  2387
             I+ +K    S
Sbjct  881   IIRSKYNYSS  890


 Score = 84.3 bits (207),  Expect(3) = 8e-85, Method: Compositional matrix adjust.
 Identities = 77/304 (25%), Positives = 142/304 (47%), Gaps = 20/304 (7%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVL-----  384
             F+ ++    L+++  S  AYTW +  S      + LDR L + EW    P+++V      
Sbjct  165   FKSFVQELKLLEIPSSSRAYTWYRANSK-----SLLDRLLVSPEWVSHCPNIKVSILQRG  219

Query  385   ---HLPM-VNSYHTLGESRRFRFNAAW*THPNYQE*VSSTWKSD--VSLEANKSNLSKQL  546
                H P+ V+S+      + FRFN  W T P   + V ++W S   +S+        K+L
Sbjct  220   LSDHCPLLVHSHIQEWGPKPFRFNNCWLTDPKCMKIVEASWSSSPKISVVEKLKETKKRL  279

Query  547   DDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldei-lYQEELLW  723
              +WN +  G+I     ++   I+   +     +        R+  +      + ++E+ W
Sbjct  280   KEWNLNEFGSIDANIRKLEDCIANFDKEADERELDKEELEKRREAQADLWKWMKRKEIYW  339

Query  724   F*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDL  903
               RSR  W+ +GD+NT+F+HA  + +K  + +  ++ + G+  +D   I +   AF+  +
Sbjct  340   AQRSRITWLKAGDKNTKFFHAIASNKKRKNMMACIETD-GQSTNDPSQIKKEARAFFKKI  398

Query  904   FSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSFY  1080
             F ED   +   L +     L  +Q  ++   FT ++++ AV   A  KAP  DGF   F 
Sbjct  399   FKEDHVKR-PTLENLHLKRLSQNQANSLITPFTTEEIDTAVSSCASDKAPGPDGFNFKFV  457

Query  1081  QNSW  1092
             +++W
Sbjct  458   KSAW  461


 Score = 28.1 bits (61),  Expect(3) = 8e-85, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 33/72 (46%), Gaps = 19/72 (26%)
 Frame = +2

Query  2441  ILLKGSKKLVKNDRSTLFWLDSWIGKQATLLSRIRYDPFDRVIR*SL*VLGPRI-GVAVG  2617
             I + G +K V N  S+LFW D+W+ +Q          P  R+         PR+  +A+ 
Sbjct  922   IAVNGMRKNVGNGISSLFWHDTWLCEQ----------PLKRI--------APRLFSIAIN  963

Query  2618  ETFEPAS*GVLE  2653
             +    AS GV E
Sbjct  964   KNSSIASYGVWE  975



>emb|CAB39638.1| RNA-directed DNA polymerase-like protein [Arabidopsis thaliana]
 emb|CAB78094.1| RNA-directed DNA polymerase-like protein [Arabidopsis thaliana]
Length=1274

 Score =   259 bits (662),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 146/415 (35%), Positives = 229/415 (55%), Gaps = 8/415 (2%)
 Frame = +3

Query  1131  FFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLI  1310
             FF    L    N+T + L+P I  P  V+ +R I LCNV YK++ K +T RL+  +  LI
Sbjct  415   FFVDSCLSPRLNETHVTLIPKISAPRKVSDYRPIALCNVQYKIVAKILTRRLQPWLSELI  474

Query  1311  GPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAYDRLSWSFIRSTL  1487
                Q++FV GR I +NVL+  E+L+ LR S + K   M IK D+ KAYDR+ W+F++  L
Sbjct  475   SLHQSAFVPGRAIADNVLITHEILHFLRVSGAKKYCSMAIKTDMSKAYDRIKWNFLQEVL  534

Query  1488  QKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSH  1667
              + GF   WIR +M CV T   +   +       +  RG+RQGDPLSP LF+L  E LS 
Sbjct  535   MRLGFHDKWIRWVMQCVCTVSYSFLINGSPQGSVVPSRGLRQGDPLSPYLFILCTEVLSG  594

Query  1668  LIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQR  1847
             L  ++ + G   G+++ R  P ++HL F DD +FF + +      +   L ++   SGQ 
Sbjct  595   LCRKAQEKGVMVGIRVARGSPQVNHLLFADDTMFFCKTNPTCCGALSNILKKYELASGQS  654

Query  1848  LSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQ  2027
             ++  KS I FS  T  +I++ +  SL I     +G+YLG+P   GR K+D ++ ++ RI+
Sbjct  655   INLAKSAITFSSKTPQDIKRRVKLSLRIDNEGGIGKYLGLPEHFGRRKRDIFSSIVDRIR  714

Query  2028  ARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGN  2207
              R   W  R LS  G+  L+++VLS++P Y M    LP  +  +++ +   F W S    
Sbjct  715   QRSHSWSIRFLSSAGKQILLKAVLSSMPSYAMMCFKLPASLCKQIQSVLTRFWWDSKPDK  774

Query  2208  RKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
             RK   +SW K+T   ++G LG + ++       AKL W+++ +   L  +++  K
Sbjct  775   RKMAWVSWDKLTLPINEGGLGFREIE-------AKLSWRILKEPHSLLSRVLLGK  822


 Score = 85.5 bits (210),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 138/310 (45%), Gaps = 27/310 (9%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSP--DVEVL-  384
             L F+ ++ + GL D+ ++G + +W +G    +F  +RLDRAL N  W    P    E L 
Sbjct  102   LAFRSFVSQNGLWDINHTGNSLSW-RGTRYSHFIKSRLDRALGNCSWSELFPMSKCEYLR  160

Query  385   -----HLPMVNSYHT--LGESRRFRFNAAW*THPNYQE*VSSTWK--SDVSLEANKSNLS  537
                  H P+V  +    L  S+ FRF+         +  V   W+     S+    S   
Sbjct  161   FEGSDHRPLVTYFGAPPLKRSKPFRFDRRLREKEEIRALVKEVWELARQDSVLYKISRCR  220

Query  538   KQLDDWNKHTIGNIFRRK*RVLARISGVQRSL-SVYQkldlikldrklrreldeilY-QE  711
             + +  W K    N  +        I   Q++L S                +  E  Y QE
Sbjct  221   QSIIKWTKEQNSNSAK-------AIKKAQQALESALSADIPDPSLIGSITQELEAAYRQE  273

Query  712   ELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAF  891
             EL W   SR +W+ SGDRN  ++HA T  R+  + +  ++D  G+   + + I     ++
Sbjct  274   ELFWKQWSRVQWLNSGDRNKGYFHATTRTRRMLNNLSVIEDGSGQEFHEEEQIASTISSY  333

Query  892   YMDLFSEDSTTQLEDLNDAFFPPLHT---SQWLAINAHFTVKDLEAVFEMAQFKAPSSDG  1062
             + ++F+  + + L+ + +A  P + +    + + I++   +K  EA+F ++  KAP  DG
Sbjct  334   FQNIFTTSNNSDLQVVQEALSPIISSHCNEELIKISSLLEIK--EALFSISADKAPGPDG  391

Query  1063  FQTSFYQNSW  1092
             F  SF+   W
Sbjct  392   FSASFFHAYW  401



>ref|XP_010687489.1| PREDICTED: uncharacterized protein LOC104901596 [Beta vulgaris 
subsp. vulgaris]
Length=1102

 Score =   281 bits (720),  Expect(3) = 1e-84, Method: Compositional matrix adjust.
 Identities = 146/433 (34%), Positives = 240/433 (55%), Gaps = 1/433 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             +F   +   +I F  ++++     +  N T + L+P    P  +  FR I LC V YK+L
Sbjct  180   RFWHILWGDIISFVLNWWNGDVDLSSVNKTCVVLIPKCATPLSMKDFRPISLCTVLYKIL  239

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDL  1439
             +K +  +LK  +  +I   Q++FV  R IT+N LV  E+ ++++ + G   G+  +K+D+
Sbjct  240   SKTLANKLKLFLPEIISTNQSAFVPRRLITDNALVAFEIFHAMKRRDGTNNGVCALKLDM  299

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+   +Q+ GF P WI  +M+C+S+       +  +  +    RG+RQGD
Sbjct  300   SKAYDRVEWCFLEKVMQRMGFCPAWIVRVMACISSVSFTFKINGAVQGFLAPSRGLRQGD  359

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             P+SP LF+L  +  S L+ ++ +  +  G +I R  P ISHLFF DD + F +AS+ + S
Sbjct  360   PISPYLFLLCADAFSTLLTKAAEEKKIHGAQICRGAPRISHLFFADDSILFTKASVQECS  419

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             VV   ++++   SGQ+++  K+ + FS+N     +  I + LG+  V    +YLG+P+I 
Sbjct  420   VVADIISKYERASGQQVNLSKTEVVFSRNVDSGCRSEIVNVLGVTEVAKQEKYLGLPTII  479

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+ ++  +  RI  +L GWK + LS  G+  LI++V+ AIP Y M    LP G++  
Sbjct  480   GRSKKVTFVCIKERIWKKLQGWKEKLLSHPGKEVLIKAVVQAIPTYMMSVFCLPSGLVDE  539

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             +  L   F WGS +G RK +   W+ +   K  G LG + L   NQAL AK  W+L    
Sbjct  540   IHSLIARFWWGSKEGERKMHWYKWETLCMPKSMGGLGFRDLHCFNQALLAKQAWRLTKNS  599

Query  2340  DGLCVKIMEAKVQ  2378
               L   +++A+  
Sbjct  600   YSLLALVLKARYH  612


 Score = 59.3 bits (142),  Expect(3) = 1e-84, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 63/131 (48%), Gaps = 5/131 (4%)
 Frame = +1

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             EE  W  R+R   +  GD+NT+++H   + RK  +T+  L D  G W    D I E   A
Sbjct  54    EESYWHARARANELRDGDKNTKYFHHKASQRKKRNTINGLLDENGVWKKGKDEIGEIVTA  113

Query  889   FYMDLFSEDSTTQLEDLNDAFFPPLHTSQWL--AINAHFTVKDLE-AVFEMAQFKAPSSD  1059
             ++ +LF+  +  ++E   +    P   +  +  ++ A  T  D+  A+F M   KAP  D
Sbjct  114   YFQNLFTSSNPDEMEAALEGV--PCCVTDLMNESLMAPPTGDDIRAALFSMHPNKAPGID  171

Query  1060  GFQTSFYQNSW  1092
             G    F+Q  W
Sbjct  172   GLHALFFQRFW  182


 Score = 25.4 bits (54),  Expect(3) = 1e-84, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 20/36 (56%), Gaps = 0/36 (0%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             S  W+ I  S  +LL+G K  V + RS   W D+W+
Sbjct  627   SFTWRSIWGSKSLLLEGLKWCVGSGRSIRVWEDAWL  662



>ref|XP_010451584.1| PREDICTED: uncharacterized protein LOC104733725 [Camelina sativa]
Length=1267

 Score =   281 bits (719),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/452 (34%), Positives = 243/452 (54%), Gaps = 1/452 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             +F  ++K  L+    +FF TG      N+T ICL+P + NP  +  FR I LCNVSYK++
Sbjct  359   RFWASLKGDLVALVREFFRTGCFDPRLNETNICLIPKVANPQRMANFRPISLCNVSYKII  418

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRS-KSGKGGLMVIKIDL  1439
             +K +  RL+  + +L+   Q++FV GR IT+N+LV QE+ + L + +  K   +  K D+
Sbjct  419   SKVLCFRLRRVLPLLVSETQSAFVSGRLITDNILVAQEMFHGLNTNRRCKSEFLAFKTDM  478

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+ + L K GF+  WI  IM CVS+    +  + +     + +RG+RQGD
Sbjct  479   SKAYDRVEWDFLEAVLVKFGFAQKWISWIMWCVSSVTYQVLMNGQPRGSIIPQRGLRQGD  538

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  E L   I+++ ++ +  G+ I R  P +SHL F DD +FF +A   +  
Sbjct  539   PLSPYLFILCTEVLIANIKKAERDKKLTGISIARDSPSVSHLLFADDSLFFCKAEESECR  598

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              V   +  +   SGQ ++  KS I F K    EI+  + S +GI     +G YLG+P   
Sbjct  599   TVISIIGNYGKASGQEVNLTKSSIMFGKKVPPEIRAQLKSVIGISQEGGMGSYLGIPENL  658

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
                K   ++ +  R+  R+ GW  + LS  G+  +I+SV  A+P + M    L Q + S+
Sbjct  659   QGSKTKVFSYVKDRLDDRVNGWSAKLLSKGGKEVMIKSVALALPTHVMSCYKLTQDLTSK  718

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             L      F W S+   R  + ++W K+ + K  G LG + L+  N A+ AK  W+L++  
Sbjct  719   LTSAISSFWWKSNDKARGMHWLAWDKMCKEKCDGGLGFRALEQFNDAMLAKQYWRLIHYP  778

Query  2340  DGLCVKIMEAKVQLPSLPSQACQMYGRVFLSR  2435
             D L  ++M+ +      P  A + Y   F  R
Sbjct  779   DSLMARVMKGRYFRNQHPIMAKKSYNPSFAWR  810


 Score = 62.8 bits (151),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 129/318 (41%), Gaps = 37/318 (12%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             + F   +   G+++    G   +W     +      RLDRAL N +W+   P+  V +L 
Sbjct  58    VSFNSMLRHCGMLEFPCYGEQLSWRGNRCNNQVVRCRLDRALGNEDWQGFFPNSRVDYLE  117

Query  394   MVNSYHT------LGESRR----FRFNAAW*THPNYQE*VSSTWKSDVSLEA-----NKS  528
             M+ S H+      L  +RR    FRF+  W         V S W    +           
Sbjct  118   MIGSDHSPILATCLKTARRCHRQFRFDKRWLGKEGITAVVESGWNRTKNFRIPGFVDKIR  177

Query  529   NLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSL--SVYQkldlikldrklrreldeil  702
             N    L  W K+ I +         + IS ++ +L  +    L      R + R+L E  
Sbjct  178   NCRNSLSWWRKNNINS-------GPSTISSLKEALQEAKMDDLISTDEIRVIERKLKEAY  230

Query  703   YQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPF  882
               EE+ W  +SR+ W+  GD+NT+++ A+T  R+  + +  L  +   WI    G+    
Sbjct  231   RDEEIYWQQKSRKFWLRVGDKNTKYFQASTKQRRVRNRIIGLFGDDDAWIESPSGMENIA  290

Query  883   HAFYMDLFSE-DSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL------EAVFEMAQF  1041
               ++  LF + D     E L +    PL T     IN   T +D+      +A+F M   
Sbjct  291   TKYFEGLFKKVDGGGISEVLQE--IKPLVTDN---INRDLT-RDISEAEVRKALFAMHPE  344

Query  1042  KAPSSDGFQTSFYQNSWA  1095
             K P  DG    F+Q  WA
Sbjct  345   KTPGPDGMTALFFQRFWA  362



>ref|XP_010233096.1| PREDICTED: uncharacterized protein LOC104583080 [Brachypodium 
distachyon]
Length=877

 Score =   306 bits (783),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 155/437 (35%), Positives = 242/437 (55%), Gaps = 0/437 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP +   +  GTVK+ ++     FF+T  +P G N+TVI L+P   NP  +  FR I LC
Sbjct  338   FPARFFQRHWGTVKNDIVNVVKKFFATRVMPEGVNNTVIVLIPKTKNPISLKDFRPISLC  397

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLM  1421
             NV YK++ K    RL   +  LI   Q++F+ GR IT+N +V  +  ++L+     G   
Sbjct  398   NVIYKVVAKCSVNRLGEYLDKLISRAQSAFIPGRIITDNAIVAFQCFHALQHSKNSGKFR  457

Query  1422  VIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLER  1601
               K+DL KAYDR+ W +++  L+K GF   WI  IM+CV + R A+  +  + + F   R
Sbjct  458   AYKLDLAKAYDRVDWGYLKEALKKFGFHHTWISWIMTCVKSVRYAVKMNGHVLESFQPSR  517

Query  1602  GIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEA  1781
             G+ QGDPLSP LF+  V+ LS LI + ++      +KI R GP +SHL F DD + F + 
Sbjct  518   GLSQGDPLSPFLFLFVVDGLSSLITREIEAASLHDLKIVRNGPRVSHLLFADDRLLFFQV  577

Query  1782  SLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYL  1961
             +  QA V+K  L ++   +GQ LS  K  +   K  S +   A+ + L +  +    +Y 
Sbjct  578   NADQAQVIKNILEQYEKCTGQLLSPGKCSLLLGKACSQQDGAAVKAILNVTNIAFDEKYF  637

Query  1962  GVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLP  2141
             G+P   G +K   +  +  ++  RL  W  + LS  G+  LI+SV+ A+P Y+M + +  
Sbjct  638   GLPVPEGCMKNGKFQGIKEKVGKRLNDWSEKYLSSGGKEVLIKSVIQALPSYSMSAFVFS  697

Query  2142  QGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGW  2321
             +G+   LE L+R F WG  +  RK + ++  K+T  K +G +G + L   NQAL AK  W
Sbjct  698   KGLCEDLEHLTRKFWWGDEENRRKIHWLACDKLTRPKSKGGIGYRDLAAFNQALLAKQAW  757

Query  2322  KLMNKEDGLCVKIMEAK  2372
             +L++K D  C + ++AK
Sbjct  758   RLIDKPDSFCARFIKAK  774



>ref|XP_008242862.1| PREDICTED: uncharacterized protein LOC103341160 [Prunus mume]
Length=872

 Score =   305 bits (782),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 164/438 (37%), Positives = 254/438 (58%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP     K+  +V+D + + A +F++        N T I L+P +  P   +QFR I LC
Sbjct  27    FPAMFYQKYWLSVQDIIFRSAEEFYTGQSHIRDMNKTFIALIPKVLAPESTSQFRPISLC  86

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGL  1418
             N SYK+L+K +  RLKS M  L+   Q +F+  RQI +NV+V  E  + L+ K +G    
Sbjct  87    NTSYKILSKLLANRLKSLMPHLVSDSQNAFLADRQIHDNVIVAHEAFHYLKLKRAGHKYE  146

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
             + IKID+ KAYDR+ W F+ + LQK GF   WIR +M C+ T   ++  + +    F+  
Sbjct  147   VGIKIDMNKAYDRVEWDFLEALLQKLGFHSGWIRLVMLCIRTVSFSVLVNGQPGSSFLPS  206

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP LF+L  E LS  + + V++G   G++++R+ P +SHLFF DD +FF +
Sbjct  207   RGLRQGDPLSPYLFLLVCEALSCNLTKLVQDGVINGIRVSRRAPILSHLFFADDSLFFIK  266

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A     S +K  L+++C  SGQ ++Y KS + FS NT  +++  ISS +GI   ++ G Y
Sbjct  267   AEEENCSRLKGLLDDYCLASGQLINYEKSSLMFSANTPEDVKTNISSIMGIRGFDNSGIY  326

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG+P   GR K+   A +  R+  ++ GWK  TLS  G+  LI+++ +A+P Y M     
Sbjct  327   LGIPMTWGRSKKVVLAYIRERVAKKIMGWKQGTLSMAGKEVLIKAIATAVPAYPMMCFKF  386

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P+ V + +      F WG S+G    +  SWK +  +K  G LG + L   N AL AK  
Sbjct  387   PKVVCNEISSNIAKFWWGKSEGGNGIHWKSWKALCLAKGDGGLGFRDLTEFNLALLAKQS  446

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W++++  + L V+I++A+
Sbjct  447   WRIISTPNALWVRILKAR  464


 Score = 54.7 bits (130),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 58/134 (43%), Gaps = 6/134 (4%)
 Frame = +2

Query  2786  RVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQR  2965
             R+W  I S++   +IR FLW    +   T     RR  T+   CG+C    E I+H +  
Sbjct  618   RIWKAIWSVRTLPKIRMFLWRCMSNAIPTRVNLFRRKITASPMCGLCDQYEESIEHALLL  677

Query  2966  CPIANSVWESLIPYDHRRL*DQDYTN---WFDEGIS-ELSSGNRKHEQRVTFAVTMWWLW  3133
             CP A +VW    P    R+  Q ++    W +  +     S   KH+     +  +W +W
Sbjct  678   CPWAQAVWFG-SPMT-LRIDTQSFSTLDVWLNSILDLRTESKMEKHDLLTMLSFFLWEIW  735

Query  3134  KWRNDLVFSGTNIN  3175
             K R   +  G  I+
Sbjct  736   KTRCKAIMEGCRID  749



>ref|XP_010669434.1| PREDICTED: uncharacterized protein LOC104886665 [Beta vulgaris 
subsp. vulgaris]
Length=1099

 Score =   241 bits (616),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/416 (35%), Positives = 225/416 (54%), Gaps = 28/416 (7%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             KF   +   +I F  D++  G   +  N T I L+P   NP  +  FR I LC V YK+L
Sbjct  461   KFWHIMGADIILFVQDWWKGGVNLSALNRTCIVLIPKCENPKSMKDFRPISLCTVLYKIL  520

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKG-GLMVIKIDL  1439
             +K +  RLK  +  +I P Q++FV  R IT+N LV  E+ ++++    +G G+  +K+D+
Sbjct  521   SKTLANRLKVLLPSIISPNQSAFVPRRLITDNALVAFEIFHAMKRSDVRGDGVCALKLDM  580

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+   + K GF  +WI  +M C+S+    +SF  +++       G+ +G 
Sbjct  581   SKAYDRVEWCFLERVMGKMGFCFEWISKVMDCLSS----VSFTFKVN-------GVVEGS  629

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
              L P          +  IE+ +      G KI R  P +SHLFFVDD + F +AS+ + S
Sbjct  630   -LVP----------ARAIEKKIH-----GAKICRGAPLVSHLFFVDDSILFTKASVQECS  673

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             VV   ++++   SGQ+++  K+ + FSK   ++ + AI S LG+  V+   +YLG+P++ 
Sbjct  674   VVADIISKYERASGQKVNLSKTEVVFSKCVEIDRRNAIVSVLGVQEVDRQEKYLGLPTVI  733

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+ ++A +  RI  +L GWK + LS  G+  LI+SV  AIP Y M    LP G++  
Sbjct  734   GRSKKVTFACIKERIWKKLQGWKEKLLSRPGKEILIKSVAQAIPTYMMSVFCLPSGLVDE  793

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKL  2327
             +  L   F WGS+   RK +  SW  +   K  G LG + L   NQ   A   W++
Sbjct  794   IHSLLARFWWGSNGVERKMHWHSWDALCLPKSMGGLGFRDLHCFNQCKHASTVWQV  849


 Score =   101 bits (251),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 84/307 (27%), Positives = 140/307 (46%), Gaps = 18/307 (6%)
 Frame = +1

Query  217   GFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPM  396
              F++ I   G+ DLG+ G  +TW +G S       RLD  L + +W    P  E++HLP 
Sbjct  160   AFREAIDDCGVKDLGFKGCRFTWQRGNSPSTLIRERLDPMLADEDWCTLFPSWEMIHLPR  219

Query  397   VNSYHT-------LGESRR-----FRFNAAW*THPNYQE*VSSTW--KSDVSLEANKSNL  534
               S H        + ++ R     F+F A W +     + V + W       + A    +
Sbjct  220   YRSDHAPLLLRTGINDAFRRGNKLFKFEAMWLSREECSKVVEAAWCESGGEDISARLEVV  279

Query  535   SKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEE  714
             S QL  W   T G++ +RK R L+R++ +Q+S        ++     +  ELD+I   EE
Sbjct  280   STQLSLWASKTFGDLKKRKKRALSRLNELQQS---SPDATILAHCNTVASELDDIHRLEE  336

Query  715   LLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFY  894
               W  R+R   +  GD+NT+++H   + RK  +++  L D  G W    + I +  H ++
Sbjct  337   SYWHARARANELRDGDKNTKYFHHKASQRKRRNSINGLLDENGVWKKGREEICDIVHQYF  396

Query  895   MDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQT  1071
               LF+ DS    E+  +     +       + +  T +++ EA+F M   KAP  DG   
Sbjct  397   AGLFTSDSPVATEEAVEGLAHCVSDEMNDRLVSPPTGEEVREALFAMHPNKAPGIDGLHA  456

Query  1072  SFYQNSW  1092
              F+Q  W
Sbjct  457   LFFQKFW  463



>gb|AAG51783.1|AC079679_3 reverse transcriptase, putative; 16838-20266 [Arabidopsis thaliana]
Length=1142

 Score =   285 bits (729),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 155/445 (35%), Positives = 244/445 (55%), Gaps = 1/445 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             K    +K  L+   + F   G      N T ICL+P    P  + + R I LCNV YK++
Sbjct  242   KSWAIIKSDLLSLVNSFLQEGVFDKRLNTTNICLIPKTERPTRMTELRPISLCNVGYKVI  301

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDL  1439
             +K +  RLK+ +  LI   Q++FV GR I++N+L+ QE+ + LR+ S  K   M IK D+
Sbjct  302   SKILCQRLKTVLPNLISETQSAFVDGRLISDNILIAQEMFHGLRTNSSCKDKFMAIKTDM  361

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYD++ W+FI + L+K GF   WI  IM C++T +  +  + +     + ERG+RQGD
Sbjct  362   SKAYDQVEWNFIEALLRKMGFCEKWISWIMWCITTVQYKVLINGQPKGLIIPERGLRQGD  421

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  E L   I ++ +     G+K+    P +SHL F DD +FF +A+  Q  
Sbjct  422   PLSPYLFILCTEVLIANIRKAERQNLITGIKVATPSPAVSHLLFADDSLFFCKANKEQCG  481

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             ++ + L ++ S+SGQ++++ KS I F       I+  I   LGI  +  +G YLG+P   
Sbjct  482   IILEILKQYESVSGQQINFSKSSIQFGHKVEDSIKADIKLILGIHNLGGMGSYLGLPESL  541

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             G  K   ++ +  R+Q+R+ GW  + LS  G+  +I+SV + +P Y M    LP+ + S+
Sbjct  542   GGSKTKVFSFVRDRLQSRINGWSAKFLSKGGKEVMIKSVAATLPRYVMSCFRLPKAITSK  601

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             L      F W S+  +R  + ++W K+  SK  G LG + +D  N AL AK  W+L+   
Sbjct  602   LTSAVAKFWWSSNGDSRGMHWMAWDKLCSSKSDGGLGFRNVDDFNSALLAKQLWRLITAP  661

Query  2340  DGLCVKIMEAKVQLPSLPSQACQMY  2414
             D L  K+ + +    S P  + + Y
Sbjct  662   DSLFAKVFKGRYFRKSNPLDSIKSY  686


 Score = 57.8 bits (138),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 59/134 (44%), Gaps = 9/134 (7%)
 Frame = +1

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             EE  W+ +SR  W+  GD N++F+HA T  R++ + +  L D  G W  + D I     +
Sbjct  116   EEQYWYQKSRSLWMKLGDNNSKFFHALTKQRRARNRITGLHDENGIWSIEDDDIQNIAVS  175

Query  889   FYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLEAVFEMAQF-----KAPS  1053
             ++ +LF    TT    + D     +       IN   T    E     A F     KAP 
Sbjct  176   YFQNLF----TTANPQVFDEALGEVQVLITDRINDLLTADATECEVRAALFMIHPEKAPG  231

Query  1054  SDGFQTSFYQNSWA  1095
              DG    F+Q SWA
Sbjct  232   PDGMTALFFQKSWA  245



>ref|XP_009121338.1| PREDICTED: uncharacterized protein LOC103846184 [Brassica rapa]
Length=1285

 Score =   261 bits (668),  Expect(2) = 9e-84, Method: Compositional matrix adjust.
 Identities = 152/456 (33%), Positives = 247/456 (54%), Gaps = 34/456 (7%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             V  ++IK    FF+TG L    N T + L+P       V  +R I LCNV +K+++K + 
Sbjct  427   VGPAVIKEVQLFFTTGVLRPAQNVTHVRLIPKTVGAKKVADYRPIALCNVFFKIISKLLA  486

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAYD  1454
             LRLK+ + ++I   Q++F+ GR I +N+L+  EVL  L+ S++ K   M +K D+ K YD
Sbjct  487   LRLKTVLHLIISENQSAFIPGRAIADNILITHEVLQFLKISQAQKRCTMAVKTDMSKTYD  546

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             R+ W FI   LQ+ GF   W + IM CVST   +   +  +      +RGIRQGDPLSP 
Sbjct  547   RIEWGFIEKVLQRLGFHSKWSQLIMQCVSTVSYSYLINDSVHGSVTPQRGIRQGDPLSPY  606

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LF+L  + LS L +++ K G  +G+++ R  P ++HL F DD +                
Sbjct  607   LFILCGQVLSGLCQKAEKEGTLQGIRVARGSPRVNHLLFADDTI----------------  650

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
                    S ++++  KS I FS  T  + ++++  +LGI      G+YLG+P   GR K+
Sbjct  651   ------RSTEKINSEKSSITFSSRTPEDTKRSVKEALGIVKEGGQGKYLGLPEHFGRRKK  704

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
             D +  L+ RI+ R + +  R LS  G+ T++++VL+AIP +TM    LP  +  R++ + 
Sbjct  705   DLFTTLVDRIRQRASSYSTRHLSKAGKLTMLKAVLTAIPTFTMSCFELPVSLCKRIQSVL  764

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
               F W SS G +K   ++W ++T  K  G LG++ +   NQAL AK  W+++   + L  
Sbjct  765   TRFWWDSSDGVKKMCWVAWDRLTMPKAGGGLGLRDIQLFNQALLAKQAWRILTNPNCLLA  824

Query  2355  KIMEAK---------VQLPSLPSQACQ--MYGRVFL  2429
             +++  K         V +P++ S   +  ++GR  L
Sbjct  825   RVLLGKYCHNKSFMEVSVPAVCSHGWRSILHGRELL  860


 Score = 79.7 bits (195),  Expect(2) = 9e-84, Method: Compositional matrix adjust.
 Identities = 75/306 (25%), Positives = 133/306 (43%), Gaps = 19/306 (6%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
               F+ ++    L D+ + G   +W +G  + +    RLDRA+ N  W    P     +L 
Sbjct  125   CAFRSFLSENDLFDIKHYGNYLSW-RGKRNTHMVQCRLDRAISNSNWMEVFPSCRSQYLK  183

Query  394   MVNSYHT-----LGESRR-----FRFNAAW*THPNYQE*VSSTWKSDVSLEANK--SNLS  537
                S H      L   R+     FRF+     H   ++ +   W+S   L+     +   
Sbjct  184   YEASDHRPLLTFLDTGRKKGLKIFRFDRRLKDHIEVKQIIREVWESTTHLDVGGRLACCR  243

Query  538   KQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEEL  717
             + + +W+K      F+   R +     +Q   ++   +    L  ++  +L     QEE 
Sbjct  244   RAICEWSKE-----FQANSRKMIETLRIQLDDAMSNHVPDDDLIHQINMQLLTAYKQEEE  298

Query  718   LWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYM  897
              W  RSR+ W+  GD NT ++HA T  RKS + +  ++++ G    + + I      +Y 
Sbjct  299   YWKQRSRQLWLALGDSNTSYFHATTKARKSKNRMTVIENDAGVPWFEEEQIANVICKYYA  358

Query  898   DLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQTS  1074
             +LF  + TT L  + +A  P + +    A+    +  ++ EA F +   KAP  DGF  S
Sbjct  359   NLFKANQTTDLHIVEEALRPCVSSQINEALIQDPSAAEIREATFAIHPDKAPGPDGFSAS  418

Query  1075  FYQNSW  1092
             F+Q +W
Sbjct  419   FFQANW  424



>ref|XP_007203701.1| hypothetical protein PRUPE_ppa020995mg, partial [Prunus persica]
 gb|EMJ04900.1| hypothetical protein PRUPE_ppa020995mg, partial [Prunus persica]
Length=1367

 Score =   230 bits (587),  Expect(3) = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/431 (32%), Positives = 219/431 (51%), Gaps = 26/431 (6%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             K+   V + ++     FF TG L    N T + L+P +  P  + Q R I L NV YK+ 
Sbjct  732   KYWQIVGEDVVAAVLHFFKTGKLLKKINFTHVALIPKVHEPKNMMQLRLISLFNVLYKIG  791

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKS-GKGGLMVIKIDL  1439
              K +  RLK+ +  LI   Q++FV GR I++N +V  E+L+ +  K+ G+ G + +KID+
Sbjct  792   AKVLATRLKAILPTLISDTQSAFVPGRAISDNSIVAFELLHMMHKKNHGRQGYLALKIDM  851

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR                         CV+    +   +     + + +RG+RQGD
Sbjct  852   SKAYDR-------------------------CVTRVSYSFMLNGNPVGYVIPQRGLRQGD  886

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  E LS LI Q+ +     G+ + R  P +SHLFF DD   F  A+     
Sbjct  887   PLSPYLFLLCAEALSSLILQAERRNLLHGVNLCRGAPSVSHLFFTDDRFLFLRANQQDCE  946

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              +     ++  + GQ++   KS + FS N     Q  +++ L +  V+    YLG+P+  
Sbjct  947   QLSIIFQKYEMVLGQKIHLEKSCVSFSNNMDRTDQDNLAAVLEVKRVDQHDVYLGLPTHV  1006

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR ++  +  L  RI  ++ GWK + LSF G+  L++ V   +P Y M   L+P+ +   
Sbjct  1007  GRSRRQCFNSLKERIWKKIQGWKAKLLSFAGKEILLKVVAQVVPIYMMNCFLIPKCLCDE  1066

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             ++++   + WG   G RK + +SW K+   K +G LG + L   N AL AK  W+L+   
Sbjct  1067  IQQVMARYWWGEQDGQRKIHWLSWNKLCLPKQEGGLGFRNLYAFNMALLAKQLWRLIQTP  1126

Query  2340  DGLCVKIMEAK  2372
             + L  +I++A+
Sbjct  1127  NSLVARILKAR  1137


 Score =   110 bits (275),  Expect(3) = 1e-83, Method: Compositional matrix adjust.
 Identities = 87/300 (29%), Positives = 141/300 (47%), Gaps = 13/300 (4%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             LGF+  I   G  DLGY+GP YTW +  ++P     RLDRAL   +W  R    +V+HL 
Sbjct  441   LGFRQAIDTCGFKDLGYTGPKYTWWR--NNPMEIRIRLDRALATADWCSRFLGTKVIHLN  498

Query  394   MVNSYHTLGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSK------QLDDW  555
                S H L   + FRF   W  H N  + +   W+      A  +   K      QL  W
Sbjct  499   PTKSDH-LPLKKLFRFEEMWAEHVNCMQTIQDGWQRTSRGSAPFTTTEKLKCTCHQLLGW  557

Query  556   NKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RS  735
             +K   G++  +   +      +   L        ++L   L ++LD ++ + E+ W  RS
Sbjct  558   SKCNFGHLPNQ---IKITQEKLGELLDAPPSHHTVELRNVLTKQLDSLMAKNEVYWRQRS  614

Query  736   REEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSED  915
             R  W+ +GDRN++F+H   + R+  +T+  L+D  G W +   G+ +    ++  LFS  
Sbjct  615   RATWLKAGDRNSKFFHYKASSRRRRNTISALEDEHGHWQTTEQGLTQTVVNYFQHLFSST  674

Query  916   STTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSFYQNSW  1092
              +++   + D     +       + A FT ++++ A+F+M   KAP  DGF   FYQ  W
Sbjct  675   GSSEYTGVVDGVRGRVTEEMNQTLLAEFTPEEIKIALFQMHPSKAPGPDGFSPFFYQKYW  734


 Score = 21.9 bits (45),  Expect(3) = 1e-83, Method: Composition-based stats.
 Identities = 10/34 (29%), Positives = 18/34 (53%), Gaps = 0/34 (0%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDS  2506
             S +W+ + K+  ++ K S+  + N  S   W DS
Sbjct  1154  SYIWQSLCKARVLIEKESQWRIGNGHSVRIWGDS  1187



>gb|AAD29058.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1229

 Score =   273 bits (699),  Expect(3) = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/434 (34%), Positives = 244/434 (56%), Gaps = 10/434 (2%)
 Frame = +3

Query  1131  FFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLI  1310
             FF++ + P   N+T I L+P    P  V  +R I LCN+ YK++ K MT R++  +  LI
Sbjct  369   FFTSKNFPRRMNETHIRLIPKDLGPRKVADYRPIALCNIFYKIVAKIMTKRMQLILPKLI  428

Query  1311  GPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGL-MVIKIDLEKAYDRLSWSFIRSTL  1487
                Q++FV GR I++NVL+  EVL+ LR+ S K    M +K D+ KAYDR+ W F++  L
Sbjct  429   SENQSAFVPGRVISDNVLITHEVLHFLRTSSAKKHCSMAVKTDMSKAYDRVEWDFLKKVL  488

Query  1488  QKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSH  1667
             Q+ GF   WI  ++ CV++   +   +       +  RG+RQGDPLSP LF+L  E LS 
Sbjct  489   QRFGFHSIWIDWVLECVTSVSYSFLINGTPQGKVVPTRGLRQGDPLSPCLFILCTEVLSG  548

Query  1668  LIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQR  1847
             L  ++ +  Q  G++++  GP ++HL F DD +FF ++     + + + L+ +   SGQ 
Sbjct  549   LCTRAQRLRQLPGVRVSINGPRVNHLLFADDTMFFSKSDPESCNKLSEILSRYGKASGQS  608

Query  1848  LSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQ  2027
             +++ KS + FS  T   ++  +   L I      G+YLG+P   GR K+D +  ++ +I+
Sbjct  609   INFHKSSVTFSSKTPRSVKGQVKRILKIRKEGGTGKYLGLPEHFGRRKRDIFGAIIDKIR  668

Query  2028  ARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGN  2207
              +   W +R LS  G+  ++++VL+++P Y+M    LP  +  +++ L   F W +    
Sbjct  669   QKSHSWASRFLSQAGKQVMLKAVLASMPLYSMSCFKLPSALCRKIQSLLTRFWWDTKPDV  728

Query  2208  RKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK-----  2372
             RK + ++W K+T  K+ G LG + ++  N +L AKLGW+L+N  + L  +I+  K     
Sbjct  729   RKTSWVAWSKLTNPKNAGGLGFRDIERCNDSLLAKLGWRLLNSPESLLSRILLGKYCHSS  788

Query  2373  ----VQLPSLPSQA  2402
                  +LPS PS  
Sbjct  789   SFMECKLPSQPSHG  802


 Score = 67.8 bits (164),  Expect(3) = 1e-83, Method: Compositional matrix adjust.
 Identities = 81/310 (26%), Positives = 132/310 (43%), Gaps = 27/310 (9%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEW--KIRSPDVEVL-  384
             + F+ +I + GL DL YSG  ++W +G+    F   RLDRA+ N  W     S   E L 
Sbjct  56    IDFRSFISKNGLWDLKYSGNPFSW-RGMRYDWFVRQRLDRAMSNNSWLESFPSGRSEYLR  114

Query  385   -----HLPMVNSYHTLGESRR--FRFNAAW*THPNYQE*VSSTWKS--DVSLEANKSNLS  537
                  H P+V         RR  FRF+     +      +  TW +  D S+    +   
Sbjct  115   FEGSDHRPLVVFVDEARVKRRGQFRFDNRLRDNDVVNALIQETWTNAGDASVLTKMNQCR  174

Query  538   KQLDDWNKHTIGNIFRRK*RVLARISGVQRSL--SVYQkldlikldrklrreldeilYQE  711
             +++ +W +  + N+   +      I   Q++L  ++            L   L+     E
Sbjct  175   REIINWTR--LQNLNSAE-----LIEKTQKALEEALTADPPNPTTIGALTATLEHAYKLE  227

Query  712   ELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAF  891
             E  W  RSR  W+ SGDRNT ++HA T  R++ + +  ++D  G    +   I +    +
Sbjct  228   EQFWKQRSRVLWLHSGDRNTGYFHAVTRNRRTQNRLTVMEDINGVAQHEEHQISQIISGY  287

Query  892   YMDLFSEDSTTQLEDLNDAFFPPLHTSQ---WLAINAHFTVKDLEAVFEMAQFKAPSSDG  1062
             +  +F+ +S      +++A  P +          I     VKD  AVF +   KAP  DG
Sbjct  288   FQQIFTSESDGDFSVVDEAIEPMVSQGDNDFLTRIPNDEEVKD--AVFSINASKAPGPDG  345

Query  1063  FQTSFYQNSW  1092
             F   FY + W
Sbjct  346   FTAGFYHSYW  355


 Score = 21.6 bits (44),  Expect(3) = 1e-83, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 18/39 (46%), Gaps = 0/39 (0%)
 Frame = +2

Query  2396  SGMSNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             S  S+ W+ I+    IL +G   L+ N      W D W+
Sbjct  797   SQPSHGWRSIIAGREILKEGLGWLITNGEKVSIWNDPWL  835



>ref|XP_008391838.1| PREDICTED: uncharacterized protein LOC103454030 [Malus domestica]
Length=1374

 Score =   310 bits (793),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 162/428 (38%), Positives = 252/428 (59%), Gaps = 3/428 (1%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             TV + ++K    F+ +G++    N T + L+P +  P  ++QFR I LCNV YK+L K +
Sbjct  393   TVGEDVVKAIKAFWHSGNMLRKLNHTNLVLIPKVKCPKNMSQFRPIALCNVIYKILAKVI  452

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL--RSKSGKGGLMVIKIDLEKA  1448
             T RLK  M  +IG  Q++FV G+QI +N+LV  E+L+SL  +SK  + G M IK+D+ KA
Sbjct  453   TNRLKKIMPKVIGENQSAFVAGKQIQDNILVVHEILHSLNHQSKDMQKG-MAIKLDMAKA  511

Query  1449  YDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLS  1628
             YDR+ W F+ S + K GF+P +   +M C+ST   +I  +   + +   +RG+RQGDPLS
Sbjct  512   YDRVEWEFLFSMMSKLGFAPMFCNRVMECISTVSFSILVNGAPTGYIQPQRGLRQGDPLS  571

Query  1629  PLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVK  1808
             P LF++  E  S LI + ++ G   G K T  G  ++HLFF DD V FG A++ +A  V 
Sbjct  572   PFLFLICTEGFSSLIRKGMERGILHGYKFTTNGIPLTHLFFADDSVLFGNATVEEAQGVA  631

Query  1809  KCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRL  1988
               LN + S SGQ ++  KS IFF  +TS   ++ I ++LGIP  +  G+YLG+ +  G  
Sbjct  632   DILNTYASGSGQEINLSKSSIFFGTSTSKRTKKRIGNTLGIPYKDGFGKYLGLQADFGHS  691

Query  1989  KQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLER  2168
             K+  +A++  +I+ARL GW  + LS  G+  +I++V  A+P Y M    LP GV   +E+
Sbjct  692   KKAVFAEIRDKIEARLAGWSEQFLSQAGKEVMIKAVAMALPNYAMSCFKLPIGVCRDVEK  751

Query  2169  LSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGL  2348
               R + W  +   R C+  SW ++ + K  G +G + +   N A  AK+GW+L+     L
Sbjct  752   AVRSYWWRGNTQKRGCHWTSWDRLMKQKSAGGMGFKDIQCFNLAFLAKIGWRLIQNPTSL  811

Query  2349  CVKIMEAK  2372
                +++ K
Sbjct  812   LATVLKDK  819


 Score = 65.5 bits (158),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 89/193 (46%), Gaps = 10/193 (5%)
 Frame = +2

Query  2777  TYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHI  2956
             T++R+W     L+ P +I+ F+W   +          RR    E  CG+C    E  +H+
Sbjct  977   TWKRIWK----LQAPNKIKFFIWKCCNKALAVRHNLQRRQIRVENICGVCNTFDESENHL  1032

Query  2957  MQRCPIANSVW-ESLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLW  3133
               +C  ++  W  S +  +   L   D+   +D+  +   +  +  E     A  +W LW
Sbjct  1033  FFQCEFSHRFWFGSPLHINSHELAGVDFLESWDKICTSTKNMEKAEEILQEVAFGLWRLW  1092

Query  3134  KWRNDLVFSGTN-INLAARIKW---IRDQVEEINISFSKAKGLIAP-IESICWRQLKWIR  3298
             K RND+VF+G +  +L   + W   I +  E + ++      LI+  ++++   +L W +
Sbjct  1093  KNRNDVVFNGVHRQHLEVMMLWRKNISEYREAMPLNLKSDCYLISKTLKTVQRPKLHWTK  1152

Query  3299  PQVGWVKANIDGS  3337
             P+ G +K N D +
Sbjct  1153  PKFGIIKVNTDAA  1165



>ref|XP_010495785.1| PREDICTED: uncharacterized protein LOC104772929 [Camelina sativa]
Length=1074

 Score =   280 bits (717),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/427 (35%), Positives = 244/427 (57%), Gaps = 1/427 (0%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             TV D +I     FF +G LP   N T + L+P I +P  V  +R I LC+V YK++ K +
Sbjct  207   TVCDKVIAEIQSFFISGLLPEHINHTHVRLIPKITSPKRVADYRPIALCSVYYKIIAKLI  266

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGL-MVIKIDLEKAY  1451
             + +L+  ++  I   Q++FV GR IT+NVL+  E L+ L+S   +  + M +K D+ KAY
Sbjct  267   SKKLQPILQDCISQNQSAFVPGRAITDNVLITHEALHYLKSSIAQERVFMAVKTDMSKAY  326

Query  1452  DRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSP  1631
             DRL W FI   L + GF P W   ++ CV+T   +   + +       E GIRQGDPLSP
Sbjct  327   DRLEWGFIEEVLTRMGFHPQWTSWLLQCVTTVSYSYLLNGQAKGLVRPEHGIRQGDPLSP  386

Query  1632  LLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKK  1811
              +F+L  E LS L  ++  +G+  G+++ +  P ++HL F DD +FF +++    + +K+
Sbjct  387   YIFILCSEVLSGLCNKAQLHGRLPGIRVAKGSPRVNHLLFADDTMFFCKSNKTSVNQLKQ  446

Query  1812  CLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLK  1991
              L ++ +  GQ++++ KS I FS  T  E+++ +   LGI  V   G+YLG+P + GR K
Sbjct  447   ILQKYEAALGQQINHDKSSITFSSKTKNEVKERVKQELGISKVGGQGKYLGLPELFGRKK  506

Query  1992  QDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERL  2171
             +D ++ ++ RI+ +   W  R LS  G+ T+++SVL+A+P YTM    LP+ + SR++  
Sbjct  507   RDLFSMIVDRIKQKGLSWSTRFLSSAGKLTMLKSVLAAMPSYTMSCFKLPKSLCSRIQSA  566

Query  2172  SRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLC  2351
                F W      +K   ++W K+T+S   G L  + +   N A  AK+ W+++ +   L 
Sbjct  567   FTRFWWDEKPTKKKMCWLAWDKMTKSLKDGGLEFRDIQTFNDAFLAKISWRILTQPSCLL  626

Query  2352  VKIMEAK  2372
              KI+  K
Sbjct  627   AKILLGK  633


 Score = 60.5 bits (145),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 60/114 (53%), Gaps = 5/114 (4%)
 Frame = +1

Query  760   DRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTTQLEDL  939
             D+NT F+HAAT  RK+ + +  ++ + GE + +   I++   ++Y  LF+   TT+   +
Sbjct  94    DKNTGFFHAATKSRKAINNISVIETDSGEIVYEEHEIVKTIASYYQKLFTSTETTRTNVV  153

Query  940   NDAFFPPL---HTSQWLAINAHFTVKDLEAVFEMAQFKAPSSDGFQTSFYQNSW  1092
              +A  P +        + I +   +K   A F++   KAP  DGF  SF+Q +W
Sbjct  154   QEAITPCVTEEMNESLIQIPSPTEIKS--ACFDIHPDKAPGPDGFSASFFQTNW  205



>dbj|BAE79385.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score =   309 bits (791),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 156/436 (36%), Positives = 254/436 (58%), Gaps = 0/436 (0%)
 Frame = +3

Query  1065  PNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCN  1244
             P     +F G V  ++    +  F  G          + L+P    P     FR I L N
Sbjct  457   PAVFYQQFWGEVGPAMTDMVNHAFENGSTYISQLQAFMTLIPKKDTPETAADFRPITLLN  516

Query  1245  VSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMV  1424
             VS+K+++K +  RL+  M  +IGP Q SF+ GR   +NV++ QEV++S+ +   K   M+
Sbjct  517   VSFKVISKVLVNRLRPIMSNIIGPHQNSFLPGRSTMDNVILTQEVVHSMNNPRRKKKQMI  576

Query  1425  IKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERG  1604
             +K+DL+KAYD +SW ++  TL+  GF    I  I+  +  S LAI ++      F   RG
Sbjct  577   LKVDLQKAYDSVSWDYLEETLEDFGFPRRLIDLILFSLQESSLAILWNGGRLPPFKPGRG  636

Query  1605  IRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEAS  1784
             +RQGDPL+P LF L +ERL+H I+  V    WK + ITR G  ISHLFF DDL+ FGEAS
Sbjct  637   LRQGDPLAPYLFNLVMERLAHDIQTRVNARTWKPVHITRGGTGISHLFFADDLMLFGEAS  696

Query  1785  LHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLG  1964
              HQA ++  CL+ F + SG ++++ KS +F S N +  +++AI S L +P+   LG YLG
Sbjct  697   EHQAQIMFDCLDSFSNASGLKVNFSKSLLFCSSNVNAGLKRAIGSILQVPVAESLGTYLG  756

Query  1965  VPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQ  2144
             +P +  R+ ++++  ++ +++ +L+ WK  +L+  GR  L+Q+ L+ +P YTMQ   LP 
Sbjct  757   IPMLKERVSRNTFNAVIDKMRTKLSSWKASSLNMAGRRVLVQASLATVPTYTMQVMALPV  816

Query  2145  GVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWK  2324
                + +++  R+FLWG     RK + ++W ++ + +++G LG++     N+A   K+ W+
Sbjct  817   STCNEIDKTCRNFLWGHDTNTRKLHSVNWAEICKPRNEGGLGLRMARDFNRAFLTKMAWQ  876

Query  2325  LMNKEDGLCVKIMEAK  2372
             + +  D L VK++  K
Sbjct  877   IFSNIDKLWVKVLREK  892


 Score =   127 bits (320),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 103/301 (34%), Positives = 157/301 (52%), Gaps = 20/301 (7%)
 Frame = +1

Query  244   GLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHT---  414
             GL+D G SGP +TW + + +   +  RLDR L N+  ++  P+ +V  LP + S H    
Sbjct  169   GLLDPGSSGPNFTWCRFIGNRVVQRRRLDRVLWNVSAQLTFPEAKVSVLPRLCSDHNPIL  228

Query  415   -LGES--------RRFRFNAAW*THPNYQE*-VSSTWKSDVSLEANKSNLSKQLDDWNKH  564
              L E+        R  RF AAW T  +Y+     +T +   +LE   + ++++   WN++
Sbjct  229   FLDEAGNPPVRSLRPVRFEAAWLTSEDYKHIWKEATEREGSNLEDIIATVTQKSLLWNRN  288

Query  565   TIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREE  744
               GNIF RK ++  RI G+QR+ +    + L  L+++L  EL+E+L QEE LWF ++R +
Sbjct  289   VFGNIFNRKRKIENRILGIQRAWNYNTSVRLQDLEKRLLSELNEVLVQEETLWFQKARTD  348

Query  745   WIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFS---ED  915
             WI +GDRNT FYH +  ++++ + VR LK   G W  D D + E    F+  LF     D
Sbjct  349   WIRNGDRNTTFYHRSALIKRNRNRVRFLKLQ-GAWTDDADLLTEHIINFFSTLFCRVDRD  407

Query  916   STTQLEDLNDAFFPPLHTSQWLAINAHF-TVKDLEAVFEMAQFKAPSSDGFQTSFYQNSW  1092
             S    + L   F  P   +  L   A    VK  +AVF M ++ +P  DG    FYQ  W
Sbjct  408   SQPPRQGLPMDFQIPRDQASTLLRRASLEEVK--KAVFGMKKYGSPGPDGIPAVFYQQFW  465

Query  1093  A  1095
              
Sbjct  466   G  466


 Score = 86.3 bits (212),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/222 (28%), Positives = 101/222 (45%), Gaps = 19/222 (9%)
 Frame = +2

Query  2825  RIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCPIANSVWESLIP  3004
             +I+ F+W    +  M N +R RRG      C +C    E +DH+ +RC +A + W+S +P
Sbjct  1048  KIKLFMWKIVKNGLMVNVERKRRGLADAASCPVCGEEDETLDHLFRRCLLAEACWDSAVP  1107

Query  3005  YDHRRL*DQDYT-NWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWRNDLVFSGTNINLA  3181
                 +  +  +  +W     S            + F   +W LWK RN LVF   NI   
Sbjct  1108  PLTFQTSNHLHMHSWMKAACSSQQKDGYGTNWSLIFPYILWNLWKARNRLVFDN-NITAP  1166

Query  3182  ARIKWIRDQVEEINISF---SKAKGLIAP---IESICWRQLKWIRPQVGWVKANIDGSSI  3343
             + I         +N SF   S+A+ L+A    +++     + W  P  G+ K N DG+  
Sbjct  1167  SDI---------LNRSFMESSEARCLLAKRTGLQTAFQTWVVWSPPAAGFTKLNSDGACK  1217

Query  3344  PSNSIARCGGFIRDDQGC*LKGFMHNIGLNQRVSS*PRLWGL  3469
               + +A  GG +R++ G  + G++ NIG      +   LWGL
Sbjct  1218  SHSHLASAGGLLRNENGLWVAGYICNIGTANSFLA--ELWGL  1257



>ref|XP_010671205.1| PREDICTED: uncharacterized protein LOC104888072 [Beta vulgaris 
subsp. vulgaris]
Length=1592

 Score =   264 bits (674),  Expect(3) = 2e-83, Method: Compositional matrix adjust.
 Identities = 156/444 (35%), Positives = 242/444 (55%), Gaps = 25/444 (6%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             VK  + +    F+++  LP GCN   I L+P I NP     FR I +    YK++ K M 
Sbjct  674   VKHDIYEMVHKFWASSQLPQGCNVAYIALIPKIDNPSSFKDFRPISMVGCLYKIIAKLMA  733

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
              RL+  M  LIG  Q+S++ GRQI +  LV  E+++S + K+GK  ++  K+D  KAYD 
Sbjct  734   SRLQKIMSSLIGTLQSSYIEGRQILDGALVAGEIIDSYK-KNGKEAIL-FKLDFHKAYDS  791

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             +SW F++  L++  F   W   IMSCVS++  +I  +   S  F L+RG+RQGDPLSP L
Sbjct  792   VSWGFLKWVLEQMNFPSKWREWIMSCVSSAYASILVNGSPSAPFKLQRGLRQGDPLSPFL  851

Query  1638  FVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCL  1817
             F+L  E L+ +I ++   G W G++I + G  I+HL + DD++ F EA +     +KK L
Sbjct  852   FLLIGEVLNQVILKASNMGLWSGLEIRKDGLNITHLQYADDILIFSEAKMESLKNIKKAL  911

Query  1818  NEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAIS-----------SSLGIPIVNDLGRYLG  1964
               F   SG ++++ KS I       + +QQA +           + LG+PI  DL R   
Sbjct  912   ILFHLASGLQVNFHKSSIIGLNTPKIWLQQAAADLQCKTGDIPFTYLGLPIGGDLSR---  968

Query  1965  VPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQ  2144
                IH      ++  +++++  +L  WK R LS  GR TLI+S LS +P Y M    +P 
Sbjct  969   ---IH------AWDPIINKVSKKLATWKGRMLSIGGRLTLIKSSLSNLPIYYMSIFPIPT  1019

Query  2145  GVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWK  2324
             GV+ ++ +++R FLW  +   R  +L+SW+ V   K  G LGI  +   N A+ +K  W+
Sbjct  1020  GVIKKINKITRQFLWSGNMEKRSLSLVSWEIVQLPKTMGGLGIGSILHKNIAMLSKWFWR  1079

Query  2325  LMNKEDGLCVKIMEAKVQLPSLPS  2396
             L+     L  +++  K +  S PS
Sbjct  1080  LLQDPTPLWSQVICDKYRYSSAPS  1103


 Score = 76.3 bits (186),  Expect(3) = 2e-83, Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 144/312 (46%), Gaps = 36/312 (12%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVL-----  384
             F +++    L+++  S   +TW +G S      + LDR   + EW  + P ++V      
Sbjct  375   FNNFVQDSHLLEISSSSGGFTWFRGNSR-----SILDRLFVHPEWLSKLPTIKVDLLQRG  429

Query  385   ---HLPMVNSYHTLGES---RRFRFNAAW*THPNYQE*VSSTWKSDVSLEANK--SNLSK  540
                H P++   HT  ++   + FRF   W T P+  + V + W+   +L+  +    + K
Sbjct  430   LSDHCPLL--VHTKDQNWGPKPFRFQNCWLTDPDCLKIVKNVWQESAALQTREKLKEVKK  487

Query  541   QLDDWNKHTIGNI---FRRK*RVLARISGVQ--RSLSVYQkldlikldrklrreldeilY  705
             +L++WN++  GNI    ++    + R+  +   R L   +  +  K   +L   +     
Sbjct  488   RLNEWNQNEFGNIDTKIKKLENEIQRLDEINNFRDLEAQEVDNRKKAQSELWVWMK----  543

Query  706   QEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFH  885
             ++EL W   SR  W+  GDRNT+F+H   + ++  +++  +  + G+ + D   I     
Sbjct  544   RKELYWAQNSRISWLKEGDRNTKFFHDIASNKRRKNSINSIIID-GQPVDDPSCIKNEAR  602

Query  886   AFYMDLFSE--DSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSS  1056
             AF+  +F E  D     ++LN   F  +   Q   +   F+ ++++ AV      KAP  
Sbjct  603   AFFKGIFREEYDIRPHFDNLN---FKQVTEEQGSQLTLPFSREEIDNAVASCDSDKAPGP  659

Query  1057  DGFQTSFYQNSW  1092
             DGF   F +++W
Sbjct  660   DGFNFKFIKSAW  671


 Score = 21.9 bits (45),  Expect(3) = 2e-83, Method: Compositional matrix adjust.
 Identities = 9/25 (36%), Positives = 14/25 (56%), Gaps = 0/25 (0%)
 Frame = +2

Query  2441  ILLKGSKKLVKNDRSTLFWLDSWIG  2515
             I+ KG +K + N   T FW + W+ 
Sbjct  1132  IISKGIRKNIGNGSQTRFWHEPWLA  1156



>ref|XP_010673168.1| PREDICTED: uncharacterized protein LOC104889608 [Beta vulgaris 
subsp. vulgaris]
Length=1712

 Score =   257 bits (657),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/431 (32%), Positives = 233/431 (54%), Gaps = 27/431 (6%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             +F   V D +    +        P+  N+T I L+P + +P LV++FR I LCNV +K++
Sbjct  845   RFWHIVGDDVTSVVAGIIHGTRPPDALNNTNIALIPKVKSPTLVSEFRPISLCNVIFKLV  904

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDL  1439
             TK +  RLK+ +  ++   Q++FV GR IT+N L+  E+ +S++ +  G  G + +K+D+
Sbjct  905   TKVLANRLKTILPGVVSENQSAFVPGRLITDNALIALELFHSMKYRCKGNRGFVAMKLDM  964

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ WSF+RS L K GF+  W++ +M CVS+ R +   +  +    +  RG+RQGD
Sbjct  965   SKAYDRVEWSFLRSLLDKMGFADSWVKCVMDCVSSVRYSFVVNGDVCGSVIPSRGLRQGD  1024

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             P+SP LF+L  +  S L+ ++V +    G++                          + S
Sbjct  1025  PISPYLFILVADAFSALVRKAVADKSIHGIQ--------------------------ECS  1058

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             V+   LN++ + SGQ+++  KS + FSK  S   ++ +   L +  V+   +YLG+P++ 
Sbjct  1059  VIVDILNKYEAASGQKINIEKSEVSFSKGVSSVQKKELVEFLAMRQVDRHSKYLGIPTLA  1118

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR KQ  ++ +M R+  +L GWK + LS  G+  L+++V+ AIP Y M     P  ++  
Sbjct  1119  GRSKQHLFSGIMDRVWKKLQGWKEKLLSRAGKEVLLKTVIQAIPTYVMGVYRFPVAIVKS  1178

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             +      F WGS    R     SW+ +   K  G +G + L   N+AL  +  W+L+  E
Sbjct  1179  IHSAMAKFWWGSKGDRRPMYWKSWESMCNPKCLGGMGFRDLSVFNEALLGRQAWRLIQCE  1238

Query  2340  DGLCVKIMEAK  2372
             D L  K+++AK
Sbjct  1239  DSLLSKVLKAK  1249


 Score = 83.2 bits (204),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 84/301 (28%), Positives = 130/301 (43%), Gaps = 23/301 (8%)
 Frame = +1

Query  247   LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHTLGES  426
             L DLG+SG  YTW +G +       RLDR L + +W    P V V H+    S HT    
Sbjct  551   LRDLGFSGLWYTWERGKNPTTQIRERLDRFLASPQWFDCFPQVHVEHMVRYKSDHTPIMV  610

Query  427   RRF--------------RFNAAW*THPNYQE*VSSTW--KSDVSLEANKSNLSKQLDDWN  558
             + F              RF  AW    + +  V + W   S +  EA    +++ L  W+
Sbjct  611   QLFGCKRRRKKRKKKRFRFGTAWLLEDSCESLVRTAWDHSSGLPFEARIGAVAQDLVVWS  670

Query  559   KHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSR  738
             K T+ ++ R    V   I  +Q S          +   +   +LD +L ++E  W+ RSR
Sbjct  671   KDTLNHLGREICLVEEEIKRLQHS----SIAADQEHLMECHSKLDGLLEKQEAYWYLRSR  726

Query  739   EEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSED-  915
                I  GD+NT+++H   + RK  + +  L D    W  D + I     A+Y +LF+   
Sbjct  727   VAEIKDGDKNTKYFHHKASQRKRRNYINGLFDEGDVWRDDDEDIERVVEAYYKNLFTSSL  786

Query  916   -STTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQTSFYQNS  1089
              S   L  + DA  P +     + +      +++ EA+ +M   KAP  DG    FYQ  
Sbjct  787   PSDEALSAVLDAVVPIISEEMNVVLCRRVVKEEVWEALRQMHPSKAPGPDGMHAVFYQRF  846

Query  1090  W  1092
             W
Sbjct  847   W  847



>ref|XP_010476358.1| PREDICTED: uncharacterized protein LOC104755638 [Camelina sativa]
Length=1553

 Score =   281 bits (718),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/445 (34%), Positives = 245/445 (55%), Gaps = 1/445 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             K  G VK  L+   + F   G      N T ICL+P +  P  + + R I LCNVSYK++
Sbjct  560   KSWGIVKTDLVDLVNRFLVEGVFDKSLNRTHICLIPKVAKPTRMAELRPISLCNVSYKII  619

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDL  1439
             +K +  RLK  +  LI   Q++FV GR I++N+L+ QE+ + LR+  S KG  M IK D+
Sbjct  620   SKVLCQRLKGVLPGLISETQSAFVPGRLISDNILIAQEMFHGLRTNPSCKGKFMAIKTDM  679

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+ + L+K GF+  W+  IM C+++    +  + + +   + ERG+RQGD
Sbjct  680   SKAYDRVEWDFVAALLRKMGFAESWVSWIMVCITSVEYRVLINGQPNGLIVPERGLRQGD  739

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  E L   I ++ ++    G+K+  K P I+HL F DD +FF +A   Q  
Sbjct  740   PLSPYLFILCTEVLIANIRKAERDKLITGIKVANKCPPITHLLFADDSLFFCKADREQCR  799

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              +   L ++  +SGQ++++ KS + F      + +  +   LGI  +  +G YLG+P   
Sbjct  800   AILDILKQYELVSGQQINFSKSSVQFGHKIDDQTKNELQGVLGIMTLGGMGSYLGLPESL  859

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             G  K   ++ +  RIQ+R  GW    LS  GR  +I+SV + +P + M    LP+ + S+
Sbjct  860   GGAKTKIFSFVRERIQSRTNGWTANLLSKGGREVMIKSVATVVPTFVMSCFRLPKTITSK  919

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             L     +F W ++  +   + ++W+K+  SK  G LG + +D  N AL AK  W+L++  
Sbjct  920   LTSAVANFWWSTNGQSGGMHWLAWEKLCVSKQLGGLGFRNVDDFNSALLAKQLWRLIDAP  979

Query  2340  DGLCVKIMEAKVQLPSLPSQACQMY  2414
             + L  ++ +++    + P    + Y
Sbjct  980   ESLFARVFKSRYYRNTNPLDPIRSY  1004


 Score = 59.7 bits (143),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 65/134 (49%), Gaps = 9/134 (7%)
 Frame = +1

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             EE+ W+ +SR +W+  GD+N++++HA T  R++ + +  L +    W ++   I     +
Sbjct  434   EEIYWYQKSRSKWMRLGDKNSKYFHALTKQRRARNRITGLFNKDDIWSTEDVDICNTAVS  493

Query  889   FYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-----AVFEMAQFKAPS  1053
             ++ DLF+  + T  E++       + T      N   T    E     A+F M   KAP 
Sbjct  494   YFEDLFTSTNPTNFEEV----LREVQTVITAEDNERLTRPATEAEVKSALFMMHPDKAPG  549

Query  1054  SDGFQTSFYQNSWA  1095
             SDG    F+Q SW 
Sbjct  550   SDGMTALFFQKSWG  563



>ref|XP_010681283.1| PREDICTED: uncharacterized protein LOC104896266 [Beta vulgaris 
subsp. vulgaris]
Length=1144

 Score =   307 bits (786),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 166/438 (38%), Positives = 252/438 (58%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             +P     K+   V +S+I+    FF +GHL    N T + L+P + NP   N FR I LC
Sbjct  412   YPPFFFQKYWTLVGNSVIRAVRAFFHSGHLLKEINHTFLALIPKVDNPSSTNHFRPISLC  471

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLM  1421
             +  YK+++K +T RLKS +  +I P Q +FV  R I +N+L+  EV +S   KSG  G +
Sbjct  472   STIYKVVSKILTNRLKSVLGKIIHPLQGAFVPDRFIQDNILIAHEVFHSFHKKSGVDGWL  531

Query  1422  VIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLER  1601
              IK+D+EKAYDRL W+FI  +L+K GF   W+  I SC+ST   ++  +    K F   R
Sbjct  532   AIKLDMEKAYDRLEWNFILVSLKKLGFCSRWVDWIRSCISTPSFSVLVNGIPGKRFTPSR  591

Query  1602  GIRQGDPLSPLLFVLYVERLS-HLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             GIRQGDPLSP LF+LY E L+  L   ++   +  G+ I + G  I  L F DD + F +
Sbjct  592   GIRQGDPLSPYLFILYAELLARQLSAANLHRDKLVGVPIGKSGIRIPFLTFADDTMIFAK  651

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             AS     V+K+ L+ +CS+SGQ ++Y KS    S N  +  + + +  LG+  V++LG Y
Sbjct  652   ASEASCVVIKQILDSYCSMSGQLVNYHKSAFQCSPNVPISTKASFAGLLGMNEVSNLGEY  711

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG P I  R+ ++++  + +R+ ++L  WK  +LS  GR+ L+Q+ L+    Y MQS  L
Sbjct  712   LGCPIIDSRVTKETFGVVCNRVASQLPKWKANSLSQAGRTVLVQANLATKANYQMQSFFL  771

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P  +L+ L++  R+F W     N+  NLI W ++   K  G LGI++    N AL  KL 
Sbjct  772   PLPILTALDKSYRNFFWNKDPLNKTANLIGWDRICLPKAFGGLGIRKAKVNNVALQIKLI  831

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W+L+     L V++++ K
Sbjct  832   WQLLKSNSSLWVRLVKKK  849



>ref|XP_004305437.1| PREDICTED: uncharacterized protein LOC101296313 [Fragaria vesca 
subsp. vesca]
Length=449

 Score =   290 bits (743),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 153/405 (38%), Positives = 227/405 (56%), Gaps = 46/405 (11%)
 Frame = +3

Query  1134  FSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIG  1313
             F T  +P G N T+I L+P +  P  +  FR I LC   YK+++K +  R+K  M+ LI 
Sbjct  91    FCTSSIPAGLNHTIIALIPKVDGPQHMINFRPISLCTTVYKIISKIIVARIKHLMQDLIS  150

Query  1314  PFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDRLSWSFIRSTLQK  1493
             P   S+V GR I++N+ + QE+    +  SGK G    KIDL KAYDR      R  L K
Sbjct  151   PNLVSYVPGRNISDNIQIAQEMFFKFKKSSGKTGFFAWKIDLSKAYDRP-----REALGK  205

Query  1494  AGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLI  1673
                                                        LS  +FVL VE+LSHLI
Sbjct  206   VA-----------------------------------------LSSYIFVLCVEKLSHLI  224

Query  1674  EQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLS  1853
             + ++  G WK +K ++ GP I HLFF DDL+ F EAS  Q S++K CL+ FC+LS Q +S
Sbjct  225   QSAIDYGYWKAVKASQSGPKILHLFFADDLILFVEASSQQTSLLKTCLDNFCALSRQTVS  284

Query  1854  YMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQAR  2033
             + KS +F S NTS      IS+  G P+  DLG+YLG+P I+ R+ + +YA L  ++Q R
Sbjct  285   FEKSLVFCSPNTSKSTASLISNVCGSPLTCDLGKYLGMPLIYDRVNKCTYAGLFDKVQKR  344

Query  2034  LTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRK  2213
             L  WK++ LSF GR TL+QSV SAIP Y MQ++     +  +L++L+RDF+    +  ++
Sbjct  345   LFSWKSKVLSFVGRLTLVQSVTSAIPMYAMQTAKFHVNLCDKLDKLNRDFILSDVENKKR  404

Query  2214  CNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGL  2348
              +L++W  + + K  G LG+++   +NQA+ +K+GW++   ++GL
Sbjct  405   VHLVNWDTICQPKYLGGLGVKKTADINQAILSKIGWRIFQHDNGL  449



>ref|XP_009150816.1| PREDICTED: uncharacterized protein LOC103874152 [Brassica rapa]
Length=1205

 Score =   276 bits (706),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 152/463 (33%), Positives = 252/463 (54%), Gaps = 12/463 (3%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             K+   V D L K    FF TG +P+  N T ICL+P      +++  R I LC V YK +
Sbjct  296   KYWEIVGDQLTKEVLLFFETGDMPSDWNYTQICLIPKKTTASVMSDLRPISLCTVMYKTI  355

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDL  1439
             +K +  RL+  +  ++ P Q++FV  R I++N+++  E ++SLR+        M  K D+
Sbjct  356   SKILASRLQCFLPEIVSPTQSAFVSDRLISDNIILAHEAVHSLRTHEVISKSYMAAKTDM  415

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KA+DR+ W ++++ L   GF   W++ IMSCV+T   ++  + +   +   +RG+RQGD
Sbjct  416   SKAFDRVEWHYLQALLLSLGFDNIWVKWIMSCVTTVTYSVLLNGQSYGYISPQRGLRQGD  475

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             P+SP LFVL  E L+H++ Q+   G  KG++    GP + HLFF DD +F  +A L Q  
Sbjct  476   PISPFLFVLCTEGLTHMMNQASLRGDLKGIQFNLAGPEVHHLFFADDSLFLFKAELSQCQ  535

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             V +    ++   +GQ ++  KS + F KNT   ++  I S LGI      G YLG+P   
Sbjct  536   VFQDIFLKYGEATGQVINLSKSSLTFGKNTCPSLKAQIKSKLGIYSEGGAGSYLGLPECF  595

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
                K +  A +  +++ R++GW +R LS  G+  +++SV  A+P Y M    LP+   + 
Sbjct  596   SGSKVEMLAYIQDKMKGRMSGWYSRFLSQAGKEVILKSVAMAMPIYAMTCFKLPKTTCNN  655

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             L+     F W +S+   K + +SW K+  SK+ G +G + ++  NQAL AK  W+++  +
Sbjct  656   LKSAMAAFWWQASEDKSKIHWLSWDKLCISKEMGGMGFKDIELFNQALLAKQAWRILTNQ  715

Query  2340  DGLCVKIMEAK---------VQLPSLPSQACQ--MYGRVFLSR  2435
             D L  + ++++           L S PS A +  ++GR  L +
Sbjct  716   DSLLTRFLQSRYFSNGSFLSATLGSRPSYAWRSILHGRELLEK  758


 Score = 63.5 bits (153),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 71/299 (24%), Positives = 128/299 (43%), Gaps = 22/299 (7%)
 Frame = +1

Query  244   GLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVL--------HLPMV  399
             G+I+L  SG  +TW  G     +  +RLDRA  N +W  + P             H P++
Sbjct  6     GMIELPSSGNPFTW-SGKRGNLWIQSRLDRAFGNQKWFDQFPASNQAFLDKRGSDHRPVL  64

Query  400   NSYHTLGESRR--FRFNAAW*THPNYQE*VSSTWKSDVSLE----ANKSNLSKQ-LDDWN  558
                 +  +S R  F+F+  +   P   E ++  W S         A++    +Q L  W 
Sbjct  65    IKLISSQDSYRGSFKFDKRFFQKPLVFETINQAWNSSSPNSNINIASRIRFCRQALSRWK  124

Query  559   KHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSR  738
             K  + N   R  ++   +   Q S++             L + L +   +EE  W  + +
Sbjct  125   KKNVSNSKLRITKIQVELEQEQSSMN-----PSFPRMENLTKSLVKAYKEEENFWKQKCK  179

Query  739   EEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDS  918
             ++WI+ GD NT+ +HAA  V +S + + +L+D+ G +        +    ++ DLF   +
Sbjct  180   DDWILHGDGNTKIFHAAVQVARSKNEIVKLQDSNGIFQRSEASKGQVAINYFSDLFKSTN  239

Query  919   TTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQTSFYQNSW  1092
             +    DL       +  +  + +    T +++ EAVF +    AP +DG    F+Q  W
Sbjct  240   SVDYSDLLRDLPVRVSNNMNMILTRKITKEEVKEAVFSIKPDSAPGADGMSGFFFQKYW  298



>ref|XP_010469706.1| PREDICTED: uncharacterized protein LOC104749719 [Camelina sativa]
Length=1474

 Score =   277 bits (709),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 148/417 (35%), Positives = 230/417 (55%), Gaps = 1/417 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             +F   +K  LI    DFF TG      N+T ICL+P +  P  + +F+ I LCNV YK++
Sbjct  297   RFWPHLKGDLIALVRDFFRTGKFDPRLNETNICLIPKVDVPKRMAEFKPISLCNVGYKII  356

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRS-KSGKGGLMVIKIDL  1439
             +K +  +LK  + ++I   Q++FV GR IT+N+LV QE+ + L++ +      +  K D+
Sbjct  357   SKILCFQLKKILPLIISETQSAFVSGRLITDNILVAQEMFHGLQTNRMCNTEFLAFKTDM  416

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+++ L + GF   WI  IM CVS+    +  + +     + +RG+ QGD
Sbjct  417   SKAYDRVEWDFLKAALIRLGFDSRWISWIMWCVSSVSYQVLLNGQPRGSILPKRGLWQGD  476

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  E L   I+++ + G+  G+KI R  P ISHL FVDD +FF +A   Q S
Sbjct  477   PLSPYLFILCTEVLIANIKKAEREGKISGIKIARDSPPISHLLFVDDSLFFSKADEEQCS  536

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              V   +  +   S Q ++  KS I F K    E++  + S +GI     +G YLG+P   
Sbjct  537   TVMDVIGNYSKASDQEVNLDKSSIMFGKKVPAEVKDKVKSVIGISNEGGMGSYLGIPESL  596

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             G  +   +  +   +  R+ GW  + LS  G+  L++SV   +P + M    LPQG+ S+
Sbjct  597   GGSRVQVFGYVRDWLNDRVNGWTAKFLSKGGKEVLLKSVALTLPTHVMSCFKLPQGLTSK  656

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLM  2330
             L     +F W S   +R  + ++W K+ + K +GRLG   L+  N AL AK  W+L+
Sbjct  657   LTSAISNFWWSSDGKDRGLHWVAWDKMCKDKSEGRLGFWDLEIFNDALLAKQYWRLI  713


 Score = 62.4 bits (150),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 75/313 (24%), Positives = 126/313 (40%), Gaps = 40/313 (13%)
 Frame = +1

Query  232   IFRE-GLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSY  408
             + RE G+++    G + +W     +      RLDRAL N +W    P   V +L M+ S 
Sbjct  1     MIRECGMLEFPCYGESLSWRGNRCNNQVVRCRLDRALGNEDWHTLFPCSRVDYLEMIGSD  60

Query  409   H--TLGES--------RRFRFNAAW*THPNYQE*VSSTWKSD----VSLEANKSNLSKQL  546
             H   L           R+FRF+  W     +   V S W       V +  +K    +  
Sbjct  61    HRPILASCAKADGRHFRQFRFDKRWMGKEGFSGAVESGWNRTKNFRVPMFVDKIKNCRNS  120

Query  547   DDWNKHTIGNIFRRK*RVL---ARISGVQRSLSVYQk--ldlikldrklrreldeilYQE  711
               W         RRK  V      IS ++ +L   +            + ++L +  + E
Sbjct  121   ISW---------RRKQNVPNSNTLISSLKMALEEAKNDDSISHAEIHIIEKKLKDAYHDE  171

Query  712   ELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAF  891
             EL W  +SR+ W+  GD+NT F+HA+T  R++ + +  L D+   W    +G+      +
Sbjct  172   ELYWQQKSRKFWLRVGDKNTSFFHASTKQRRTRNKIVGLFDSEDVWDESNEGMERIASDY  231

Query  892   YMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL------EAVFEMAQFKAPS  1053
             +  LF++     + ++  A  P +       +N   T KD+      +A+F M     P 
Sbjct  232   FNKLFAQPDVCGISEMVQAVNPFVTER----MNRELT-KDISEMEVRKALFAMHPEITPG  286

Query  1054  SDGFQTSFYQNSW  1092
              DG    F+   W
Sbjct  287   PDGMTALFFHRFW  299



>ref|XP_010513002.1| PREDICTED: uncharacterized protein LOC104788940 [Camelina sativa]
Length=1347

 Score =   307 bits (787),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 158/438 (36%), Positives = 253/438 (58%), Gaps = 2/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             F       +   V  ++I    +FF+TG +    N T +CL+P   +P  +  FR I LC
Sbjct  425   FNAAFYQHYWDVVGPAIISEVKNFFTTGEMQQEWNHTNLCLIPK-NDPKTMKDFRPIALC  483

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGL  1418
             NV+YK+++K +T RLK  +  ++   Q +F+ GR IT+NVL+  EVL+SL+ +       
Sbjct  484   NVTYKIISKILTKRLKQVLSEVVSETQAAFIPGRFITDNVLIAHEVLHSLKVRQRCANSY  543

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
             M +K D+ KAYDR+ W F+ + L K GF P WI+ IM CV T   ++  +     +F   
Sbjct  544   MAVKTDISKAYDRVEWRFLEAVLIKKGFHPTWIKWIMGCVETVSFSVLINGSTYGYFRPS  603

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RGIRQGDPLSP LF+L  + LS L+ Q+ + G+ +G++I+  GP +SHL F DD +FF +
Sbjct  604   RGIRQGDPLSPSLFILCADVLSSLLSQATREGRIQGIQISNGGPRVSHLLFADDSLFFLK  663

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A+   +  + +   ++   SGQ +++ KS I F      + +  I   L IP V   G+Y
Sbjct  664   ANYRNSVNLLQIFKDYGDASGQIINFEKSSITFGSRVYQQTRDRIKHILSIPNVGGGGKY  723

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG+P   GR K++    + + ++ +  GW+ R L+  G+ TLI+SV  A+P Y+M    L
Sbjct  724   LGLPKQFGRRKKEMLQYIHTHVKQKTDGWQTRFLNTAGKETLIKSVAFAMPVYSMNCFEL  783

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P+ + S L+ L   F WGS++  +K + ++WKK+  SK++G LG +     NQAL A   
Sbjct  784   PKKLCSELDSLIARFWWGSTQEKKKISWVAWKKLVTSKNEGGLGFRDFHLFNQALLANQA  843

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             WK++ + D L  ++++A+
Sbjct  844   WKILQRPDNLIYRLLKAR  861



>ref|XP_009140393.1| PREDICTED: uncharacterized protein LOC103864388 [Brassica rapa]
Length=1377

 Score =   270 bits (691),  Expect(3) = 6e-83, Method: Compositional matrix adjust.
 Identities = 148/435 (34%), Positives = 228/435 (52%), Gaps = 1/435 (0%)
 Frame = +3

Query  1071  QLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVS  1250
             Q   KF   V   +      FF  G LP   N T +CL+P + NP  +   R I LC+V 
Sbjct  462   QFFQKFWNIVGPQVTHEVRRFFDDGLLPVDWNYTELCLLPKVQNPNQMKDLRPISLCSVV  521

Query  1251  YKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVI  1427
             YK+++K +  RLK  +  ++ P Q +FV GR I++N+L+  E+++ LR+    K   + I
Sbjct  522   YKIVSKVLCDRLKVVLPHIVSPAQGAFVAGRLISDNLLIAHEMVHGLRTNPACKSDFIAI  581

Query  1428  KIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGI  1607
             K D+ KAYDR+ W F+ +   K GF   W+  IM CV +   ++  + +    F  ERGI
Sbjct  582   KTDMSKAYDRVEWDFLEALFLKLGFHQRWVSWIMLCVRSVSYSVILNGQSYGHFTPERGI  641

Query  1608  RQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASL  1787
             RQGDPLSP LF+L  E L H + ++ + G   GMK+    P + HL F DD  F   ASL
Sbjct  642   RQGDPLSPFLFILCAEALVHTMSKAEQEGVLTGMKLAPSCPAVQHLLFADDSFFLCRASL  701

Query  1788  HQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGV  1967
              + +   + L  +   SGQ +++ KS I F       +++ ++  L I      G+YLG+
Sbjct  702   AECTEFLRRLKLYGDSSGQMINFQKSAITFGAGIDPIMRRVLAELLNIEKEGGDGKYLGL  761

Query  1968  PSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQG  2147
             P      KQ   A +  ++  RL GW  + LSF G+  L++S+  A+P Y M    L + 
Sbjct  762   PECFSGSKQQLLAFIGEKMSKRLKGWFAKKLSFGGKEVLLKSIAMALPVYAMSCFRLTKH  821

Query  2148  VLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKL  2327
             +  ++      F W  +   +K + ISWKK+  SK+ G LG + ++  NQAL AK  W+L
Sbjct  822   LCQKIMSAMASFWWDENDEKKKIHWISWKKLCISKENGGLGFRDIEDFNQALLAKQAWRL  881

Query  2328  MNKEDGLCVKIMEAK  2372
             +N    L  +I + +
Sbjct  882   LNDPTSLIARIYKGR  896


 Score = 62.8 bits (151),  Expect(3) = 6e-83, Method: Compositional matrix adjust.
 Identities = 67/297 (23%), Positives = 117/297 (39%), Gaps = 25/297 (8%)
 Frame = +1

Query  256   LGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHL--------PMVNSYH  411
             L + G       G+    +   RLDRA  N EW    P    ++L        P+  S  
Sbjct  179   LSWGGVREIMENGVKEKVWVQCRLDRAFGNAEWFRIFPQSHTVYLEKTGSDHRPIFTSLA  238

Query  412   TLGESR--RFRFNAAW*THPNYQE*VSSTWKSDV-----SLEANKSNLSKQLDDWNKHTI  570
              +G+ R  RF F+  W   P   E +   W S+      S+     +  ++L  W +H  
Sbjct  239   NIGQRRTGRFMFDKRWCQKPEITEVIRRGWCSNFISGQGSVSERIKSCRQELCKWKRHAN  298

Query  571   GNIFRRK*RVLARISGVQRSLSVYQkld--likldrklrreldeilYQEELLWF*RSREE  744
              N           I  ++R L V +      + +   LR +L++   +EE  W  + +  
Sbjct  299   VN-------SSVTIRRLRRELEVEESKRWPNLLILPSLRLDLEKAYDEEEAFWKQKCKNS  351

Query  745   WIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTT  924
             W+  GD+NT+ +H     R+  + +  L DN G      D + +    ++ +LF    + 
Sbjct  352   WLQVGDKNTKVFHGWVESRRMKNKIHSLIDNAGIEQFSEDEMGKVAVEYFQELFHSTGSA  411

Query  925   QLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQTSFYQNSW  1092
              + +L D   P +  S  + +    +  ++  AV E+     P  DG    F+Q  W
Sbjct  412   DVSELLDGMAPRVTESMNIGLIKPISDAEIRRAVKEIKSDSTPGVDGMTGQFFQKFW  468


 Score = 26.9 bits (58),  Expect(3) = 6e-83, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 18/36 (50%), Gaps = 0/36 (0%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             S  W+ IL    +L KG  K + N  ST  W  +WI
Sbjct  913   SYAWRSILFGRELLNKGLMKSIGNGNSTFVWSHNWI  948


 Score = 59.7 bits (143),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 82/193 (42%), Gaps = 7/193 (4%)
 Frame = +2

Query  2825  RIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCPIANSVWESLIP  3004
             +IR FLW A         +   RG   ++ C IC+   E I+H++ +C +A+  W S   
Sbjct  1060  KIRNFLWRAASGALAVAERLNTRGLNLDLRCKICKAATESIEHVLFKCSLAHEAWSSAGF  1119

Query  3005  YDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWRNDLVFSGTNINLAA  3184
                  + +    +     +  ++      EQR+     +W +WK RN L+++ T +++  
Sbjct  1120  QSLPHVGNLSVIDCLSAYLHMMNDVLIPLEQRLAIPWILWTIWKNRNMLLYAETQVSITI  1179

Query  3185  RIKWIRDQV---EEINISFSKAKGLIAPIESICWRQLKWIRPQVGWVKANIDGSSIPSNS  3355
             +IK   ++     E+N    K    +  I  +     +W  P  G+VK N   +   +  
Sbjct  1180  QIKQALEEACTWHELN----KKAVSLENITGLNEETKRWDPPLAGYVKCNFHANWRNAAL  1235

Query  3356  IARCGGFIRDDQG  3394
              +     +RD +G
Sbjct  1236  HSGVAFIVRDQRG  1248



>dbj|BAE79382.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score =   307 bits (787),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 155/436 (36%), Positives = 253/436 (58%), Gaps = 0/436 (0%)
 Frame = +3

Query  1065  PNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCN  1244
             P     +F G V  ++    +  F  G          + L+P    P     FR I L N
Sbjct  457   PAVFYQQFWGEVGPAMTDMVNHAFENGSTYISQLQAFMTLIPKKDTPETAADFRPITLLN  516

Query  1245  VSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMV  1424
              S+K+++K +  RL+  M  +IGP Q SF+ GR   +NV++ QEV++S+ +   K   M+
Sbjct  517   ASFKVISKVLVNRLRPIMSNIIGPHQNSFLPGRSTMDNVILTQEVVHSMNNPRRKKKQMI  576

Query  1425  IKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERG  1604
             +K+DL+KAYD +SW ++  TL+  GF    I  I+  +  S LAI ++      F   RG
Sbjct  577   LKVDLQKAYDSVSWDYLEETLEDFGFPRRLIDLILFSLQESSLAILWNGGRLPPFKPGRG  636

Query  1605  IRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEAS  1784
             +RQGDPL+P LF L +ERL+H I+  V    WK + ITR G  ISHLFF DDL+ FGEAS
Sbjct  637   LRQGDPLAPYLFNLVMERLAHDIQTRVNARTWKPVHITRGGTGISHLFFADDLMLFGEAS  696

Query  1785  LHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLG  1964
              HQA ++  CL+ F + SG ++++ KS +F S N +  +++AI S L +P+   LG YLG
Sbjct  697   EHQAQIMFDCLDSFSNASGLKVNFSKSLLFCSSNVNAGLKRAIGSILQVPVAESLGTYLG  756

Query  1965  VPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQ  2144
             +P +  R+ ++++  ++ +++ +L+ WK  +L+  GR  L+Q+ L+ +P YTMQ   LP 
Sbjct  757   IPMLKERVSRNTFNAVIDKMRTKLSSWKASSLNMAGRRVLVQASLATVPTYTMQVMALPV  816

Query  2145  GVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWK  2324
                + +++  R+FLWG     RK + ++W ++ + +++G LG++     N+A   K+ W+
Sbjct  817   STCNEIDKTCRNFLWGHDTNTRKLHSVNWAEICKPRNEGGLGLRMARDFNRAFLTKMAWQ  876

Query  2325  LMNKEDGLCVKIMEAK  2372
             + +  D L VK++  K
Sbjct  877   IFSNIDKLWVKVLREK  892


 Score =   127 bits (320),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 103/301 (34%), Positives = 157/301 (52%), Gaps = 20/301 (7%)
 Frame = +1

Query  244   GLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHT---  414
             GL+D G SGP +TW + + +   +  RLDR L N+  ++  P+ +V  LP + S H    
Sbjct  169   GLLDPGSSGPNFTWCRFIGNRVVQRRRLDRVLWNVSAQLTFPEAKVSVLPRLCSDHNPIL  228

Query  415   -LGES--------RRFRFNAAW*THPNYQE*-VSSTWKSDVSLEANKSNLSKQLDDWNKH  564
              L E+        R  RF AAW T  +Y+     +T +   +LE   + ++++   WN++
Sbjct  229   FLDEAGNPPVRSLRPVRFEAAWLTSEDYKHIWKEATEREGSNLEDIIATVTQKSLLWNRN  288

Query  565   TIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREE  744
               GNIF RK ++  RI G+QR+ +    + L  L+++L  EL+E+L QEE LWF ++R +
Sbjct  289   VFGNIFNRKRKIENRILGIQRAWNYNTSVRLQDLEKRLLSELNEVLVQEETLWFQKARTD  348

Query  745   WIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFS---ED  915
             WI +GDRNT FYH +  ++++ + VR LK   G W  D D + E    F+  LF     D
Sbjct  349   WIRNGDRNTTFYHRSALIKRNRNRVRFLKLQ-GAWTDDADLLTEHIINFFSTLFCRVDRD  407

Query  916   STTQLEDLNDAFFPPLHTSQWLAINAHF-TVKDLEAVFEMAQFKAPSSDGFQTSFYQNSW  1092
             S    + L   F  P   +  L   A    VK  +AVF M ++ +P  DG    FYQ  W
Sbjct  408   SQPPRQGLPMDFQIPRDQASTLLRRASLEEVK--KAVFGMKKYGSPGPDGIPAVFYQQFW  465

Query  1093  A  1095
              
Sbjct  466   G  466


 Score = 86.3 bits (212),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/222 (28%), Positives = 100/222 (45%), Gaps = 19/222 (9%)
 Frame = +2

Query  2825  RIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCPIANSVWESLIP  3004
             +I+ F+W    +  M N +R RRG      C +C    E +DH+ +RC +A + W+S +P
Sbjct  1048  KIKLFMWKIVKNGLMVNVERKRRGLADAASCPVCGEEDETLDHLFRRCLLAEACWDSAVP  1107

Query  3005  YDHRRL*DQDYT-NWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWRNDLVFSGTNINLA  3181
                 +  +  +  +W     S            + F   +W LWK RN LVF   NI   
Sbjct  1108  PLTFQTSNHLHMHSWMKAACSSQQKDGYSTNWSLIFPYILWNLWKARNRLVFDN-NITAP  1166

Query  3182  ARIKWIRDQVEEINISF---SKAKGLIAP---IESICWRQLKWIRPQVGWVKANIDGSSI  3343
             + I         +N SF   S+A+ L+A    +++     + W  P  G+ K N DG+  
Sbjct  1167  SDI---------LNRSFMESSEARCLLAKRTGLQTAFQTWVVWSPPAAGFTKLNSDGACK  1217

Query  3344  PSNSIARCGGFIRDDQGC*LKGFMHNIGLNQRVSS*PRLWGL  3469
               + +A  GG +R++ G  + G+  NIG      +   LWGL
Sbjct  1218  SHSHLASAGGLLRNENGLWVAGYTCNIGTANSFLA--ELWGL  1257



>gb|ABA98898.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1188

 Score =   306 bits (783),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 158/434 (36%), Positives = 248/434 (57%), Gaps = 1/434 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP +   +  G +K+ ++K   +FF+TG +P G N+T I L+P +  P  +  +R I LC
Sbjct  315   FPARFFQRNWGLLKEEVVKAVKEFFNTGVMPAGVNETAIVLIPKVDQPIELRDYRPISLC  374

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGL  1418
             NV YK+++K +  RL+  +  LI P Q++FV GR IT+N L+  E  +S+ ++K      
Sbjct  375   NVLYKVVSKCLVNRLRPILDELISPNQSAFVPGRMITDNALIAFECFHSIQKNKKLSSAT  434

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
                K+DL KAYDR+ W F+  ++ K GF+  W+  IMSC+++ R ++ F+  L   F   
Sbjct  435   CAYKLDLSKAYDRVDWKFLEQSMYKLGFAHCWVNWIMSCITSVRYSVKFNGTLLSTFAPS  494

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP LF+  V+ LS L+E+ V  G    + I R+ P IS+L F DD + F +
Sbjct  495   RGLRQGDPLSPFLFLFVVDGLSLLLEERVAQGALSPVHICRRAPGISNLLFTDDTLLFFK  554

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A+  QA+VV   L ++   +GQ ++  K  I F + +  ++Q+++ S L +   +   +Y
Sbjct  555   ATSEQANVVMNVLADYAWCTGQLINQEKCSIMFGEASPPDVQESVRSVLQVGSTSFDDKY  614

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG P+  GR+ +  +  L  ++  R+  W    LS  G+  LI++VL AI  Y M    L
Sbjct  615   LGFPTPEGRMNKGKFQSLQEKLCKRIMQWGENFLSSGGKEILIKAVLQAITVYVMGIFKL  674

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P  +   L +L+R+F WGS KG RK +  SW  +T+ K  G LG +     NQAL A+  
Sbjct  675   PDSICDELTKLTRNFWWGSEKGKRKAHWKSWDCITKPKHCGGLGFRDFRLFNQALLARQA  734

Query  2319  WKLMNKEDGLCVKI  2360
             W+L+     L +KI
Sbjct  735   WRLIENPHSLSIKI  748


 Score = 77.0 bits (188),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 93/220 (42%), Gaps = 25/220 (11%)
 Frame = +2

Query  2783  RRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQ  2962
             ++VWN++    +P +++ F W A  +C  T   + +R       C  C   PED+ H + 
Sbjct  852   KKVWNHVWKCNIPQKVKVFSWRAISNCLPTMVNKKKRNPELSDVCSFCGLEPEDVAHALW  911

Query  2963  RCPIANSVWE---SLIPYDHRRL*DQDYTNW---FDEGISELSSGNRKHEQRVTFAVTMW  3124
             RCP A   W+   S +          + ++W   F E ISE        + R  F +++W
Sbjct  912   RCPHARRYWDLMSSEMQVQRILYGSGEGSDWILDFLESISE--------DDRPVFLMSLW  963

Query  3125  WLWKWRNDLVFSGTNINLAARIKWIRDQVEEI-------NISFSKAKGLIAPIESICWRQ  3283
              +W  RN++        +    +++R  V  +       N +    K +I      C +Q
Sbjct  964   RIWYTRNEITHDKAAPPVEVSKRFVRSYVNSLKEIKARPNANLGSGKHVIGEDRPKCKKQ  1023

Query  3284  ---LKWIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQG  3394
                 KW +P  GW+K N+DGS    N I      +R+  G
Sbjct  1024  SVLAKWEKPPSGWMKLNVDGSYQEDN-IGEISAILRNSTG  1062


 Score = 77.0 bits (188),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 81/315 (26%), Positives = 128/315 (41%), Gaps = 57/315 (18%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             F+D +    L  LG+SG  YT+       N    RLDRAL + +W+    +  V HL   
Sbjct  45    FRDVLQTCDLHALGFSGVPYTYDNRREGRNNIRVRLDRALADNDWREMFGNARVSHLTST  104

Query  400   NSYHTLG------------ESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSK-  540
              S H                ++   +   W   P+ QE ++  W   VS    KS+L + 
Sbjct  105   RSDHCPISVCFSPEDCRPFHTKCLHYEICWEREPSLQEVITDAWSEGVS----KSDLGEI  160

Query  541   ---------QLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreld  693
                      +L  W+K  + N+ +   +   R++      S+        L R+    L+
Sbjct  161   STALHRVMTRLHSWSKVKVKNVGKELEKARKRLT------SLLVSDAESSLVRQALDHLN  214

Query  694   eilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGIL  873
             E+LY+EE+LW  RSR  W+  GDRNTRF+H+    R   + +  L+D  G  +     ++
Sbjct  215   ELLYREEMLWLQRSRINWLKEGDRNTRFFHSKGVWRAKKNKISALRDASGT-VHHLTNVM  273

Query  874   EPFHA-FYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLEAVFEMAQFKAP  1050
             E     ++  LFS D             P L  S+   +             ++   KAP
Sbjct  274   EQMATDYFKTLFSAD-------------PNLDHSRVTTLIQE----------KIGPLKAP  310

Query  1051  SSDGFQTSFYQNSWA  1095
               DGF   F+Q +W 
Sbjct  311   GPDGFPARFFQRNWG  325



>ref|XP_010430664.1| PREDICTED: uncharacterized protein LOC104714891 [Camelina sativa]
Length=1271

 Score =   281 bits (720),  Expect(2) = 9e-83, Method: Compositional matrix adjust.
 Identities = 156/448 (35%), Positives = 245/448 (55%), Gaps = 1/448 (0%)
 Frame = +3

Query  1074  LLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSY  1253
                K    VKD ++   + FF  G      N T ICL+P +     + + R I LCNV Y
Sbjct  422   FFEKAWTVVKDDMVALVNQFFEEGEFDKSLNQTHICLIPNVAKTTRMTELRPISLCNVGY  481

Query  1254  KMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIK  1430
             K+L+K +  RLKS +  LI   Q++FV GR I++N+L+ QE+ + LR+  S KG  M IK
Sbjct  482   KILSKVLCNRLKSILPGLISETQSAFVPGRLISDNILIAQEMFHGLRTNNSCKGKFMAIK  541

Query  1431  IDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIR  1610
              D+ KAYDR+ W F+ + L+K GF+  WI  IM CVS+    +  + + +   +  RG+R
Sbjct  542   TDMSKAYDRVEWDFVAALLRKMGFAEIWISWIMFCVSSVEYKVLINRQPNGQIVPARGLR  601

Query  1611  QGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLH  1790
             QGDPLSP LF+L +E L   I ++  + +   +K+  K P I+HL F DD +FF +A   
Sbjct  602   QGDPLSPYLFILCMEVLIANIRKAEADKRITSIKVANKRPQITHLLFADDSLFFFKADKE  661

Query  1791  QASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVP  1970
             Q  VV   L ++ ++SGQ++++ KS + F       ++  +   LGI  +  +G YLG+ 
Sbjct  662   QCGVVLDILKQYEAVSGQQINFAKSLVQFGHTVDDRVRSELHGVLGISNLGGMGSYLGIH  721

Query  1971  SIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGV  2150
                G  K  +++ +  R+Q R TGW  + LS  G+  +I+SV +A+P + M    LP+ +
Sbjct  722   ESLGGSKTKNFSYVRDRLQNRTTGWTAKLLSKGGKEVMIKSVATAVPTFVMSCYRLPKTI  781

Query  2151  LSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLM  2330
              S+L      F W S+  +   + I+W+K+  SK  G L  + +D  N ALFAK  W+L+
Sbjct  782   TSKLTSAVAKFWWSSNGQSGGMHWIAWEKLCCSKQMGGLEFRNVDDFNTALFAKQLWRLI  841

Query  2331  NKEDGLCVKIMEAKVQLPSLPSQACQMY  2414
                D L  ++ ++     S P    + Y
Sbjct  842   EFPDSLFARVFKSIYYRNSDPLDPIRSY  869


 Score = 56.6 bits (135),  Expect(2) = 9e-83, Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 123/303 (41%), Gaps = 50/303 (17%)
 Frame = +1

Query  229   WIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSY  408
             W+ + GL+D+  SG    W       +F G      + N   +I   D    +LPM+ S 
Sbjct  160   WVGKPGLMDVISSG----WSDK-PDQDFSGK-----IINCRREISRWDTVTEYLPMIASD  209

Query  409   H-----TLGESR-----RFRFNAAW*THPNYQE*VSSTW--KSDVSLEANKSNLSKQLDD  552
             H     ++G  R      F F+  W   P   + +SS W  + D        N  +++  
Sbjct  210   HKPLVVSIGAKRPRGRRSFMFDRRWVGKPGLMDAISSGWSDEPDQDFARKIINCRQEISR  269

Query  553   WNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldr--klrreldeilYQEELLWF  726
             W K      F R+      I  ++R L + Q  D    +    L   L E    EE+ W+
Sbjct  270   WCKSQAP--FGRE-----LIEDIKRQLEMAQANDSSTPEMFSDLNGRLREAYRDEEIHWY  322

Query  727   *RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLF  906
              +SR  W+  GD+NT+++ A T  R+                 DG  I +   +++ +LF
Sbjct  323   LKSRNRWMRVGDKNTKYFQAQTKQRR-----------------DG-AICDTAVSYFEELF  364

Query  907   SEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSFYQ  1083
             S    T  E+     +  +  +    + A  T  +++ A+F M   KAP  DG  T F++
Sbjct  365   SSICPTNFEESLREIYTVITEADNTRLTASATEAEVKHALFMMHPDKAPRPDGMTTLFFE  424

Query  1084  NSW  1092
              +W
Sbjct  425   KAW  427



>gb|AAF69169.1|AC007915_21 F27F5.21 [Arabidopsis thaliana]
Length=1023

 Score =   280 bits (716),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 153/442 (35%), Positives = 241/442 (55%), Gaps = 1/442 (0%)
 Frame = +3

Query  1092  GTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKA  1271
              T+K  ++   + F   G      N T ICL+P    P  + + R I LCNV YK+++K 
Sbjct  311   ATIKMDMLFLVNSFLQDGVFDKQLNTTNICLIPKTERPTRMTELRPISLCNVGYKIISKI  370

Query  1272  MTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDLEKA  1448
             +  RLK  +  LI    ++FV GR I++N+L+ QE+ + LR+  S KG  M IK D+ KA
Sbjct  371   LCQRLKKILPSLISETHSAFVEGRLISDNILIAQEMFHGLRTNPSCKGKFMAIKTDMSKA  430

Query  1449  YDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLS  1628
             YDR+ W+FI   L+K GF   WI  IM C++T +  +  + +     + +RG+RQGDPLS
Sbjct  431   YDRVEWNFIEELLKKMGFCEKWISWIMWCITTVQYRVLLNGQPRGLIVPKRGLRQGDPLS  490

Query  1629  PLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVK  1808
             P LF+L  E L   I ++ +     G+K+    P +SHL F +D +FF +A+  Q  V+ 
Sbjct  491   PYLFILCTEVLIANIRKAEQEKLITGIKVATASPSVSHLLFANDSLFFCKANKEQCGVIL  550

Query  1809  KCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRL  1988
               L ++ ++SGQ +++ KS I F      +I+  I S+LGI  +  +G YLG+P   G  
Sbjct  551   GILKQYEAVSGQMINFSKSSIQFGHKVGDDIKAEIKSALGIHSIGGMGSYLGLPESLGGS  610

Query  1989  KQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLER  2168
             K   ++ +  R+Q R+ GW  + LS  G+  +I+SV++ +P Y M    LP+ + S+L  
Sbjct  611   KTRIFSFVRDRLQTRINGWSAKFLSKGGKEVMIKSVVAVLPTYVMSCFRLPKTITSKLTS  670

Query  2169  LSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGL  2348
                 F W S   +R  + ++W K+  SK  G LG + ++  N AL AK  W+L+   D L
Sbjct  671   AVAKFWWSSDGESRGMHWMAWNKLCSSKADGGLGFRSVNDFNSALLAKQLWRLITVPDSL  730

Query  2349  CVKIMEAKVQLPSLPSQACQMY  2414
               K+ + +    S P    + Y
Sbjct  731   FAKVFKGRYFRKSNPLDKLKSY  752


 Score = 57.8 bits (138),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 66/135 (49%), Gaps = 11/135 (8%)
 Frame = +1

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             EE  W+ +SR  W+  GD N++++HA T  R++ + +  L D  G+W ++   +     +
Sbjct  182   EEQYWYQKSRSLWMKVGDNNSKYFHALTKQRRARNRIIGLHDENGKWFAEDKDVQHIAVS  241

Query  889   FYMDLFSEDSTTQL-EDLNDAFFPPLHTSQWLAINAHFTVKDLE-----AVFEMAQFKAP  1050
             ++  LF++ +   + E L++     L T Q   IN   T    E     A+F M   KAP
Sbjct  242   YFETLFNKSNPQNIAESLSEV--KTLITDQ---INDFLTTPATEDEVRAALFLMHPEKAP  296

Query  1051  SSDGFQTSFYQNSWA  1095
               DG    F+Q  WA
Sbjct  297   GPDGMTALFFQKPWA  311



>ref|XP_002454941.1| hypothetical protein SORBIDRAFT_03g001780 [Sorghum bicolor]
 gb|EES00061.1| hypothetical protein SORBIDRAFT_03g001780 [Sorghum bicolor]
Length=631

 Score =   294 bits (753),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 153/438 (35%), Positives = 252/438 (58%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
              P+    KF   V D + K      + G +P G NDT+I L+P    P ++   R I LC
Sbjct  32    IPSIFYKKFWSVVGDQVKKEVLAVLNGGPIPEGWNDTIIVLIPKTNTPQMLKDLRPISLC  91

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRS-KSGKGGL  1418
             NV YK+++K +  RLK  +  +I   Q++FV GR IT+NVL+  E+++ L+S K G GGL
Sbjct  92    NVLYKLISKVLANRLKKILPNIISNSQSAFVPGRLITDNVLLAYEIVHHLKSIKKGAGGL  151

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
               IK+D+ KAYDR+ WSF+ + ++K GF   W++ IM CV+T    I  +   ++    +
Sbjct  152   AAIKLDMSKAYDRVEWSFLENMMRKMGFDEKWVQLIMKCVTTVTYKIKVNDSYTQKIFPQ  211

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP LF++  E LS +++++ + G+ +G+KI R  P ++HLFF DD +    
Sbjct  212   RGLRQGDPLSPYLFIICAEGLSAMLQKAEQKGKIEGIKICRGAPKVNHLFFADDSLILMR  271

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A    A  +++ L+ +   SGQ ++  KS + FS NT    +  + S+L I       +Y
Sbjct  272   ARASDALELRRILDVYEKASGQVINKEKSSMMFSPNTGQHDRSLMRSNLSITDEASTEKY  331

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG+P   G+ ++  +  +  +I +R+ GW+ + LS  G+  LI++V  +IP Y M    L
Sbjct  332   LGLPVNIGKSRKKPFEYIKKKIWSRIQGWQEKLLSKAGKEILIKAVAQSIPTYAMSCFDL  391

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
              +G+   L  +   + W       K + ISW+K+T+SK++G LG + L   N A+ ++  
Sbjct  392   TKGLCDELSSIIGRYWWSQQDKANKIHWISWEKLTQSKEKGGLGFRDLHLFNLAMLSRQA  451

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W+L+   D LC ++++A+
Sbjct  452   WRLLTNPDSLCGQVLKAR  469



>ref|XP_009126341.1| PREDICTED: uncharacterized protein LOC103851249 [Brassica rapa]
Length=1160

 Score =   278 bits (711),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 154/463 (33%), Positives = 253/463 (55%), Gaps = 12/463 (3%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             K+   V D L K    FF TG +P+  N T ICL+P      +++  R I LC V YK +
Sbjct  296   KYWEIVGDQLTKEVLLFFETGDMPSDWNYTQICLIPKKTTASVMSDLRPISLCTVMYKTI  355

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDL  1439
             +K +  RL+  +  ++ P Q++FV  R I++N+++  E ++SLR+        M  K D+
Sbjct  356   SKILASRLQCFLPEIVSPTQSAFVSDRLISDNIILAHEAVHSLRTHEVISKSYMAAKTDM  415

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KA+DR+ W +I++ L   GF   W++ IMSCV+T   ++  + +   +   +RG+RQGD
Sbjct  416   SKAFDRVEWHYIQALLLSLGFDNIWVKWIMSCVTTVTYSVLLNGQSYGYISPQRGLRQGD  475

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             P+SP LFVL  E L+H++ Q+   G  KG++    GP + HLFF DD +F  +A L Q  
Sbjct  476   PISPFLFVLCTEGLTHMMNQASLRGDLKGIQFNLAGPEVHHLFFADDSLFLFKAELSQCQ  535

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             V +  L ++   +GQ ++  KS + F KNT   ++  I S LGI      G YLG+P   
Sbjct  536   VFQDILLKYGEATGQVINLSKSSLTFGKNTCPSLKAQIKSKLGICSEGGAGSYLGLPECF  595

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
                K +  A +  +++ R++GW +R LS  G+  +++SV  A+P Y M    LP+   + 
Sbjct  596   SGSKVEMLAYIQDKMKGRMSGWYSRFLSQAGKEVILKSVAMAMPIYAMTCFKLPKTTCNN  655

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             L+     F W +S+   K + +SW K+  SK+ G +G + ++  NQAL AK  W+++  +
Sbjct  656   LKSAMAAFWWQASEDKSKIHWLSWDKLCISKEMGGMGFKDIELFNQALLAKQAWRILTNQ  715

Query  2340  DGLCVKIMEAK---------VQLPSLPSQACQ--MYGRVFLSR  2435
             D L  + ++++           L S PS A +  ++GR  L +
Sbjct  716   DSLLTRFLQSRYFSNGSFLSATLGSRPSYAWRSILHGRELLEK  758


 Score = 58.9 bits (141),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 127/299 (42%), Gaps = 22/299 (7%)
 Frame = +1

Query  244   GLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVL--------HLPMV  399
             G+I+L  SG  +TW  G     +  +RLDRA  N +W  + P             H P++
Sbjct  6     GMIELPSSGNPFTW-SGKRGNLWIQSRLDRAFGNQKWFDQFPASNQAFLDKRGSDHRPVL  64

Query  400   NSYHTLGESRR--FRFNAAW*THPNYQE*VSSTWKSDVSLE----ANKSNLSKQ-LDDWN  558
                 +  +S R  F+F+  +   P   E ++  W S         A++    +Q L  W 
Sbjct  65    IKLISSQDSYRGSFKFDKRFFQKPLVFETINQAWNSSSPNSNINIASRIRFCRQALSRWK  124

Query  559   KHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSR  738
             K  + N   R  ++   +   Q S++             L + L +   +EE  W  + +
Sbjct  125   KKNVSNSKLRITKIQVELEQEQSSMN-----PSFPRMENLTKSLVKAYKEEENFWKQKCK  179

Query  739   EEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDS  918
             ++WI+ G  NT+ +HAA  V +S + + +L+D+ G +        +    ++ DLF   +
Sbjct  180   DDWILYGGGNTKNFHAAVQVARSRNEIVKLQDSNGIFQRSEASKGQVAINYFSDLFKSTN  239

Query  919   TTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQTSFYQNSW  1092
             +    DL       +  +  + +    T +++ EAVF +    AP +DG    F+Q  W
Sbjct  240   SVDYSDLLRDLPVRVSNNMNMILTRKITKEEVKEAVFSIKPDSAPGADGMSGFFFQKYW  298



>emb|CCA66188.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1381

 Score =   249 bits (637),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/430 (34%), Positives = 241/430 (56%), Gaps = 13/430 (3%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             +K  +     +F+++G LP G N   I L+     P  +N FR I +    YK++ K + 
Sbjct  463   IKLDVYNIVENFWNSGSLPKGSNVAFIALIAKREVPEGLNDFRPISMVGCIYKIIAKLLA  522

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
              RL+  M  LIGP+Q+SF+ GRQI +  L+  E++++ R K  K  L ++K+D  KA+D 
Sbjct  523   RRLQKVMDSLIGPYQSSFIAGRQILDGALIAGELIDTCRRK--KVQLSILKLDFHKAFDS  580

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             ++WSF+  TL K GF P W   I SC++++  +I  +   +  F L RG+RQGDPLSP L
Sbjct  581   VAWSFLDWTLDKMGFPPRWRMWISSCITSAAASILINGSPTAPFKLHRGLRQGDPLSPFL  640

Query  1638  FVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCL  1817
             F L VE LS +I+++   G W+G+++T+ G  I+HL + DD + F   +L     +KK L
Sbjct  641   FDLVVETLSLVIQKASHLGLWEGVEVTKNGEKITHLQYADDTIIFCPPNLDYLLNIKKTL  700

Query  1818  NEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGR----YLGVPSIHGR  1985
               F   SG ++++ KS I       + +Q+A ++     ++  +GR    YLG+P I G 
Sbjct  701   ILFQLASGLQVNFHKSSIMGIHVDEIWLQEAANA-----LLCKVGRLPFTYLGLP-IGGN  754

Query  1986  LKQDSYAD-LMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRL  2162
             + + ++ D ++ +I+ +L  WK R LS  GR TLI++ +S++P Y M     P+GV+  +
Sbjct  755   ISRLAHWDPIIKKIEGKLASWKGRMLSIAGRITLIKASISSLPLYYMSLFPAPRGVIEAI  814

Query  2163  ERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKED  2342
              +L R+FLW          L++W +V   K+ G L    L   N +L  K  W+L +  +
Sbjct  815   NKLQRNFLWSGELRKSSLALVAWNQVVLPKESGGLNCGNLLNRNISLLFKWIWRLSHDPE  874

Query  2343  GLCVKIMEAK  2372
              L  K+++ K
Sbjct  875   SLWQKVIKEK  884


 Score = 87.4 bits (215),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 86/310 (28%), Positives = 136/310 (44%), Gaps = 28/310 (9%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVL---  384
             L F+++I +  L+++  S   +TW  G +      ++LDR L N EW    P ++V    
Sbjct  162   LDFKNFIQQTHLMEISASDGWFTWFSGQAK-----SKLDRLLVNPEWVSLFPSLQVSILR  216

Query  385   -----HLPMVNSYHTLG-ESRRFRFNAAW*THPNYQE*VSSTWKSDVS--LEANKSNLSK  540
                  H P++     L    R FRF   W +HP   + +   W S  S  L        K
Sbjct  217   RNLSDHCPLLVKSDELNWGPRPFRFQNCWLSHPGCLQIIKDVWASHTSGNLTDKLKETKK  276

Query  541   QLDDWNKHTIGNIFRRK*RVLARISGVQ-----RSLSVYQkldlikldrklrreldeilY  705
             +L  WN    G+I R    +  RI  +      R L + +  +      +L   L     
Sbjct  277   RLKIWNSSEFGHIDRNIEELEDRIHNLDLISNGRDLQLEELAERRSSQMELWVWLR----  332

Query  706   QEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFH  885
             ++E  W   SR +WI  GD+NT+++H   + RK  +T+  L  N G  +SD  GI     
Sbjct  333   RKEAFWAQNSRAKWIKEGDKNTKYFHTLASTRKKKNTIPALITNNGV-VSDPAGIHHEAV  391

Query  886   AFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDG  1062
             +F+  +F ED +++    N   F  L   Q   +   F+ K++ EAV      KAP  DG
Sbjct  392   SFFKSIFKEDFSSR-PVFNGLQFRSLSCEQVSQLTEPFSHKEVDEAVESCDPQKAPGPDG  450

Query  1063  FQTSFYQNSW  1092
             +   F ++SW
Sbjct  451   YNFRFIKDSW  460



>dbj|BAE79384.1| unnamed protein product [Ipomoea batatas]
Length=1898

 Score =   308 bits (790),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 156/437 (36%), Positives = 252/437 (58%), Gaps = 0/437 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
              P     +F G V  ++    +  F  G          + L+P    P     FR I L 
Sbjct  988   IPAVFYQQFWGEVGPAMTDMVNHAFENGSTYISQLQAFMTLIPKKDTPETAADFRPITLP  1047

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLM  1421
             NVS+K+++K +  RL+  M  +IGP Q SF+ GR   +NV++ QEV++S+ +   K   M
Sbjct  1048  NVSFKVISKVLVNRLRPIMSNIIGPHQNSFLPGRSTMDNVILTQEVVHSMNNPRRKKKQM  1107

Query  1422  VIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLER  1601
             ++K+DL+KAYD +SW ++  TL+  GF    I  I+  +  S LAI ++      F   R
Sbjct  1108  ILKVDLQKAYDSVSWDYLEETLEDFGFPRRLIDLILFSLQESSLAILWNGGRPPPFKPGR  1167

Query  1602  GIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEA  1781
             G+RQGDPL P LF L +ERL+H I+  V    WK + ITR G  ISHLFF DDL+ FGEA
Sbjct  1168  GLRQGDPLVPYLFNLVMERLAHDIQTRVNARTWKPVHITRGGTGISHLFFADDLMLFGEA  1227

Query  1782  SLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYL  1961
             S HQA ++  CL+ F   SG ++++ KS +F S N +  +++AI S L +P+   LG YL
Sbjct  1228  SEHQAQIMFDCLDSFSDASGLKVNFSKSLLFCSSNVNAGLKRAIGSILQVPVAESLGTYL  1287

Query  1962  GVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLP  2141
             G+P +  R+ ++++  ++ +++ +L+ WK  +L+  GR  L+Q+ L+ +P YTMQ   LP
Sbjct  1288  GIPMLKERVSRNTFNAVIDKMRTKLSSWKASSLNMAGRRVLVQASLATVPTYTMQVMALP  1347

Query  2142  QGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGW  2321
                 + +++  R+FLWG     RK + ++W ++ + +++G LG++     N+A   K+ W
Sbjct  1348  VSTCNEIDKTCRNFLWGHDTNTRKLHSVNWAEICKPRNEGGLGLRMARDFNRAFLTKMAW  1407

Query  2322  KLMNKEDGLCVKIMEAK  2372
             ++ +  D L VK++  K
Sbjct  1408  QIFSNIDKLWVKVLREK  1424


 Score =   127 bits (318),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 103/301 (34%), Positives = 156/301 (52%), Gaps = 20/301 (7%)
 Frame = +1

Query  244   GLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHT---  414
             GL+D G SGP +TW + + +   +  RLDR L N+  ++  P+ +V  LP + S H    
Sbjct  701   GLLDPGSSGPNFTWCRFIGNRVVQRRRLDRVLWNVSAQLTFPEAKVSVLPRLCSDHNPIL  760

Query  415   -LGES--------RRFRFNAAW*THPNYQE*-VSSTWKSDVSLEANKSNLSKQLDDWNKH  564
              L E+        R  RF AAW T  +Y+     +T +   +LE   +  +++   WN++
Sbjct  761   FLDEAGNPPDRSLRPVRFEAAWLTSEDYKHIWKEATEREGSNLEDIIATATQKSLLWNRN  820

Query  565   TIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREE  744
               GNIF RK ++  RI G+QR+ +    + L  L+++L  EL+E+L QEE LWF ++R +
Sbjct  821   VFGNIFNRKRKIENRILGIQRAWNYNTSVRLQDLEKRLLSELNEVLVQEETLWFQKARTD  880

Query  745   WIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFS---ED  915
             WI +GDRNT FYH +  ++++ + VR LK   G W  D D + E    F+  LF     D
Sbjct  881   WIRNGDRNTTFYHRSALIKRNRNRVRFLKLQ-GAWTDDADLLTEHIINFFSTLFCRVDRD  939

Query  916   STTQLEDLNDAFFPPLHTSQWLAINAHF-TVKDLEAVFEMAQFKAPSSDGFQTSFYQNSW  1092
             S    + L   F  P   +  L   A    VK  +AVF M ++ +P  DG    FYQ  W
Sbjct  940   SQPPRQGLPMDFQIPRDQASTLLRRASLEEVK--KAVFGMKKYGSPGPDGIPAVFYQQFW  997

Query  1093  A  1095
              
Sbjct  998   G  998


 Score = 85.5 bits (210),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 62/222 (28%), Positives = 100/222 (45%), Gaps = 19/222 (9%)
 Frame = +2

Query  2825  RIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCPIANSVWESLIP  3004
             +I+ F+W    +  M N +R RRG      C +C    E +DH+ +RC +A + W+S +P
Sbjct  1580  KIKLFMWKIVKNGLMVNVERKRRGLADAASCPVCGEEDETLDHLFRRCLLAEACWDSAVP  1639

Query  3005  YDHRRL*DQDYT-NWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWRNDLVFSGTNINLA  3181
                 +  +  +  +W     S            + F   +W LWK RN LVF   NI   
Sbjct  1640  PLTFQTSNHLHMHSWMKAACSSQQKDGYGTNWSLIFPYILWNLWKARNRLVFD-NNITAP  1698

Query  3182  ARIKWIRDQVEEINISF---SKAKGLIAP---IESICWRQLKWIRPQVGWVKANIDGSSI  3343
             + I         +N SF   S+A+ L+A    +++     + W  P  G+ K N DG+  
Sbjct  1699  SDI---------LNRSFMESSEARCLLAKRTGLQTAFQTWVVWSPPAAGFTKLNSDGACK  1749

Query  3344  PSNSIARCGGFIRDDQGC*LKGFMHNIGLNQRVSS*PRLWGL  3469
               + +A  GG +R++ G  + G+  NIG      +   LWGL
Sbjct  1750  SHSHLASAGGLLRNENGLWVAGYTCNIGTANSFLA--ELWGL  1789



>ref|XP_010495286.1| PREDICTED: uncharacterized protein LOC104772356 [Camelina sativa]
Length=1158

 Score =   268 bits (684),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 154/469 (33%), Positives = 249/469 (53%), Gaps = 39/469 (8%)
 Frame = +3

Query  1068  NQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNV  1247
             +Q   ++   V   +++    FF++GHLP+  N T ICL+P + NP  +   R I    +
Sbjct  266   SQFFKEYWDVVGPQVVQEVQQFFASGHLPSDWNFTQICLIPKVQNPTRMTNLRPI----I  321

Query  1248  SYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMV  1424
             SY                      Q +FV GR IT+N+L+  E++++L++K+G     + 
Sbjct  322   SYT---------------------QGTFVSGRLITDNILLAHELVHALQTKAGCNEEFLA  360

Query  1425  IKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERG  1604
             IK D+ KAYDR+ W+F+   L + GF   W+  IMSCV +   ++  + +   +   ERG
Sbjct  361   IKTDMSKAYDRVEWNFLEELLIRLGFDIKWVNWIMSCVRSVTFSVLINGKEHGFIKPERG  420

Query  1605  IRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEAS  1784
             IRQGDPLSP LF+L  E L H++ ++ + G+  G+K+T + P I HL F DD +F   AS
Sbjct  421   IRQGDPLSPFLFILCAEALVHVMNKAEQEGRLTGLKLTPECPSIQHLLFADDSLFLCRAS  480

Query  1785  LHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLG  1964
             L + S + +CL  +   SGQ ++  KS I F K     +++ I    GI      G+YLG
Sbjct  481   LLECSNLLQCLRLYGDASGQEINLQKSSITFGKKLDPYMRRVIGLFTGIEQEGGAGKYLG  540

Query  1965  VPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQ  2144
             +P      K+D  A +  R+ +RL GW  +TLS  G+  L+++V  A+P Y M    L +
Sbjct  541   LPECFSGSKKDMLAYITDRLTSRLRGWFEKTLSLGGKEVLLKAVALALPVYAMSCFRLSK  600

Query  2145  GVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWK  2324
                 ++     +F W + +  +K + +SW+K+ +SKDQG LG + +   NQAL AK  W+
Sbjct  601   HQCKKITSAMANFWWNAVEEKQKMHWVSWEKMCKSKDQGGLGFRDIGRFNQALLAKQAWR  660

Query  2325  LMNKEDGLCVKIMEAKVQLPSL----------PSQACQ--MYGRVFLSR  2435
             L++    L  ++ +A+   PS+          PS A +  ++GR  L +
Sbjct  661   LLDAPSSLLARVYKARY-FPSISFMEANLGPRPSYAWRSILFGRELLEK  708


 Score = 69.3 bits (168),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 122/279 (44%), Gaps = 35/279 (13%)
 Frame = +1

Query  325   LDRALCNIEWKIRSPDVEVLHLPMVNSYH----------TLGESRRFRFNAAW*THPNYQ  474
             LDRAL N  W    P V+  ++  + S H           +  S RF FN  W + P++ 
Sbjct  7     LDRALGNEAWFQLFPRVQGEYMERIGSDHRALLLRLANDNVSRSGRFIFNKRWISKPDFA  66

Query  475   E*VSSTWKSDV-----SLEANKSNLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSV  639
               V S W   V     S+ +  +   + +  W +    N+  +      RI  V+  L  
Sbjct  67    AVVQSGWNKGVTTGQTSVMSRIAECRRTISGWKRSQ--NLNSK-----VRIQQVREQLDA  119

Query  640   --YQkldlikldrklrreldeilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSAS  813
                +     +L R LR EL E    EEL W  RSRE+W+  GDRNT+F+H +   R+  +
Sbjct  120   EGTKIHPNFQLMRDLRWELAENYRAEELYWKERSREQWLQGGDRNTKFFHGSVQRRRIQN  179

Query  814   TVRRLKDNFG-EWISDGDGILEPFHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAIN  990
              +  L D  G E  S+G    E   A++  +F+  + + + +  D   P +  S    +N
Sbjct  180   KILSLFDENGVEQFSEGSKG-EVAVAYFRKMFTSSNPSAIMEALDGMVPRVTDS----MN  234

Query  991   AHFT--VKDLE---AVFEMAQFKAPSSDGFQTSFYQNSW  1092
             A     V  LE   AVF +   K P +DG  + F++  W
Sbjct  235   AELIRPVSALEIKNAVFSIKGEKTPGADGMSSQFFKEYW  273



>emb|CCA65974.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1379

 Score =   254 bits (648),  Expect(3) = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/433 (34%), Positives = 238/433 (55%), Gaps = 17/433 (4%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             T+K+ +     +F++T  LP G N T I L+P I NP     FR I +    YK++ K M
Sbjct  462   TIKEDVYTLVREFWATSKLPKGSNSTFITLIPKIDNPENFKDFRPISMVGCVYKIIAKLM  521

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYD  1454
               R++  M  LIGP Q+S+V GRQI +  LV  EV++  + K  K   +++K+D  KAYD
Sbjct  522   AKRIQRVMSSLIGPLQSSYVEGRQILDGALVASEVIDLCKRK--KMEAILLKLDFHKAYD  579

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
              +SWSF++ TL +  F P W + +M+CV+++  +I  +   S+ F L RG+RQGDPLSP 
Sbjct  580   SVSWSFLQWTLAQMKFPPQWCKWVMACVASASASILINGSPSRPFKLHRGLRQGDPLSPF  639

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LFV+  E L+ LI ++ +   W+G++ +R GP ISHL + DD + F + S      +K  
Sbjct  640   LFVIIGEALNQLIIKATRLNLWRGIETSRDGPMISHLQYADDTLVFSDTSTDSLKSIKST  699

Query  1815  LNEFCSLSGQRLSYMKS*IF-------FSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPS  1973
             L  F  +SG ++++ KS +         + N +  +Q  + S   IP       YLG+P 
Sbjct  700   LILFQLVSGLQVNFHKSSLIGLNISDARANNAANLLQCKVGS---IPFT-----YLGLPI  751

Query  1974  IHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVL  2153
                  +   +  ++ ++  +L  WK++ LS  GR TLI+S L+++P Y M    +P+GV+
Sbjct  752   GGNPSRIQFWKPVIEKLCEKLAMWKSKMLSIGGRLTLIKSSLASLPLYFMSLFPIPKGVV  811

Query  2154  SRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMN  2333
              ++  ++R FLW      +    +SWK V   K +G L I  +   N A+  K  W+   
Sbjct  812   EKINMITRRFLWSGCAEKKTLPPVSWKVVQLPKSRGGLNIGNVMHKNLAMLFKWIWRFFQ  871

Query  2334  KEDGLCVKIMEAK  2372
             + + L  K++++K
Sbjct  872   EPNNLWCKVIKSK  884


 Score = 75.9 bits (185),  Expect(3) = 2e-82, Method: Compositional matrix adjust.
 Identities = 82/309 (27%), Positives = 147/309 (48%), Gaps = 30/309 (10%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVL-----  384
             F++++    L+++  S   +TW +G S      + LDR L N EW    P + +      
Sbjct  164   FKNFLQVMELLEVSPSNKGFTWFRGRSK-----SVLDRLLLNPEWINEFPSMRLSLLQRG  218

Query  385   ---HLPMVNSYHTLG-ESRRFRFNAAW*THPNYQE*VSSTW--KSDVSLEANKSNLSKQL  546
                H P++ + HT     + FRF   W T P+  E V+ TW   +++ +      +  +L
Sbjct  219   LSDHCPLLTNIHTQNWGPKPFRFQNCWLTDPHCLEIVNKTWLESTNMPMIDKLRRVKIRL  278

Query  547   DDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilY----QEE  714
               WN+   G+I      +      +Q+  ++  + +L + + + R+E    L+    ++E
Sbjct  279   KAWNRDEFGHIDTN---IKIMEDEIQKFDTISNERELDEQEIERRKEAQSDLWMWMKRKE  335

Query  715   LLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFY  894
             L W   SR  W+  GDRNT+F+H   + +K  + +  +K N G  I   + I E    F+
Sbjct  336   LYWAQNSRILWLKHGDRNTKFFHMVASNKKRRNFIASIKVN-GRRIEKPNQIKEEAVTFF  394

Query  895   MDLFSEDSTTQ--LEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGF  1065
              ++F+E+ T +  LE L    F  L  +Q  ++   F+ ++++ AV   A  KAP  DGF
Sbjct  395   KEIFTEEFTERPTLEGLQ---FNQLSQNQADSLIQPFSDEEIDYAVNSCASDKAPGPDGF  451

Query  1066  QTSFYQNSW  1092
                F +N+W
Sbjct  452   NFKFIKNAW  460


 Score = 28.5 bits (62),  Expect(3) = 2e-82, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = +2

Query  2453  GSKKLVKNDRSTLFWLDSWIGKQ  2521
             G +K++ N  +TLFWLD WI   
Sbjct  925   GLRKIIGNGGNTLFWLDPWISSH  947



>ref|XP_007212615.1| hypothetical protein PRUPE_ppa017091mg, partial [Prunus persica]
 gb|EMJ13814.1| hypothetical protein PRUPE_ppa017091mg, partial [Prunus persica]
Length=921

 Score =   249 bits (635),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/431 (32%), Positives = 226/431 (52%), Gaps = 26/431 (6%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             K+  T+ D +     DFF         N T + L+P IPNP  V+ FR I LCN S+K++
Sbjct  332   KYWDTIYDEIRGITEDFFRNNQSLGALNTTNLVLIPKIPNPEGVSHFRPISLCNFSFKIV  391

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDL  1439
             +K M  RLK  +  +I P Q +FV  RQI  N+L+  E  + L+  K+ K     IK+D+
Sbjct  392   SKVMANRLKVFLPQIISPAQNAFVPNRQIQENILIAHEAFHILKLRKTTKMYDFGIKLDM  451

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+ S + K GF   W+  +M+ V T + ++  +      F   RGI+Q D
Sbjct  452   NKAYDRVEWHFLESVMLKMGFDVRWVNLVMNLVRTVQFSLVLNGVQGNTFTPTRGIQQVD  511

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF++  E LS +I+++ +    + +K  R GP +SHL F DD +FF  A+     
Sbjct  512   PLSPYLFLIVSEVLSLMIKKACEANYMQCLKFGRSGPTLSHLLFADDALFFIRAN-----  566

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
               + C N                     NT   I+  + + LG+ +V+D G+YLG+P++ 
Sbjct  567   -TQNCRN-------------------IPNTPASIRAQLGAILGMTMVDDPGKYLGLPTMW  606

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+++   +  ++  +L+GWK   LS   R  LI+ V  A+P Y M   L P+   ++
Sbjct  607   GRSKKEALQFVREKLCRKLSGWKQSLLSQASREVLIKVVAQAVPNYPMGVFLFPKMFCTK  666

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             +E    +F WG  +  RK + + W ++   K +G +G       N AL AK  W+L+ + 
Sbjct  667   MESEIANFWWGQKQEERKIHWVRWTELGLPKHEGGMGFCDFHDFNLALLAKQCWRLLTEL  726

Query  2340  DGLCVKIMEAK  2372
             + +  ++++A+
Sbjct  727   NSVWARLIKAR  737


 Score = 87.8 bits (216),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 125/302 (41%), Gaps = 48/302 (16%)
 Frame = +1

Query  238   REGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHT-  414
             + GLIDLGY G ++TW     +  F   RLDR L N+ W+   P+  + H P + S H  
Sbjct  64    KAGLIDLGYHGSSFTWRALRQNGIFVQERLDRVLGNLPWQESCPNTFISHHPAIGSDHNP  123

Query  415   ---------LGESRRFRFNAAW*THPNYQE*VSSTWKSDV------SLEANKSNLSKQLD  549
                          R+F+F A W     +   +   W  +        +EA  + L+++  
Sbjct  124   LVLETTMYHKNHRRQFKFEAYWADELQHCTTLLKKWSREKFSNNKKRMEALHAELNEKQL  183

Query  550   DWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*  729
              W+++ +             I  + + ++                   E   +EE  W  
Sbjct  184   RWDENHV------------EIRRITQEIT-------------------ETGAREEQYWHQ  212

Query  730   RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFS  909
             RSR +W+  GD NT F+H +   R+  + + R+K + G W      +   F   + +LF+
Sbjct  213   RSRIKWLSKGDANTAFFHQSMLARRLQNCILRIKGDDGRWHVGEQAVKRVFEEHFKNLFT  272

Query  910   EDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQTSFYQN  1086
              ++ +   D+ D     +  +    +    T++++ EA  +M   KAP  DG+Q  F+  
Sbjct  273   FEAQSINRDILDCVDSVISQTTNDNLLQAITMEEIKEAAMQMGGLKAPGPDGYQGIFFHK  332

Query  1087  SW  1092
              W
Sbjct  333   YW  334



>ref|XP_009150035.1| PREDICTED: uncharacterized protein LOC103873375 [Brassica rapa]
Length=1285

 Score =   273 bits (699),  Expect(3) = 3e-82, Method: Compositional matrix adjust.
 Identities = 144/416 (35%), Positives = 238/416 (57%), Gaps = 1/416 (0%)
 Frame = +3

Query  1128  DFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRML  1307
             + F T  LP   N T ICL+P I +P  +   R I LC+V YK ++K +  RL+  ++ +
Sbjct  398   EVFQTVSLPRDWNFTYICLLPKINDPEFMKDLRPISLCSVLYKSVSKILVRRLQPFLQDI  457

Query  1308  IGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGLMVIKIDLEKAYDRLSWSFIRST  1484
             I   Q++FV  R I++N+++  E +++L R       +M +K D+ KAYDR+ WS++RS 
Sbjct  458   ISSNQSAFVRDRLISDNIVIAHEAVHALKRHHPISQEMMAVKTDMSKAYDRVEWSYLRSL  517

Query  1485  LQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLS  1664
             +   GFS  W+  +M CV++   A+  + +       +RG+RQGDPLSP LFVL  E L+
Sbjct  518   MLALGFSLKWVDWVMMCVTSVSFAVLINDQPFGLINPQRGLRQGDPLSPFLFVLCTEGLT  577

Query  1665  HLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQ  1844
             HL+  + +NG   GMK + +GP ISHL F DD +F  +AS+ +ASV+++ L  +   +GQ
Sbjct  578   HLLNVAERNGLISGMKFSEEGPTISHLLFADDSLFLCKASVSEASVLQRILTFYGEATGQ  637

Query  1845  RLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRI  2024
              ++  KS I F      E + AI  +LGI       +YLG+P      K D ++ L  + 
Sbjct  638   TINREKSSISFGDKVGEESRAAIQHTLGISNQGGASKYLGLPECFSGSKVDLFSYLKDKT  697

Query  2025  QARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKG  2204
               +L  W  + LS  G+  LI+S  S++  + M    LP+ ++ +L  +   F WG+   
Sbjct  698   HGKLDVWYYKHLSQAGKEVLIKSSGSSLSTFAMSCFRLPKSIIDKLTSMLAAFWWGAEPH  757

Query  2205  NRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
              RK + ++W+++   KDQG LG + L+  NQA+ AK  WK++++ D +  + ++++
Sbjct  758   QRKIHWVAWERLCLPKDQGGLGFRDLEAFNQAMLAKQAWKVLSQPDSMLARFLKSR  813


 Score = 55.8 bits (133),  Expect(3) = 3e-82, Method: Compositional matrix adjust.
 Identities = 35/132 (27%), Positives = 68/132 (52%), Gaps = 5/132 (4%)
 Frame = +1

Query  706   QEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFG--EWISDGDGILEP  879
             +EEL W  +SR++W++ GDR ++F+H++    +S + + +LKD  G  +W S+G    E 
Sbjct  256   EEELFWKQKSRDKWMIHGDRCSKFFHSSVKTSRSRNLIDKLKDKNGKDQW-SEG-AKAEV  313

Query  880   FHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSS  1056
                ++  LF   +      + ++  P +  S    ++   + +++ EA+F +    AP  
Sbjct  314   AIDYFSTLFRSSNPRSYTPVLESMVPKVSDSMNDVLSRDISKEEVREAIFSIDPDSAPGP  373

Query  1057  DGFQTSFYQNSW  1092
             DG    F+Q  W
Sbjct  374   DGMTGLFFQRHW  385


 Score = 28.5 bits (62),  Expect(3) = 3e-82, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 19/36 (53%), Gaps = 0/36 (0%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             S  W+ +L    +L KG  + V N + T  W+D WI
Sbjct  830   SYAWRSLLHGRELLTKGIIRRVGNGQKTRVWIDKWI  865



>ref|XP_010676027.1| PREDICTED: uncharacterized protein LOC104891937 [Beta vulgaris 
subsp. vulgaris]
Length=1261

 Score =   305 bits (780),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 161/439 (37%), Positives = 256/439 (58%), Gaps = 3/439 (1%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP     K+   V +S+I+    FF +  +    N T + L+P I NP   N FR I LC
Sbjct  338   FPPFFFQKYWTLVGNSVIRAVQAFFHSSRILKEINHTFLALIPKIDNPTSANHFRPISLC  397

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLM  1421
             +  YK+++K MT RLK  M  +I P Q +FV  R I +N+L+  EV  S ++KSG  G +
Sbjct  398   STIYKIISKIMTSRLKIVMGHIIHPLQGAFVPDRLIQDNILIAHEVFQSFKNKSGASGWI  457

Query  1422  VIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLER  1601
              IK+D+EKAYDRL W++I +TL+K GF+  W+  + +C++++  ++  +    + F   R
Sbjct  458   AIKLDMEKAYDRLEWNYIFTTLEKLGFAAQWVNWVKACITSTSFSVLVNGIPGEKFSPSR  517

Query  1602  GIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWK--GMKITRKGPCISHLFFVDDLVFFG  1775
             GIRQGDPLSP LF+L  E L+ L+  S  +G  K  G+ I R G  +  L F DD + F 
Sbjct  518   GIRQGDPLSPFLFILCAELLARLLS-SAASGPTKPIGVPIGRSGVKVPFLTFADDTMIFA  576

Query  1776  EASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGR  1955
             +A+ +   V+++ L+++C++SGQ ++Y KS    + N S + +   +S L +    DLG 
Sbjct  577   KATNYSCLVIRQILDKYCAMSGQLVNYHKSSFQCTANISEDDKANFASILQMSETFDLGE  636

Query  1956  YLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSL  2135
             YLG P IH ++ +++++ ++++   +L  WK   LS  GRS LI+S L++   Y MQS L
Sbjct  637   YLGCPIIHSKVTKETFSSVINKTVGQLPKWKANALSQAGRSILIKSNLASKASYQMQSFL  696

Query  2136  LPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKL  2315
             LP  +LS L++  R+F W      +  NLI W K+ + K  G LG ++ +  NQAL  KL
Sbjct  697   LPNSILSSLDKTYRNFFWNKDPNAKSPNLIGWDKICKPKVAGGLGFRKAEVNNQALQMKL  756

Query  2316  GWKLMNKEDGLCVKIMEAK  2372
              W+++  +  L V ++  +
Sbjct  757   LWRIVKNDTNLWVNLVRKR  775


 Score = 78.6 bits (192),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 80/318 (25%), Positives = 137/318 (43%), Gaps = 30/318 (9%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             L  Q+       I++ +SG  YTW +     +    RLDR + +I+W    P  ++ H  
Sbjct  35    LNMQNLFNSLPCIEIPFSGSIYTWRKKKGGADNIHERLDRGVASIDWLSLFPQAKISHNI  94

Query  394   MVNSYHT----------LGESRRFRFNAAW*THPNYQE*VSSTWKSDV------SLEANK  525
               +S H             ++  F+F   W +  +Y   V  TW +         L    
Sbjct  95    FTSSDHCQITLNYIPFQKAKAPPFKFEKMWCSRRDYDTLVKKTWCTHFIGSHMFRLTQKC  154

Query  526   SNLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSV--YQkldlikldrklrreldei  699
               L ++   WN+   GNIFR+  +V  ++  +Q  L       L L K D  L++  + +
Sbjct  155   KLLKEKSKIWNQSQFGNIFRQLRKVDEKLQSLQLLLITEPLNHLLLSKQDTFLQKRSNLL  214

Query  700   lYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEP  879
              +  E  W  + + ++++ GD N+ FYHA  ++R++ + ++ L     + IS+ D I + 
Sbjct  215   SFSYEY-WKQKCKVDYLLLGDTNSSFYHAHASIRRNRNAIKELSKADNDTISNPDIISQE  273

Query  880   FHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFT-------VKDLEAVFEMAQ  1038
                 +M+ F+ DS T     ND  F  L     +  N + T       +K   A F +A 
Sbjct  274   LTRAFMERFTSDSRTCFNSAND--FSLLEAIISVDDNTYLTSLVTCDEIK--SATFSLAP  329

Query  1039  FKAPSSDGFQTSFYQNSW  1092
              K+P  DGF   F+Q  W
Sbjct  330   DKSPGPDGFPPFFFQKYW  347


 Score = 55.1 bits (131),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 90/219 (41%), Gaps = 21/219 (10%)
 Frame = +2

Query  2780  YRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIM  2959
             Y+ +WN I    +P +I+ FLW A +D   T  +  R        C  C N  E I H+ 
Sbjct  920   YKWIWNLI----IPPKIKNFLWKACNDGLPTKVRLERSHVFLPQQCVFCSNASESIGHLC  975

Query  2960  QRCPIANSVWESLI-----PYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMW  3124
               CP    V+  L      P  +R L   D T++     + LS   +    + +F    W
Sbjct  976   FACPFTLDVFSHLKASFDWPLPNRCLASIDLTSFRSALEACLSLACKSEVTKFSF--VWW  1033

Query  3125  WLWKWRNDLVFSGTNIN----LAARIKWIRDQVEEINISFSKAKGLIA--PIESICWRQL  3286
             ++W +RN L+F+   ++     A   K+  D  + +          I+  PI S   R  
Sbjct  1034  FIWFFRNKLIFNNEVVSSRKASAIIAKYYVDWSKALTSDTRHPSTSISHCPIISRSPRSG  1093

Query  3287  K---WIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQG  3394
                 W  P   + K N DGS + SNS A  G  IR+  G
Sbjct  1094  PASFWSPPPQNYFKLNFDGSKLSSNSTA-LGFVIRNVAG  1131



>ref|XP_010054717.1| PREDICTED: uncharacterized protein LOC104443052 [Eucalyptus grandis]
Length=916

 Score =   299 bits (766),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 148/418 (35%), Positives = 243/418 (58%), Gaps = 1/418 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             +K  + K   DF +T  L    N T I L+P +P+P  ++Q+R I LCN  YK+++K +T
Sbjct  44    IKWDIFKEVEDFLATASLSPALNKTNISLIPKVPHPERLDQYRPISLCNFGYKIMSKVLT  103

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLM-VIKIDLEKAYD  1454
              RLK  +  LI P Q++FV GRQI +N+ + QEVL+ +R ++ K     V+K+D++KAYD
Sbjct  104   NRLKPLLTELIAPEQSAFVGGRQIQDNIFIVQEVLHQIRIRNRKKKFQAVLKLDMKKAYD  163

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             R+ W F+ + L K GF   W++ +M CV+T   ++ F+     +F   +G+RQGDPLSP 
Sbjct  164   RVEWDFLEACLLKTGFDEKWVKLVMQCVTTITYSVKFNGEQLPYFQPSKGLRQGDPLSPY  223

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LF++    LS L++Q+ +NG  KG+K+ R  P +SHL F DD +FF   ++ +   +   
Sbjct  224   LFIIVANVLSSLMKQAEENGTIKGIKLNRNCPTLSHLMFADDSIFFLHGTILECQNLAMI  283

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             LN++C  +GQ ++  KS IFFSK     ++  ++  L +PI++  G+YLG+PS  G  K+
Sbjct  284   LNQYCLAAGQEINLNKSGIFFSKGCPQSLKDNMARELRVPIIDKTGKYLGIPSDWGESKK  343

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
               +A ++ RI  +L  WK + LS  G+  L+++V+ A+P Y M    L   +   +E+  
Sbjct  344   QMFAWILGRISKKLESWKEKLLSKAGKEVLLKTVIQALPQYAMSVFKLSVSICKAIEQKI  403

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGL  2348
               F W +++     +   W  +   KD+G +G + L   N+A+  K  W+L  +   L
Sbjct  404   ASFWWKTNEKKEGMHWKRWDTLKIRKDRGGMGFRDLLSFNRAMLGKQAWRLAQQPSSL  461



>ref|XP_008387315.1| PREDICTED: uncharacterized protein LOC103449768 [Malus domestica]
Length=2699

 Score =   255 bits (652),  Expect(3) = 7e-82, Method: Compositional matrix adjust.
 Identities = 153/438 (35%), Positives = 241/438 (55%), Gaps = 5/438 (1%)
 Frame = +3

Query  1071  QLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVS  1250
             Q++ +    +K +++K   +F+ TG +    N+T ICL+P   +   V  FR I L    
Sbjct  1461  QMIQQCWDILKANIMKIMEEFYETGIINAVTNETFICLIPKKSDSMKVTDFRPISLVTGL  1520

Query  1251  YKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIK  1430
             YK++ K +  RLK  +   I   Q +FV  RQI + VL+  EV+  +R K  +G  +V+K
Sbjct  1521  YKIMAKTLASRLKEVLGSTISQNQGAFVKDRQILDAVLIANEVVEEVRQKKEEG--LVLK  1578

Query  1431  IDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIR  1610
             ID EKAYD + W F+   LQ+  F   W + +  C+S++  ++  + R    F   RG+R
Sbjct  1579  IDFEKAYDHVEWRFLDEVLQRKSFGNRWRKWMQGCLSSANFSVLINGRPRGKFQXSRGLR  1638

Query  1611  QGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLH  1790
             QGDPLSP LF L V+ LS L+E++ +N   KG+ I ++   I HL F DD +FF      
Sbjct  1639  QGDPLSPFLFTLVVDVLSRLMEKAQENHLIKGLCIGQEKVEIXHLQFADDTIFFLAXXEG  1698

Query  1791  QASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVP  1970
               + + + L  FCS+SG +++  K       N+  E    ++ S G  + +   +YLG+P
Sbjct  1699  GWNNLLELLKLFCSVSGLKINKAKC-YLXGINSDCEKLNRLADSWGCEVGSXPIKYLGLP  1757

Query  1971  SIHGRLKQDSYAD-LMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQG  2147
              + GR +   + D ++ +++ RL  WK   LS  GR TLIQSVL ++P Y M    +P G
Sbjct  1758  -LGGRPRALKFWDPVVDKMEKRLQSWKKAFLSRGGRLTLIQSVLGSLPTYYMSLFKMPCG  1816

Query  2148  VLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKL  2327
             V+ RLE+L + FLW   +  +K NL+ W+ V +SK++G LG+  L   N+AL AK  W+ 
Sbjct  1817  VIGRLEKLMKGFLWEGVEEGKKNNLVKWEIVIKSKEEGGLGVGNLRNRNEALLAKWLWRF  1876

Query  2328  MNKEDGLCVKIMEAKVQL  2381
               +   L  K++ +K  L
Sbjct  1877  PXEPHSLWHKVIRSKYGL  1894


 Score = 74.7 bits (182),  Expect(3) = 7e-82, Method: Compositional matrix adjust.
 Identities = 83/315 (26%), Positives = 135/315 (43%), Gaps = 33/315 (10%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             F D+I    L DL      +TW      P  +  RLDR L +   +   P+V  + L  V
Sbjct  1162  FNDFIRETELKDLELLNAQFTWSNFREEPVCR--RLDRFLVSAGCEEIFPEVRQMALARV  1219

Query  400   NSYHT--LGESRR-------FRFNAAW*THPNYQE*VSSTWKSD-----------VSLEA  519
              S H     ES +       FRF   W  HP ++   +  W+S+           + L+A
Sbjct  1220  ISDHCPIQLESNKVKWGPSPFRFENMWLQHPEFRNKFNLWWQSEQVEGWEGYKFMIKLKA  1279

Query  520   NKSNLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrr-elde  696
              K    K++  W+K + G + +      A +  + R   +       +  R+       +
Sbjct  1280  XK----KKVQRWSKESFGEVEKDFKEAEASLEELDRREGMEGLDVDARRKREELLFXXGD  1335

Query  697   ilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILE  876
             + Y+EE+ W  RS+ EW   GD NT+F+H   + R+  + + RL+   G  I D + I +
Sbjct  1336  LAYKEEVKWRQRSKVEWXKEGDGNTKFFHRVASGRRKRNYIERLEXEVGGVIEDANEIED  1395

Query  877   PFHAFYMDLFS--EDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKA  1047
                 F+  LFS  E++   LE +N A    L  + W  I   F   +++ AVF+  + K+
Sbjct  1396  HIVXFFKSLFSSNEEACWGLEGINWAPISELE-ANW--IERPFEEAEVQRAVFDCGKDKS  1452

Query  1048  PSSDGFQTSFYQNSW  1092
             P  DG+     Q  W
Sbjct  1453  PGPDGYSLQMIQQCW  1467


 Score = 26.6 bits (57),  Expect(3) = 7e-82, Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 76/209 (36%), Gaps = 22/209 (11%)
 Frame = +2

Query  2414  WKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIG--------KQATLLSRIRYDPFDRVI  2569
             WK I   + + L   K  V N     FW D W+          +  LLSR         +
Sbjct  1913  WKDISIGSQLFLHCCKFEVGNGERVRFWEDGWLDGGXLKEQFPRLFLLSRKHNQNISSFV  1972

Query  2570  R*SL*VLG----PRIGVAVGETFEPAS*GVLEYVGGVQLIR-*L*A*KWPGLGRGLFW*I  2734
               S   L      R  +   E  E A   +L+ V  V+L +      +W     GLF   
Sbjct  1973  DLSTNSLSWNFDFRRNLNEAEIEEAAR--LLQKVEEVRLSQSRXDNRRWKMEASGLF---  2027

Query  2735  LC*INL*HYS-RGLSTYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRG---FT  2902
              C       S  G+  Y +  + I   KVP +++  +WLA      T  +  RR      
Sbjct  2028  TCKSYCSFLSNNGMMQYFQPHSQIWKSKVPPKVKILVWLAAKGKLNTCDQIQRRSPFICL  2087

Query  2903  SEVFCGICRNLPEDIDHIMQRCPIANSVW  2989
             S  +C +C+   E ++HI   C     +W
Sbjct  2088  SPQWCSLCKAKEESVNHIFLHCSYTIQLW  2116



>ref|XP_009102231.1| PREDICTED: uncharacterized protein LOC103828378 [Brassica rapa]
Length=1036

 Score =   261 bits (668),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 155/442 (35%), Positives = 231/442 (52%), Gaps = 12/442 (3%)
 Frame = +3

Query  1131  FFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLI  1310
             FF    L    N+T + L+        V  +R I LC+  YK++ K +T RLK  +  LI
Sbjct  169   FFDASCLNPRFNETHVRLIAKSKGAKKVADYRPIALCSTHYKIIAKLLTKRLKPMLPALI  228

Query  1311  GPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAYDRLSWSFIRSTL  1487
              P Q++FV GR I++NVL+  E+L+ LR SK+ K   M IK D+ KAYDR+ W F+   L
Sbjct  229   SPQQSAFVAGRAISDNVLITHEMLHYLRTSKAKKSCSMAIKTDMSKAYDRIEWDFLDHVL  288

Query  1488  QKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSH  1667
                GF   W   IM CV +   +   +    +  + ERG+RQGDPLSP LF+L  E LS 
Sbjct  289   HCFGFHQVWRTWIMQCVQSVSYSFLINGEPREKVLPERGLRQGDPLSPYLFILCSEVLSG  348

Query  1668  LIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQR  1847
             L  ++  +G   G+K+ R  P I+HL F DD +FF ++     S +   L ++   SGQ 
Sbjct  349   LCRKAQDSGLLPGLKVARNSPAINHLLFADDTMFFSKSDPLSCSSLLDILRKYEIASGQC  408

Query  1848  LSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQ  2027
             ++ +KS I FS  T   I+  +   LGI     +G+YLG+P    R K+D +A ++ RI+
Sbjct  409   INLLKSAIMFSSKTPAAIRSRVKQDLGIAAEGGIGKYLGLPEHFSRRKRDIFAGIIDRIR  468

Query  2028  ARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGN  2207
              R   W  + L+  G+  L+++VL A+P Y M    LP  +  ++  +   F W      
Sbjct  469   QRSHSWSTKFLNGAGKQVLLKAVLMAMPAYAMSCFKLPLSLCKQILSILTRFWWDMKPEI  528

Query  2208  RKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK-----  2372
             RK   +SW+ +T +K  G LG + +   N AL  KL W++M   + L  +I+  K     
Sbjct  529   RKMCWVSWQTLTRAKADGGLGFRDIALFNDALLGKLAWRIMTNPESLLGRILLGKYCHSA  588

Query  2373  ----VQLPSLPSQACQ--MYGR  2420
                 V +PS PS   +  M GR
Sbjct  589   SFLDVTIPSSPSHGWRGIMAGR  610


 Score = 73.2 bits (178),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 69/130 (53%), Gaps = 1/130 (1%)
 Frame = +1

Query  706   QEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFH  885
             +EE  W  RSR +W+  GDRNT F+HA T  R + + +  +++  GE +   D I + F 
Sbjct  26    EEESFWRQRSRIQWLQHGDRNTGFFHAVTRGRNAMNKMSVIENEAGEAVYGDDKISQAFA  85

Query  886   AFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDG  1062
              FY  +F+    + L  +++   P +      ++ A  T  +++ AVF + + KAP  DG
Sbjct  86    EFYRKVFTSSPRSDLSFISEVITPVISEEMNSSLIARPTDDEIKTAVFSIHKDKAPGPDG  145

Query  1063  FQTSFYQNSW  1092
             F  SFY + W
Sbjct  146   FSASFYHSFW  155



>ref|XP_010693052.1| PREDICTED: uncharacterized protein LOC104906048 [Beta vulgaris 
subsp. vulgaris]
Length=1259

 Score =   303 bits (775),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 159/431 (37%), Positives = 244/431 (57%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             KF   + D +  F S        P+  N T I L+P + NP    +FR I LCNV YK++
Sbjct  366   KFWHIIGDDVTHFVSSILHGSTPPSCINHTNIALIPKVKNPTTAAEFRPIALCNVVYKLV  425

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKS-GKGGLMVIKIDL  1439
             +KA+ +RLK  +  L+   Q++FV GR IT+N L+  EV +S++ ++  + G + +K+D+
Sbjct  426   SKALVIRLKEFLPSLVSENQSAFVPGRLITDNALIAMEVFHSMKHRNRSRKGTIAMKLDM  485

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+R  L   GF   W+  IMSCVS+   +   +  +       RG+RQGD
Sbjct  486   SKAYDRVEWGFLRKLLLTMGFDGRWVNLIMSCVSSVSYSFIINGGVCGSVTPARGLRQGD  545

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  +  S +I++ V+  Q  G K +R GP ISHLFF DD + F  AS  + +
Sbjct  546   PLSPYLFILIADAFSKMIQKKVQGKQLHGAKASRSGPVISHLFFADDSLLFTRASRQECT  605

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             ++   LN +   SGQ+++Y KS + FSK  S   ++ +++ L +  V+   +YLG+PSI 
Sbjct  606   IIVDILNRYEKASGQKINYEKSEVSFSKGVSTAQKEDLTNILHMRQVDRHVKYLGIPSIT  665

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR +   +  LM RI  +L GWK + LS  G+  L++SV+ AIP Y M    LP  ++ +
Sbjct  666   GRSRTAIFDSLMDRIWKKLQGWKEKLLSRAGKEILLKSVIQAIPTYLMGVYKLPCSIIQK  725

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             +      F WGSS  +RK +  SW  +   K  G +G + L   N AL  +  W+L+ + 
Sbjct  726   IHSAMARFWWGSSDTHRKIHWKSWDSLCTLKCFGGMGFRDLRVFNDALLGRQAWRLVREP  785

Query  2340  DGLCVKIMEAK  2372
               L  ++M+AK
Sbjct  786   HSLLARVMKAK  796


 Score = 54.3 bits (129),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 66/150 (44%), Gaps = 14/150 (9%)
 Frame = +1

Query  220  FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
            F+D +    L DLGY+G  +TW +G S       RLDR +C+  W +  P+  V H    
Sbjct  123  FRDTMDDLLLRDLGYNGVWHTWERGNSLSTCIRERLDRFVCSPSWAVLYPNSIVEHSMRY  182

Query  400  NSYH------------TLGESRRFRFNAAW*THPNYQE*VSSTWKSDV--SLEANKSNLS  537
             S H              G+ RRF F  +W   P  +E + + W      SL      L+
Sbjct  183  KSDHLAICLRPNRIRRPTGKQRRFFFETSWLLDPTCEETIRAAWIDSTGDSLTGRLGLLA  242

Query  538  KQLDDWNKHTIGNIFRRK*RVLARISGVQR  627
            ++L  W+    GN  ++  RV A +  +Q+
Sbjct  243  QKLQCWSSERGGNFGKQLGRVEAALGRIQQ  272



>ref|XP_010419439.1| PREDICTED: uncharacterized protein LOC104705159 [Camelina sativa]
Length=1840

 Score =   258 bits (660),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 148/459 (32%), Positives = 247/459 (54%), Gaps = 14/459 (3%)
 Frame = +3

Query  1131  FFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLI  1310
             FF +G  P   N T +CL+P   N  L++  R I LC+V YK++ K +  RL+  +  ++
Sbjct  940   FFDSGIFPKEWNFTQLCLIPKKVNSSLMSDLRPISLCSVLYKVVAKIIMSRLQPLLSEIV  999

Query  1311  GPFQTSFVLGRQITNNVLVYQEVLNSLRS-KSGKGGLMVIKIDLEKAYDRLSWSFIRSTL  1487
              P Q++F+  R I++N+L+  E ++ LR+ K      M +K D+ KAYDR+ WS++ + +
Sbjct  1000  SPNQSAFIPERLISDNILIAHEAIHGLRTDKVIAKEFMAVKTDMSKAYDRMEWSYLEALM  1059

Query  1488  QKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSH  1667
                GF   W++ +M CV++    +  + +       +RG+RQGDPLSP LFVL  E L+H
Sbjct  1060  LGLGFHQRWVQLVMFCVTSVTYTVLINGQPFGIINPQRGLRQGDPLSPALFVLCAEGLTH  1119

Query  1668  LIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQR  1847
             L+ ++   G+  G++ + +GP I HL F DD +F  +AS  Q   ++K L+++  ++GQ 
Sbjct  1120  LLNKAESEGKIYGIQFSTEGPAIHHLLFADDSLFMIKASEDQGCALQKILSDYGEVTGQL  1179

Query  1848  LSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQ  2027
             ++  KS I F       ++  I++ LGI      G YLG+P      K +  + +  R++
Sbjct  1180  INLEKSSITFGAQVEQSLKTMIATRLGIFKEGGAGTYLGLPECFSGSKVEMLSYIHDRMK  1239

Query  2028  ARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGN  2207
              R++GW  RTLS  G+  L++SV  A+P + M    LP+     L      F W S++  
Sbjct  1240  GRMSGWFARTLSQGGKEILLKSVAMAMPVFAMTCFKLPKKTCENLSSAMSAFWWDSTENK  1299

Query  2208  RKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK-----  2372
             +K + ISW+K+   K  G LG + +   NQAL +K  W+++  +D L  +  +++     
Sbjct  1300  KKMHWISWEKLCLPKHAGGLGFKDIQIFNQALLSKQAWRVLQDKDCLFARFFKSRYFPDS  1359

Query  2373  ----VQLPSLPSQACQ--MYGRVFLSR--RQSF*KGAKS  2465
                   L   PS A +  ++GR  L R  RQ    GA +
Sbjct  1360  DFLSATLGYRPSYAWRSILHGRDLLKRGLRQMIGDGAST  1398


 Score = 75.9 bits (185),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 81/311 (26%), Positives = 139/311 (45%), Gaps = 26/311 (8%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             L F   +   G+ +L  SG  +TW  G    ++  ++LDR   N +W    P      LP
Sbjct  624   LPFSTMLKDCGMSELPSSGNGFTW-GGRRGTHWIQSKLDRCFANKDWVSCFPAANQAFLP  682

Query  394   MVNSYH-----TLGESR-----RFRFNAAW*THPNYQE*VSSTWK-SDVSLEANKS----  528
                S H     +L  S+      FRF+      P  +E +S  W+ S +S  A  S    
Sbjct  683   KRGSDHRPILVSLVSSQDLYRGSFRFDKRLLHKPGVKEAISMVWRQSAISAPAPVSQRIR  742

Query  529   NLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkld--likldrklrreldeil  702
             +  + L  W K    N    K +++A    +Q  L + Q          R L+ +L E  
Sbjct  743   DCRRVLSKWKKE---NEMNSKVKIIA----IQNELELVQSSSDPSASRLRSLKNKLVEAN  795

Query  703   YQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPF  882
              +EE  W  +SR++W++ GDRNT+F+HA+    +S + + +L+D  G          E  
Sbjct  796   KEEESHWQQKSRDKWMLEGDRNTKFFHASVKNLRSKNGLDKLQDPNGIVHRSEASKGEVA  855

Query  883   HAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSD  1059
              +++ +LFS  S   ++ + +   P +      ++ A  + ++++ AVF +   KAP +D
Sbjct  856   ASYFQNLFSTSSPVDIQAMLEGVTPRVTDVMNQSLLAKVSKEEVKNAVFSINPSKAPGAD  915

Query  1060  GFQTSFYQNSW  1092
             G    F+Q  W
Sbjct  916   GMTGMFFQQYW  926



>ref|XP_008393538.1| PREDICTED: uncharacterized protein LOC103455726 [Malus domestica]
Length=1401

 Score =   246 bits (629),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/426 (34%), Positives = 220/426 (52%), Gaps = 36/426 (8%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             TV   +IK    F+ +G +    N T + L+P +  P  + Q+R I LCNV YK++ K +
Sbjct  564   TVGKDVIKIVKAFWHSGTILRKLNHTNLVLIPKVKCPRNMTQYRPIALCNVIYKVIAKVL  623

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYD  1454
             T RLK+ M                                 K+G    M IK+D+ KAYD
Sbjct  624   TNRLKTVM--------------------------------PKTG----MAIKLDMAKAYD  647

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             R+ W F+ S + K GF+P +   I  C+ST+  +I  +   +   +  RG+R GDPLSP 
Sbjct  648   RVEWVFLLSMMAKLGFAPLFCNWIKECISTASFSILVNGNPTGLVLPXRGLRXGDPLSPY  707

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LF+L  E LS LI + +  G   G  ++  G  ISHLFF DD V FG AS+ +A  + + 
Sbjct  708   LFLLCTEGLSMLIRRGIDRGALHGXXVSANGTPISHLFFADDSVLFGHASVEEARGMVEV  767

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L  +   SGQ ++  KS IFF   TS  +++ I  ++GI   +  GRYLG+ S  G  K+
Sbjct  768   LRTYARGSGQAVNLSKSSIFFGSKTSNRVRKXIGRTMGIQCKSGFGRYLGLQSDFGHSKK  827

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
               + ++  R+++RL GW  + LS  G+  L+++V  A+P Y M    LP GV   LE+  
Sbjct  828   VVFEEVRDRLESRLAGWAEQFLSQAGKEVLVKAVAMAMPNYAMSCFKLPIGVCRDLEKAI  887

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
             R+F W  S+  +  + IS +++ + K  G  G + +   N A  AK+GW+L+     L  
Sbjct  888   RNFWWRGSEQRKXVHWISXERLMKQKRVGGXGFRDIQCFNXAFLAKIGWRLIQNPGSLLA  947

Query  2355  KIMEAK  2372
              +++ K
Sbjct  948   TVLQEK  953


 Score = 87.8 bits (216),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 69/303 (23%), Positives = 136/303 (45%), Gaps = 38/303 (13%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             F++++ +  L+DLG+ G  +TW     +   +  RLD  L  +EW+   P+  + H+ + 
Sbjct  286   FREFVAQNELMDLGFVGYPFTWRNNQEAKPIQ-QRLDMGLATMEWQDLYPENTIRHVVLE  344

Query  400   NSYHTLG----------ESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQLD  549
              S H L           + R+F ++A W T     +                   ++ + 
Sbjct  345   GSDHALLFLSTEKVKAWKGRKFSYDARWSTTEECPK-------------------AQGVK  385

Query  550   DWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQ-EELLWF  726
             DW +       R   +V+ ++    R+   Y   +      K++       ++ EE  W 
Sbjct  386   DWYRGR----GRNSKKVIEQLKEEIRT--AYMSTEFASEVVKMKERELRAAHRNEEAYWR  439

Query  727   *RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLF  906
              +SR +W+  GD+N++F+HA T  R+  + ++ L+D  G W  D   I     +++  LF
Sbjct  440   VKSRAQWLKEGDKNSKFFHAQTLKRRRFNQIKGLEDVNGVWQEDEAAISSIATSYFEVLF  499

Query  907   SEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSFYQ  1083
                S   ++++ +   P +     +A+ A  T ++++ AVF++   +AP  DG+   FYQ
Sbjct  500   KSSSPGXIDEIGECLAPRVTAEDNIALTAAVTEEEIKTAVFQIPPIRAPGPDGYSGCFYQ  559

Query  1084  NSW  1092
             + W
Sbjct  560   DHW  562



>ref|XP_010418618.1| PREDICTED: uncharacterized protein LOC104704191 [Camelina sativa]
Length=1833

 Score =   258 bits (660),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 148/459 (32%), Positives = 247/459 (54%), Gaps = 14/459 (3%)
 Frame = +3

Query  1131  FFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLI  1310
             FF +G  P   N T +CL+P   N  L++  R I LC+V YK++ K +  RL+  +  ++
Sbjct  940   FFDSGIFPKEWNFTQLCLIPKKVNSSLMSDLRPISLCSVLYKVVAKIIMSRLQPLLSEIV  999

Query  1311  GPFQTSFVLGRQITNNVLVYQEVLNSLRS-KSGKGGLMVIKIDLEKAYDRLSWSFIRSTL  1487
              P Q++F+  R I++N+L+  E ++ LR+ K      M +K D+ KAYDR+ WS++ + +
Sbjct  1000  SPNQSAFIPERLISDNILIAHEAIHGLRTDKVIAKEFMAVKTDMSKAYDRMEWSYLEALM  1059

Query  1488  QKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSH  1667
                GF   W++ +M CV++    +  + +       +RG+RQGDPLSP LFVL  E L+H
Sbjct  1060  LGLGFHQRWVQLVMFCVTSVTYTVLINGQPFGIINPQRGLRQGDPLSPALFVLCAEGLTH  1119

Query  1668  LIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQR  1847
             L+ ++   G+  G++ + +GP I HL F DD +F  +AS  Q   ++K L+++  ++GQ 
Sbjct  1120  LLNKAESEGKIYGIQFSTEGPAIHHLLFADDSLFMIKASEDQGCALQKILSDYGEVTGQL  1179

Query  1848  LSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQ  2027
             ++  KS I F       ++  I++ LGI      G YLG+P      K +  + +  R++
Sbjct  1180  INLEKSSITFGAQVEQSLKTMIATRLGIFKEGGAGTYLGLPECFSGSKVEMLSYIHDRMK  1239

Query  2028  ARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGN  2207
              R++GW  RTLS  G+  L++SV  A+P + M    LP+     L      F W S++  
Sbjct  1240  GRMSGWFARTLSQGGKEILLKSVAMAMPVFAMTCFKLPKKTCENLSSAMSAFWWDSTENK  1299

Query  2208  RKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK-----  2372
             +K + ISW+K+   K  G LG + +   NQAL +K  W+++  +D L  +  +++     
Sbjct  1300  KKMHWISWEKLCLPKHAGGLGFKDIQIFNQALLSKQAWRVLQDKDCLFARFFKSRYFPDS  1359

Query  2373  ----VQLPSLPSQACQ--MYGRVFLSR--RQSF*KGAKS  2465
                   L   PS A +  ++GR  L R  RQ    GA +
Sbjct  1360  DFLSATLGYRPSYAWRSILHGRDLLKRGLRQMIGDGAST  1398


 Score = 75.9 bits (185),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 81/311 (26%), Positives = 139/311 (45%), Gaps = 26/311 (8%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             L F   +   G+ +L  SG  +TW  G    ++  ++LDR   N +W    P      LP
Sbjct  624   LPFSTMLKDCGMSELPSSGNGFTW-GGRRGTHWIQSKLDRCFANKDWVSCFPAANQAFLP  682

Query  394   MVNSYH-----TLGESR-----RFRFNAAW*THPNYQE*VSSTWK-SDVSLEANKS----  528
                S H     +L  S+      FRF+      P  +E +S  W+ S +S  A  S    
Sbjct  683   KRGSDHRPILVSLVSSQDLYRGSFRFDKRLLHKPGVKEAISMVWRQSAISAPAPVSQRIR  742

Query  529   NLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkld--likldrklrreldeil  702
             +  + L  W K    N    K +++A    +Q  L + Q          R L+ +L E  
Sbjct  743   DCRRVLSKWKKE---NEMNSKVKIIA----IQNELELVQSSSDPSASRLRSLKNKLVEAN  795

Query  703   YQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPF  882
              +EE  W  +SR++W++ GDRNT+F+HA+    +S + + +L+D  G          E  
Sbjct  796   KEEESHWQQKSRDKWMLEGDRNTKFFHASVKNLRSKNGLDKLQDPNGIVHRSEASKGEVA  855

Query  883   HAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSD  1059
              +++ +LFS  S   ++ + +   P +      ++ A  + ++++ AVF +   KAP +D
Sbjct  856   ASYFQNLFSTSSPVDIQAMLEGVTPRVTDVMNQSLLAKVSKEEVKNAVFSINPSKAPGAD  915

Query  1060  GFQTSFYQNSW  1092
             G    F+Q  W
Sbjct  916   GMTGMFFQQYW  926



>ref|XP_010238942.1| PREDICTED: uncharacterized protein LOC100831270 [Brachypodium 
distachyon]
Length=1468

 Score =   303 bits (777),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 157/409 (38%), Positives = 238/409 (58%), Gaps = 1/409 (0%)
 Frame = +3

Query  1149  LPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTS  1328
             +P   NDT I L+P I NP  +  FR I LCNV YK++ K +  RL+  +  +I P Q++
Sbjct  1     MPPDVNDTAIVLIPKIKNPRSLKDFRPISLCNVVYKIIAKCLVNRLRPLLNDIISPTQSA  60

Query  1329  FVLGRQITNNVLVYQEVLNSL-RSKSGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFS  1505
             FV GR IT+N ++  E + +L ++KS KG     K DL KAYDR+ W ++R  L K GF 
Sbjct  61    FVPGRMITDNAIIAFECIFALQKNKSDKGKYCAYKFDLAKAYDRVDWEYLRGALVKLGFH  120

Query  1506  PDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSV  1685
               W+  IM CV +   ++ F+  L + F   RG+RQGDPLSP LF+L  E LS  I+   
Sbjct  121   SRWVNWIMECVCSVSYSVRFNGNLLEKFNPSRGLRQGDPLSPYLFLLVAEGLSASIQSKT  180

Query  1686  KNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS  1865
              +G  + +KI +  P ISHL F DD + F +A+++QA V+K+ L+ F + +GQ LS  K 
Sbjct  181   ASGMLEDLKICKNSPGISHLLFADDSLLFFKANMNQAVVIKEILSNFEAGTGQLLSPQKC  240

Query  1866  *IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGW  2045
              I        +    + + LGI  V    +YLG+P   GRLK   +  L  RI  +L  W
Sbjct  241   SILLGNMVDTQDGAKVVTLLGIQNVGFEEKYLGLPVPEGRLKNGKFQSLKERINKKLNDW  300

Query  2046  KNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLI  2225
               + LS  G+  +I+SV+ AIP Y+M    LP  +   LE+L+R+F WG  +  +K + +
Sbjct  301   TEKYLSAAGKEVMIKSVIQAIPAYSMSVFKLPANLCEDLEQLTRNFWWGDEENKKKVHWL  360

Query  2226  SWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
             +W K+ + K++G +G + L   NQA+ A+  W+L+ + D LCV+++ +K
Sbjct  361   AWDKLLKPKNRGGVGFRDLRVFNQAMLARQAWRLIERPDSLCVRVLRSK  409



>ref|XP_010058710.1| PREDICTED: uncharacterized protein LOC104446568 [Eucalyptus grandis]
Length=1356

 Score =   303 bits (775),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/420 (35%), Positives = 250/420 (60%), Gaps = 1/420 (0%)
 Frame = +3

Query  1092  GTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKA  1271
               +K ++I+   +FF TG +P   N T+I L+P + +P  + Q+R I LCN +YK+++K 
Sbjct  488   NVIKTTVIQTVQEFFHTGCMPPRLNRTIIALIPKVQHPESIEQYRPISLCNFAYKIISKI  547

Query  1272  MTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGL-MVIKIDLEKA  1448
             M  RLK  + +LI   Q +F+  RQI +N++V QEV++  + ++ K    +++K D++KA
Sbjct  548   MANRLKPWLSILISKEQAAFINDRQIQDNIMVVQEVMHQFKVRACKKRFNLILKTDMQKA  607

Query  1449  YDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLS  1628
             YDR+ W F+ + L++ GF+  W+  +M+CV+T   +I F+     +F   RG+RQGDPLS
Sbjct  608   YDRVEWDFLEAYLKRLGFNDSWVTRVMACVTTVSFSIRFNGEPLPYFKPTRGLRQGDPLS  667

Query  1629  PLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVK  1808
             P LF+L    LS  + Q++  G  KG++  R  P +SHLFF DD VFF  A++ +   + 
Sbjct  668   PYLFILLANALSTTLTQAMAMGHIKGIQFNRDCPKLSHLFFADDSVFFLRATISECQNLA  727

Query  1809  KCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRL  1988
               LN++C  +GQ ++  KS +FFSK+  + +Q  ++  L +PI++  G+YLG+PS  GR 
Sbjct  728   NLLNQYCFATGQLINRNKSGVFFSKHCPISLQHNLAQELRVPIISKYGKYLGIPSDWGRS  787

Query  1989  KQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLER  2168
             K++ ++ +++R+ A+L GW+ + LS  G+  L++SV+ A+  Y M    LP  +   +ER
Sbjct  788   KREMFSWILARVNAKLAGWQEQFLSKSGKEILLKSVIQALLQYAMSLFKLPLSLCRLIER  847

Query  2169  LSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGL  2348
                 F W     +   +  +W ++  SK  G +G + L   N A+  K  W+L+ +   +
Sbjct  848   KISAFWWSKHNSHSGIHWKNWSELKLSKVSGGMGFRDLINFNTAMLGKQAWRLLQQPQAI  907


 Score = 61.6 bits (148),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 86/209 (41%), Gaps = 19/209 (9%)
 Frame = +2

Query  2789  VWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRN-LPEDIDHIMQR  2965
             +W  I  +    +IR FLWLA  +   T     +R      +C +C N +PE I+H+   
Sbjct  1066  LWRKIWHMCTAPKIRVFLWLACKNAIATQHNLYQRHIIPHPYCSLCNNSVPESIEHLFFF  1125

Query  2966  CPIANSVWESLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWRN  3145
             CP  N +W      + R        + FD  I + +S  +   +    A  +W +W+ RN
Sbjct  1126  CPWTNDIWNH---EEIRVKISPTSVSRFDAWIVDRASLPQASPEFEVVAHILWEIWRQRN  1182

Query  3146  DLVFSGTNINLAARIKWIRDQVEEINI------SFSKAKGLIAPIESICWRQLKWIRPQV  3307
             + VF     +    ++ + D + +  I      S  K K  +  +E       +W  P  
Sbjct  1183  NAVFRQIPPD---PLQVVNDALTQTTIFKVLQPSPQKIKNKLVSLEQ------RWKPPAE  1233

Query  3308  GWVKANIDGSSIPSNSIARCGGFIRDDQG  3394
             G++K NIDG+    +         RD +G
Sbjct  1234  GYIKCNIDGAYRKESETGTITCIYRDSKG  1262



>ref|XP_009102778.1| PREDICTED: uncharacterized protein LOC103828890 [Brassica rapa]
Length=1302

 Score =   247 bits (631),  Expect(3) = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/438 (34%), Positives = 220/438 (50%), Gaps = 51/438 (12%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             KF   VK+ L    + F   G + +G NDT ICL+P I  P  + QFR I LCNVSYK++
Sbjct  468   KFWDIVKEDLTLMVNQFLFEGTMASGLNDTNICLIPKITKPNAMAQFRPISLCNVSYKII  527

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDL  1439
             +K +  RLK  +  LI   Q++FV GRQI++N+++ QE+ ++LR+K SG+   M IK D+
Sbjct  528   SKVLCQRLKKVLPGLISETQSAFVAGRQISDNIMIAQEMFHALRTKPSGRNKRMAIKTDM  587

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ WSFI + ++K GFS  WI  IM C+S+ +  +  +       +  RG+RQGD
Sbjct  588   RKAYDRMEWSFIEAVMRKMGFSEIWIAWIMRCISSVKYKVLMNGEPRGNIVPGRGLRQGD  647

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP +F+L  E L+ L+  +   G+  GM++TR  P                       
Sbjct  648   PLSPFIFILCTEALASLLNHAESQGKITGMRVTRACP-----------------------  684

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
                                       S+ T+   +Q I   LGI     +G YLG+P   
Sbjct  685   --------------------------SRITATS-RQEIKDVLGIQNEGGMGTYLGIPEDI  717

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
                K   +A L  ++  R+ GW  R LS  G+  LI+S+L A+P Y M + LLP  +   
Sbjct  718   SGSKCKLFAFLKDKLMHRVNGWTGRWLSKGGKEVLIKSILLALPTYVMSTFLLPLEICEN  777

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             L      F W S+   R  +   W+KV   +++G +G + +   N AL AK  W+L+   
Sbjct  778   LASAIAKFWWSSNPPKRGIHSAKWEKVCLPREEGGMGFRMIHEFNLALLAKQLWRLVQFP  837

Query  2340  DGLCVKIMEAKVQLPSLP  2393
             D L  +++  +    S P
Sbjct  838   DSLVARVLRGRYYKMSSP  855


 Score = 84.3 bits (207),  Expect(3) = 2e-81, Method: Compositional matrix adjust.
 Identities = 73/316 (23%), Positives = 139/316 (44%), Gaps = 35/316 (11%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             L F+  +   G+++  ++G   +W+   +  +    RLDRA+ N +W  + P   V ++ 
Sbjct  167   LPFKQMLHDCGMLEFPFTGDMLSWVGKRAGGSTVRCRLDRAVGNADWHEKFPHSAVKYMR  226

Query  394   MVNSYH----------TLGESRRFRFNAAW*THPNYQE*VSSTWKS-----DVSLEANKS  528
             +  S H           +  S++F+F+  W  +   ++ +   WKS     + ++  + S
Sbjct  227   LWGSDHRPILADILIKPMRRSKKFKFDKRWLDNEELRQVILEGWKSPDLPPNATIMEHIS  286

Query  529   NLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQ  708
             +  K L +W K    N  +    +  ++ G+      Y   +    +     +      +
Sbjct  287   SCRKALSEWRKQHNVNSAKLVEELKEKVEGL------YADDNATTEEIAAALKELSDALK  340

Query  709   -EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFH  885
              EE+ W  +SR  W+  GDRNT+F+HA T  R++ + + +L D  G  + D +G++    
Sbjct  341   AEEMFWKQKSRVFWLREGDRNTKFFHALTKQRRARNKITQLLDENGNIVEDEEGLVAIAT  400

Query  886   AFYMDLFSEDSTTQLEDLNDAF--FPPLHTSQWLAINAHFTVKDLE-----AVFEMAQFK  1044
             +++  +F    ++  ED+ +A    P   T    A+N +      E     A+F M   K
Sbjct  401   SYFRQIF---ESSNPEDIEEALAQVPSTITG---AMNDNLIAPVTEWEVKLALFAMHPEK  454

Query  1045  APSSDGFQTSFYQNSW  1092
             AP  DG    FYQ  W
Sbjct  455   APGPDGMTALFYQKFW  470


 Score = 23.5 bits (49),  Expect(3) = 2e-81, Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 19/41 (46%), Gaps = 0/41 (0%)
 Frame = +2

Query  2390  AKSGMSNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             + S  S VW  I  +  +LL G ++ + +      W D WI
Sbjct  860   SASNPSYVWSSISAARKLLLTGIRQKIHSGYEVKVWEDPWI  900



>emb|CCA66140.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1381

 Score =   252 bits (644),  Expect(3) = 3e-81, Method: Compositional matrix adjust.
 Identities = 151/432 (35%), Positives = 233/432 (54%), Gaps = 5/432 (1%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             TVK  +      F  +  LP GCN   I L+  I NP   N +R I +    YK++ K +
Sbjct  462   TVKSDIYAMVRKFHDSSTLPQGCNIAYITLIQKIDNPKNFNDYRPISMVGCIYKIIAKLL  521

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYD  1454
               RL+  +  LIGP Q S++ GR I +  L+  E+++  + KS +  L+  K+D  KAYD
Sbjct  522   ARRLQGVINSLIGPLQFSYIEGRSILDGALIASELIDHCKRKSIEAALL--KLDFHKAYD  579

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
              +SWSF+   L++  F   W + IM+CVST+ ++I  +      F L+RG+RQGDPLS  
Sbjct  580   SISWSFLEWVLKEMNFPDQWCKWIMNCVSTAAVSILVNGSPCAPFKLQRGLRQGDPLSSF  639

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LFVL  E L+ +I ++     WKG+++ +    ++HL + DD + F +A++     VKK 
Sbjct  640   LFVLIAESLNQIIMKATSQNLWKGVEVGQGEIIVTHLQYADDTLIFCDANIESLKNVKKA  699

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L  F   SG ++++ KS      NTS    +  + +L   I      YLGVP I G+  +
Sbjct  700   LILFQLASGLQINFHKS-SLIGLNTSSGWIKVAAEALLCKIGEIPFTYLGVP-IGGQCSR  757

Query  1995  DSYAD-LMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERL  2171
                 D ++++I  RL  WK + LS  GR TLI+S L ++P Y M    +PQ V++++  L
Sbjct  758   IQLWDPIIAKISRRLATWKCKMLSIGGRLTLIKSSLISLPVYFMSIYPMPQDVVNKIIGL  817

Query  2172  SRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLC  2351
             +R FLW  S G     L++W  +   K  G +GI  +   NQAL  K  W+L ++   L 
Sbjct  818   ARQFLWAGSDGKNAMPLVAWSVLQLPKSLGGMGIGNIKHKNQALLFKWIWRLFDEPSQLW  877

Query  2352  VKIMEAKVQLPS  2387
              KI+ AK + P+
Sbjct  878   CKIIRAKYKYPN  889


 Score = 69.7 bits (169),  Expect(3) = 3e-81, Method: Compositional matrix adjust.
 Identities = 77/312 (25%), Positives = 135/312 (43%), Gaps = 36/312 (12%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVL-----  384
             F+D++    L+++  S   +TW +G S      + LDR   N EW I  P +++      
Sbjct  164   FRDFVQNLQLLEIPSSSGGFTWFRGNSK-----SLLDRLFINPEWLILFPGLKLSLLMRG  218

Query  385   ---HLPMV--NSYHTLGESRRFRFNAAW*THPNYQE*VSSTWK--SDVSLEANKSNLSKQ  543
                H P++  N     G  + FRF   W + PN  + V   W+  S VS       + K+
Sbjct  219   LSDHCPLLVHNEDKNWGP-KPFRFQNCWLSDPNCLKIVKEVWQASSGVSAVGKLKAVRKR  277

Query  544   LDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQE----  711
             L  WN+   GNI         RIS ++  +  Y ++   ++  +   E  +    E    
Sbjct  278   LKVWNQEEYGNIDN-------RISKMENLIQQYDEISNQRILTEDELEEKQKAQVELWKW  330

Query  712   ----ELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEP  879
                 E+ W   +R  W+  GDRNTRF+H   + ++  +++  ++   G+   D   I   
Sbjct  331   MKRREVYWAQNARISWLKEGDRNTRFFHTIASNKRRKNSIICIEVK-GKESGDPQIIKRE  389

Query  880   FHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSS  1056
               + +  +F+E++  +        F  +   Q   +   F+ K++ EAV   A  KAP  
Sbjct  390   AVSHFKKIFAENNYNR-PTFKGLSFRQITDDQASDLTQPFSNKEIDEAVSSCAADKAPGP  448

Query  1057  DGFQTSFYQNSW  1092
             DGF   F +++W
Sbjct  449   DGFNFRFIKSAW  460


 Score = 32.7 bits (73),  Expect(3) = 3e-81, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 21/30 (70%), Gaps = 1/30 (3%)
 Frame = +2

Query  2447  LKGSKKLVKNDRSTLFWLDSWIGKQATLLS  2536
             +KG +K VKN   +LFW D WIG +ATL S
Sbjct  923   IKGVRKNVKNGHDSLFWHDVWIG-EATLKS  951



>ref|XP_010674186.1| PREDICTED: uncharacterized protein LOC104890406 [Beta vulgaris 
subsp. vulgaris]
Length=1667

 Score =   255 bits (651),  Expect(3) = 3e-81, Method: Compositional matrix adjust.
 Identities = 153/432 (35%), Positives = 237/432 (55%), Gaps = 5/432 (1%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             T+K  + +   +F  +  LP GCN   I L+P    P     +R I +    YK++ K M
Sbjct  748   TIKTEVYEMVREFQKSSRLPRGCNTAFITLIPKCDMPKEFKDYRPISMVGCMYKIIAKLM  807

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYD  1454
               RL+  M  L+GP Q+S++ GRQI +  L+  E++++ + K+ +  L+  K+D  KAYD
Sbjct  808   ARRLQKVMHHLVGPLQSSYIEGRQILDGALIASELIDTCKRKNIEAALL--KLDFHKAYD  865

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
              +SW F+   L+K  F   W + IM+CVS++ ++I  +   S+ F L+RG+RQGDPLSP 
Sbjct  866   SVSWQFLGWILEKMNFPSQWCKWIMACVSSASVSILINGSPSEPFKLQRGLRQGDPLSPF  925

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LFVL VE L+ LI+++     W G++I +    I+HL + DD + F +A+L+    VKK 
Sbjct  926   LFVLIVEALNQLIKKATTLSLWNGIEIPQSNVKITHLQYADDTLIFCDANLNSLINVKKM  985

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L  F   SG ++++ KS      N+S E  QA +++L   I      YLG+P I G +  
Sbjct  986   LILFQLASGLQVNFHKS-SLIGINSSHERVQAAANALLCKIGCVPFTYLGLP-IGGNISS  1043

Query  1995  -DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERL  2171
                +  ++S+I  RL  WK + LS  GR TLI+S LS++P Y M    +P GV+ ++ +L
Sbjct  1044  IQLWEPVISKITKRLASWKGKMLSIGGRLTLIKSSLSSLPLYYMSIYPIPMGVIQKIIKL  1103

Query  2172  SRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLC  2351
             SR FLW           +SWK     K  G LGI  +   N AL  K  W+  +      
Sbjct  1104  SRSFLWNGDSEKLALAPVSWKVAQLPKALGGLGIGNILHKNLALLFKWFWRYFDDSSLPW  1163

Query  2352  VKIMEAKVQLPS  2387
              ++++AK + PS
Sbjct  1164  CQVIKAKYKYPS  1175


 Score = 67.0 bits (162),  Expect(3) = 3e-81, Method: Compositional matrix adjust.
 Identities = 71/311 (23%), Positives = 128/311 (41%), Gaps = 34/311 (11%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVL-----  384
             F++++    L+++  S   YTW +G S      + LDR   N EW    P + +      
Sbjct  450   FRNFLQELHLMEISSSSRGYTWFRGNSK-----SILDRLFVNPEWITTFPSLSLALLQRG  504

Query  385   ---HLPMVNSYHTLGE--SRRFRFNAAW*THPNYQE*VSSTW--KSDVSLEANKSNLSKQ  543
                H P++ +Y  L     + FRF   W T P   + +   W   S   +      +  +
Sbjct  505   LSDHCPLL-AYSKLRNFGPKPFRFQNFWLTDPKCLKIIKEAWVNSSSSCVGEKLKGVKAK  563

Query  544   LDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilY-----Q  708
             L  WN    GNI       ++R+  + +SL        ++      ++           +
Sbjct  564   LKQWNHDDFGNIDSN----ISRLENIIQSLDALSNQRDLEEAELEEKKGATADLWMWMKR  619

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
              E+ W   SR  W+  GDRNT+F+H   + ++  +++  +  N G+ I D   + +    
Sbjct  620   REVYWAQNSRVAWLKDGDRNTKFFHTVASNKRRKNSISSIMVN-GKTIEDPSMLKKEAAT  678

Query  889   FYMDLFSED--STTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSD  1059
             F+  +F E+  +    E L    F  L   Q + +   F+ ++++ AV      KAP  D
Sbjct  679   FFKSIFKEEWKNRPIFEGLE---FNCLSQEQAMELTQPFSNEEIDSAVSSCDSNKAPGPD  735

Query  1060  GFQTSFYQNSW  1092
             GF   F + +W
Sbjct  736   GFNFKFIKAAW  746


 Score = 32.3 bits (72),  Expect(3) = 3e-81, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 2/34 (6%)
 Frame = +2

Query  2441  ILLKGSKKLVKNDRSTLFWLDSWIGKQATLLSRI  2542
             + +KG +K+V N  S LFW DSWI  +A+ L  I
Sbjct  1207  VAIKGVRKIVNNGMSCLFWHDSWI--EASPLKHI  1238



>ref|XP_009146506.1| PREDICTED: uncharacterized protein LOC103870148 [Brassica rapa]
Length=1206

 Score =   269 bits (688),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 152/461 (33%), Positives = 241/461 (52%), Gaps = 12/461 (3%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             K+ G + D +       F +G +P   N T +CL+P I NP L+   R I LC+V YK +
Sbjct  290   KYWGILGDQVTSEIQQVFCSGTMPREWNLTYLCLLPKISNPDLMTDLRPISLCSVLYKAV  349

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDL  1439
              K +  R +  +  ++   Q++FV  R I++N+++  E +++L+         M +K D+
Sbjct  350   AKILVKRFQPHLHSIVSVNQSAFVRDRVISDNIIIAHEAVHALKGHPQISKEFMTVKTDM  409

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ WS++RS L   GF    ++ +M CV+T   ++  +         +RGIRQGD
Sbjct  410   SKAYDRVEWSYLRSLLAALGFDNRVVQWVMMCVTTVTYSVLINDHPFGLITPQRGIRQGD  469

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LFVL  E L+HL+    +NG   GM+    GP I HL F DD +F  +AS  QA+
Sbjct  470   PLSPFLFVLCTEGLTHLLNVVERNGLLDGMQFASDGPSIHHLLFADDSLFMCKASHDQAT  529

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             V+ + L  +   +GQ ++  KS I F      E +  +   +GI       +YLG+P   
Sbjct  530   VLNRILQYYGKATGQTINLQKSSISFGNMVGEETRAQVRVIMGIVSEGGTSKYLGLPECF  589

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
                K D  + +  R QARL  W  R +S  G+  L++S +  +P + M    LP+ V ++
Sbjct  590   SGSKVDMLSFIKDRSQARLDSWYLRQISPGGKEILLKSTVGGMPVFAMSVFRLPKTVTAK  649

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             +  +  ++ WG     RK + I+W K+   KD+G +G + L+  NQAL AK GWK++N  
Sbjct  650   ISSMMANYWWGDDSNKRKIHWIAWDKLCLPKDRGGIGFRDLECFNQALLAKQGWKILNAP  709

Query  2340  DGLCVKIMEA---------KVQLPSLPSQACQ--MYGRVFL  2429
             D L  + +++            L S PS A +  ++GR  L
Sbjct  710   DCLLSRFLKSIYFNNGDFLSATLGSRPSYAWRSILFGRELL  750


 Score = 63.5 bits (153),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 75/302 (25%), Positives = 135/302 (45%), Gaps = 32/302 (11%)
 Frame = +1

Query  253   DLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEW------------KIRSPDVEVLHLPM  396
             +L  SG  +TW  G     +    LDR+  N  W            + R  D   + L +
Sbjct  3     ELSSSGDRFTW-AGKRWEKWIRCCLDRSFGNKAWLEIFPGSNQTFMEKRGSDHRPVWLKL  61

Query  397   VNSYHTLGESRR--FRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQLDDWNKHTI  570
              +S+    E RR  FRF+  +   P+ ++ +S  W +     A  +N+++++   N  +I
Sbjct  62    CDSH----EDRRGLFRFDKRFLRRPDIEKEISEVWSNQ--HHAAGTNVAQKIR--NCRSI  113

Query  571   GNIFRRK*RVLAR--ISGVQRSLSVYQkldlikl-drklrreldeilYQE-ELLWF*RSR  738
              + ++RK    A+  I  +Q  L  +Q           L      + Y+E EL W  +SR
Sbjct  114   LSRWKRKENFNAKDKIRSLQLRLEWFQSKPYPCRFMVDLITRDLLLAYKEDELFWKQKSR  173

Query  739   EEWIVSGDRNTRFYHAATAVRKSASTVRRLKD--NFGEWISDGDGILEPFHAFYMDLFSE  912
             ++W+V GDR+++F+H +    +S + + +LKD  N  +W SDG    E    ++ +LF  
Sbjct  174   DKWLVFGDRSSKFFHDSVKTNRSKNQLLKLKDKNNHDQW-SDG-AKAEVAVEYFSELFKS  231

Query  913   DSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSFYQNS  1089
              + T  E   ++F P +       +    +  ++  A+F +    AP  DG   +F+Q  
Sbjct  232   SNPTSYEPAFESFLPRVSGEMNEQLTRQISKDEVTLAIFSICADSAPGPDGMTATFFQKY  291

Query  1090  WA  1095
             W 
Sbjct  292   WG  293


 Score = 55.8 bits (133),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/198 (25%), Positives = 81/198 (41%), Gaps = 12/198 (6%)
 Frame = +2

Query  2825  RIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCPIANSVWE-SLI  3001
             ++R F+W A  D    +     RG   +  C  C +  E I+H++  CP A  VW  S I
Sbjct  888   KLRIFIWRALSDALPVSDLIIGRGMKIDGRCQTCGDEGESINHLIFLCPFARQVWVLSPI  947

Query  3002  PYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWRNDLVFSGTNIN-L  3178
             PY             F+   +   S N + E+   +   +W +WK RN  +F     N L
Sbjct  948   PYPREGFSTSSVFANFEFLFNIRKSRNVQSEEGRVWPWVVWNIWKRRNGFLFENRCYNPL  1007

Query  3179  AARIKWIRDQVE-----EINISFSKAKGLIAPIESICWRQLKWIRPQVGWVKANIDGSSI  3343
                 K +RD  E      I   + +   +  P+      + +W  P+ GW   N+  +  
Sbjct  1008  EVSAKAVRDAEEWFVAQSIEKEWKELDKITPPVP-----ERRWFPPKPGWKMCNVGFTFD  1062

Query  3344  PSNSIARCGGFIRDDQGC  3397
              +  IA  G  +R+++G 
Sbjct  1063  GNKKIAGGGWVLRNERGV  1080



>gb|KDP39672.1| hypothetical protein JCGZ_02692 [Jatropha curcas]
Length=320

 Score =   280 bits (715),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 141/310 (45%), Positives = 200/310 (65%), Gaps = 3/310 (1%)
 Frame = +3

Query  1284  LKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDRLS  1463
             +KS +  LI P Q SFV GRQ+ +NV+V Q+V+ S   KSG  G M++KIDLEKAYDRL 
Sbjct  1     MKSLLPKLISPSQASFVPGRQLRDNVIVLQKVVPS---KSGSNGWMILKIDLEKAYDRLR  57

Query  1464  WSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFV  1643
             WSFI  +L+ AGF   WI  IM C+    + + ++   S+ F   RGIRQGDP+SP LFV
Sbjct  58    WSFIEDSLRLAGFPEPWISIIMKCLEACSMRVLWNGIPSESFHPSRGIRQGDPISPYLFV  117

Query  1644  LYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNE  1823
             L +ERL H I Q+V +  W+ + I R+ P ISHLFF D+L+ F +AS+ Q +VV +CL +
Sbjct  118   LAMERLGHCISQAVSDKCWRPISIPRQAPAISHLFFADELLLFAKASVDQIAVVNQCLQQ  177

Query  1824  FCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSY  2003
             F +LSGQR++  KS IFFS N  + ++  I S+ GI +  D+G YLGVP  +GR+ + ++
Sbjct  178   FDNLSGQRVNMAKSKIFFSANVDMPLRTHICSTAGISLTEDIGVYLGVPIFNGRVTKSAF  237

Query  2004  ADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDF  2183
               ++S+I A L GWK + LS  G  TL + VL A+P + MQS  +P+ V    ++  R+F
Sbjct  238   DSMLSQIDAHLAGWKVQYLSLAGHVTLARPVLIALPNHVMQSVYIPRVVSDEFDKWVRNF  297

Query  2184  LWGSSKGNRK  2213
             + G   G + 
Sbjct  298   VLGGPSGEKN  307



>ref|XP_010687808.1| PREDICTED: uncharacterized protein LOC104901884 [Beta vulgaris 
subsp. vulgaris]
Length=1208

 Score =   277 bits (708),  Expect(3) = 4e-81, Method: Compositional matrix adjust.
 Identities = 152/431 (35%), Positives = 240/431 (56%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             K+   V +S+ +    FF +G +    N T I L+P I NP   N FR I LC+  YK++
Sbjct  343   KYWSLVGNSVFRAIKAFFHSGKILKEINHTFITLIPKIDNPSNPNHFRPISLCSTIYKII  402

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLE  1442
              K +  RLK  +  +I P Q +FV  R I +NVL+  EV +S ++K G  G + IK+D+E
Sbjct  403   AKILANRLKVVLGKIIHPLQGAFVPERLIQDNVLLAHEVFHSFKNKKGASGWLAIKLDME  462

Query  1443  KAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDP  1622
             KAYDRL W +I  TL+K GF   W+  +  C++T   ++  +    + F+ +RGIRQGDP
Sbjct  463   KAYDRLEWKYIFITLEKLGFCARWVDWLRQCITTVSFSVLVNGIPGETFVPQRGIRQGDP  522

Query  1623  LSPLLFVLYVERLSHLIEQ-SVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             LSP +F+L  E L+  ++  S+   +  G+ +   G  I  L F DD + F +AS     
Sbjct  523   LSPYIFILCAEILARQLQHASLMGSRSLGVTLGHSGVRIPFLTFADDTMIFAKASEESCI  582

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              +K  L+++C++SGQ +++ KS    ++N S  +    +  L +     LG+YLG P I 
Sbjct  583   TIKAILDKYCNMSGQLINFHKSAYQCTQNVSDNVSANFAEILQMDKSFSLGKYLGCPIID  642

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
              ++   ++A+L  ++ ++LT WK  +LS  GR+ L+QS L+    Y MQS  LP  +LS 
Sbjct  643   SKVTNATFAELQEKVCSQLTKWKANSLSQAGRTILVQSNLATKANYQMQSFSLPPAILSS  702

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             L++   +F W  +   +  NLI W K+   K  G LG+++    N AL  KL WK++   
Sbjct  703   LDKCYINFFWNKASDAKSPNLIGWDKICSPKKFGGLGLRKAKANNNALQFKLLWKILESP  762

Query  2340  DGLCVKIMEAK  2372
             D L V+++  K
Sbjct  763   DNLWVQLVTRK  773


 Score = 42.0 bits (97),  Expect(3) = 4e-81, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 54/118 (46%), Gaps = 9/118 (8%)
 Frame = +1

Query  760   DRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTTQLEDL  939
             D NT++YH+   +R++ + +  + D  G  IS    I E F   +   F+ + +    D 
Sbjct  232   DANTKYYHSCATIRRNRNILSSISDQQGVAISHPLKIEECFTEAFKQRFTSNESCGF-DA  290

Query  940   NDAFFPPLHTSQWLAINAHFTVKDL------EAVFEMAQFKAPSSDGFQTSFYQNSWA  1095
             N  F   L T      +  +  +D+      EA F++A  KAP  DG+   F+Q  W+
Sbjct  291   NVDF--DLLTEIISDNDNAYLCRDVTYEEVKEATFDLAPDKAPGPDGYSPFFFQKYWS  346


 Score = 35.0 bits (79),  Expect(3) = 4e-81, Method: Compositional matrix adjust.
 Identities = 52/240 (22%), Positives = 83/240 (35%), Gaps = 65/240 (27%)
 Frame = +2

Query  2393  KSGMSNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQATLLSRIRYDPFDRVIR  2572
             K+ +S  W+ ++       KG + +V N     FW D+WI   A L  +         ++
Sbjct  786   KANVSWQWRRLMSLRSTFKKGLRWIVGNGDQVSFWFDNWIFNTA-LDEKCLVPRGSEALK  844

Query  2573  *SL*V--------------LGPRIGVAVGETFEPAS------------*GVLEYVGGVQL  2674
              S  +              +   I   +   F P++             G+     GV+L
Sbjct  845   VSFFINQDGHWNVALLRQYVPAEIATLIANYFLPSNLCHDKRIWGLTPHGIYSVKSGVEL  904

Query  2675  IR*L*A*KWPGLGRGLFW*ILC*INL*HYSRGLSTYRRVWNYI*SLKVPYRIRTFLWLAR  2854
             ++        GL               H  R  S +  +W     L +P +I+ FLW   
Sbjct  905   LQ--------GLN--------------HQIRAPSPFGWIW----KLSIPPKIKFFLWKVC  938

Query  2855  HDCHMTNTKRARRGFTSEVF----CGICRNLPEDIDHIMQRCPIANSVWESLIPYDHRRL  3022
             H+         +R   S VF    C  C    EDIDH+  +CP    V+  L    H+ L
Sbjct  939   HN----GIPTKKRLELSHVFLPLECVFCNFHSEDIDHLFSKCPFTQDVFLEL----HQHL  990



>ref|XP_007017131.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
 gb|EOY14356.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
Length=2251

 Score =   248 bits (632),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 153/442 (35%), Positives = 235/442 (53%), Gaps = 15/442 (3%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             T+   L+    DFF   ++P G   T + L+P   +    ++FR I LC V  K++TK +
Sbjct  1348  TIAHDLLDAVRDFFHGANIPRGVTSTTLVLLPKKSSASKWSEFRPISLCTVMNKIITKLL  1407

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYD  1454
             + RL   +  +I   Q+ FV GR I++N+L+ QE++  L +KS +GG + +K+D+ KAYD
Sbjct  1408  SNRLAKILPSIITENQSGFVGGRLISDNILLAQELIRKLDTKS-RGGNLALKLDMMKAYD  1466

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             RL WSF+   LQ  GF+  WI  I  C+S    ++  + R+  +F  ERG+RQGD +SP 
Sbjct  1467  RLDWSFLIKVLQHFGFNEQWIGMIQKCISNCWFSLLLNGRIEGYFKSERGLRQGDSISPQ  1526

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGP-CISHLFFVDDLVFFGEASLHQASVVKK  1811
             LF+L  E LS  +  +    Q+  +  +   P  +SHL F DD++ F   S      +  
Sbjct  1527  LFILAAEYLSRGL--NALYDQYPSLHYSSGVPLSVSHLAFADDVLIFTNGSKSALQRILV  1584

Query  1812  CLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLG-----IPIVNDLGRYLGVPSI  1976
              L E+  +SGQR++  KS      N     +Q I+ + G     +PI      YLG P  
Sbjct  1585  FLQEYEEISGQRINAQKSCFVTHTNIPNSRRQIIAQATGFNHQLLPIT-----YLGAPLY  1639

Query  1977  HGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLS  2156
              G  K   + DL+++I+ R+TGW+N+ LS  GR TL++SVL+++P Y +Q    P  VL 
Sbjct  1640  KGHKKVILFNDLVAKIEERITGWENKILSPGGRITLLRSVLASLPIYLLQVLKPPVCVLE  1699

Query  2157  RLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNK  2336
             R+ RL   FLWG S  +++ +  SW K+     +G L I+ L  + +A   KL W+    
Sbjct  1700  RVNRLFNSFLWGGSAASKRIHWASWAKIALPVTEGGLDIRSLAEVFEAFSMKLWWRFRTT  1759

Query  2337  EDGLCVKIMEAKVQLPSLPSQA  2402
              D L  + M  K     LP Q 
Sbjct  1760  -DSLWTRFMRMKYCRGQLPMQT  1780


 Score = 84.7 bits (208),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 134/311 (43%), Gaps = 28/311 (9%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHL---  390
             F   +   GL+D G+ G  +TW       N    RLDR + N +W    P   + HL   
Sbjct  1044  FASVLLDCGLLDGGFEGNPFTWTN-----NRMFQRLDRVVYNHQWINMFPITRIQHLNRD  1098

Query  391   -----PMVNSYHTLGESR--RFRFNAAW*THPNYQE*VSSTWKSDVS---LEA---NKSN  531
                  P++ S     E     FRF  AW  H +++  V   W   ++   L+A    +  
Sbjct  1099  GSDHCPLLISCFISSEKSPSSFRFQHAWVLHHDFKTSVEGNWNLPINGSGLQAFWIKQHR  1158

Query  532   LSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQE  711
             L + L  WNK   G+IF +      R+   +      Q +       K   +L++ L  E
Sbjct  1159  LKQHLKWWNKAVFGDIFSKLKEAEKRVEECEILHQQEQTVGSRINLNKSYAQLNKQLNVE  1218

Query  712   ELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAF  891
             E+ W  +S  +W+V G+RNT+F+H     ++  S + ++++  G WI D + + +    +
Sbjct  1219  EIFWKQKSGVKWVVEGERNTKFFHMRMQKKRIRSHIFKVQEPDGRWIEDQEQLKQSAIEY  1278

Query  892   YMDLFSEDSTTQLEDLNDAFFPPLHT---SQWLAINAHFT-VKDLEAVFEMAQFKAPSSD  1059
             +  L   +    +    ++  P + +   ++ L    +   VKD  AVF++    A   D
Sbjct  1279  FSSLLKAEP-CDISRFQNSLIPSIISNSENELLCAEPNLQEVKD--AVFDIDPESAAGPD  1335

Query  1060  GFQTSFYQNSW  1092
             GF + FYQ  W
Sbjct  1336  GFSSYFYQQCW  1346



>ref|XP_010689711.1| PREDICTED: uncharacterized protein LOC104903385 [Beta vulgaris 
subsp. vulgaris]
Length=1533

 Score =   246 bits (627),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 143/432 (33%), Positives = 222/432 (51%), Gaps = 48/432 (11%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             +F   + D + ++ S+     + P   N T I L+P + +P  V++FR I LCNV YK+ 
Sbjct  685   RFWHIIGDDVFEYVSNLLHNFYCPTEINCTNIALIPKVKSPTDVSEFRPISLCNVLYKIA  744

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDL  1439
              KA+ LRLK  +  ++   Q++FV GR I++N L+  E+ +S++ ++  + GL+ +K+D+
Sbjct  745   FKAIVLRLKQFLPDIVTENQSAFVPGRMISDNSLIALEIFHSMKKRNNSRKGLIAMKLDM  804

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYD++ W F+R  L   GF   W+  IMSCVS+ + +   + R+       RG+RQGD
Sbjct  805   SKAYDQVEWGFLRKLLLTMGFDGRWVNLIMSCVSSVQYSFIINRRVCGSVCPSRGLRQGD  864

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  +  S +I+Q     +  G K +R GP ISHL F DD + F  A   +  
Sbjct  865   PLSPFLFILVFDAFSQMIQQKANVRELHGAKASRNGPEISHLLFADDNLLFTRAIRQECR  924

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             V K                                                +YLGVP+I 
Sbjct  925   VDKH----------------------------------------------QKYLGVPTIC  938

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+  + DL+ R+  +L GWK + LS  G+  LI++V+ A+P Y M    +P  V+  
Sbjct  939   GRSKKVVFRDLLDRMWKKLRGWKEKLLSRAGKEVLIKAVIQALPTYLMGVYKIPATVIQE  998

Query  2160  LERLSRDFLWGSSKG-NRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNK  2336
             +      F WG  KG  RK + +SW+K+ + K  G LG + L   N AL  K  W L++ 
Sbjct  999   IHSAMARFWWGGGKGEERKMHWLSWEKLCKPKCMGGLGFKDLRVFNDALLGKQVWCLLHY  1058

Query  2337  EDGLCVKIMEAK  2372
             ++ L  ++M AK
Sbjct  1059  KNSLLSRVMSAK  1070


 Score = 86.3 bits (212),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 79/322 (25%), Positives = 129/322 (40%), Gaps = 43/322 (13%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             +GF++ +    L DL + G  YTW +G S       RLDR L +  W    P+  + H  
Sbjct  380   VGFREVMESCNLGDLWFVGQWYTWERGRSPETRIRERLDRFLVSHSWNELFPEAFIEHTV  439

Query  394   MVNSYHTL-------------GESRRFRFNAAW*THPNYQE*VSSTWKSDVS--LEANKS  528
               +S H                + R FRF  +W    + +  V   W   V   +E    
Sbjct  440   RYSSDHAAVILKSKVDVRDQRRQKRGFRFETSWLLDDSCESVVREAWNKSVGGVIEERLG  499

Query  529   NLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQ  708
              ++++L  W+K  +GN+ ++  RV  R+   QR  +  +              L     +
Sbjct  500   VVARELQVWSKKGVGNLQKQIERVEKRLQEAQREATTTESCMRCASLEIELDSLHA---K  556

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
              E  W+ RSR   +  GDRNT ++H   + RK  + +  +KD  G W +D + + E    
Sbjct  557   NEAYWYMRSRVTEVKDGDRNTSYFHHKASQRKKRNFIHGIKDREGVWQTDIEDVEEEVVR  616

Query  889   FYMDLF-----SEDSTTQL---------EDLNDAFFPPLHTSQWLAINAHFTVKDLEAVF  1026
             ++ ++F     S DS  ++         ++ ND    P    +  A           A+ 
Sbjct  617   YFDNIFTSSVPSRDSLREVLQHVRFSVTQEYNDILLQPYSKEEIHA-----------ALC  665

Query  1027  EMAQFKAPSSDGFQTSFYQNSW  1092
             +M   KAP  DG    FYQ  W
Sbjct  666   QMHPCKAPGPDGMHAIFYQRFW  687


 Score = 59.3 bits (142),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/208 (26%), Positives = 86/208 (41%), Gaps = 8/208 (4%)
 Frame = +2

Query  2771  LSTYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDID  2950
             L  + RVW  I SL+V  ++R FLW    +         RR  T +  C  C    E   
Sbjct  1207  LEDFHRVWGLIWSLEVSPKVRHFLWRVCTNSLPVRAALKRRHLTDDDSCPRCACGEESAQ  1266

Query  2951  HIMQRCPIANSVWESLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWL  3130
             H+   C  A+ +W+ +   +  R    D      + I   +  ++K  Q+ ++   MW L
Sbjct  1267  HVFFDCTHASQLWDLVGCKEMTR---HDVGEEMVDLIIRWNDLDKKLVQKGSY--LMWNL  1321

Query  3131  WKWRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVG  3310
             W  +N +VF   +       + +  QVEE N   ++  G     + +     +W  P  G
Sbjct  1322  WTEKNKIVFENCSHPPVVVAQRVGRQVEEFNEHITRIYG--GGQQRVMASSSRWTTPPDG  1379

Query  3311  WVKANIDGSSIPSNSIARCGGFIRDDQG  3394
             +VK N D +SI  +     G   RD QG
Sbjct  1380  FVKLNSD-ASIGDDGWIGLGVVARDSQG  1406



>ref|XP_008364002.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=839

 Score =   295 bits (754),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 153/408 (38%), Positives = 236/408 (58%), Gaps = 1/408 (0%)
 Frame = +3

Query  1152  PNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSF  1331
             P   N T I L+P + NP +V+QFR I LCN SYK+L+K +  RLK  +  +I P Q +F
Sbjct  67    PINLNSTYIVLIPKVQNPEMVSQFRPISLCNYSYKILSKVLANRLKPILTEIISPMQNAF  126

Query  1332  VLGRQITNNVLVYQEVLNSLRSKSGKGGLMV-IKIDLEKAYDRLSWSFIRSTLQKAGFSP  1508
             V GRQI +N+ +  EV + L+ +  K    V IK+D++KAYDR+ W F+ + +++ GF  
Sbjct  127   VAGRQIQDNIRLAHEVFHFLKVRKAKRRFEVGIKLDMQKAYDRVEWDFLDAVMERMGFGI  186

Query  1509  DWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVK  1688
              W + IM CVS+   A+  + +  + F    G+RQGDPLSP LF+L  + LS +I+++V+
Sbjct  187   SWRKLIMGCVSSVNFAVLLNGQPGEKFAHSHGLRQGDPLSPYLFLLVGKVLSRMIQEAVE  246

Query  1689  NGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*  1868
               Q +G+K++  GP ISH+FF DD + F +      + +   L ++C+ SGQ ++  KS 
Sbjct  247   RRQLEGVKLSVAGPVISHIFFTDDTLIFLKEDRKNCNNLVDLLKDYCNASGQAINMQKSS  306

Query  1869  IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWK  2048
             +FF  N    + + + + LG+ +V + G YLGVP+I GR K+   A +  RI  +L GWK
Sbjct  307   VFFGNNVQSTLSEELGNILGMTVVENPGSYLGVPAIWGRSKKLGLAYVKGRILGKLQGWK  366

Query  2049  NRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLIS  2228
                LS  G   LI++V+ AIP Y M     P  +   L+ L   F W  S G RK + +S
Sbjct  367   QSMLSRAGNEVLIKAVVQAIPAYPMNIFKFPATLCKELDALIAKFWWDDSSGRRKTHWVS  426

Query  2229  WKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
              + +   K  G +G +     N AL AK  W+L+ + D L  ++M+A+
Sbjct  427   METLGLPKHLGGMGFRNFQDFNDALLAKQCWRLIVEPDSLWAQVMKAR  474


 Score = 62.8 bits (151),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/213 (28%), Positives = 90/213 (42%), Gaps = 10/213 (5%)
 Frame = +2

Query  2774  STYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDH  2953
             S    +W  I  +KVP ++R FLW + H+  +T     +R  +    C IC    E ++H
Sbjct  626   SVPELLWKGIWRVKVPAKVRLFLWSSLHNALVTVAVLFQRRSSPTPICPICLCQEESVEH  685

Query  2954  IMQRCPIANSVWE-SLIPYDHRRL*DQDYTNWFDEGI-SELSSGNRKHEQRVTFAVTMWW  3127
             ++  CP   S+W    + Y+ +      +  W      S L S   K   +   A T W 
Sbjct  686   LLLSCPWVFSIWSGGALKYNIQVGIFSSWGAWLHAVFTSNLGSLASKEWVQTYMAFTCWH  745

Query  3128  LWKWRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESI---CWRQL-KWI  3295
             +WK R D VF+   I  +  I  I   V E    F  A+ +    +S+     RQL +W 
Sbjct  746   IWKSRCDYVFNQVPIIPSKVIMGIGFSVAE----FLNARSVPVNSQSVDRGLVRQLCRWT  801

Query  3296  RPQVGWVKANIDGSSIPSNSIARCGGFIRDDQG  3394
              P   +VK N+D S    N+        RD +G
Sbjct  802   PPVSPFVKLNVDASWSRVNNSGFAAVVARDARG  834



>gb|ABB46931.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1853

 Score =   303 bits (776),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 155/437 (35%), Positives = 246/437 (56%), Gaps = 2/437 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP +   +    +KD +++   +FFS G +P+G N+T I L+P    P  +  FR I LC
Sbjct  987   FPGRFYQRNWAILKDDIVRAVQEFFSLGTMPSGVNETAIVLIPKTEQPQELKDFRPISLC  1046

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGL  1418
             NV YK+++K +  RL+  +  L+   Q++FV GR IT+N L+  E  + + R+K+ +   
Sbjct  1047  NVVYKIVSKCLVNRLRPILDDLVSQNQSAFVPGRLITDNALIAFEYFHHIQRNKNPENAY  1106

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
                K+DL KAYDR+ W F+   + K GF+  W++ IM+C++  R A+  +  L   F   
Sbjct  1107  SAYKLDLSKAYDRVDWEFLEQAMVKLGFAHCWVKWIMACITLVRYAVKLNGTLLNTFAPS  1166

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP LF+   + LS L+E+ V  G    + I R  P + HL F DD   F +
Sbjct  1167  RGLRQGDPLSPFLFLFVADGLSFLLEEKVDQGAMNPIHICRHAPAVLHLLFADDTPLFFK  1226

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A+  QA V+K+ L  + S +GQ ++  K  I F +++   +Q  I  +L I    +  +Y
Sbjct  1227  AANDQAVVMKEVLETYASCTGQLINPSKCSIMFGQSSPTAVQNQIKQTLQISNSFE-DKY  1285

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG P+  GR+ +  +  L  R+  R+  W  + LS  G+  LI++VL A+P Y M    L
Sbjct  1286  LGFPTPEGRMTKGKFQSLQERLWKRIMLWGEKFLSTGGKEILIKAVLQAMPVYVMGLFKL  1345

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P+ V   L +L R+F WG+ KG R+ +  SW  +   K +G +G +     NQAL A+  
Sbjct  1346  PESVCEELTKLVRNFWWGAEKGMRRTHWKSWDCLIAQKLKGGMGFRDFRLFNQALLARQA  1405

Query  2319  WKLMNKEDGLCVKIMEA  2369
             W+L+++ D LC +I++A
Sbjct  1406  WRLLDRPDSLCARILKA  1422


 Score = 63.9 bits (154),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 62/129 (48%), Gaps = 1/129 (1%)
 Frame = +1

Query  712   ELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAF  891
             +++W  RSR  W+  GDRNTRF+H     R   + + +L+D+     S    +      +
Sbjct  869   QMIWLQRSRIAWLKEGDRNTRFFHNKAVWRAKKNKITKLRDSDDTVHSTTKELERMATEY  928

Query  892   YMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQ  1068
             +  LF+ D +     +     P +  +    +   F+ +++  A+F++   KAP  DGF 
Sbjct  929   FQRLFTADPSIDHSRVTSLMKPKVTDAMNEELCKTFSEEEIANALFQIGPLKAPGPDGFP  988

Query  1069  TSFYQNSWA  1095
               FYQ +WA
Sbjct  989   GRFYQRNWA  997



>ref|XP_009107566.1| PREDICTED: uncharacterized protein LOC103833219 [Brassica rapa]
Length=1182

 Score =   276 bits (706),  Expect(3) = 8e-81, Method: Compositional matrix adjust.
 Identities = 151/430 (35%), Positives = 238/430 (55%), Gaps = 1/430 (0%)
 Frame = +3

Query  1086  FMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLT  1265
             F  TV+  +++    FF  G LP   N T +CL+P  P P  V+  R I LC+V YK+++
Sbjct  263   FWTTVEAQVVREVQRFFHFGVLPKEWNYTHLCLIPKTPEPKTVSDLRPISLCSVIYKVIS  322

Query  1266  KAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRS-KSGKGGLMVIKIDLE  1442
             K M  RL+  M  LI P Q++FV  R +++N+ +  E+++SL    +     MV+K D+ 
Sbjct  323   KIMVSRLRPWMPGLISPTQSAFVAERLMSDNITIAHEMVHSLGVVDTPASEQMVVKTDMS  382

Query  1443  KAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDP  1622
             KAYDR+ W ++RS L   GF   W++ +M CV+T   ++  + +       +RG+RQGDP
Sbjct  383   KAYDRVEWGYLRSVLLALGFDLRWVQWVMKCVTTVTYSVLINDQPHGMIEPQRGLRQGDP  442

Query  1623  LSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASV  1802
             LSP LFVL  E L HL+  + +     GMK   +GP I HL F DD +F  +A+  Q++V
Sbjct  443   LSPFLFVLCTEGLPHLLSNAERRQSISGMKFGVRGPSIHHLLFADDCLFSCKANEEQSNV  502

Query  1803  VKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHG  1982
             +   L  + + +GQ ++  KS I F K+   E    +   LGI       +YLG+P    
Sbjct  503   LMNILGRYGAATGQVINPQKSSIMFGKSVRKENNIRVKHILGIEAEGGEAKYLGLPECFN  562

Query  1983  RLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRL  2162
               K   ++ L  ++  R++GW  RTLS  G+  +I++V SA+P   M    +P+ V + L
Sbjct  563   GSKVKLFSYLKEKMGRRISGWHARTLSQAGKEVMIKAVASALPVSAMSVFKIPKTVTTSL  622

Query  2163  ERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKED  2342
                  +F W + +  RK + ISW+K+   KD G +G + L+  N+AL AK  W+L+N E 
Sbjct  623   SSALANFWWSAVEHKRKIHWISWEKMCLPKDLGGMGFKDLESFNKALLAKQAWRLINLES  682

Query  2343  GLCVKIMEAK  2372
              L  ++++ K
Sbjct  683   CLMSQVLKGK  692


 Score = 51.6 bits (122),  Expect(3) = 8e-81, Method: Compositional matrix adjust.
 Identities = 68/297 (23%), Positives = 119/297 (40%), Gaps = 54/297 (18%)
 Frame = +1

Query  247   LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEW------------KIRSPDVEVLHL  390
             L++L   G  +TW  GL S ++   RLDR   N  W              R  D   + +
Sbjct  7     LVELQSHGNGFTW-SGLRSNSWVHTRLDRCFGNTAWFKKFPCANQSFLDKRGSDHRPVLI  65

Query  391   PMVNSYHTLGESRRFRFNAAW*THPNYQE*VSSTWKSD-VSLEANKSNLSKQLDDWNKHT  567
              +++S H+      FRF+         +  V + W  D  S  A+ SN            
Sbjct  66    HLIDSQHSY--KGWFRFDRRLLEVDGVKANVENAWCLDGTSGNASLSN------------  111

Query  568   IGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREEW  747
                          R+   +RSLS  +K   +   ++           EEL W+ +S+++W
Sbjct  112   -------------RLKACRRSLSGLKKQQELVKAQR----------DEELYWWQKSKDKW  148

Query  748   IVSGDRNTRFYHAATAVRKSASTVRRLKDNFG-EWISDGDGILEPFHAFYMDLFSEDSTT  924
             +  GD+N+RF+H +    ++ +++ +L +  G E  S+ D        FY +LF   +  
Sbjct  149   LARGDKNSRFFHTSVRASRARNSLDKLLNPQGVEVYSEADKGKVAVD-FYTNLFRSSNPA  207

Query  925   QLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQTSFYQNSW  1092
                +      P + T     +    +  ++ +AVF +   KAP  DG    F+Q+ W
Sbjct  208   PFSEWFQDLQPRVSTLMNGELTRPVSAAEIRDAVFSINPSKAPGPDGMSALFFQSFW  264


 Score = 25.4 bits (54),  Expect(3) = 8e-81, Method: Compositional matrix adjust.
 Identities = 11/36 (31%), Positives = 18/36 (50%), Gaps = 0/36 (0%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             S  W+ +L+   +L++G K  V N      W D W+
Sbjct  709   SYAWRSVLEGKDLLVQGLKVAVGNGSLLKVWTDPWL  744



>gb|AAM01179.2|AC113336_31 Putative retroelement [Oryza sativa Japonica Group]
Length=1888

 Score =   303 bits (776),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 155/437 (35%), Positives = 246/437 (56%), Gaps = 2/437 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP +   +    +KD +++   +FFS G +P+G N+T I L+P    P  +  FR I LC
Sbjct  1022  FPGRFYQRNWAILKDDIVRAVQEFFSLGTMPSGVNETAIVLIPKTEQPQELKDFRPISLC  1081

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGL  1418
             NV YK+++K +  RL+  +  L+   Q++FV GR IT+N L+  E  + + R+K+ +   
Sbjct  1082  NVVYKIVSKCLVNRLRPILDDLVSQNQSAFVPGRLITDNALIAFEYFHHIQRNKNPENAY  1141

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
                K+DL KAYDR+ W F+   + K GF+  W++ IM+C++  R A+  +  L   F   
Sbjct  1142  SAYKLDLSKAYDRVDWEFLEQAMVKLGFAHCWVKWIMACITLVRYAVKLNGTLLNTFAPS  1201

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP LF+   + LS L+E+ V  G    + I R  P + HL F DD   F +
Sbjct  1202  RGLRQGDPLSPFLFLFVADGLSFLLEEKVDQGAMNPIHICRHAPAVLHLLFADDTPLFFK  1261

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A+  QA V+K+ L  + S +GQ ++  K  I F +++   +Q  I  +L I    +  +Y
Sbjct  1262  AANDQAVVMKEVLETYASCTGQLINPSKCSIMFGQSSPTAVQNQIKQTLQISNSFE-DKY  1320

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG P+  GR+ +  +  L  R+  R+  W  + LS  G+  LI++VL A+P Y M    L
Sbjct  1321  LGFPTPEGRMTKGKFQSLQERLWKRIMLWGEKFLSTGGKEILIKAVLQAMPVYVMGLFKL  1380

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P+ V   L +L R+F WG+ KG R+ +  SW  +   K +G +G +     NQAL A+  
Sbjct  1381  PESVCEELTKLVRNFWWGAEKGMRRTHWKSWDCLIAQKLKGGMGFRDFRLFNQALLARQA  1440

Query  2319  WKLMNKEDGLCVKIMEA  2369
             W+L+++ D LC +I++A
Sbjct  1441  WRLLDRPDSLCARILKA  1457



>ref|XP_007046404.1| Uncharacterized protein TCM_011923 [Theobroma cacao]
 gb|EOY02236.1| Uncharacterized protein TCM_011923 [Theobroma cacao]
Length=1954

 Score =   248 bits (632),  Expect(3) = 9e-81, Method: Compositional matrix adjust.
 Identities = 152/437 (35%), Positives = 244/437 (56%), Gaps = 13/437 (3%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             +K  L++   DFF+   +P G   T + L+P  PN    + FR I LC V  K++TK + 
Sbjct  1052  IKQDLLEAVLDFFNGTPMPQGVTSTTLVLLPKKPNSCQWSDFRPISLCTVLNKIVTKTLA  1111

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
              RL   +  +I   Q+ FV GR I++N+L+ QE++  L +K+ +GG +V+K+D+ KAYDR
Sbjct  1112  NRLSKILPSIISENQSGFVNGRLISDNILLAQELVGKLDAKA-RGGNVVLKLDMAKAYDR  1170

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             L+W F+   +++ GF+  WI  I +C+S    ++  +  L  +F  ERG+RQGD +SPLL
Sbjct  1171  LNWDFLYLMMKQFGFNDRWISMIKACISNCWFSLLINGSLVGYFKSERGLRQGDSISPLL  1230

Query  1638  FVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCL  1817
             FVL  + LS  I Q + N     + ++     ISHL F DD+V F          +   L
Sbjct  1231  FVLAADYLSRGINQ-LFNRHKSLLYLSGCFMPISHLAFADDIVIFTNGCRPALQKILVFL  1289

Query  1818  NEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLG-----IPIVNDLGRYLGVPSIHG  1982
              E+  +SGQ++++ KS    +    +  +Q I+ + G     +P++     YLG P   G
Sbjct  1290  QEYEEVSGQQVNHQKSCFITANGCPMTRRQIIAHTTGFQHKTLPVI-----YLGAPLHKG  1344

Query  1983  RLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRL  2162
               K   +  L+++I+ R++GW+N+TLS  GR TL++SVLS++P Y +Q    P  V+ ++
Sbjct  1345  PKKVTLFDSLITKIRDRISGWENKTLSPGGRITLLRSVLSSLPLYLLQVLKPPVVVIEKI  1404

Query  2163  ERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKED  2342
             ERL   FLWG S  +++ +  +W K+T    +G L I+RL  M  A   KL W+    E 
Sbjct  1405  ERLFNSFLWGDSTNDKRIHWAAWHKLTFPCSEGGLDIRRLTDMFDAFSLKLWWRFSTCE-  1463

Query  2343  GLCVKIMEAKVQLPSLP  2393
             GL  K ++ K  +  +P
Sbjct  1464  GLWTKFLKTKYCMGQIP  1480


 Score = 81.3 bits (199),  Expect(3) = 9e-81, Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 131/310 (42%), Gaps = 34/310 (11%)
 Frame = +1

Query  232   IFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHL-------  390
             +F  GLID G+ G ++TW       N    RLDR + N EW        V HL       
Sbjct  751   LFDCGLIDAGFEGNSFTWTN-----NHMFQRLDRVVYNPEWAHCFSSTRVQHLNRDGSDH  805

Query  391   -PMVNSYHTLGES--RRFRFNAAW*THPNYQE*VSSTWKSDVSLEA------NKSNLSKQ  543
              P++ S  T  +     FRF  AW  H ++   V  +W+  ++          +  L + 
Sbjct  806   CPLLISCATASQKGPSTFRFLHAWTKHHDFLPFVERSWQVPLNSSGLTAFWIKQQRLKRD  865

Query  544   LDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLW  723
             L  WNK   G+IF +  R        ++            L  K   +L+  L  EEL W
Sbjct  866   LKWWNKQIFGDIFEKLKRAEIEAEKREKEFQQDPSSINRNLMNKAYAKLNRQLSIEELFW  925

Query  724   F*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDL  903
               +S  +W+V G+RNT+F+H     ++  + + R++D+ G    D   I      ++ +L
Sbjct  926   QQKSGVKWLVEGERNTKFFHLRMRKKRVRNNIFRIQDSEGNIYEDPQYIQNSAVQYFQNL  985

Query  904   FSEDSTTQLEDLNDAFFPPLHTSQWLAIN------AHFTVKDL-EAVFEMAQFKAPSSDG  1062
              +       E  + + F P    + ++I       A  ++K++ E VF + +      DG
Sbjct  986   LTA------EQCDFSRFDPSLIPRTISITDNEFLCAAPSLKEIKEVVFNIDKDSVAGPDG  1039

Query  1063  FQTSFYQNSW  1092
             F + FYQ+ W
Sbjct  1040  FSSLFYQHCW  1049


 Score = 23.9 bits (50),  Expect(3) = 9e-81, Method: Compositional matrix adjust.
 Identities = 12/44 (27%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQATLLS  2536
             S VWK +++   + ++ ++  +    S  FW D W+G Q  + S
Sbjct  1490  SQVWKRMVRGREVAIQNTRWRIGKG-SLFFWHDCWMGDQPLVTS  1532



>ref|XP_010686872.1| PREDICTED: uncharacterized protein LOC104901027 [Beta vulgaris 
subsp. vulgaris]
Length=1273

 Score =   223 bits (568),  Expect(3) = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/431 (31%), Positives = 213/431 (49%), Gaps = 53/431 (12%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             KF   V   +I F  D+++ G   +  N T I L+P   +P  +  FR I LC+V YK+L
Sbjct  424   KFWHIVGPDVILFVRDWWNGGVDLSALNKTCIVLIPKCDSPKSMRDFRPISLCSVIYKIL  483

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKG-GLMVIKIDL  1439
             +K +  RLK  +  +I P Q++FV  R IT+N LV  E+ ++++ +  +G G+  +K+D+
Sbjct  484   SKTLANRLKLLLPAIISPNQSAFVPRRLITDNALVAFEIFHAMKRRDVRGDGVCALKLDM  543

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+   ++K GF  +W                                   
Sbjct  544   SKAYDRVEWCFLEKVMEKLGFCDEW-----------------------------------  568

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
                              I ++ +  +  G +I R  P +SHLFF DD + F +AS+ + S
Sbjct  569   -----------------ISKAAQENRIHGARICRGAPLVSHLFFADDSILFTKASVQECS  611

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             VV   ++++   SGQ+++  K+ + FSK    E +  I S LG+  V    +YLG+P++ 
Sbjct  612   VVADIISKYERASGQKVNLSKTEVVFSKGVDEERRNDIVSILGVQEVARQEKYLGLPTVI  671

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+ ++A +  RI  +L GWK + LS  G+  L++SV  AIP Y M    LP G++  
Sbjct  672   GRSKKVTFACIKERIWKKLQGWKEKLLSRPGKEVLLKSVAQAIPTYMMSVFCLPSGLIDE  731

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             +  +   F WGS+   RK +   W  +   K  G LG + L   N AL AK  W+L    
Sbjct  732   IHAMFARFWWGSNGVERKLHWHKWDSLCLPKSMGGLGFRDLHCFNMALLAKQAWRLSQDG  791

Query  2340  DGLCVKIMEAK  2372
                  ++++A+
Sbjct  792   HSFLHQVLKAR  802


 Score =   107 bits (267),  Expect(3) = 1e-80, Method: Compositional matrix adjust.
 Identities = 86/311 (28%), Positives = 139/311 (45%), Gaps = 26/311 (8%)
 Frame = +1

Query  217   GFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPM  396
              F++ I   G+ DLG++G  +TW +G S       RLDR L + EW    P  EV+HLP 
Sbjct  123   AFREVIDDCGVKDLGFNGSRFTWQRGNSPSTLIRERLDRMLADDEWCDLFPSWEVVHLPR  182

Query  397   VNSYHT------------LGESRRFRFNAAW*THPNYQE*VSSTW--KSDVSLEANKSNL  534
               S H                ++ F+F A W +  +    V   W   S   + A    +
Sbjct  183   YRSDHAPLLLKTGVNDQFRRRNKLFKFEAMWLSQDDCATVVKEAWSESSGDDVTARLEAV  242

Query  535   SKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEE  714
             S +L  W     GN+ +RK + L+R+  +Q+     Q   +I     +  +LD I   EE
Sbjct  243   SNKLSSWAAKVFGNLKKRKKQALSRLDVLQQG---AQDAAVIAQCHAIADDLDAIHRLEE  299

Query  715   LLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFY  894
               W  R+R   I  GD+NT+++H   + RK  + ++ L D  G W    + + +  + ++
Sbjct  300   SYWHARARANEIRDGDKNTKYFHHKASQRKRRNCIKGLLDENGVWKKGREEMCDVVYQYF  359

Query  895   MDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKD-----LEAVFEMAQFKAPSSD  1059
              +LF+ D+ ++++   D     LH+    A+N             EA+F M   KAP  D
Sbjct  360   AELFTSDNPSEMDVAVDG----LHSCVSAAMNEQLVSPPSGEEIREALFSMHPNKAPGID  415

Query  1060  GFQTSFYQNSW  1092
             G    F+Q  W
Sbjct  416   GLHALFFQKFW  426


 Score = 21.9 bits (45),  Expect(3) = 1e-80, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 20/41 (49%), Gaps = 0/41 (0%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQAT  2527
             S  W+ I  S  +LL+G K  V N  S     D+WI  + +
Sbjct  819   SFTWRSIWGSKALLLEGLKWRVGNGESIRVGEDAWIMGEGS  859



>ref|XP_010485231.1| PREDICTED: uncharacterized protein LOC104763574 [Camelina sativa]
Length=1808

 Score =   238 bits (608),  Expect(3) = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/441 (32%), Positives = 224/441 (51%), Gaps = 24/441 (5%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             +F   V + + +    F  TG L    N T ICL+P       +  FR I LCNV YK++
Sbjct  907   QFWERVGEDITEMVRSFMRTGRLEEEINRTNICLIPKKMKASKLQDFRPISLCNVVYKIV  966

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDL  1439
             +K +  RLK  +  +I   Q +FV GR I++N+L+  E+L++L S++      + IK D+
Sbjct  967   SKLLASRLKRILPNIISETQAAFVKGRLISDNILIAHEMLHALSSRNKCAENFIAIKTDI  1026

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ WSF+ + +   GFS  WIR +M CV T    +  +    +     RG+RQGD
Sbjct  1027  SKAYDRVEWSFLGNAMTYLGFSGSWIRLVMECVKTVEYQVLINGVPYRDIQPTRGLRQGD  1086

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LFV+  E L  ++ ++ + G+  G+KI    P ISHL F DD +F+      + +
Sbjct  1087  PLSPYLFVICTEMLVRMLNKAEEEGKITGLKIASGAPSISHLLFADDSLFYCRKEEEEIN  1146

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              + + + E+   SGQR++Y KS I+F K    E +  I   LGI      G YLG+P   
Sbjct  1147  QMVRIIEEYSLASGQRVNYQKSSIYFGKLIPEETRGEIKHKLGISKEGGEGIYLGLPEAF  1206

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
                K    + L  R+  R+ GW+   LS  G+  L+++V+ A+P YTM    LP+  L+ 
Sbjct  1207  KGSKVTILSYLKERLNQRVNGWQTMFLSQGGKEVLLKAVVMALPTYTMTCFKLPRNALAS  1266

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             + R                         ++K +G +  + ++  N AL  K  W+++ ++
Sbjct  1267  MGR-----------------------ADQAKSRGGIEFRDIEAFNDALLGKQLWRIITQK  1303

Query  2340  DGLCVKIMEAKVQLPSLPSQA  2402
             + L  ++ +++    S P  A
Sbjct  1304  ESLVARVFKSRYFRKSDPLTA  1324


 Score = 87.0 bits (214),  Expect(3) = 1e-80, Method: Compositional matrix adjust.
 Identities = 83/308 (27%), Positives = 148/308 (48%), Gaps = 24/308 (8%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             FQ  +   GL ++ + G  ++W  G  +      RLDR + N EW    P+ + ++L  V
Sbjct  609   FQQMLSACGLWEVRHKGYQFSWF-GNRNEELVQCRLDRTVANQEWMELFPEAQAVYLKKV  667

Query  400   NSYHT------LGESRR----FRFNAAW*THPNYQE*VSSTWKSDVSLEANK-----SNL  534
             +S H+      +GE  R    F+++  W     + + +  TW+S+   ++N      +  
Sbjct  668   SSDHSPLITTLMGEKWRRWVGFKYDQRWVQREGFCDFMKETWESEKVKQSNSLVEKLTRC  727

Query  535   SKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEE  714
              K++  W +    N   R   + +RI       +  Q    I+  R+L+ EL++   QEE
Sbjct  728   RKEISGWKRRNKPNSSLRIQELHSRID-----RATQQSPFSIEEVRRLKSELNKEYVQEE  782

Query  715   LLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFG-EWISDGDGILEPFHAF  891
               W  +SR  W+ +GD+NT+F+HAAT  R++ + ++ L+D  G EW ++ D        F
Sbjct  783   KFWQQKSRFIWLNNGDKNTKFFHAATKNRRAQNRIQVLEDKDGIEWFAEEDLGRVAESYF  842

Query  892   YMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQ  1068
              M   SED   +L+++       + T     ++A  +++++ EAVFE+   K P  DG  
Sbjct  843   KMLYTSEDVGYRLQEMEQG-TNTVSTEMNEMLSAEVSLEEVKEAVFEINPNKCPGPDGLT  901

Query  1069  TSFYQNSW  1092
               F+Q  W
Sbjct  902   GFFFQQFW  909


 Score = 27.3 bits (59),  Expect(3) = 1e-80, Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 26/51 (51%), Gaps = 1/51 (2%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI-GKQATLLSRIRYDP  2554
             S  W+ +  +  +L +G++ +V N +    W   W+  K A  LSR++  P
Sbjct  1331  SYAWRSLQAAQELLRQGARAVVGNGKEINIWQHQWLQSKPARGLSRVKQIP  1381


 Score = 77.0 bits (188),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/211 (29%), Positives = 93/211 (44%), Gaps = 12/211 (6%)
 Frame = +2

Query  2774  STYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDH  2953
             + Y+++W     L+ P +I  F+W    +C   N   A    + E  C  C N  E ++H
Sbjct  1475  ALYQQIWK----LEAPPKIHHFVWKCLSNCLSVNGNLAYPHISKEALCIRCPNCTETVNH  1530

Query  2954  IMQRCPIANSVWE-SLIPYDH-RRL*DQDYTN--WFDEGISELSSGNRKHEQRVTFAVTM  3121
             +  +CP A  VW  S +P        D  Y N  WF     E  S   +  Q       +
Sbjct  1531  LFFQCPYARVVWAVSSVPAPQGGEWSDSLYANMDWFLNYQKEQRS---QTPQPTVSQWVL  1587

Query  3122  WWLWKWRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRP  3301
             W LWK RN+L F+G +I +   IK + +  EE      +  G + P  S    +++W  P
Sbjct  1588  WRLWKSRNELCFNGKDIGVERLIKLVEEDAEEWR-GREENTGRLRPNPSALSLEVRWRPP  1646

Query  3302  QVGWVKANIDGSSIPSNSIARCGGFIRDDQG  3394
              + WVK N+DG+       +  G  +RD QG
Sbjct  1647  PLEWVKCNMDGAWPREGDRSGVGWVLRDHQG  1677



>ref|XP_010490159.1| PREDICTED: uncharacterized protein LOC104767890 [Camelina sativa]
Length=1712

 Score =   239 bits (610),  Expect(3) = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/483 (30%), Positives = 236/483 (49%), Gaps = 50/483 (10%)
 Frame = +3

Query  1104  DSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLR  1283
             + L+     FF +G L    N T ICL+P       +  FR I L NV YK++ K M  R
Sbjct  746   EHLLMMVQGFFHSGSLDRDMNKTNICLIPKKIKAERLTDFRPISLSNVVYKIIAKVMANR  805

Query  1284  LKSAMRMLIGPFQTSFVLGRQITNNVLVYQ------------------------------  1373
             LK  +  ++   Q +F+ GR IT+N+LV                                
Sbjct  806   LKKVLPGVVSETQAAFIKGRLITDNILVAHELLHALDSPNKCSEDSLAIKTDISKAFDRV  865

Query  1374  -------------------EVLNSLRSKSG-KGGLMVIKIDLEKAYDRLSWSFIRSTLQK  1493
                                E+L++L S +      + IK D+ KA+DR+ WSF++  L+ 
Sbjct  866   EWSFLQDALKLLDNILVAHELLHALDSPNKCSEDSLAIKTDISKAFDRVEWSFLQDALKL  925

Query  1494  AGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLI  1673
              GFS  WIR IM+CV T    +  +          RG+RQGDPLSP LFVL  E L  ++
Sbjct  926   LGFSERWIRLIMTCVRTVNYQVLINGSPFGEITPTRGLRQGDPLSPYLFVLCSEILVRML  985

Query  1674  EQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLS  1853
             + +   G+  G+K+ R  P +SHL F DD +F+ + +  +   +   L+E+   SGQR++
Sbjct  986   QDAESRGKITGLKVARSAPSVSHLLFTDDSIFYCKENDDELQHLISILDEYNIASGQRIN  1045

Query  1854  YMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQAR  2033
             Y KS I+F +  + E +  I +  GI      G YLG+P   G  K      L  R+Q +
Sbjct  1046  YQKSSIYFGRRITQERRDLIKALTGIAAEGGQGFYLGLPEAFGGSKVTILRYLKERLQHK  1105

Query  2034  LTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRK  2213
             ++GW+   LSF G+  L++S+  A+P +T+    LP+ V  +L  +  DF W + + ++ 
Sbjct  1106  VSGWQTNFLSFGGKEILLKSIAMALPSHTISCFKLPKTVSQQLASVMADFWWRNKQNSKG  1165

Query  2214  CNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAKVQLPSLP  2393
              +  +W+ +++ K +G LG + ++  N ALF K  W+++   + L  ++ +++    S P
Sbjct  1166  MHWRAWEHLSKPKSEGGLGFKEIEAYNIALFGKQLWRMLMNPNSLIARVFKSRYFSKSSP  1225

Query  2394  SQA  2402
               A
Sbjct  1226  LSA  1228


 Score = 82.0 bits (201),  Expect(3) = 2e-80, Method: Compositional matrix adjust.
 Identities = 83/304 (27%), Positives = 142/304 (47%), Gaps = 32/304 (11%)
 Frame = +1

Query  244   GLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHT---  414
             G+ D+ ++   ++W  G  +      RLDR + N  W    P  +  +L  V+S H+   
Sbjct  449   GMWDIKHTVYQFSWY-GNRNDELVQCRLDRTVANQLWMELFPSAQAEYLQKVSSDHSPLI  507

Query  415   ---LGESRR----FRFNAAW*THPNYQE*VSSTWK-----SDVSLEANKSNLSKQLDDWN  558
                LGE R+    FR++  W     ++E +S+ W+     S  S+ +  +   K++  W 
Sbjct  508   TSLLGEQRKKWATFRYDQRWIAREGFKELISNFWRKEGVVSHGSMMSRIAACRKEISRWK  567

Query  559   KHTIGNIFRRK*RVLARISGV--QRSLSVYQkldlikldrklrreldeilYQEELLWF*R  732
             +    +  RR       I  +  Q  L+  Q     +   KL+ EL      EE  W  +
Sbjct  568   RDNQPSSARR-------IQALHHQIDLATRQNPFSRQELLKLKNELKIEYRHEETYWKDK  620

Query  733   SREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGE-WISDGDGILEPFHAFYMDLFS  909
             SR  W+ +GD+NT+F+HAAT  +++ + ++RL D+ G+ W  D D      + F +   S
Sbjct  621   SRLTWLNNGDKNTKFFHAATKNKRAQNRIQRLVDDEGKAWFGDNDLGRLAENYFKLLFTS  680

Query  910   EDSTTQLED-LNDA-FFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSFY  1080
             ED   ++ D L +     P+  +Q L      T+++++ AVF M   K+P  DG    FY
Sbjct  681   EDVGHKVTDKLGEGNKVSPVENAQLL---KEVTLEEVKHAVFAMNPSKSPGPDGMTGHFY  737

Query  1081  QNSW  1092
             Q +W
Sbjct  738   QQNW  741


 Score = 30.4 bits (67),  Expect(3) = 2e-80, Method: Compositional matrix adjust.
 Identities = 15/52 (29%), Positives = 25/52 (48%), Gaps = 0/52 (0%)
 Frame = +2

Query  2375  PTS*SAKSGMSNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQATL  2530
             P S    S  S  W+ I ++  +L +G + ++ N  S   W D W+G +  L
Sbjct  1225  PLSAKLGSRPSFAWRSIHEAQELLKQGVRAIIGNGESVNLWQDPWLGSKPAL  1276



>ref|XP_007022832.1| Uncharacterized protein TCM_026877 [Theobroma cacao]
 gb|EOY25454.1| Uncharacterized protein TCM_026877 [Theobroma cacao]
Length=2367

 Score =   248 bits (634),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 156/441 (35%), Positives = 233/441 (53%), Gaps = 24/441 (5%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             +   L+    DFF   ++P G   T + L+P  P+    + FR I LC V  K++TK ++
Sbjct  1519  IAHDLLDAVRDFFHGANIPRGVTSTTLILLPKKPSASKWSDFRPISLCTVMNKIITKLLS  1578

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
              RL   +  +I   Q+ FV GR I++N+L+ QE++  L +KS +GG + +K+D+ KAYDR
Sbjct  1579  NRLAKILPSIITENQSGFVGGRLISDNILLAQELIGKLNTKS-RGGNLALKLDMMKAYDR  1637

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             L WSF+   LQ  GF+  WI  I  C+S    ++  + R   +F  ERG+RQGDP+SP L
Sbjct  1638  LDWSFLIKVLQHFGFNDQWIGMIQKCISNCWFSLLLNGRTEGYFKFERGLRQGDPISPQL  1697

Query  1638  FVLYVERLSH----LIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVV  1805
             F++  E LS     L EQ        G+ I      +SHL F DD++ F   S      +
Sbjct  1698  FLIAAEYLSRGLNALYEQYPSLHYSTGVSIP-----VSHLAFADDVLIFTNGSKSALQRI  1752

Query  1806  KKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLG-----IPIVNDLGRYLGVP  1970
                L E+  +S QR++  KS      N S   +Q I+ + G     +PI      YLG P
Sbjct  1753  LAFLQEYEEISRQRINAQKSCFVTHTNVSSSRRQIIAQTTGFNHQLLPIT-----YLGAP  1807

Query  1971  SIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGV  2150
                G  K   + DL+++I+ R+TGW+N+ LS  GR TL++SVL+++P Y  Q    P  V
Sbjct  1808  LYKGHKKVILFNDLVAKIEERITGWENKILSPGGRITLLKSVLTSLPIYLFQVLKPPVCV  1867

Query  2151  LSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLM  2330
             L R+ R+   FLWG S  ++K +  SW K++    +G L I+ L  + +A   KL W+  
Sbjct  1868  LERINRIFNSFLWGGSAASKKIHWTSWAKISLPVKEGGLDIRSLAEVFEAFSMKLWWRFR  1927

Query  2331  NKEDGLCVKIMEAKV---QLP  2384
                D L  + M  K    QLP
Sbjct  1928  TT-DSLWTRFMRMKYCRGQLP  1947


 Score = 81.6 bits (200),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 80/314 (25%), Positives = 138/314 (44%), Gaps = 34/314 (11%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHL---  390
             F   +   GL+D G+ G  +TW       N    RLDR + N  W  + P   + HL   
Sbjct  1214  FASTLLDCGLLDGGFEGNPFTWTN-----NRMFQRLDRIVYNHHWINKFPITRIQHLNRD  1268

Query  391   -----PMVNSYHTLGES--RRFRFNAAW*THPNYQE*VSSTWKSDVS---LEA---NKSN  531
                  P++ S     E     FRF  AW  H +++  V S W   ++   L+A    +  
Sbjct  1269  GSDHCPLLISCFNSSEKAPSSFRFQHAWVLHHDFKTSVESNWNLPINGSGLQAFWSKQHR  1328

Query  532   LSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQE  711
             L + L  WNK   G+IF +      R+   +      Q ++ I    K   +L++ L  E
Sbjct  1329  LKQHLKWWNKVMFGDIFSKLKEAEKRVEECEILHQNEQTVESIIKLNKSYAQLNKQLNIE  1388

Query  712   ELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAF  891
             E+ W  +S  +W+V G+RNT+F+H     ++  S + ++++  G WI D + + +    +
Sbjct  1389  EIFWKQKSGVKWVVEGERNTKFFHTRMQKKRIRSHIFKVQEPDGRWIEDQEQLKQSAIKY  1448

Query  892   YMDLFSEDSTTQLEDLNDAFF------PPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAP  1050
             +  L       + E  +D+ F        +  S+   + A   ++++ +AVF +    A 
Sbjct  1449  FSSLL------KFEPCDDSRFQRSLIPSIISNSENELLCAEPNLQEVKDAVFGIDPESAA  1502

Query  1051  SSDGFQTSFYQNSW  1092
               DGF + FYQ  W
Sbjct  1503  GPDGFSSYFYQQCW  1516


 Score = 56.2 bits (134),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 61/227 (27%), Positives = 91/227 (40%), Gaps = 55/227 (24%)
 Frame = +2

Query  2789  VWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRC  2968
             V+N+I    +P     FLW   HD      +   +GF     C  CR+  E I H+M   
Sbjct  2077  VFNFIWHKAIPLTTSFFLWRLLHDWIPVELRMKSKGFQLASRCRCCRS-EESIIHVMWDN  2135

Query  2969  PIANSVWE--SLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWR  3142
             P+A       +LIP                                     T+W+LW  R
Sbjct  2136  PVAVQPGHIRTLIPI-----------------------------------FTLWFLWVER  2160

Query  3143  NDLVFSGTNINLAARI---KWIRDQ--VEEINISFSKAKGLIAPIESICWRQLKWIRPQV  3307
             ND      + NL  ++   +W  D+   +E  I+F +AK L  P +  CW      +P  
Sbjct  2161  ND----AKHRNLGQQLLEWQWKGDKQIAQEWGITF-QAKSL-PPPKVFCWH-----KPSN  2209

Query  3308  GWVKANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNIGLNQRVSS  3448
             G  K N+DGS+  S + A  GG +RD  G  + GF  N+G+   + +
Sbjct  2210  GEFKLNVDGSAKLSQNAA-GGGVLRDHAGVMIFGFSENLGIQNSLKA  2255



>ref|XP_007031313.1| Uncharacterized protein TCM_016763 [Theobroma cacao]
 gb|EOY02239.1| Uncharacterized protein TCM_016763 [Theobroma cacao]
Length=2127

 Score =   243 bits (621),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/438 (34%), Positives = 236/438 (54%), Gaps = 11/438 (3%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             +K+ L+    DFF    LP G   T + L+P  PN    +++R I LC V  K++TK + 
Sbjct  1226  IKNDLLDAVLDFFRGSPLPRGVTSTTLVLLPKKPNACHWSEYRPISLCTVLNKIVTKLLA  1285

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
              RL   +  +I   Q+ FV GR I++N+L+ QE++  + +KS +GG +V+K+D+ KAYDR
Sbjct  1286  NRLSKILPSIISENQSGFVNGRLISDNILLAQELIGKIDAKS-RGGNVVLKLDMAKAYDR  1344

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             L+W F+   ++  GF+  WI  I SC+S    ++  +  L+ +F  ERG+RQGD +SP+L
Sbjct  1345  LNWDFLYLMMEHFGFNAHWINMIKSCISNCWFSLLINGSLAGYFKSERGLRQGDSISPML  1404

Query  1638  FVLYVERLS----HLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVV  1805
             F+L  + LS    HL           G ++      ISHL F DD+V F          +
Sbjct  1405  FILAADYLSRGLNHLFSCYSSLQYLSGCQMP-----ISHLSFADDIVIFTNGGRSALQKI  1459

Query  1806  KKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGR  1985
                L E+  +SGQ++++ KS    +   S+  +Q IS + G         YLG P   G 
Sbjct  1460  LSFLQEYEQVSGQKVNHQKSCFITANGCSLSRRQIISHTTGFQHKTLPVTYLGAPLHKGP  1519

Query  1986  LKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLE  2165
              K   +  L+S+I+ R++GW+N+ LS  GR TL++SVLS++P Y +Q    P  V+ R++
Sbjct  1520  KKVLLFDSLISKIRDRISGWENKILSPGGRITLLRSVLSSLPMYLLQVLKPPVTVIERID  1579

Query  2166  RLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDG  2345
             RL   FLWG S   +K +   W K++    +G LGI++L+ +  A   KL W+     + 
Sbjct  1580  RLFNSFLWGDSTECKKMHWAEWAKISFPCAEGGLGIRKLEDVCAAFTLKLWWRFQTG-NS  1638

Query  2346  LCVKIMEAKVQLPSLPSQ  2399
             L  + +  K  L  +P  
Sbjct  1639  LWTQFLRTKYCLGRIPHH  1656


 Score = 86.7 bits (213),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 83/311 (27%), Positives = 139/311 (45%), Gaps = 28/311 (9%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHL---  390
             F   +F  GL+D G+ G ++TW       N    RLDR + N EW        V HL   
Sbjct  921   FASTLFDCGLLDAGFEGNSFTWTN-----NHMFQRLDRVVYNPEWAQCFSSTRVQHLNRD  975

Query  391   -----PMVNSYHTLGE--SRRFRFNAAW*THPNYQE*VSSTWKSDVS---LEA---NKSN  531
                  P++ S +T  +  +  FRF  AW  H ++   V+ +W++ +    L A    +  
Sbjct  976   GSDHCPLLISCNTASQKGASTFRFLHAWTKHHDFLPFVTRSWQTPIQGSGLSAFWFKQQR  1035

Query  532   LSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQE  711
             L + L  WNKH  G+IF +           +        L    L  K   +L+  L  E
Sbjct  1036  LKRDLKWWNKHIFGDIFEKLRLAEEEAEKKEIEFQHNPSLTNRNLMHKAYAKLNRQLSIE  1095

Query  712   ELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAF  891
             EL W  +S  +W+V G+ NT+F+H     ++  S + +++D+ G    D   I +    F
Sbjct  1096  ELFWQQKSGVKWLVEGENNTKFFHMRMRKKRVRSHIFQIQDSEGNVFDDIHSIQKSATDF  1155

Query  892   YMDLFSEDSTTQLEDLNDAFFPPLHTS---QWLAINAHFTVKDL-EAVFEMAQFKAPSSD  1059
             + DL   ++   L   + +  P + +S   ++L   A   ++++ EAVF + +      D
Sbjct  1156  FRDLMQAEN-CDLSRFDPSLIPRIISSADNEFLC--AAPPLQEIKEAVFNINKDSVAGPD  1212

Query  1060  GFQTSFYQNSW  1092
             GF + FYQ+ W
Sbjct  1213  GFSSLFYQHCW  1223



>ref|XP_007008704.1| Uncharacterized protein TCM_042330 [Theobroma cacao]
 gb|EOY17514.1| Uncharacterized protein TCM_042330 [Theobroma cacao]
Length=2249

 Score =   245 bits (625),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 151/436 (35%), Positives = 232/436 (53%), Gaps = 11/436 (3%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             +   L+    DFF   ++P G   T + L+P   +    + FR I LC V  K++TK ++
Sbjct  1347  IAQDLLDAVRDFFHGANIPRGVTSTTLILLPKKSSASKWSDFRPISLCTVMNKIITKLLS  1406

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
              RL   +  +I   Q+ FV GR I++N+L+ QE++  L +KS +GG + +K+D+ KAYD+
Sbjct  1407  NRLAKVLPSIITENQSGFVGGRLISDNILLAQELIGKLNTKS-RGGNLALKLDMMKAYDK  1465

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             L WSF+   LQ  GF+  WI+ I  C+S    ++  + R   +F  ERG+RQGD +SP L
Sbjct  1466  LDWSFLFKVLQHFGFNGQWIKMIQKCISNCWFSLLLNGRTEGYFKSERGLRQGDSISPQL  1525

Query  1638  FVLYVERLSH----LIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVV  1805
             F++  E LS     L +Q        G+ I+     +SHL F DD++ F   S      +
Sbjct  1526  FIIAAEYLSRGLNALYDQYPSLHYSSGVSIS-----VSHLAFADDVLIFTNGSKSALQRI  1580

Query  1806  KKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGR  1985
                L E+  +SGQR++  KS      N S   +Q I+ + G      L  YLG P   G 
Sbjct  1581  LAFLQEYQEISGQRINVQKSCFVTHTNVSSSRRQIIAQTTGFSHQLLLITYLGAPLYKGH  1640

Query  1986  LKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLE  2165
              K   + DL+++I+ R+TGW+N+ LS  GR TL++SVL+++P Y +Q    P  VL R+ 
Sbjct  1641  KKVILFNDLVAKIEERITGWENKILSPGGRITLLRSVLASLPIYLLQVLKPPICVLERVN  1700

Query  2166  RLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDG  2345
             R+   FLWG S  ++K +  SW K++    +G L I+ L  + +A   KL W+     D 
Sbjct  1701  RIFNSFLWGGSAASKKIHWASWAKISLPIKEGGLDIRNLAEVFEAFSMKLWWRFRTI-DS  1759

Query  2346  LCVKIMEAKVQLPSLP  2393
             L  + M  K     LP
Sbjct  1760  LWTRFMRMKYCRGQLP  1775


 Score = 85.1 bits (209),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 78/308 (25%), Positives = 133/308 (43%), Gaps = 22/308 (7%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHL---  390
             F   +   GL+D G+ G ++TW       N    RLDR + N  W  + P   + HL   
Sbjct  1042  FASTLLDCGLLDGGFEGNSFTWTN-----NRMFQRLDRIVYNHHWINKFPVTRIQHLNRD  1096

Query  391   -----PMVNSYHTLGES--RRFRFNAAW*THPNYQE*VSSTWKSDVS---LEA---NKSN  531
                  P++ S     E     FRF  AW  H +++  V S W   ++   L+A    +  
Sbjct  1097  GSDHCPLLISCFNSSEKAPSSFRFQHAWVLHHDFKTSVESNWNLPINGSGLQAFWSKQHR  1156

Query  532   LSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQE  711
             L + L  WNK   G+IF +      R+   +      Q  +      K   +L++ L  E
Sbjct  1157  LKQHLKWWNKAVFGDIFSKLKEAEKRVEECEILHQQEQTFESRIKLNKSYAQLNKQLNIE  1216

Query  712   ELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAF  891
             EL W  +S  +W+V G+RNT+F+H     ++  S + +++D  G WI D + +      +
Sbjct  1217  ELFWKQKSGVKWVVEGERNTKFFHMRMQKKRIRSHIFKVQDPEGRWIEDQEQLKHSAIEY  1276

Query  892   YMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQ  1068
             +  L   +        +      +  S+   + A  +++++ +AVF +    A   DGF 
Sbjct  1277  FSSLLKVEPCYDSRFQSSLIPSIISNSENELLCAEPSLQEVKDAVFGINSESAAGPDGFS  1336

Query  1069  TSFYQNSW  1092
             + FYQ  W
Sbjct  1337  SYFYQQCW  1344


 Score = 59.7 bits (143),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 64/247 (26%), Positives = 96/247 (39%), Gaps = 41/247 (17%)
 Frame = +2

Query  2789  VWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRC  2968
             V+N+I    VP  I  FLW   HD      K   +GF     C  C++  E I H+M   
Sbjct  1905  VFNFIWHKTVPLTISFFLWRLLHDWIPVELKMKSKGFQLASRCRCCKS-EESIMHVMWDN  1963

Query  2969  PIANSVWESLIPYDHRRL-----*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLW  3133
             P+A  VW     +    +      +Q    WF  G          H + +    T+W+LW
Sbjct  1964  PVATQVWNYFSKFFQILVINPCTINQILGAWFYSG----DYCKPGHIRTLVPIFTLWFLW  2019

Query  3134  KWRNDLVFSGTNINLAARIKW----------------------IRDQVEEINISFSKAKG  3247
               RND       +    RI W                       +   +E  I+F +A+ 
Sbjct  2020  VERNDAKHRNLGM-YPNRIVWRILKLIQQLSLGQQLLKWQWKGDKQIAQEWGITF-QAES  2077

Query  3248  LIAPIESICWRQLKWIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHNIG  3427
             L  P      +   W +P +G  K N+DGS+  S + A  GG +RD  G  + GF  N+G
Sbjct  2078  LPPP------KVFPWHKPSIGEFKLNVDGSAKLSQNAA-GGGVLRDHAGVMVFGFSENLG  2130

Query  3428  LNQRVSS  3448
             +   + +
Sbjct  2131  IQNSLQA  2137



>emb|CAE04866.2| OSJNBa0086O06.14 [Oryza sativa Japonica Group]
Length=1205

 Score =   298 bits (762),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 154/438 (35%), Positives = 248/438 (57%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP +   +  G +K  +I+   +FF TG    G NDTVI ++P    P  +  FR + LC
Sbjct  439   FPARFFQRNWGVLKRDVIEGVREFFETGEWKEGMNDTVIVMIPKTNAPVEMKDFRPVSLC  498

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKG-GL  1418
             NV YK++ K +  RL+  ++ +I   Q++FV GR IT+N LV  E  +S+   + +    
Sbjct  499   NVIYKVVAKCLVNRLRPLLQEIISETQSAFVPGRMITDNALVAFECFHSIHKCTRESQDF  558

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
               +K+DL KAYDR+ W F+   LQK GF   W + IMSCV++ R ++  +  + + F   
Sbjct  559   CALKLDLSKAYDRVDWGFLDGALQKLGFGNIWRKWIMSCVTSVRYSVRLNGNMLEPFYPT  618

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+R+GDPL+P LF+   + LS+++++     Q + +K+ R  P +SHL F DD + F +
Sbjct  619   RGLREGDPLNPYLFLFIADGLSNILQRRRDERQIQPLKVCRSAPGVSHLLFADDSLLFFK  678

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A + QA+ +K+ L+ +   +GQ ++  +  + FS     E Q  I + L +       + 
Sbjct  679   AEVIQATRIKEALDLYERCTGQLINPKECSLLFSALCPQERQDGIKAVLQVERTCFDDKC  738

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG+P+  GR+K + +  +  R + RLT W  R LS  G+  LI+SV  A+P YTM    +
Sbjct  739   LGLPTPDGRMKAEQFQPIKERFEKRLTDWSERFLSLAGKEALIKSVAQALPTYTMGVFKM  798

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P+      E+L R+F WG  KG +K + I+W+K+T  K  G LG + +   NQAL A+  
Sbjct  799   PERFCEEYEQLVRNFWWGHEKGEKKVHWIAWEKLTSPKLLGGLGFRDIRCFNQALLARQA  858

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W+L+   D LC ++++AK
Sbjct  859   WRLIESPDSLCARVLKAK  876


 Score = 65.1 bits (157),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 129/312 (41%), Gaps = 72/312 (23%)
 Frame = +1

Query  235   FREGLI-----DLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             FRE L+     D+G+    +T+    +SPN    RLDRA+ +  W+       ++HL   
Sbjct  185   FREVLVECDLQDIGFQCVPWTYDNNQASPNNVKVRLDRAVASPVWRAMFDQANIMHLTTA  244

Query  400   NSYHT---------LGESRRFRFN---AAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQ  543
              S H          + + RR + N   A W    ++      +W  D  L  N  ++  +
Sbjct  245   CSDHVPLLLEKGGNMQQRRRSKINCFEAVWERVKSFNSIEHESW-DDGGLAKNLGDVRTK  303

Query  544   -------LDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeil  702
                    L  W++  IGNI +     + R       + +  + D      +L+  L E+L
Sbjct  304   LAYTMENLKRWSRDKIGNIKKS----IERCRRELEEMRMRGREDSEPDVHRLKIFLQELL  359

Query  703   YQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGIL-EP  879
             ++EE+ W  RSR  W+  GDRNTR++H   + R   + +++L+ +  E     +G+L +P
Sbjct  360   HREEIWWKQRSRITWLKEGDRNTRYFHLKASWRARKNLIKKLRRSDDEM----NGMLTKP  415

Query  880   FHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLEAVFEMAQFKAPSSD  1059
             F                E+++D                        A+F++   KAP  D
Sbjct  416   FTD--------------EEISD------------------------ALFQIGPLKAPGPD  437

Query  1060  GFQTSFYQNSWA  1095
             GF   F+Q +W 
Sbjct  438   GFPARFFQRNWG  449



>ref|XP_007020288.1| Uncharacterized protein TCM_036737 [Theobroma cacao]
 gb|EOY17513.1| Uncharacterized protein TCM_036737 [Theobroma cacao]
Length=2215

 Score =   242 bits (617),  Expect(2) = 7e-80, Method: Compositional matrix adjust.
 Identities = 151/442 (34%), Positives = 234/442 (53%), Gaps = 24/442 (5%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             +   L +   +FF    +P G   T + L+P   +    ++FR I LC V  K++TK + 
Sbjct  1312  IAHDLFEAVKEFFHGADIPQGMTSTTLVLIPKTTSASKWSEFRPISLCTVMNKIITKILA  1371

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
              RL   +  +I   Q+ FV GR I++N+L+ QE++  L  K+ +GG + +K+D+ KAYDR
Sbjct  1372  NRLAKILPSIITENQSGFVGGRLISDNILLAQELIGKLDQKN-RGGNVALKLDMMKAYDR  1430

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             L WSF+   LQ  GF+  WI  I  C+S    ++  + R   +F  ERG+RQGD +SP L
Sbjct  1431  LDWSFLFKVLQHLGFNAQWIGMIQKCISNCWFSLLLNGRTVGYFKSERGLRQGDSISPQL  1490

Query  1638  FVLYVERLSH----LIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVV  1805
             F+L  E L+     L +Q        G  ++     +SHL F DD++ F   S      +
Sbjct  1491  FILAAEYLARGLNALYDQYPSLHYSSGCSLS-----VSHLAFADDVIIFANGSKSALQKI  1545

Query  1806  KKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLG-----IPIVNDLGRYLGVP  1970
                L E+  LSGQR++  KS +    N +   +Q I  + G     +PI      YLG P
Sbjct  1546  MAFLQEYEKLSGQRINPQKSCVVTHTNMASSRRQIILQATGFSHRPLPIT-----YLGAP  1600

Query  1971  SIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGV  2150
                G  K   + DL+++I+ R+TGW+N+TLS  GR TL++S LS++P Y +Q    P  V
Sbjct  1601  LYKGHKKVMLFNDLVAKIEERITGWENKTLSPGGRITLLRSTLSSLPIYLLQVLKPPVIV  1660

Query  2151  LSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLM  2330
             L R+ RL  +FLWG S  +++ +  SW K+     +G L I+ ++ + +A   KL W+  
Sbjct  1661  LERINRLLNNFLWGGSTASKRIHWASWGKIALPIAEGGLDIRNVEDVCEAFSMKLWWRFR  1720

Query  2331  NKEDGLCVKIMEAKV---QLPS  2387
                + L  + M AK    QLP+
Sbjct  1721  TT-NSLWTQFMRAKYCGGQLPT  1741


 Score = 86.7 bits (213),  Expect(2) = 7e-80, Method: Compositional matrix adjust.
 Identities = 82/314 (26%), Positives = 131/314 (42%), Gaps = 34/314 (11%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHL---  390
             F   +   GL+D G+ G  +TW       N    RLDR + N +W  + P   + HL   
Sbjct  1007  FASVLLDCGLLDGGFEGNPFTWTN-----NRMFQRLDRMVYNQQWINKFPITRIQHLNRD  1061

Query  391   -----PMVNSYHTLGES--RRFRFNAAW*THPNYQE*VSSTWKSDVSLE------ANKSN  531
                  P++ S     E     FRF  AW  H N+   V   W   ++        + +  
Sbjct  1062  GSDHCPLLLSCSNSSEKAPSSFRFLHAWALHHNFNASVEGNWNLPINGSGLMAFWSKQKR  1121

Query  532   LSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQE  711
             L + L  WNK   G+IF        R+   +      Q +       K   +L++ L  E
Sbjct  1122  LKQHLKWWNKTVFGDIFSNIKEAEKRVEECEILHQQEQTIGSRIQLNKSYAQLNKQLSME  1181

Query  712   ELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAF  891
             E+ W  +S  +W+V G+RNT+F+H     ++  S + ++++  G WI D     E     
Sbjct  1182  EIFWKQKSGVKWVVEGERNTKFFHMRMQKKRIRSHIFKIQEQDGNWIEDP----EQLQQS  1237

Query  892   YMDLFSEDSTTQLEDLNDAFFPPLHTSQWLA------INAHFTVKDL-EAVFEMAQFKAP  1050
              +D FS  S  + E  +D  F        ++      + A  T++++ EAVF +    A 
Sbjct  1238  AIDFFS--SLLKAESCDDTRFQSSLCPSIISDTDNGFLCAEPTLQEVKEAVFGIDPESAA  1295

Query  1051  SSDGFQTSFYQNSW  1092
               DGF + FYQ  W
Sbjct  1296  GPDGFSSHFYQQCW  1309



>ref|XP_009103791.1| PREDICTED: uncharacterized protein LOC103829852 [Brassica rapa]
Length=1374

 Score =   258 bits (660),  Expect(2) = 7e-80, Method: Compositional matrix adjust.
 Identities = 144/447 (32%), Positives = 235/447 (53%), Gaps = 12/447 (3%)
 Frame = +3

Query  1131  FFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLI  1310
             FFS G  P   N T +CL+P + NP  +   R I LC + YK++++ +  RLK  +  ++
Sbjct  476   FFSDGSFPRDWNVTQLCLIPKVINPERMVDLRPISLCTIMYKIISRILVSRLKPMLETVV  535

Query  1311  GPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDLEKAYDRLSWSFIRSTL  1487
              P Q++FV  R I++N+++  EV++ LR+        + IK D+ KAYDR+ W ++ + L
Sbjct  536   SPTQSAFVPERLISDNIIIAHEVVHGLRTHQAISSEFIAIKTDMSKAYDRIEWRYLENLL  595

Query  1488  QKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSH  1667
                GF   ++  IM CV++   ++  +         +RG+RQGDPLSP LF L  E LS+
Sbjct  596   TALGFDKKFVDWIMFCVTSVTYSVLINGEEKGNINPKRGLRQGDPLSPFLFDLCTEGLSY  655

Query  1668  LIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQR  1847
             L+ ++   G+ +G+K + +GP I HLFF DD     +AS  Q + ++  L  +   SGQ 
Sbjct  656   LLNKAESMGEIEGIKFSAEGPVIHHLFFADDSFLMVKASDEQCTKLRSILKVYEENSGQM  715

Query  1848  LSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQ  2027
             +S  KS I F    +   +  I   LGI      G+YLG+P      K +    +  +++
Sbjct  716   ISLTKSSITFGAKIAPSRKVKIKEILGIEAEGGTGKYLGLPECFSGSKVEMLQYIQEKMK  775

Query  2028  ARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGN  2207
             +R  GW  R LS  G+  L+++V  A+P + M    LP+     L      F W   +G 
Sbjct  776   SRFHGWYGRFLSAGGKDILLKTVAMAMPVFAMSVFKLPKTTCKNLTSAMSKFWWDVQEGK  835

Query  2208  RKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK-----  2372
              K + ISW+K+   K+QG +G + ++  NQAL AK GW+L+   + LC + + ++     
Sbjct  836   SKIHWISWEKLCLGKNQGGMGFRDIEKFNQALLAKQGWRLLMDSESLCARFLRSRYYPNG  895

Query  2373  ----VQLPSLPSQACQ--MYGRVFLSR  2435
                   L + PS A +  ++GR  L +
Sbjct  896   KFMEASLGARPSYAWRSILFGRQLLEK  922


 Score = 70.1 bits (170),  Expect(2) = 7e-80, Method: Compositional matrix adjust.
 Identities = 72/311 (23%), Positives = 123/311 (40%), Gaps = 30/311 (10%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             F+D +   G+ +L   G ++TW  G+    +  ++LDR   N EWK   P    + L  +
Sbjct  162   FRDCVSVCGMTELSGWGDSFTW-SGVRCKKYIQSKLDRCFGNTEWKRNFPLATQVFLERL  220

Query  400   NS----------YHTLGESRRFRFNAAW*THPNYQE*VSSTWK-----SDVSLEANKSNL  534
              S           H  G    F+F+         +E +   WK        SL      +
Sbjct  221   GSDHKPVLVRLFGHQSGPRGSFKFDKRMVGKQKVRECIMEAWKRQNGNDQRSLSERFGCV  280

Query  535   SKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSV-YQkldlikldrklrreldeilYQ-  708
              + L  W +    N          R+ G++  L   Y          K  +      ++ 
Sbjct  281   RRSLGRWKRECSNN-------SKERLCGLRYDLEAEYSSGVPDWGKIKFLKLEISQAFRD  333

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             EE  W  +SR++W+V+GD NT F+HA+    +  + + +L D+ G+  ++ + + +    
Sbjct  334   EEEFWRQKSRDKWLVAGDNNTSFFHASVKDTRLRNQISKLIDDSGQEATNTEAMGQVAVE  393

Query  889   FYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE---AVFEMAQFKAPSSD  1059
             ++  LFS  +     D+ D F  P   +  +       V D E   AVF +    AP  D
Sbjct  394   YFTSLFSSGAGGDPSDIFDGF--PARVTAEMNRTLLREVSDAEIRDAVFGIKSSSAPGWD  451

Query  1060  GFQTSFYQNSW  1092
             G    F+Q  W
Sbjct  452   GLNGLFFQKYW  462



>gb|EEC83100.1| hypothetical protein OsI_28249 [Oryza sativa Indica Group]
Length=1300

 Score =   297 bits (761),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 151/438 (34%), Positives = 245/438 (56%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP +   +   T+K  +++   +FF TG +P+  N+T I L+P +  P  +  FR I LC
Sbjct  373   FPARFYQRNWPTLKVDILRAVKEFFHTGVMPDDVNETTIVLIPKVAQPSQLKDFRPISLC  432

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGL  1418
             NV YK+++K +  R++  +  ++ P Q++FV GR IT+N L+  E  + + +++S     
Sbjct  433   NVLYKVVSKCLVNRMRPILDEVVSPNQSAFVPGRLITDNALLAFECFHFIQKNRSPNNAA  492

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
                K+DL KAYDR+ W F+   + K GF+  W+  IMSC++T R AI F+  L   F   
Sbjct  493   CAYKLDLSKAYDRVDWRFLEQAMYKMGFAHRWVSWIMSCITTVRYAIKFNGTLLSTFAPT  552

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP LF+   + LS L+E+ V  G    ++I R+ P ISHL F DD + F +
Sbjct  553   RGLRQGDPLSPFLFLFVADGLSLLLEEKVNQGAISPVRICRRAPGISHLLFADDTLLFLK  612

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             ++  QA ++   L ++ + +GQ ++  K  I F + T +  Q  I ++L I       +Y
Sbjct  613   SNKEQAEIINSVLGDYAASTGQLVNPSKCSIMFGEATPLSEQTDIKATLQITNNVFEDKY  672

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG P+  GR+ +  +  L  R+  R+  W    LS  G+  LI+SV+ A+P Y M    L
Sbjct  673   LGFPTPDGRMHKGKFQSLHERVWKRIIQWGENFLSSGGKEVLIKSVMQALPVYVMGIFKL  732

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P  V   L +  R+F WG+  G R+ +  +W  +T+ K  G +G +     NQAL A+  
Sbjct  733   PDSVCEDLSKAVRNFWWGAGDGKRRTHWRAWDSLTKPKQCGGMGFRDFRLFNQALLARQS  792

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W+++   + LC ++++AK
Sbjct  793   WRILEFPESLCARVLKAK  810


 Score = 80.1 bits (196),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 95/224 (42%), Gaps = 29/224 (13%)
 Frame = +2

Query  2786  RVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQR  2965
             + WN + S  VP ++R F+W A  +   T   + ++       C IC    ED+ H + R
Sbjct  961   KAWNQLWSCHVPQKVRIFIWRAASNSLATMVNKKKKRLEHCSMCSICGTEEEDVAHALCR  1020

Query  2966  CPIANSVWESLIPYDHRRL*DQDYTNW------FDEGISELSSGNRKHEQRVTFAVTMWW  3127
             CP A  +WE +     + +  Q   NW      FD  ISE  S     E+R T  + +W 
Sbjct  1021  CPHAKYLWEVM--RRAKAITVQADRNWTGADWIFD--ISERIS----KEERPTLLMMLWR  1072

Query  3128  LWKWRNDLVFSGTNINLAARIKWIRD---------QVEEINISFSK------AKGLIAPI  3262
             +W  RN++      +      ++I           Q  + N+   K      A G     
Sbjct  1073  IWYVRNEITHGKAAVPAEVSQRFISSYITSLLEIRQFPDANLCKGKHVIRCAAAGAQVNH  1132

Query  3263  ESICWRQLKWIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQG  3394
               +    ++W+RPQ GW+K N+DGS  P +     G  +R+ +G
Sbjct  1133  PRVNSVPVRWVRPQAGWMKLNVDGSYDPRDGSGGIGAVLRNSEG  1176



>gb|EEE61581.1| hypothetical protein OsJ_15963 [Oryza sativa Japonica Group]
Length=1494

 Score =   298 bits (764),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 154/438 (35%), Positives = 248/438 (57%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP +   +  G +K  +I+   +FF TG    G NDTVI ++P    P  +  FR + LC
Sbjct  703   FPARFFQRNWGVLKRDVIEGVREFFETGEWKEGMNDTVIVMIPKTNAPVEMKDFRPVSLC  762

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKG-GL  1418
             NV YK++ K +  RL+  ++ +I   Q++FV GR IT+N LV  E  +S+   + +    
Sbjct  763   NVIYKVVAKCLVNRLRPLLQEIISETQSAFVPGRMITDNALVAFECFHSIHKCTRESQDF  822

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
               +K+DL KAYDR+ W F+   LQK GF   W + IMSCV++ R ++  +  + + F   
Sbjct  823   CALKLDLSKAYDRVDWGFLDGALQKLGFGNIWRKWIMSCVTSVRYSVRLNGNMLEPFYPT  882

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+R+GDPL+P LF+   + LS+++++     Q + +K+ R  P +SHL F DD + F +
Sbjct  883   RGLREGDPLNPYLFLFIADGLSNILQRRRDERQIQPLKVCRSAPGVSHLLFADDSLLFFK  942

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A + QA+ +K+ L+ +   +GQ ++  +  + FS     E Q  I + L +       + 
Sbjct  943   AEVIQATRIKEALDLYERCTGQLINPKECSLLFSALCPQERQDGIKAVLQVERTCFDDKC  1002

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG+P+  GR+K + +  +  R + RLT W  R LS  G+  LI+SV  A+P YTM    +
Sbjct  1003  LGLPTPDGRMKAEQFQPIKERFEKRLTDWSERFLSLAGKEALIKSVAQALPTYTMGVFKM  1062

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P+      E+L R+F WG  KG +K + I+W+K+T  K  G LG + +   NQAL A+  
Sbjct  1063  PERFCEEYEQLVRNFWWGHEKGEKKVHWIAWEKLTSPKLLGGLGFRDIRCFNQALLARQA  1122

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W+L+   D LC ++++AK
Sbjct  1123  WRLIESPDSLCARVLKAK  1140


 Score = 97.4 bits (241),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 81/312 (26%), Positives = 145/312 (46%), Gaps = 30/312 (10%)
 Frame = +1

Query  235   FREGLI-----DLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             FRE L+     D+G+ G  +T+    +SPN    RLDRA+ +  W+       ++HL   
Sbjct  407   FREVLVECDLQDIGFQGVPWTYDNNQASPNNVKVRLDRAVASPVWRAMFDQANIMHLTTA  466

Query  400   NSYHT---------LGESRRFRFN---AAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQ  543
              S H          + + RR + N   A W    ++      +W  D  L  N  ++  +
Sbjct  467   CSDHVPLLLEKGGNMQQRRRSKINCFEAVWERVKSFNSIEHESW-DDGGLAKNLGDVRTK  525

Query  544   -------LDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeil  702
                    L  W++  IGNI +     + R       + +  + D      +L+  L E+L
Sbjct  526   LAYTMENLKRWSRDKIGNIKKS----IERCRRELEEMRMRGREDSEPDVHRLKIFLQELL  581

Query  703   YQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPF  882
             ++EE+ W  RSR  W+  GDRNTR++H   + R   + +++L+ + G   S  + + E  
Sbjct  582   HREEIWWKQRSRITWLKEGDRNTRYFHLKASWRARKNLIKKLRRSDGMMCSKEEELGEIA  641

Query  883   HAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSD  1059
              +F+ DL+++D +    +L + F P +       +   FT +++ +A+F++   KAP  D
Sbjct  642   RSFFRDLYTKDESLNPGELLNMFEPKITDEMNGMLTKPFTDEEISDALFQIGPLKAPGPD  701

Query  1060  GFQTSFYQNSWA  1095
             GF   F+Q +W 
Sbjct  702   GFPARFFQRNWG  713



>ref|XP_008372905.1| PREDICTED: uncharacterized protein LOC103436258 [Malus domestica]
Length=1222

 Score =   293 bits (750),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 154/408 (38%), Positives = 235/408 (58%), Gaps = 1/408 (0%)
 Frame = +3

Query  1152  PNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSF  1331
             P   N T I L+P +P+P  V+QFR I LCN SYK+L+K +  RLK  + MLI P Q +F
Sbjct  326   PTSLNATYIVLIPKVPHPETVSQFRPISLCNYSYKVLSKVLANRLKVILPMLISPSQNAF  385

Query  1332  VLGRQITNNVLVYQEVLNSLRSKSGKGGL-MVIKIDLEKAYDRLSWSFIRSTLQKAGFSP  1508
             V GRQI +N+ +  E+ + L+ ++ K    M +K+D++KAYDR+ W F+ + +++ GF  
Sbjct  386   VAGRQIQDNIGIAHEMFHFLKGRTAKRKFEMGVKLDMQKAYDRVEWDFLDAVMERMGFCC  445

Query  1509  DWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVK  1688
              W R +M CVS+   A+  + +    F   RG+RQGDPLSP LF++  E LS +I+ ++ 
Sbjct  446   LWRRLVMGCVSSVNFAVLLNGQPGNKFAPSRGLRQGDPLSPYLFIILGEVLSCMIQAAID  505

Query  1689  NGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*  1868
             + Q + ++I   GP ISHLFF DD + F  A  +    +   ++ +C  SG +++  KS 
Sbjct  506   DKQLERVRIGVSGPIISHLFFADDTLLFLRAGDNYCRNLLSIIDRYCXASGXKVNLQKSS  565

Query  1869  IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWK  2048
             I+F  N    +   +   LG+ +V++ G YLGVP I GR K+   A +  RI  +L GWK
Sbjct  566   IYFGANVPKGVAANLGGILGVSVVDNPGTYLGVPXIWGRSKKRGLAYVKGRILGKLQGWK  625

Query  2049  NRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLIS  2228
                LS  GR  LI++V+ AIP Y M     P  V   L+ L   F WGS   +RK + +S
Sbjct  626   QSALSRAGREVLIKAVVQAIPAYPMCIFKFPXVVCXELDALVARFWWGSHGZBRKIHWVS  685

Query  2229  WKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
              + +   KD G LG +     N AL AK  W+L+ + + L  ++++A+
Sbjct  686   KZVLGLPKDMGGLGFRNFXEFNXALLAKQCWRLLTEPNSLWARVIKAR  733


 Score = 34.7 bits (78),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 50/118 (42%), Gaps = 3/118 (3%)
 Frame = +1

Query  745   WIVSGDRNTRFY-HAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDST  921
             W+ + D N   + H  +   +  + + ++KD+   W+     + +     ++  F+    
Sbjct  189   WLCARDFNEFLWDHEKSGEWRRRNQIIKIKDD-ENWVEQPGRVRKLVEDHFIQTFTSGEA  247

Query  922   TQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSFYQNSW  1092
                  L D   P +      A+    +  +++ A+F+M   KA   DGFQ  FYQ+ W
Sbjct  248   RNWGSLLDCISPRVSEEMNQALLKPVSEDEIKTAIFKMGGLKAQGPDGFQGIFYQSYW  305


 Score = 61.2 bits (147),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 57/212 (27%), Positives = 91/212 (43%), Gaps = 8/212 (4%)
 Frame = +2

Query  2774  STYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDH  2953
             S  + +W  I  L VP +IR FLW++ H    T      R  +    C +C++  E ++H
Sbjct  885   SISKTLWKCIWQLAVPQKIRHFLWVSLHLGLPTGKALCTRRLSPFPSCPLCQSADETVEH  944

Query  2954  IMQRCPIANSVW-ESLIPYDHRRL*DQDYTNWFDEGISE--LSSGNRK-HEQRVTFAVTM  3121
             +  RC    +VW    + Y         +  W     S    SS NR+  +  V+F  + 
Sbjct  945   VFLRCSWVAAVWFGGALNYKVDAAGIDSWARWLQTVFSSNWGSSTNRQWFQAYVSF--SC  1002

Query  3122  WWLWKWRNDLVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAP-IESICWRQLKWIR  3298
             W++WK R D VF+   IN +  I  +        ++ S + G+  P   S     ++W  
Sbjct  1003  WFIWKARCDFVFNQVPINPSKVIFSLSTAFGNFLLAVS-SLGIARPVSVSQEEVVVRWCP  1061

Query  3299  PQVGWVKANIDGSSIPSNSIARCGGFIRDDQG  3394
             P   +VK N+D S   S+ +   G   R D G
Sbjct  1062  PASPFVKINVDASWSKSSWMGFAGVVARQDGG  1093



>ref|XP_008244613.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=930

 Score =   292 bits (748),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 156/404 (39%), Positives = 238/404 (59%), Gaps = 1/404 (0%)
 Frame = +3

Query  1164  NDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGR  1343
             N T I L+P +  P   NQFR IGLCN SYK+L K +  RLKS +  +I   Q +FV  R
Sbjct  32    NKTFIALIPKVQAPVSTNQFRPIGLCNNSYKILAKVIANRLKSILPDIISENQNAFVPER  91

Query  1344  QITNNVLVYQEVLNSLRSKSGKGGLMV-IKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIR  1520
             QI +N+L+  E  + L+ K+  G     +KID+ KAYDR+ W F+ + + K GF+  WI 
Sbjct  92    QIQDNILMAHETFHYLKLKNSGGVHEAGLKIDMNKAYDRIEWDFLEAVMMKMGFARVWIN  151

Query  1521  NIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQW  1700
              IM+C+ST   A+  + +  K+F   RG+RQGDPLSP LF+L  E LS  +  +V NG+ 
Sbjct  152   LIMNCISTVSFAVIINGQPGKFFKPTRGLRQGDPLSPCLFLLVSEALSRNLSSAVHNGEI  211

Query  1701  KGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFS  1880
             KG++I R+ P ISHLFF DD +FF +A       +K+ L+++C  SGQ ++  KS +FFS
Sbjct  212   KGIRIARRCPMISHLFFADDALFFVKAEAQNCMKLKEKLDKYCLASGQCINSQKSSLFFS  271

Query  1881  KNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTL  2060
              NT    +  I + + I  V++ G YLG+P+I GR K  +   +  RI+ ++ GWK  +L
Sbjct  272   PNTPANTRHDICTLMNINGVDNPGIYLGLPTIWGRSKNAALGYIKERIRKKIDGWKLNSL  331

Query  2061  SFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKV  2240
             S  G+   ++ V +A+P + M     P+G  +++      F WG+++ +   +  SWKK+
Sbjct  332   SLAGKEVPLKVVATAVPAFPMTCFRFPEGTCNQINSDLASFWWGNNEESAGIHWKSWKKL  391

Query  2241  TESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
               +K  G LG + L   N AL AK  W+++   +   VKI++A+
Sbjct  392   CLAKKVGGLGFRDLSNFNLALIAKQSWRIILNPEAAWVKILKAR  435


 Score = 72.0 bits (175),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 92/208 (44%), Gaps = 10/208 (5%)
 Frame = +2

Query  2789  VWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRC  2968
             VW  I  ++   +I+ FLW A      T     +R   ++  C IC    E ++HI+  C
Sbjct  592   VWKTIWKVETLPKIKLFLWRALSGYISTRLALFKRKIATDPICPICEGFEESVEHILFLC  651

Query  2969  PIANSVW-ESLIPY--DHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWW-LWK  3136
             P    VW  S + Y  D RR+    +  W +  IS   +     +  ++F   + W +WK
Sbjct  652   PWTQLVWFGSNLSYKVDPRRI--STFDRWIEGIISIPGTSRTDGDFLLSFLSFLCWEIWK  709

Query  3137  WRNDLVFSGTNINLAARIKWIRDQVEEINISFSK--AKGLIAPIESICWRQLKWIRPQVG  3310
              R   VF+G + +    I   RD   E     SK  A+G ++P+  +  +  +W +P   
Sbjct  710   ARCKFVFNGVSPDPRLVITHARDACSEYLAVVSKVDARGNLSPVHHV--QGTRWSKPGPN  767

Query  3311  WVKANIDGSSIPSNSIARCGGFIRDDQG  3394
             +VK N+DGS +P       G   R+  G
Sbjct  768   YVKFNLDGSWLPGTMKGSIGIVSRNSSG  795



>ref|XP_007227312.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
 gb|EMJ28511.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
Length=992

 Score =   293 bits (751),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 157/437 (36%), Positives = 246/437 (56%), Gaps = 1/437 (0%)
 Frame = +3

Query  1065  PNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCN  1244
             P     K+   V   + +   DF ++G L    N T + L+P + +P  ++Q R I LCN
Sbjct  97    PPIFFQKYWHIVGSDVTRAIKDFLTSGRLLQKINFTHVVLIPKVKHPKDMSQLRPISLCN  156

Query  1245  VSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGG-LM  1421
             V +K+ TK +  RLK  +  +I P Q++ + GR I++N ++  E+++ LR +       M
Sbjct  157   VLFKIATKVLANRLKLILDKIISPSQSALISGRLISDNTILAAEIIHYLRRRRRGKKGFM  216

Query  1422  VIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLER  1601
              +K+D+ KAYDR+ WSF+ + ++K GF+  WI+ +++C+ST   +   +     +    R
Sbjct  217   ALKMDMSKAYDRIEWSFLEAIMRKLGFAEQWIQLMLTCISTVSYSFVINGTPHGFLHPSR  276

Query  1602  GIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEA  1781
             G+RQGDPLSP LF+L  E L+ LI Q  + G  KG+ I R  P ISHLFF DD   F  A
Sbjct  277   GLRQGDPLSPYLFLLCAEGLTALIAQKEREGFLKGVSICRGAPAISHLFFADDSFLFAWA  336

Query  1782  SLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYL  1961
             ++     +K  L+ +    GQ++++ KS + FSKN     Q  ++  +GIP V+   +YL
Sbjct  337   NMADCMALKDILDTYERALGQQVNFQKSAVCFSKNVHRGDQLMLAQFMGIPCVDHHSQYL  396

Query  1962  GVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLP  2141
             G+P +  + K  S+  L  R+  +L  WK + LS  G+  LI+ V  AIP YTM   LLP
Sbjct  397   GLPMVLDKKKGASFNHLKERLWKKLQTWKGKLLSGAGKEILIKVVAQAIPIYTMSCFLLP  456

Query  2142  QGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGW  2321
             + V   L +L   F W SS  N+K + ++W ++   K++G LG + L   N AL AK GW
Sbjct  457   KYVCEDLNKLVAQFWWNSSTENKKIHWMAWDRLCAPKEEGGLGFRNLHAFNLALLAKQGW  516

Query  2322  KLMNKEDGLCVKIMEAK  2372
             +L+   D L  K+++AK
Sbjct  517   RLLQNPDSLVTKVLKAK  533



>emb|CCA66235.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1380

 Score =   249 bits (636),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/439 (33%), Positives = 240/439 (55%), Gaps = 11/439 (3%)
 Frame = +3

Query  1074  LLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSY  1253
              + K    +K+ + +   +F+++  LP GCN   I L+P   +P     FR I +    Y
Sbjct  455   FIKKAWDVIKEEIYETVQEFWNSSRLPKGCNMAFIALIPKTDSPKGFQDFRPISMVGCVY  514

Query  1254  KMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKI  1433
             K++ K +T+RL+  M  L+GP Q+SF+ GR I ++ L+  E+++S   K  K    ++KI
Sbjct  515   KIVAKLLTMRLQKVMNSLVGPAQSSFIEGRHILDSALIAGELIDS--CKRWKTSSSLLKI  572

Query  1434  DLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQ  1613
             D  KA+D +SW+F+  TL+K  F   W + I +CV+T+  ++  +   S  F L++G+RQ
Sbjct  573   DFHKAFDSVSWAFLDWTLEKMNFPIQWRQWIQTCVTTASSSVLINGSPSPPFKLQKGLRQ  632

Query  1614  GDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQ  1793
             GDPLSP LFVL VE L+ LI +++  G W+G+++++ G  +SHL + DD + F    +  
Sbjct  633   GDPLSPFLFVLVVETLNLLINKAISLGFWEGVEVSKGGLKLSHLQYADDTLIFCAPRIDY  692

Query  1794  ASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSL----GIPIVNDLGRYL  1961
                +KK L  F   SG ++++ KS +     ++  ++ A +S L     +P       YL
Sbjct  693   LQNIKKVLILFHLASGLQINFHKSSLIGINVSNQWMKDATASLLCKGGSLPF-----NYL  747

Query  1962  GVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLP  2141
             G+P      +  ++  ++ RI  +L  WK R LS  GR TLI+S +S++P Y M    +P
Sbjct  748   GLPIGGDSSRIKTWEPILERISKKLDSWKGRLLSIGGRVTLIKSSISSLPLYFMSLFPIP  807

Query  2142  QGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGW  2321
             + V+ ++ +L R FLW   +G R  + ++WK +   K  G LGI  +   N AL  K  W
Sbjct  808   RSVIEQINKLQRHFLWSGDRGKRALSQVAWKVIELPKAFGGLGIGNIFHRNLALLFKWIW  867

Query  2322  KLMNKEDGLCVKIMEAKVQ  2378
             K  N    L  +++  K +
Sbjct  868   KFFNDTSPLWRELIWHKYK  886


 Score = 78.2 bits (191),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 79/292 (27%), Positives = 133/292 (46%), Gaps = 34/292 (12%)
 Frame = +1

Query  277   YTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVL--------HLPMV-NSYHTLGESR  429
             +TW +G S      ++LDR   N EW    P +++         H P++ NS       +
Sbjct  183   FTWFRGNSK-----SKLDRCFVNPEWLTHYPTLKLSLLNRGLSDHCPLLLNSSVRNWGPK  237

Query  430   RFRFNAAW*THPNYQE*VSSTWK--SDVSLEANKSNLSKQLDDWNKHTIGNI------FR  585
              F+F   W + P     V  TW+  S + L      + K L DWN+   GNI        
Sbjct  238   PFKFQNCWLSDPRCMRLVKDTWQKSSPMGLVQKLKTVKKDLKDWNEKVFGNIEANIKQLE  297

Query  586   RK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREEWIVSGDR  765
              +   L +IS  +R L  ++     K    L   +      +E  W  +SR +W+  GDR
Sbjct  298   HEINQLDKISN-ERDLDSFELEKKKKAQVDLWSWMKT----KESYWSQQSRIKWLKQGDR  352

Query  766   NTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTTQ--LEDL  939
             NT+F+H   ++RK  +++  ++ N G+ IS+ + I      ++   F E+S  +  LE L
Sbjct  353   NTKFFHVVASIRKHRNSITSIEVN-GDKISEPEKIKLEAMKYFRKAFKEESYNRPLLEGL  411

Query  940   NDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQTSFYQNSW  1092
             +   F  L  +Q   + A F+ +++ +AV   +  KAP  DGF  +F + +W
Sbjct  412   D---FKHLTEAQSADLIAPFSHEEIDKAVASCSSDKAPGPDGFNFTFIKKAW  460


 Score = 58.9 bits (141),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 59/222 (27%), Positives = 92/222 (41%), Gaps = 37/222 (17%)
 Frame = +2

Query  2816  VPYRIRTFLWLARHDCHMTNTKRARRGFT--SEVFCGICRNLPEDIDHIMQRCPIANSVW  2989
             VP+R+  F+W+A      T  K A  G    SE  C +C   PE  +H++  CP + S+W
Sbjct  1055  VPHRVEIFVWMALLGRINTRCKLASIGIIPQSENICVLCNTSPEQHNHLLLHCPFSLSLW  1114

Query  2990  ---------ESLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWR  3142
                      + ++P   R L        FD+ +S + +   K     TF +  W +WK R
Sbjct  1115  NWWLDLWRLKWVLPETLRGL--------FDQWLSPIKTPFFKKVWAATFFIISWSIWKER  1166

Query  3143  NDLVFSGTNINLAA-------RIK-WIRDQVEEINISFSKAK---------GLIA-PIES  3268
             N  +F  T+   ++       R+  WI    E    S +  +         G I  P+++
Sbjct  1167  NSRIFENTSSPPSSLHDLILLRLGWWISGWDEAFPYSPTDIQRNPQCLVWGGKIPHPLQA  1226

Query  3269  ICWRQLKWIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQG  3394
                    W  P  G +K N+D S  P N  A  GG +R+  G
Sbjct  1227  PHPSSAIWTPPDHGSLKWNVDASYNPLNHRAAVGGVLRNHLG  1268



>emb|CCA65995.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1389

 Score =   297 bits (761),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 165/474 (35%), Positives = 265/474 (56%), Gaps = 8/474 (2%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP     K+   +  S+ +    FF +G++    N T + L+P +  P   N FR I LC
Sbjct  467   FPPYFFQKYWTLIGKSVCRAVQAFFHSGYMLKEVNHTFLALIPKVDKPVNANHFRPISLC  526

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLM  1421
             +  YK+++K +T RLK  +  +I P Q +F+  R I +N+L+  EV +S ++K+G+GG +
Sbjct  527   STIYKVISKIITNRLKITLGKIIHPLQGAFIPERLIQDNILIAHEVFHSFKNKTGRGGWI  586

Query  1422  VIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLER  1601
              IK+D+EKAYDRL W +I +T+ K GFSP WI  I SC+S++  ++  +    + F   R
Sbjct  587   AIKLDMEKAYDRLEWKYIYTTMDKMGFSPIWIEWIRSCISSASFSVLVNGIPGERFFPSR  646

Query  1602  GIRQGDPLSPLLFVLYVERLSHLIEQSVKN-GQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             GIRQGDPLSP LF+L  E L+    ++    G+  G+ I R    I  L F DD + F +
Sbjct  647   GIRQGDPLSPYLFILCAELLAREFSKACHEPGKLIGVPIGRTRTRIPFLTFADDTMIFAK  706

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A+      +++ L+++C +SGQ ++Y KS    S N     +   +S LG+   ++LG Y
Sbjct  707   ATEASCHKIRQILDKYCLMSGQLVNYHKSAFQCSPNVRDIDKVNFASILGMQESSELGDY  766

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG P I+ R+ ++++A ++S+   +L  WK  +LS  GR+ LIQS L++   + MQS  L
Sbjct  767   LGCPIINSRVTKETFAGVISKTVQQLPKWKANSLSQAGRTVLIQSNLASKASFQMQSFTL  826

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P+ VL+ L+   R+F W      +  N I W K+ + K  G +G ++ +  N AL  KL 
Sbjct  827   PKKVLTTLDTTYRNFFWNKDPAAKSANFIGWNKICQPKSVGGVGFRKAEVTNIALQMKLL  886

Query  2319  WKLMNKEDGLCVKIM------EAKVQLPSLPSQACQMYGRVFLSRRQSF*KGAK  2462
             WK+M  +D + VK++      E  + +  +PS A   + +  L  R  F KG +
Sbjct  887   WKIMVSKDNIWVKLVTQKYLKEQNLLVCKIPSNASWQW-KNLLRHRNFFSKGLR  939


 Score = 80.5 bits (197),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 77/306 (25%), Positives = 132/306 (43%), Gaps = 30/306 (10%)
 Frame = +1

Query  253   DLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHTL-----  417
             ++ ++G  +TW +    PN    RLDR + +  W +  P   + H    +S H       
Sbjct  177   EISFTGQIFTWRKKKDGPNNIHERLDRGVASTSWLMLFPHAFLKHHIFTSSDHCQISLEY  236

Query  418   -----GESRRFRFNAAW*THPNYQE*VSSTWKSDVSLE-----ANKSNLSK-QLDDWNKH  564
                   ++  FRF   W T  +Y   V  TW +            K  L K    +WNK 
Sbjct  237   LANNKSKAPPFRFEKMWCTRKDYDSLVKRTWCTKFYGSHMFNFVQKCKLVKINSKEWNKT  296

Query  565   TIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQ-EELLWF*RSRE  741
               GNIFR+  +V  R+  +QR+L +      +K  ++L       L +     W  + + 
Sbjct  297   QFGNIFRQLRQVDERLEEIQRNLLIDHNNTSLKTQQELFLAKRNKLLEYNTTYWKQKCKS  356

Query  742   EWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGI-LEPFHAFYMDLFSEDS  918
             +++V GD N++FYH   ++RK  + ++    +  + I+  D I  E   AF     S  +
Sbjct  357   DFMVLGDTNSKFYHTHASIRKYRNQIKEFIPDNAQPITQPDLIEKEITLAFKKRFISNPA  416

Query  919   TTQLEDLNDAFFPPLHTSQWLAINAHFT-------VKDLEAVFEMAQFKAPSSDGFQTSF  1077
                 ++++     P+ +    A NA+ T       +K+  AVF++A  K+P  DGF   F
Sbjct  417   CKFNQNVDFNLLSPIVSE---ADNAYLTSAVSPEEIKN--AVFDLAPDKSPGPDGFPPYF  471

Query  1078  YQNSWA  1095
             +Q  W 
Sbjct  472   FQKYWT  477


 Score = 56.2 bits (134),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 87/216 (40%), Gaps = 22/216 (10%)
 Frame = +2

Query  2792  WNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCP  2971
             +N+I  +  P +I+ FLW A +D   T ++  R        C  C    E I H+  +CP
Sbjct  1049  FNWIWGIHAPPKIKNFLWKACNDGLATTSRLERSHIFVPQNCCFCDCPSETICHLCFQCP  1108

Query  2972  IANSVWESLIPYDHRRL*DQDYTNWFD-------EGISELSSGNRKHEQRVTFAVTMWWL  3130
                 ++  L      +     Y +WF          + E    N   E     ++  W +
Sbjct  1109  FTLDIYSHL----EDKFQWPAYPSWFSTLQLSSFRSVLEACHINLTLEYLTKLSIVWWHV  1164

Query  3131  WKWRNDLVFS--GTNINLAARI------KWIRDQVEEINISFSKAKGLIAPIESICWRQL  3286
             W +RN L+F+   T+ + A+ I      KW +  +E  + +    K    P+ S   + L
Sbjct  1165  WYFRNKLIFNNESTSFSQASFIIHSFMGKWEKANLEIPSFNTPLPKDCKLPVRS--GKNL  1222

Query  3287  KWIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQG  3394
              W  P    +K N DGS +  N  A  G  IR+  G
Sbjct  1223  IWSPPNEDVLKVNFDGSKL-DNGQAAYGFVIRNSNG  1257



>ref|XP_009102787.1| PREDICTED: uncharacterized protein LOC103828902 [Brassica rapa]
Length=938

 Score =   292 bits (747),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 161/453 (36%), Positives = 253/453 (56%), Gaps = 12/453 (3%)
 Frame = +3

Query  1107  SLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRL  1286
             S+I+    FFSTG +P   N+T + L+P I     V ++R I LCNV YK+++K ++LRL
Sbjct  77    SIIQEIQRFFSTGIMPTSLNETHVRLIPKIQGAKRVEEYRPIALCNVYYKVISKLLSLRL  136

Query  1287  KSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAYDRLS  1463
             K  ++ +I   Q++F+ GR IT+NVL+  EVL  L+ S++ K   M +K+D+ KAYDR+ 
Sbjct  137   KPVLKEIISENQSAFIPGRAITDNVLITHEVLQYLKTSQAKKQCSMAVKMDMSKAYDRVE  196

Query  1464  WSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFV  1643
             W F+   + + GF   WI  +M C+ST   +   +  +       RGIRQGDP+SP LF+
Sbjct  197   WEFLLQVMTRLGFHSKWINWVMQCISTVSYSFLINDSVYGKVKPHRGIRQGDPISPYLFI  256

Query  1644  LYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNE  1823
             L  E LS L   +  +G  +G+++ R  P ++HL F DD + F  +S      + K L E
Sbjct  257   LCGELLSGLCRNAELDGTMRGIRVARGSPRVNHLLFADDTMMFCNSSSESCLSLSKILRE  316

Query  1824  FCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSY  2003
             +   SGQ+++  KS I FS  T  E +      LGI     +G+YLG+P   GR K+D +
Sbjct  317   YERASGQKVNISKSSITFSVKTPQETKSVAKHILGIHKEGGVGKYLGLPEHFGRRKRDLF  376

Query  2004  ADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDF  2183
               ++ RI+ R + W  R LS  G+ T+++SVL+AIP Y M    LP  +  R++     F
Sbjct  377   TSIVDRIRQRASNWSTRFLSRAGKLTMLKSVLTAIPTYAMSCFQLPMSLCKRIQSTLTRF  436

Query  2184  LWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIM  2363
              W  +   RK   ++W K+T+ K  G LG++ +   NQAL AK+ W+++   + L  +++
Sbjct  437   WWDDTTEKRKMCWVAWDKLTKPKASGGLGLRDIQIFNQALLAKVAWRVLTVPNCLLARVL  496

Query  2364  EAK---------VQLPSLPSQACQ--MYGRVFL  2429
               K          QLP++ S   +  ++GR  L
Sbjct  497   TGKYCHKRSFLEAQLPAVCSHGWRSILHGRDLL  529



>gb|AAD21778.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1715

 Score =   254 bits (648),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/414 (34%), Positives = 225/414 (54%), Gaps = 19/414 (5%)
 Frame = +3

Query  1131  FFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLI  1310
             FF +  + N  N T ICL+P I +P  ++ +R I LC  SYK+++K +  RLK  +  +I
Sbjct  836   FFESDVMDNQINQTQICLIPKIIDPKHMSDYRPISLCTASYKIISKILIKRLKQCLGDVI  895

Query  1311  GPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDLEKAYDRLSWSFIRSTL  1487
                Q +FV G+ I++NVLV  E+L+SL+S+   + G + +K D+ KAYDR+ W+F+   +
Sbjct  896   SDSQAAFVPGQNISDNVLVAHELLHSLKSRRECQSGYVAVKTDISKAYDRVEWNFLEKVM  955

Query  1488  QKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSH  1667
              + GF+P W++ IM+CV++    +  +          RGIRQGDPLSP LF+   E LS+
Sbjct  956   IQLGFAPRWVKWIMTCVTSVSYEVLINGSPYGKIFPSRGIRQGDPLSPYLFLFCAEVLSN  1015

Query  1668  LIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQR  1847
             ++ ++  N Q  GMKIT+    ISHL F DD +FF  AS      +     ++   SGQ+
Sbjct  1016  MLRKAEVNKQIHGMKITKDCLAISHLLFADDSLFFCRASNQNIEQLALIFKKYEEASGQK  1075

Query  1848  LSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQ  2027
             ++Y KS I F +      +Q +   LGI  V   G+YLG+P   GR K + +  ++++++
Sbjct  1076  INYAKSSIIFGQKIPTMRRQRLHRLLGIDNVRGGGKYLGLPEQLGRRKVELFEYIVTKVK  1135

Query  2028  ARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGN  2207
              R  GW    LS  G+  +I+++  A+P Y+M   LLP  + + +  L   F WG     
Sbjct  1136  ERTEGWAYNYLSPAGKEIVIKAIAMALPVYSMNCFLLPTLICNEINSLITAFWWG-----  1190

Query  2208  RKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEA  2369
                           +++G LG + L   N+AL AK  W+++     L  ++ + 
Sbjct  1191  -------------KENEGDLGFKDLHQFNRALLAKQAWRILTNPQSLLARLYKG  1231


 Score = 73.2 bits (178),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 72/311 (23%), Positives = 127/311 (41%), Gaps = 30/311 (10%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             F + I    + DL   G  Y+W+    +   +   LDR   N +W+   P  E   LP+ 
Sbjct  522   FTNMINCCNMKDLKSKGNPYSWVGKRQNETIESC-LDRVFINSDWQASFPAFETEFLPIA  580

Query  400   NSYH----------TLGESRRFRFNAAW*THPNYQE*VSSTWKSDVS---------LEAN  522
              S H             +  +FR++       ++ + V   W    S         L   
Sbjct  581   GSDHAPVIIDIAEEVCTKRGQFRYDRRHFQFEDFVDSVQRGWNRGRSDSHGGYYEKLHCC  640

Query  523   KSNLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeil  702
             +  L+K    W + T  N   +   +  R+   +R  ++  +  L       +       
Sbjct  641   RQELAK----WKRRTKTNTAEKIETLKYRVDAAERDHTLPHQTILRLRQDLNQAYR----  692

Query  703   YQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPF  882
               EEL W  +SR  W++ GDRNT F++A+T +RKS + ++ + D  G      D I +  
Sbjct  693   -DEELYWHLKSRNRWMLLGDRNTMFFYASTKLRKSRNRIKAITDAQGIENFRDDTIGKVA  751

Query  883   HAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSD  1059
               ++ DLF+   T+  E++     P +       +    T +++ +AVF +   +AP  D
Sbjct  752   ENYFADLFTTTQTSDWEEIISGIAPKVTEQMNHELLQSVTDQEVRDAVFAIGADRAPGFD  811

Query  1060  GFQTSFYQNSW  1092
             GF  +FY + W
Sbjct  812   GFTAAFYHHLW  822


 Score = 61.2 bits (147),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 84/207 (41%), Gaps = 19/207 (9%)
 Frame = +2

Query  2810  LKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCPIANSVW  2989
             LK+  +I+ F+W        T T+   R   ++  C  C N  E I+HI+  C  A  VW
Sbjct  1391  LKITPKIKHFIWRCLSGALSTTTQLRNRNIPADPTCQRCCNADETINHIIFTCSYAQVVW  1450

Query  2990  ESLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVT----MWWLWKWRNDLVF  3157
              S       RL    +T+  +E I  +  G +     +   +     MW LWK RN+ +F
Sbjct  1451  RSANFSGSNRL---CFTDNLEENIRLILQGKKNQNLPILNGLMPFWIMWRLWKSRNEYLF  1507

Query  3158  SGTNI---NLAAR-----IKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGW  3313
                +     +A +      +W+   V +  IS + A+    P+     R  +W  P  G+
Sbjct  1508  QQLDRFPWKVAQKAEQEATEWVETMVNDTAISHNTAQSNDRPLS----RSKQWSSPPEGF  1563

Query  3314  VKANIDGSSIPSNSIARCGGFIRDDQG  3394
             +K N D   +        G  +RD  G
Sbjct  1564  LKCNFDSGYVQGRDYTSTGWILRDCNG  1590



>gb|EEE69906.1| hypothetical protein OsJ_29747 [Oryza sativa Japonica Group]
Length=1139

 Score =   294 bits (753),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 159/439 (36%), Positives = 240/439 (55%), Gaps = 21/439 (5%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP +   +  G +K  +++   +FF +G +P G NDT I L+P I  P  +   R I LC
Sbjct  701   FPARFYQRNWGGLKSDIVRAVKEFFRSGIMPAGVNDTAIVLIPKIDQPTELKDLRPISLC  760

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGL  1418
             NV YK+++K +  RL+  +  LI   Q++FV GR IT+N L+  E  + + ++K+     
Sbjct  761   NVIYKVVSKCLVNRLRPLLDELISVNQSAFVPGRMITDNALLAFECFHYIQKNKNPNKAA  820

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
                K+DL KAYDR+ W F+   + K GF+  W+R IM C++T R ++ F+  L   F   
Sbjct  821   SAYKLDLSKAYDRVDWGFLEQAMYKLGFAHRWVRWIMECITTVRYSVKFNGTLLHSFAPS  880

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+ QGDPLSP LF+   + LS L+++ V+ G    + I R  P ISHL F DD + F +
Sbjct  881   RGLCQGDPLSPFLFLFLADGLSLLLDEKVQQGVLSPIHICRSAPGISHLLFTDDTLLFLK  940

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVE-IQQAISSSLGIPIVNDLGR  1955
             A   QA V+++ LN++                    T+ E +Q+AI  +L I       +
Sbjct  941   AVPEQAEVIREVLNDYA-------------------TATELVQEAIRDTLQIANNVFEDK  981

Query  1956  YLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSL  2135
             YLG P+  GRLK+  +  +  RI  RL  W    LS  G+  LI++V+ AIP Y M    
Sbjct  982   YLGFPTPDGRLKKGKFQSIQERIWKRLIQWGENYLSSGGKEILIKAVIQAIPVYVMGIFK  1041

Query  2136  LPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKL  2315
             LP+ V   L R++R F WG  KG RK +  +W  +T+ K+ G LG +     NQAL A+ 
Sbjct  1042  LPESVCDELTRITRGFWWGGEKGVRKTHWKAWDTLTKPKNCGGLGFRDFRLFNQALLARQ  1101

Query  2316  GWKLMNKEDGLCVKIMEAK  2372
              W+L++  D LC  +++AK
Sbjct  1102  AWRLIDSPDSLCAIVLKAK  1120



>ref|XP_010495306.1| PREDICTED: uncharacterized protein LOC104772378 [Camelina sativa]
Length=885

 Score =   290 bits (743),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 156/440 (35%), Positives = 246/440 (56%), Gaps = 1/440 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             VKD L+   + FF  G      N T ICL+P +  P  + + R I LCNV YK+L+K + 
Sbjct  33    VKDDLVALVNRFFEEGEFDKSLNQTHICLIPKVAKPTRMAELRPISLCNVGYKILSKVLC  92

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDLEKAYD  1454
              RLK  +  LI   Q++FV GR I++N+L+ QE+ + LR+  S KG  M IK D+ KAYD
Sbjct  93    NRLKWFLPGLISETQSAFVSGRLISDNILIAQEMFHGLRTNNSCKGKFMAIKTDMSKAYD  152

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             R+ W F+ + L+K GF+  WI  +M C+S+    +  + + +   +  RG+RQGDPLSP 
Sbjct  153   RVEWDFVAALLRKMGFAERWISWMMFCISSVEYKVLINGQPNGRIVPARGLRQGDPLSPY  212

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LF+L  E L   I ++  + +  G+K+  K P I+HL F DD +FF +A   Q  VV   
Sbjct  213   LFILCTEVLIANIRKAEADKRITGIKVANKCPQITHLLFADDSLFFYKADKEQCGVVLAI  272

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L ++ ++SGQ++++ KS I F       +Q  +   LGI  +  +G YLG+P   G  K 
Sbjct  273   LKQYEAVSGQQINFAKSSIQFGHTVDERVQTELHGVLGITNLGGMGSYLGIPESLGGSKT  332

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
               ++ +  R+Q+R TGW  + LS  G+  +++SV +A+P + M    LP+ + S+L    
Sbjct  333   KVFSYVRDRLQSRTTGWSVKLLSKGGKEVMVKSVATAVPTFVMSCYRLPKTITSKLTSAV  392

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
               F W S+  +   + I+W+++  SK  G LG + +D  N AL AK  W+L+   D L  
Sbjct  393   AKFWWSSNGQSGGMHWIAWERLCCSKQMGGLGFRNVDDFNTALLAKQLWRLIEFPDSLFA  452

Query  2355  KIMEAKVQLPSLPSQACQMY  2414
             ++ +++    S P    + Y
Sbjct  453   RVFKSRYYRNSDPLDPIRSY  472


 Score = 55.5 bits (132),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 48/114 (42%), Gaps = 5/114 (4%)
 Frame = +2

Query  2819  PYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCPIANSVWE-S  2995
             P ++R F+W     C   N    RRG   EV C  C    E I+H + RCP A  VW  +
Sbjct  622   PPKLRHFMWQVLSGCVPVNANLCRRGINCEVGCTRCGAEVETINHAIFRCPPARQVWALA  681

Query  2996  LIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWRNDLVF  3157
              +P        +      D  +   + G+    Q   F   MW++WK RN  VF
Sbjct  682   HVPVGSLHFPSESVYANVDHFLGSTNPGS----QIQIFPWLMWYIWKARNARVF  731



>ref|XP_008350747.1| PREDICTED: uncharacterized protein LOC103414113 [Malus domestica]
Length=2297

 Score =   254 bits (650),  Expect(3) = 4e-79, Method: Compositional matrix adjust.
 Identities = 153/438 (35%), Positives = 241/438 (55%), Gaps = 5/438 (1%)
 Frame = +3

Query  1071  QLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVS  1250
             Q++ +    +K +++K   +F+ TG +    N+T ICL+P   +   V  FR I L    
Sbjct  1010  QMIQQCWDILKXNIMKIMEEFYETGIINAVTNETFICLIPKKSDSMKVTDFRPISLVTGL  1069

Query  1251  YKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIK  1430
             YK++ K +  RLK  +   I   Q +FV  RQI + VL+  EV+  +R K  +G  +V+K
Sbjct  1070  YKIMAKTLASRLKEVLGSTISQNQGAFVKDRQILDAVLIANEVVEEVRQKKEEG--LVLK  1127

Query  1431  IDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIR  1610
             ID EKAYD + W F+   LQ+  F   W + +  C+S++  ++  + R    F   RG+R
Sbjct  1128  IDFEKAYDHVEWRFLDEVLQRKSFGNRWRKWMQGCLSSANFSVLINGRPRGKFQASRGLR  1187

Query  1611  QGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLH  1790
             QGDPLSP LF L V+ LS L+E++ +N   KG+ I ++   I HL F DD +FF      
Sbjct  1188  QGDPLSPFLFTLVVDVLSRLMEKAQENHLIKGLCIGQEKVEIXHLQFADDTIFFLAEDEG  1247

Query  1791  QASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVP  1970
               + + + L  FCS+SG +++  K       N+  E    ++ S G  + +   +YLG+P
Sbjct  1248  GWNNLLELLKLFCSVSGLKINKAKC-YLAGINSDCEKLNRLADSWGCEVGSWPIKYLGLP  1306

Query  1971  SIHGRLKQDSYAD-LMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQG  2147
              + GR +   + D ++ +++ RL  WK   LS  GR TLIQSVL ++P Y M    +P G
Sbjct  1307  -LGGRPRALKFWDPVVDKMEKRLQSWKKAFLSRGGRLTLIQSVLGSLPTYYMSLFKMPCG  1365

Query  2148  VLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKL  2327
             V+ RLE+L + FLW   +  +K NL+ W+ V +SK++G LG+  L   N+AL AK  W+ 
Sbjct  1366  VIGRLEKLMKGFLWEGVEEGKKNNLVKWEIVIKSKEEGGLGVGNLRNRNEALLAKWLWRF  1425

Query  2328  MNKEDGLCVKIMEAKVQL  2381
               +   L  K++ +K  L
Sbjct  1426  PKEPHSLWHKVIRSKYGL  1443


 Score = 65.9 bits (159),  Expect(3) = 4e-79, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 67/133 (50%), Gaps = 6/133 (5%)
 Frame = +1

Query  703   YQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPF  882
             Y+EE+ W  RS+ EW   GD NT+F+H   + R+  + + RL+   G  I D + I +  
Sbjct  887   YKEEVKWRQRSKVEWXKEGDGNTKFFHRVASGRRKRNYIERLEXEVGGVIEDANEIEDHI  946

Query  883   HAFYMDLFS--EDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPS  1053
               F+  LFS  E++   LE +N A    L  + W  I   F   +++ AVF+  + K+P 
Sbjct  947   VXFFKSLFSSNEEACWGLEGINWAPISELE-ANW--IERPFEEAEVQRAVFDCGKDKSPG  1003

Query  1054  SDGFQTSFYQNSW  1092
              DG+     Q  W
Sbjct  1004  PDGYSLQMIQQCW  1016


 Score = 27.3 bits (59),  Expect(3) = 4e-79, Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 77/209 (37%), Gaps = 22/209 (11%)
 Frame = +2

Query  2414  WKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIG--------KQATLLSRIRYDPFDRVI  2569
             WK I   + + L   K  V N     FW D W+          +  LLSR         +
Sbjct  1462  WKDISIGSQLFLHCCKFEVGNGERVRFWEDGWLDGGPLKEQFPRLFLLSRKHNQNISSFV  1521

Query  2570  R*SL*VLG----PRIGVAVGETFEPAS*GVLEYVGGVQLIR-*L*A*KWPGLGRGLFW*I  2734
               S   L      R  +   E  E A   +L+ V  V+L +  +   +W     GLF   
Sbjct  1522  DLSTNSLSWNFDFRRNLNEAEIEEAAR--LLQKVEEVRLSQSRMDNRRWKMEASGLF---  1576

Query  2735  LC*INL*HYS-RGLSTYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRG---FT  2902
              C       S  G+  Y +  + I   KVP +++  +WLA      T  +  RR      
Sbjct  1577  TCKSYCSFLSNNGMMQYFQPHSQIWKSKVPPKVKILVWLAAKGKLNTCDQIQRRSPFICL  1636

Query  2903  SEVFCGICRNLPEDIDHIMQRCPIANSVW  2989
             S  +C +C+   E ++HI   C     +W
Sbjct  1637  SPQWCSLCKAKEESVNHIFLHCSYTIQLW  1665



>gb|EEC71228.1| hypothetical protein OsI_03168 [Oryza sativa Indica Group]
Length=995

 Score =   252 bits (643),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/393 (33%), Positives = 221/393 (56%), Gaps = 3/393 (1%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             +++ + +    F +   +P G  D++I L+P I N   +++FR I LCNV YK+ +K + 
Sbjct  203   LENDICRAVRGFLTGDEIPEGLCDSIIVLIPKIHNLVHLSKFRPINLCNVLYKIASKVLA  262

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
               LK  +  ++  FQ++FV G  IT+N LV  E L+S+R +  K     +KID+ KAYDR
Sbjct  263   NHLKIFLPDIVSEFQSAFVPGWLITDNALVAFECLHSIRRQHSKNPFFALKIDMMKAYDR  322

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             + WS+++  L K GF+P W+ ++M CV++ R A+  +  L++  +  RGIRQGDP+SP L
Sbjct  323   IEWSYLQGCLTKLGFAPAWVSSVMRCVTSVRYAVRINGELTRPVIPSRGIRQGDPVSPYL  382

Query  1638  FVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCL  1817
             F+L +E LS+L+++    G   G++   +GP ISHL F DD +FF ++      V+K  L
Sbjct  383   FLLCIEGLSYLLQRKESLGLLHGIRNGHQGPPISHLLFADDSIFFAKSDPRSVQVLKSTL  442

Query  1818  NEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQD  1997
               +C+ SGQ+++  KS + F +     I+  +   L +        YLG+P+        
Sbjct  443   QSYCNASGQKINLQKSSLLFGRYCPEAIKTCVKDCLQVSNEALQDTYLGMPTEINCAVTS  502

Query  1998  SYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSR  2177
             S+  L  R+  R+ GW +R LS  G+ T++++V+ AIP Y M    +P  +  +++    
Sbjct  503   SFNFLSERVWKRVNGWNDRPLSRAGKETMLKAVVQAIPTYIMSCFQVPTTICDKMKSSMA  562

Query  2178  DFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQ  2276
             +  WG   G +K   + W+ +   ++  + G++
Sbjct  563   NHWWGYEDGRKK---MHWRSILFGRELLKKGVR  592


 Score = 73.9 bits (180),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 71/130 (55%), Gaps = 1/130 (1%)
 Frame = +1

Query  706   QEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFH  885
             +EE++   RSR EW+  GDRNT F+HA  + R+  + ++ L  + G   S+  GI     
Sbjct  71    REEIMAKQRSRIEWLKEGDRNTSFFHARASARRRTNKIKLLVRDDGSSCSESQGIKLMAE  130

Query  886   AFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDG  1062
              F+  LF+ +    +E++ +A    +  S    +   ++ +++ EA+F+M   KAPS DG
Sbjct  131   HFFEKLFTSEQCESVEEVLEAIPCKVDESINEELCKAYSDEEIKEALFQMGPTKAPSPDG  190

Query  1063  FQTSFYQNSW  1092
             F   FYQ+ W
Sbjct  191   FLALFYQSHW  200



>ref|XP_009125370.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=943

 Score =   291 bits (745),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 163/441 (37%), Positives = 248/441 (56%), Gaps = 5/441 (1%)
 Frame = +3

Query  1065  PNQLLPKFMGTVKDSL----IKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSI  1232
             P+     F  T  DS+    +K   DFF +  LP   N+T I L+  I +P  V+++R I
Sbjct  71    PDGFSASFFHTNWDSIGKDIVKEIQDFFISDSLPPKINETHIRLISKISSPQRVSEYRPI  130

Query  1233  GLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGK  1409
              LCNV YK+++K +T RL+  +  ++   Q++FV GR I++NVL+  EVL+ L+ S + K
Sbjct  131   ALCNVYYKIISKLLTKRLQPLLSSIVSENQSAFVPGRAISDNVLITHEVLHFLKTSDAEK  190

Query  1410  GGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWF  1589
                M +K D+ KAYDRL W FIR  LQ+ GF   WI  IM CVST   +   +       
Sbjct  191   RCSMAVKTDMSKAYDRLEWDFIRLVLQRLGFHTKWIAWIMQCVSTVTYSFLINGSPRGRV  250

Query  1590  MLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVF  1769
                RGIRQGDPLSP +F+L  E LS L  ++ ++G  KG+++ R  P ++HL F DD +F
Sbjct  251   TPSRGIRQGDPLSPYIFILCSEVLSGLCNKAQEDGSLKGIRVARGTPRVNHLLFADDTMF  310

Query  1770  FGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDL  1949
             F  AS   +  + K L  +   SGQ ++  KS + FS  T   ++  + ++L I     +
Sbjct  311   FVRASKESSESLCKLLKRYEEASGQSINTEKSSVSFSHRTPRSLKSTVQNTLAIQKEGGV  370

Query  1950  GRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQS  2129
             G+YLG+P   GR K + ++ ++ RI+ +  GW NR LS  G+ T+++SVLSA+P + M  
Sbjct  371   GKYLGLPEHFGRSKGNLFSSIVDRIRQKARGWSNRFLSTAGKMTMLKSVLSAVPSHAMSC  430

Query  2130  SLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFA  2309
               LP  +  R++     F W     ++K   I+W+K+   K QG L  + +   NQA  A
Sbjct  431   FELPVSLCRRIQSALTRFWWDDRMDSKKMAWIAWEKLIRPKQQGGLDFRDIQSFNQAFLA  490

Query  2310  KLGWKLMNKEDGLCVKIMEAK  2372
             KL W+++N  D L  +I+  K
Sbjct  491   KLSWRIINNPDCLLGRILIEK  511



>ref|XP_008345353.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=953

 Score =   291 bits (745),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 153/410 (37%), Positives = 242/410 (59%), Gaps = 3/410 (1%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             TV + ++K  + F+ +G L    N T + L+P +  P  + Q+R I LCNV YK+L K +
Sbjct  32    TVGEDVVKIVNAFWHSGTLLRKLNHTNLVLIPKVKCPRNMTQYRPISLCNVIYKILAKVL  91

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL--RSKSGKGGLMVIKIDLEKA  1448
             T +LK  M  +IG  Q++FV G+QI +N+LV  EVL+SL  + +  + G M IK+D+ KA
Sbjct  92    TNKLKVVMPKVIGDNQSAFVAGKQIQDNILVVHEVLHSLLHQXREDQAG-MAIKLDMVKA  150

Query  1449  YDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLS  1628
             YDR+ W F+ S + K GF+P + + I +C+ST   ++  +   + + + +RG+RQGDPLS
Sbjct  151   YDRIEWDFLTSIMAKMGFAPLFCKWIKACISTVSFSVLINGTPTGYIVPQRGLRQGDPLS  210

Query  1629  PLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVK  1808
             P LF+L  E LS L+ + ++ G   G K T  G  ++HLFF DD V FG A++ +A  V 
Sbjct  211   PFLFLLCTEXLSMLLRKGLELGALHGFKFTPSGTPLTHLFFADDSVVFGNATVDEARAVV  270

Query  1809  KCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRL  1988
             + L  +   SGQ ++  KS +FFS  TS  +++ I  +LGI      G+YLG+ +  G  
Sbjct  271   EALQTYXRGSGQEINLSKSSVFFSXKTSNRLKREIEETLGIQCRMGFGKYLGLQADFGHS  330

Query  1989  KQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLER  2168
             K+  +A++  +++ARL GW  + LS  G+  LI++V  A+P Y M    LP GV   +E+
Sbjct  331   KKAVFAEVRDKVEARLAGWTEQFLSQAGKEVLIKAVAMALPNYAMSCFKLPXGVCRDIEK  390

Query  2169  LSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
               R F W      +  + +SW+++++ K  G LG + +   N A  AK+G
Sbjct  391   AIRKFWWKGDDKRKGIHWVSWERISKQKKSGGLGFKDIQCFNLAFLAKIG  440



>ref|XP_009147172.1| PREDICTED: uncharacterized protein LOC103870758 [Brassica rapa]
Length=1637

 Score =   263 bits (672),  Expect(3) = 5e-79, Method: Compositional matrix adjust.
 Identities = 139/416 (33%), Positives = 237/416 (57%), Gaps = 1/416 (0%)
 Frame = +3

Query  1128  DFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRML  1307
             +FF  G +P   N T +CL+P + +P  +   R I LC+V YK+++K +  RL+  +  +
Sbjct  731   NFFERGRMPTDWNFTYLCLLPKVQDPETMADLRPISLCSVLYKIISKVIVRRLQPLLPEI  790

Query  1308  IGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAYDRLSWSFIRST  1484
             I   Q++FV  R IT+N+ +  E +++LR ++S     MV+K D+ KAYD++ WS++R+ 
Sbjct  791   ISVNQSAFVAERLITDNIGIAHEAVHALRVNQSIMKEYMVVKTDMSKAYDKVEWSYLRTL  850

Query  1485  LQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLS  1664
             ++  GF+  WI  +M+CVS+   A+  + +       +RG+RQGDPLSP LFV+  E L+
Sbjct  851   MEALGFATVWIDLVMACVSSVSFAVLVNDKPFGMIRPQRGLRQGDPLSPFLFVICTEGLT  910

Query  1665  HLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQ  1844
             HL+ ++ +     G+K + +GP + HL F DD +F  +A+ ++A ++ + L  +   +GQ
Sbjct  911   HLLNRAERMSLLNGLKFSEEGPSVHHLLFADDSLFMCKATQNEAQILHEVLLRYGKATGQ  970

Query  1845  RLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRI  2024
              ++  KS I F      E +  I   LGI       +YLG+P      K +    L SR+
Sbjct  971   TINLQKSAISFGAQIDHECKVVIQEVLGIMNEGGSSKYLGLPECFSGSKIELLDYLRSRV  1030

Query  2025  QARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKG  2204
               RL  W  R LS  G+  L+++  SA+P + M    LP+ V++ +     +F WGS   
Sbjct  1031  NGRLNAWYLRKLSQGGKEILLKTTASALPVFPMSVFKLPKKVIANISGAMANFWWGSDAH  1090

Query  2205  NRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
              RK + I+W+K+  SK+ G +G + L+  NQAL AK  WK+++    L  ++++++
Sbjct  1091  LRKIHWIAWEKLCLSKESGGMGFRDLEAFNQALLAKQAWKVLSAPHCLLAQLLKSR  1146


 Score = 56.6 bits (135),  Expect(3) = 5e-79, Method: Compositional matrix adjust.
 Identities = 72/310 (23%), Positives = 127/310 (41%), Gaps = 27/310 (9%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSP--DVEVL---  384
             F D +   G+ +L  SG  +TW  G     +    LDRA  N  W    P  + + L   
Sbjct  417   FGDMLSACGMEELESSGIRFTWA-GQRWQKWIQCCLDRAFGNKAWLQAFPASNQKFLDKR  475

Query  385   ---HLPMVNSYHT--LGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSK---  540
                H P++  +      E+  FRF+  +   P  ++ +   W+       N+S + +   
Sbjct  476   GSDHRPVLVKFQVSQAREAGLFRFDKKFLFQPGVKQKIIEAWRISEVGSVNRSVVKRLRD  535

Query  541   ---QLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlik--ldrklrreldeilY  705
                 L  W K  I N          RI  ++R L  +Q  +       R +R+EL     
Sbjct  536   CRGVLSTWKKERIFN-------AKDRIHILERRLEWFQSRNYPCWHAIRVIRKELCRAYK  588

Query  706   QEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFH  885
             +EEL W  +S E+W+  GDRN+ F+H +    ++   + ++KD  G      +   +   
Sbjct  589   EEELFWQQKSMEKWLKYGDRNSNFFHESVKANRAKIKLIKIKDVNGVERWSEEAKAQVAL  648

Query  886   AFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDG  1062
              ++ +LF   +    + +     P +  +    + A  T ++++ AVF +    AP  DG
Sbjct  649   DYFNELFKSSNPPSYQQVFQEMVPRVSDAMNQGLMAEVTEEEIKSAVFSIKASSAPGPDG  708

Query  1063  FQTSFYQNSW  1092
                 F+Q  W
Sbjct  709   MSGLFFQQFW  718


 Score = 26.9 bits (58),  Expect(3) = 5e-79, Method: Compositional matrix adjust.
 Identities = 13/40 (33%), Positives = 21/40 (53%), Gaps = 0/40 (0%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQA  2524
             S  W+ +L    +L+KG +K V +  S   W D W+  +A
Sbjct  1163  SYAWRSLLFGRELLIKGLQKRVGDGNSINVWTDRWMEDEA  1202



>emb|CCA66198.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1381

 Score =   242 bits (618),  Expect(3) = 6e-79, Method: Compositional matrix adjust.
 Identities = 150/430 (35%), Positives = 234/430 (54%), Gaps = 5/430 (1%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             +K        +F+ TG LP G N   I L+  I +P     FR I +    YK+++K + 
Sbjct  463   IKHDFYSIIQEFWHTGILPRGSNVAFIALIAKIESPSGFKDFRPISMVGCVYKIISKLLA  522

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
              RLK  M  L+GP Q+SF+ GRQI +++L+  E+  S + +  K   +++KID  KA+D 
Sbjct  523   GRLKQVMNDLVGPHQSSFIEGRQILDSILIASELFESCKRR--KKATVMLKIDFHKAFDS  580

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             +SWSF+  TL + GF P W + I SCVS++  ++  +   S  F L+RG+RQGDPLSP L
Sbjct  581   VSWSFLDWTLSQMGFPPRWKKWISSCVSSAAASVLLNGSPSLPFKLQRGLRQGDPLSPFL  640

Query  1638  FVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCL  1817
             FVL VE ++ +I+++     W+G++IT+ GP ++HL F DD + F   ++     +KK L
Sbjct  641   FVLVVEVMNLMIKKAESLNSWQGIEITKNGPILTHLQFADDTILFAPHNMEALENIKKTL  700

Query  1818  NEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQD  1997
               F   SG ++++ KS +    N   +  Q  + +L   + +    YLG+P + G   + 
Sbjct  701   ILFQLSSGLKINFHKSEL-LGINVPQDWMQRAAKNLCCKVGSFPITYLGMP-VGGSCSKL  758

Query  1998  SYAD-LMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
             S+ D L+ +I  +L+ WK   LS  GR TLI++ L  +P Y M    +PQGV+ ++ R+ 
Sbjct  759   SFWDPLIEKISKKLSLWKGNLLSLGGRLTLIKASLLNLPIYYMSLFPMPQGVIDKITRIQ  818

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
             R+FLW      +   LI W      K  G L I  L   N  L  K  W+   + + L  
Sbjct  819   RNFLWSGGLNKKSLALIKWSYAQLPKIFGGLNIGNLLARNLGLLFKWIWRYFQEPNALWR  878

Query  2355  KIMEAKVQLP  2384
             +I+EAK   P
Sbjct  879   QIIEAKYGYP  888


 Score = 82.0 bits (201),  Expect(3) = 6e-79, Method: Compositional matrix adjust.
 Identities = 86/309 (28%), Positives = 141/309 (46%), Gaps = 26/309 (8%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVL---  384
             L F+++I    LI++      YTW +G S      ++LDR L   EW  + P + V    
Sbjct  162   LKFRNFINNLRLIEVSPVEGWYTWFRGNSR-----SKLDRVLVQAEWIEKFPALAVSILN  216

Query  385   -----HLPMVNSYHTLG-ESRRFRFNAAW*THPNYQE*VSSTW--KSDVSLEANKSNLSK  540
                  H P++     +    R F+F   W +H    E V   W    +++L      +  
Sbjct  217   RSISDHCPLLLQSSIVDWGPRPFKFQDVWLSHKGCMEIVEKAWIQSKELTLMQKLKKVKL  276

Query  541   QLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilY----Q  708
              L  WN  + GNI      +L R + +Q+  S     DL   + K R +    L+    +
Sbjct  277   DLKTWNSESFGNIDAN---ILLREAEIQKWDSEANSRDLEPEEIKTRAQAQLELWEWLKK  333

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             +E+ W  +SR +W+ SGDRNT+F+H   ++R+S + +  +    G+ I D   I E    
Sbjct  334   KEIYWAQQSRIKWLKSGDRNTKFFHICASIRRSKNNISSILLQ-GKKIEDPIIIKEEAVK  392

Query  889   FYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGF  1065
             ++ +LF+ED   +     +  F  L  SQ  +I+A F+  ++ EAV      K+P  DGF
Sbjct  393   YFKNLFTEDFKER-PTFTNLSFKKLSESQAFSISAPFSTTEIDEAVASCNPSKSPGPDGF  451

Query  1066  QTSFYQNSW  1092
                F + SW
Sbjct  452   NFKFIKASW  460


 Score = 22.7 bits (47),  Expect(3) = 6e-79, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 0/25 (0%)
 Frame = +2

Query  2450  KGSKKLVKNDRSTLFWLDSWIGKQA  2524
             +G +  V N  ST FW D WI   A
Sbjct  924   QGLRMRVSNGESTRFWHDIWIDNSA  948



>gb|ABA96650.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1100

 Score =   293 bits (749),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 153/438 (35%), Positives = 240/438 (55%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP +   +    +K+ + K    FF    +P G N T I L+P       +  FR I LC
Sbjct  568   FPARFFQRNWEVLKNDVCKAVKLFFDQKVMPEGVNTTAIVLIPKKKESKELKDFRPISLC  627

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGL  1418
             NV YK++ K +   L+  +  +I   Q++F+ GR IT+N L+  E  +++ +SK      
Sbjct  628   NVIYKVVAKCLVNHLRPILESIISQEQSAFIPGRMITDNALIAFECFHNIAQSKRESQEF  687

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
                K+DL KAYDR+ W ++   L + GFS  WI+ +M+CV++ R A+ F+  + K F   
Sbjct  688   CAYKLDLAKAYDRVDWQYLEGVLDRMGFSNTWIQWMMACVTSVRYAVRFNGSMLKSFQPS  747

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP LF+   + LS ++  +V+ G    +K+ R+ P ISHL F DD + F +
Sbjct  748   RGLRQGDPLSPYLFLFVADGLSTILSSAVRTGDLVPLKVCRQAPGISHLLFADDSLLFFK  807

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A++ QA+VVK+ LN +   + Q LS  K  + F K+ S + Q  I S L +   +   +Y
Sbjct  808   ANVEQATVVKEALNLYERCTSQLLSPAKCSMLFGKHCSDQTQPGIKSLLDVQQNSFEDKY  867

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG+P+  GR+K D +  +  R   RL  W  + L   G+  LI+SV+ A+P Y M    L
Sbjct  868   LGLPTPEGRMKADRFQSIKERFFKRLIDWAEKHLPMGGKEVLIKSVIQALPTYMMSVFKL  927

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P        +L R F WG  +  RK +  SW+++ + K  G +G + +   NQAL A+  
Sbjct  928   PPSFCEEYMQLVRKFWWGEDRSQRKVHWASWQQLIKPKSMGGMGFKDMKIFNQALLARQA  987

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W+L+   D LC ++++AK
Sbjct  988   WRLVQFPDSLCARVLKAK  1005


 Score = 80.5 bits (197),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 76/312 (24%), Positives = 132/312 (42%), Gaps = 24/312 (8%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
             L F++ +    + DLG+ G  +T+            RLDRA+ +  W +  P  +V HL 
Sbjct  271   LDFREILSHCDVFDLGFIGTPWTYDNKRKGGYNVRVRLDRAVASQSWSVLYPQAQVRHLV  330

Query  394   MVNSYHTL------------GESRRFRFNAAW*THPNYQE*VSSTWK-----SDVSLEAN  522
                S H                SR  R+   W    +  E + + W+     +D+   ++
Sbjct  331   SSRSDHCPILVQCTPDEDKDKPSRCMRYEILWEREESLSEEIRTAWEQHHAATDLGSVSS  390

Query  523   KSNLSK-QLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldei  699
             K  L    L  W++   G++ +     L  +      L +  +    +  +   R ++EI
Sbjct  391   KLKLVMGALQHWSREKFGSVNKE----LGALRKKMEELQLGGRHTHDQEYQSCSRRMEEI  446

Query  700   lYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEP  879
             LY+EE++W  RSR  W+  GDRNT F H   A R   + + +L    G W      +   
Sbjct  447   LYREEMMWLQRSRVAWLREGDRNTSF-HRKAAWRHRKNKISKLFLPDGSWTDQRKEMETM  505

Query  880   FHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSS  1056
                F+ DL+++D     + L D     +       +   F+ K++ +A+F++   KAP  
Sbjct  506   ATNFFKDLYTKDPLVTPQPLLDLIMLKVTEQMNEDLCKAFSDKEISDALFQIGPIKAPGP  565

Query  1057  DGFQTSFYQNSW  1092
             DGF   F+Q +W
Sbjct  566   DGFPARFFQRNW  577



>ref|NP_001066197.2| Os12g0156200 [Oryza sativa Japonica Group]
 gb|ABA96496.2| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29216.2| Os12g0156200 [Oryza sativa Japonica Group]
Length=1764

 Score =   297 bits (760),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 156/438 (36%), Positives = 240/438 (55%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP +   +  GT+K  +I     FF TG +P G NDT I L+P    P  +  FR I LC
Sbjct  582   FPARFYQRNWGTIKADIIGAVRRFFQTGLMPEGVNDTAIVLIPKKEQPVDLRDFRPISLC  641

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGL  1418
             NV YK+++K +  RL+  +  L+   Q++FV GR IT+N L+  E  +++ ++K      
Sbjct  642   NVVYKVVSKCLVNRLRPILDDLVSVEQSAFVQGRMITDNALLAFECFHAMQKNKKANHAA  701

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
                K+DL KAYDR+ W F+   + K GF+  W+  IM CV++ R  + F+  L + F   
Sbjct  702   CAYKLDLSKAYDRVDWRFLEMAMNKLGFARRWVNWIMKCVTSVRYMVKFNGTLLQSFAPT  761

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPL P LF+   + LS L+++ V        K+ R  P ISHL F DD + F +
Sbjct  762   RGLRQGDPLLPFLFLFVADGLSLLLKEKVAQNSLTPFKVCRAAPGISHLLFADDTLLFFK  821

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A   +A VVK+ L+ +   +GQ ++  K  I     ++  + +AIS  L +       RY
Sbjct  822   AHQREAEVVKEVLSSYAMGTGQLINPAKCSILMGGASTPAVSEAISEILQVERDRFEDRY  881

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG P+  GR+ +  +  L ++I  R+  W    LS  G+  LI++V+ AIP Y M    L
Sbjct  882   LGFPTPEGRMHKGRFQSLQAKIWKRVIQWGENHLSTGGKEVLIKAVIQAIPVYVMGIFKL  941

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P+ V+  L +L+++F W S  G RK +  +W  +T+ K  G LG +     NQAL A+  
Sbjct  942   PESVIDDLTKLTKNFWWDSMNGQRKTHWKAWDSLTKPKSLGGLGFRDYRLFNQALLARQA  1001

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W+L+   D LC ++++AK
Sbjct  1002  WRLITYPDSLCARVLKAK  1019


 Score = 72.8 bits (177),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 70/314 (22%), Positives = 132/314 (42%), Gaps = 31/314 (10%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP--  393
             F+D +    L DLG+ G  +T+            RLDR + + +W+      +V+HL   
Sbjct  288   FRDVLQDCELHDLGFKGVPHTYDNKREGWRNVKVRLDRVVADDKWRDIYSTAQVVHLVSP  347

Query  394   -----------MVNSYHTLGESRRFRFNAAW*THPNYQE*VSSTW-----KSDVSLEANK  525
                        +V   H L   +   +   W   P   + +   W     K+D+  + NK
Sbjct  348   CSDHCPILLNLVVKDPHQL-RQKCLHYEIVWEREPEATQVIEEAWVVAGEKADLG-DINK  405

Query  526   S--NLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldei  699
             +   +   L  W++  + N+ R   +   +++       + +      + R     ++E+
Sbjct  406   ALAKVMTALRSWSRAKVKNVGRELEKARKKLA------ELIESNADRTVIRNATDHMNEL  459

Query  700   lYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEP  879
             LY+EE+LW  RSR  W+   DRNT+F+H+    R   + + +L+D   E +      LE 
Sbjct  460   LYREEMLWLQRSRVNWLKDEDRNTKFFHSRAVWRAKKNKISKLRDA-NETVHSSTMKLES  518

Query  880   FHA-FYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPS  1053
                 ++ D+++ D     E +       +       +   FT  ++ +A+F++   K+P 
Sbjct  519   MATEYFQDVYTADPNLNPETVTRLIQEKVTDIMNEKLCEDFTEDEISQAIFQIGPLKSPG  578

Query  1054  SDGFQTSFYQNSWA  1095
              DGF   FYQ +W 
Sbjct  579   PDGFPARFYQRNWG  592


 Score = 60.1 bits (144),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/231 (23%), Positives = 96/231 (42%), Gaps = 27/231 (12%)
 Frame = +2

Query  2762  SRGLSTYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPE  2941
             S G +   + W  I   KVP +++ F W    +C  T   + +R       C IC    E
Sbjct  1162  SSGTNNINKAWEMIWKCKVPQKVKIFAWRVASNCLATMVNKKKRKLEQSDMCQICDRENE  1221

Query  2942  DIDHIMQRCPIANSVWESL-----IPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVT  3106
             D  H + RC  A+ +W  +     +  D +      +  W  + + ++     ++EQ + 
Sbjct  1222  DDAHALCRCIQASQLWSCMHKSGSVSVDIKASVLGRF--WLFDCLEKIP----EYEQAM-  1274

Query  3107  FAVTMWWLWKWRNDLVFSGTNINLAARIKWIRDQVEEI-------NISFSKAKGLI--AP  3259
             F +T+W  W  RN+L+   +        ++I+  V+ +            K K ++   P
Sbjct  1275  FLMTLWRNWYVRNELIHGKSAPPTETSQRFIQSYVDLLFQIRQAPQADLVKGKHVVRTVP  1334

Query  3260  IES------ICWRQLKWIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQG  3394
             ++       +   Q  W RP+ GW+K N+DGS   S+     G  +R+  G
Sbjct  1335  LKGGPKYRVLNNHQPCWERPKDGWMKLNVDGSFDASSGKGGLGMILRNSAG  1385



>ref|XP_009146764.1| PREDICTED: uncharacterized protein LOC103870391 [Brassica rapa]
Length=985

 Score =   291 bits (745),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 160/460 (35%), Positives = 257/460 (56%), Gaps = 12/460 (3%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             T+  S+I    +FFSTG L    N T + L+P       V+++R I LCNV YK+++K +
Sbjct  93    TIGQSIITEIQEFFSTGVLSPTLNVTHVRLIPKTLGAKRVDEYRPIALCNVYYKVISKLL  152

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAY  1451
             +LRLK  +  +I   Q++F+ GR IT+NVL+  EVL  L+ S++ K   M +K+D+ KAY
Sbjct  153   SLRLKPILCSIISENQSAFIPGRAITDNVLITHEVLQFLKTSQAKKQCAMAVKMDMSKAY  212

Query  1452  DRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSP  1631
             DR+ W FI   +++ GF   WI  IM C+++   +   +  +       RGIRQGDP+SP
Sbjct  213   DRVEWEFIAQVMKRLGFHEKWINWIMQCITSVSYSYLINDSVYGLVKPHRGIRQGDPISP  272

Query  1632  LLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKK  1811
              LF+L  E LS L  ++   G  +G+++ R  P ++HL F DD + F  ++      + +
Sbjct  273   YLFILCGEVLSGLCRKAELEGSMRGVRVARGCPRVNHLLFADDTMIFCNSTSESCLALLR  332

Query  1812  CLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLK  1991
              L ++ S+SGQ+++  KS I FS  T  E++QA    LGI     +G+YLG+P   GR K
Sbjct  333   ILRDYESVSGQKVNIAKSAINFSSKTPPEVKQAAKDLLGIQKEGGMGKYLGLPEHFGRKK  392

Query  1992  QDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERL  2171
             +D +  ++ RI+ R   W  R LS  G+ T++++VL+AIP Y M   +LPQ + +R++  
Sbjct  393   KDLFTSIVDRIRQRAANWSTRFLSRAGKLTMLKAVLTAIPTYAMSCFILPQSLCNRIQSS  452

Query  2172  SRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLC  2351
                F W  S   +    ++W K+T  K  G LG++ +   NQAL AK+ W+++     L 
Sbjct  453   LTRFWWDKSPDKKNMCWVAWGKLTRPKKAGGLGLRDIQRFNQALLAKVAWRILTSPHCLL  512

Query  2352  VKIMEAK---------VQLPSLPSQACQ--MYGRVFLSRR  2438
              +++  K         VQ P++ S   +  ++GR  L   
Sbjct  513   ARVLTGKYCHKKSFLDVQTPAVCSHGWRSILHGRDLLQEH  552



>gb|AAS55787.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAV32224.1| hypothetical protein [Oryza sativa Japonica Group]
Length=1936

 Score =   297 bits (760),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 152/438 (35%), Positives = 244/438 (56%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP +   +  GT+K  +I    +FF +G +P G NDT I L+P    P  +  +R I LC
Sbjct  1091  FPARFYQRNWGTLKSDIILAVRNFFQSGLMPKGVNDTAIVLIPKKDQPIDLKDYRPISLC  1150

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGL  1418
             NV YK+++K +  RL+  +  L+   Q++F+ GR IT+N L+  E  +S+ ++K      
Sbjct  1151  NVVYKVVSKCLVNRLRPILDDLVSKEQSAFIQGRMITDNALLAFECFHSIQKNKKANSAA  1210

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
                K+DL KAYDR+ W F+   L K GF+  W+  IM CV+T R ++ F+  L + F   
Sbjct  1211  CAYKLDLSKAYDRVDWRFLELALNKLGFAHRWVSWIMLCVTTVRYSVKFNGTLLRSFAPT  1270

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQG+PLSP LF+   + LS L+++ V       +KI R+ P IS+L F DD + F +
Sbjct  1271  RGLRQGEPLSPFLFLFVADGLSLLLKEKVAQNSLTPLKICRQAPGISYLLFADDTLLFFK  1330

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A   +A VVK+ L  +   +GQ ++  K  I F + +   + + I ++L +   N   RY
Sbjct  1331  AEKKEAEVVKEVLTNYAQGTGQLINPAKCSILFGEASPSSVSEDIRNTLQVERDNFEDRY  1390

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG P+  GR+ +  +  L ++I  R+  W    LS  G+  LI++V+ AIP Y M     
Sbjct  1391  LGFPTPEGRMHKGRFQSLQAKIAKRVIQWGENFLSSGGKEILIKAVIQAIPVYVMGLFKF  1450

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P  V   L +++R+F WG+  G R+ +  +W  +T++K  G LG +     NQAL  +  
Sbjct  1451  PDSVYDELTKMTRNFWWGADNGRRRTHWRAWDSLTKAKINGGLGFRDYKLFNQALLTRQA  1510

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W+L+   + LC ++++AK
Sbjct  1511  WRLIEFPNSLCAQVLKAK  1528


 Score = 85.9 bits (211),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 73/312 (23%), Positives = 133/312 (43%), Gaps = 27/312 (9%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             F+D ++   L DLG+ G  +T+            RLDRA+ + +W+   P+ +V HL   
Sbjct  797   FRDALYDCDLQDLGFKGVPHTYDNRRDGWRNVKVRLDRAVADDKWRDLFPEAQVSHLVSP  856

Query  400   NSYH------------TLGESRRFRFNAAW*THPNYQE*VSSTW-----KSDVS-LEANK  525
              S H            T    +   +   W   P   + +   W     K+D+  +    
Sbjct  857   CSDHSPILLEFIVKDTTRPRQKCLHYEIVWEREPESVQVIEEAWINAGVKTDLGDINIAL  916

Query  526   SNLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilY  705
               +   L  W+K  + N+ +   +   ++  +  S             R+    ++E+LY
Sbjct  917   GRVMSALRSWSKTKVKNVGKELEKARKKLEDLIAS------NAARSSIRQATDHMNEMLY  970

Query  706   QEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFH  885
             +EE+LW  RSR  W+  GDRNTRF+H+    R   + + +L+D  G  I     +LE   
Sbjct  971   REEMLWLQRSRVNWLKEGDRNTRFFHSRAVWRAKKNKISKLRDENGA-IHSTTSVLETMA  1029

Query  886   A-FYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSD  1059
               ++  ++  D +   E +   F   +  +    +   F  +++ +A+F++   K+P  D
Sbjct  1030  TEYFQGVYKADPSLNPESVTRLFQEKVTDAMNEKLCQEFKEEEIAQAIFQIGPLKSPRPD  1089

Query  1060  GFQTSFYQNSWA  1095
             GF   FYQ +W 
Sbjct  1090  GFPARFYQRNWG  1101



>gb|AAQ19327.1| bZIP-like protein [Oryza sativa Japonica Group]
Length=2367

 Score =   297 bits (760),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 156/438 (36%), Positives = 240/438 (55%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP +   +  GT+K  +I     FF TG +P G NDT I L+P    P  +  FR I LC
Sbjct  1185  FPARFYQRNWGTIKADIIGAVRRFFQTGLMPEGVNDTAIVLIPKKEQPVDLRDFRPISLC  1244

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGL  1418
             NV YK+++K +  RL+  +  L+   Q++FV GR IT+N L+  E  +++ ++K      
Sbjct  1245  NVVYKVVSKCLVNRLRPILDDLVSVEQSAFVQGRMITDNALLAFECFHAMQKNKKANHAA  1304

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
                K+DL KAYDR+ W F+   + K GF+  W+  IM CV++ R  + F+  L + F   
Sbjct  1305  CAYKLDLSKAYDRVDWRFLEMAMNKLGFARRWVNWIMKCVTSVRYMVKFNGTLLQSFAPT  1364

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPL P LF+   + LS L+++ V        K+ R  P ISHL F DD + F +
Sbjct  1365  RGLRQGDPLLPFLFLFVADGLSLLLKEKVAQNSLTPFKVCRAAPGISHLLFADDTLLFFK  1424

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A   +A VVK+ L+ +   +GQ ++  K  I     ++  + +AIS  L +       RY
Sbjct  1425  AHQREAEVVKEVLSSYAMGTGQLINPAKCSILMGGASTPAVSEAISEILQVERDRFEDRY  1484

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG P+  GR+ +  +  L ++I  R+  W    LS  G+  LI++V+ AIP Y M    L
Sbjct  1485  LGFPTPEGRMHKGRFQSLQAKIWKRVIQWGENHLSTGGKEVLIKAVIQAIPVYVMGIFKL  1544

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P+ V+  L +L+++F W S  G RK +  +W  +T+ K  G LG +     NQAL A+  
Sbjct  1545  PESVIDDLTKLTKNFWWDSMNGQRKTHWKAWDSLTKPKSLGGLGFRDYRLFNQALLARQA  1604

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W+L+   D LC ++++AK
Sbjct  1605  WRLITYPDSLCARVLKAK  1622


 Score = 73.2 bits (178),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 70/314 (22%), Positives = 132/314 (42%), Gaps = 31/314 (10%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP--  393
             F+D +    L DLG+ G  +T+            RLDR + + +W+      +V+HL   
Sbjct  891   FRDVLQDCELHDLGFKGVPHTYDNKREGWRNVKVRLDRVVADDKWRDIYSTAQVVHLVSP  950

Query  394   -----------MVNSYHTLGESRRFRFNAAW*THPNYQE*VSSTW-----KSDVSLEANK  525
                        +V   H L   +   +   W   P   + +   W     K+D+  + NK
Sbjct  951   CSDHCPILLNLVVKDPHQL-RQKCLHYEIVWEREPEATQVIEEAWVVAGEKADLG-DINK  1008

Query  526   S--NLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldei  699
             +   +   L  W++  + N+ R   +   +++       + +      + R     ++E+
Sbjct  1009  ALAKVMTALRSWSRAKVKNVGRELEKARKKLA------ELIESNADRTVIRNATDHMNEL  1062

Query  700   lYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEP  879
             LY+EE+LW  RSR  W+   DRNT+F+H+    R   + + +L+D   E +      LE 
Sbjct  1063  LYREEMLWLQRSRVNWLKDEDRNTKFFHSRAVWRAKKNKISKLRDA-NETVHSSTMKLES  1121

Query  880   FHA-FYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPS  1053
                 ++ D+++ D     E +       +       +   FT  ++ +A+F++   K+P 
Sbjct  1122  MATEYFQDVYTADPNLNPETVTRLIQEKVTDIMNEKLCEDFTEDEISQAIFQIGPLKSPG  1181

Query  1054  SDGFQTSFYQNSWA  1095
              DGF   FYQ +W 
Sbjct  1182  PDGFPARFYQRNWG  1195


 Score = 61.6 bits (148),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 53/231 (23%), Positives = 96/231 (42%), Gaps = 27/231 (12%)
 Frame = +2

Query  2762  SRGLSTYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPE  2941
             S G +   + W  I   KVP +++ F W    +C  T   + +R       C IC    E
Sbjct  1765  SSGTNNINKAWEMIWKCKVPQKVKIFAWRVASNCLATMVNKKKRKLEQSDMCQICDRENE  1824

Query  2942  DIDHIMQRCPIANSVWESL-----IPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVT  3106
             D  H + RC  A+ +W  +     +  D +      +  W  + + ++     ++EQ + 
Sbjct  1825  DDAHALCRCIQASQLWSCMHKSGSVSVDIKASVLGRF--WLFDCLEKIP----EYEQAM-  1877

Query  3107  FAVTMWWLWKWRNDLVFSGTNINLAARIKWIRDQVEEI-------NISFSKAKGLI--AP  3259
             F +T+W  W  RN+L+   +        ++I+  V+ +            K K ++   P
Sbjct  1878  FLMTLWRNWYVRNELIHGKSAPPTETSQRFIQSYVDLLFQIRQAPQADLVKGKHVVRTVP  1937

Query  3260  IES------ICWRQLKWIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQG  3394
             ++       +   Q  W RP+ GW+K N+DGS   S+     G  +R+  G
Sbjct  1938  LKGGPKYRVLNNHQPCWERPKDGWMKLNVDGSFDASSGKGGLGMILRNSAG  1988



>ref|XP_009140970.1| PREDICTED: uncharacterized protein LOC103864947 [Brassica rapa]
Length=1547

 Score =   295 bits (756),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 159/426 (37%), Positives = 240/426 (56%), Gaps = 1/426 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             V   +IK    FF +G  P   N+T + L+P I NP +V  +R I LCNV YK ++K ++
Sbjct  668   VGPDMIKEVQKFFDSGVFPPRTNETNVRLIPKILNPQVVADYRPIALCNVFYKTVSKLLS  727

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAYD  1454
              R++  +  +I   Q++FV GR I++NVL+  EVL+ L+ S++ K   M +K D+ KAYD
Sbjct  728   RRMQPLLANIISETQSAFVPGRAISDNVLITHEVLHFLKTSRAEKRCSMAVKTDMSKAYD  787

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             RL W FI   LQ+ GF   WI+ IM CVST   +   +          RGIRQGDPLSP 
Sbjct  788   RLEWEFIELVLQRLGFHETWIKMIMQCVSTVTYSFLINGSPRGRVQPSRGIRQGDPLSPY  847

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             +F+L  E LS L  ++ + G  KG+++ R  P ++HL F DD +FF  A+      + K 
Sbjct  848   IFILCSEVLSGLCNRASEEGSLKGIRVARACPRVNHLLFADDTMFFIRANKESTQCLSKI  907

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L ++   SGQ ++  KS I FS+   +E++  I   L I     +G+YLG+P   GR K+
Sbjct  908   LKQYEEASGQSINTNKSSISFSRKAPLELRAKIKEELNIQREGGVGKYLGLPEHFGRRKK  967

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
             D +  ++ RI  +   W NR LS  G+ T+I+SVLS IP + M    LP  +  R++   
Sbjct  968   DLFTSIVDRIIQKGRSWSNRFLSKAGKLTMIKSVLSPIPSHAMTCFKLPLSLCKRIQAAV  1027

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
               F W   +G +K   +SW K+T+SK+ G LG++     N A   KL W+++N  + L  
Sbjct  1028  TRFWWDDKEGTKKMAWVSWDKMTQSKEVGGLGVRDFQAFNDAFLGKLSWRILNNPEILLS  1087

Query  2355  KIMEAK  2372
             +++  K
Sbjct  1088  RVLLGK  1093



>ref|XP_008237273.1| PREDICTED: uncharacterized protein LOC103336015 [Prunus mume]
Length=1765

 Score =   249 bits (635),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/407 (34%), Positives = 228/407 (56%), Gaps = 2/407 (0%)
 Frame = +3

Query  1155  NGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFV  1334
             N  N T++ L+P + +P  V+++R I LCNV YK+++K +  RLK  +  +I  FQ++F+
Sbjct  882   NDFNHTLVALIPKVHSPTRVSEYRPISLCNVLYKIISKTLANRLKKVLPEVISEFQSAFI  941

Query  1335  LGRQITNNVLVYQEVLNSLRSKSGKGGL-MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPD  1511
               R I +NVL   E ++ L+ +   G   +++K+D+ KAYDR+ W F+   L+  GF   
Sbjct  942   PNRMILDNVLAAFETVHCLKRRGKTGKKKLILKLDMAKAYDRVEWQFLEQMLRTMGFPIR  1001

Query  1512  WIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKN  1691
             +I+ IM CV+T   ++    R     +  RG+RQGDP+SP LF++  E  S L++Q+ ++
Sbjct  1002  FIQLIMGCVTTVSYSLLIQGRPFGRIIPSRGLRQGDPISPYLFLIVAEAFSALLQQAERD  1061

Query  1692  GQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*I  1871
              +  G+ I    P I+HLFF DD + F  A   +A  +K+    +   SGQ+++  KS +
Sbjct  1062  SRLHGVSIAPSAPSINHLFFADDSLLFCNAGTTEALELKRIFGVYELASGQKVNLGKSAL  1121

Query  1872  FFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKN  2051
              FS +T   +Q  I   L + +V    RYLG+P+I G+ K+  +  +  R+  ++ GW+ 
Sbjct  1122  CFSPSTPRVLQDDIRQLLNVTLVPCHERYLGLPTIVGKDKKKLFRTVKDRVWNKVNGWQG  1181

Query  2052  RTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISW  2231
             + LS  G+  LI+SV  AIP Y+M    LP G+   +E +   F W  + G R  +   W
Sbjct  1182  KLLSKAGKEVLIKSVCQAIPSYSMSVFRLPVGLCREIESIIAKFWWSKNDG-RGIHWKKW  1240

Query  2232  KKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
               + + K  G LG + L   NQAL  K GW+L+     L  ++++A+
Sbjct  1241  SFMCQHKSDGGLGFRELTSFNQALLCKQGWRLLEFPHSLIARMLKAR  1287


 Score = 75.9 bits (185),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 97/224 (43%), Gaps = 4/224 (2%)
 Frame = +1

Query  427   RRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQLDDWNKHTIGNIFRRK*RVLA  606
             RRF+F   W    + +E V  +W++ VS  +N  N +  L  W+    G + ++   +  
Sbjct  641   RRFQFEEVWTKEVDCEEVVRHSWQNAVSPLSNIDNCASNLSRWSAEKGGQVPKKVKELRL  700

Query  607   RISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREEWIVSGDRNTRFYHA  786
             R++ +Q      Q      L         E   QEE+ W  RSR  W+  GDRNT F+H 
Sbjct  701   RLASLQSDEPSTQTFHNRSLIETELDTCLE---QEEIYWHQRSRVHWLQHGDRNTSFFHK  757

Query  787   ATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTTQLEDLNDAFFPPLH  966
                 R+  + +  + D    W  + D I   F  F+ +LF+ D      ++  A    + 
Sbjct  758   QATSRRKKNALVGILDENDRWQREYDKIGGVFVEFFTNLFTSDMGVADVEVFSAVQARVS  817

Query  967   TSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSFYQNSWA  1095
             +  +  +   ++  ++E A+  +   KAP  DG    FYQ  W+
Sbjct  818   SRSYHNLLLPYSRDEIEVALNSIGPTKAPGPDGMPALFYQKYWS  861


 Score = 63.5 bits (153),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/209 (26%), Positives = 80/209 (38%), Gaps = 12/209 (6%)
 Frame = +2

Query  2774  STYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDH  2953
             S+  + W ++  LKVP +I   LW    D   +     RR  T    C  C    E   H
Sbjct  1437  SSSLKSWKHLWKLKVPQKILHLLWRVAQDILPSKEVLFRRRITQGEVCCRCFAPRETTLH  1496

Query  2954  IMQRCPIANSVWESL-IPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWL  3130
              +  C +   VWE+L  P D       D   W D   S +       +++  FA T+W L
Sbjct  1497  ALVGCVVCLQVWEALDFPRDFLLPTVADVGTWMDAAWSIIPP-----DKQSLFAFTVWVL  1551

Query  3131  WKWRNDLVFSGTNINLAARIKWIRDQVEEIN-ISFSKAKGLIAPIESICWRQLKWIRPQV  3307
             W  RN ++F          ++  +D   E    S +  + L     S   R +KW  P  
Sbjct  1552  WNERNGVLFGSQPTPSGVLVQRAKDYDAEFKRYSAANHRSL-----SSLVRDIKWRPPTG  1606

Query  3308  GWVKANIDGSSIPSNSIARCGGFIRDDQG  3394
                K N+DG++         G  +RD  G
Sbjct  1607  NCFKLNVDGATDMETGARGAGAIVRDSHG  1635



>emb|CAB75484.1| putative protein [Arabidopsis thaliana]
Length=851

 Score =   288 bits (737),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 151/441 (34%), Positives = 244/441 (55%), Gaps = 5/441 (1%)
 Frame = +3

Query  1065  PNQLLPKFM----GTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSI  1232
             P+ L  +F       V + +IK    FF + H+    N T IC++P I NP  ++ +R I
Sbjct  69    PDGLTARFYKQCWDIVGNDVIKEVKLFFESSHMKTSVNHTNICMIPKIQNPQTLSDYRPI  128

Query  1233  GLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGK  1409
              LCNV YK+++K M  RLK+ +  ++   Q +F+ GR I +NV++  E+++SL+  K   
Sbjct  129   ALCNVLYKVISKCMVNRLKAHLNSIVSDSQAAFIPGRIINDNVMIAHEIMHSLKVRKRVS  188

Query  1410  GGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWF  1589
                M +K D+ KAYDR+ W F+ +T++  GF   WI  IM+ V +   ++  +     + 
Sbjct  189   KTYMAVKTDVSKAYDRVEWDFLETTMRLFGFCDKWIGWIMAAVKSVHYSVLINGSPHGYI  248

Query  1590  MLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVF  1769
                RGIRQGDPLSP LF+L  + LSHLI+    +G  +G++I    P I+HL F DD +F
Sbjct  249   SPTRGIRQGDPLSPYLFILCGDILSHLIKVKASSGDIRGVRIGNGAPAITHLQFADDSLF  308

Query  1770  FGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDL  1949
             F +A++     +K   + +   SGQ+++  KS I F        Q  + + L IP     
Sbjct  309   FCQANVRNCQALKDVFDVYEYYSGQKINVQKSLITFGSRVYGSTQTRLKTLLNIPNQGGG  368

Query  1950  GRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQS  2129
             G+YLG+P   GR K++ +  ++ R++ R   W  + LS  G+  L++SV  A+P Y M  
Sbjct  369   GKYLGLPEQFGRKKKEMFNYIIDRVKERTASWSAKFLSPAGKEILLKSVALAMPVYAMSC  428

Query  2130  SLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFA  2309
               LPQG++S +E L  +F W  +   R    ++WK++  SK +G LG + L   N AL A
Sbjct  429   FKLPQGIVSEIESLLMNFWWEKASNKRGIPWVAWKRLQYSKKEGGLGFRDLAKFNDALLA  488

Query  2310  KLGWKLMNKEDGLCVKIMEAK  2372
             K  W+++   + L  ++M+A+
Sbjct  489   KQAWRIIQYPNSLFARVMKAR  509


 Score = 54.7 bits (130),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 47/198 (24%), Positives = 84/198 (42%), Gaps = 13/198 (7%)
 Frame = +2

Query  2756  HYSRGLSTYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNL  2935
             H S  L T  ++WN    L +  +++ FLW        T  +   RG   +  C  CR  
Sbjct  658   HGSVDLKT--KIWN----LPIMPKLKHFLWRILSKALPTTDRLTTRGMRIDPGCPRCRRE  711

Query  2936  PEDIDHIMQRCPIANSVWE-SLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFA  3112
              E I+H +  CP A   W  S  P     +   +  +     +  L +      Q++   
Sbjct  712   NESINHALFTCPFATMAWRLSDTPLYRSSILSNNIEDNISNILLLLQNTTITDSQKLIPF  771

Query  3113  VTMWWLWKWRNDLVFSGTNINLAARIKWIRDQVEE---INISFSKAKGLIAPIESICWRQ  3283
               +W +WK RN++VF+  N+  +  I  +R + E    +N + ++    + P  +     
Sbjct  772   WLLWRIWKARNNVVFN--NLRESPSITVVRAKAETNEWLNATQTQGPRRL-PKRTTAAGN  828

Query  3284  LKWIRPQVGWVKANIDGS  3337
               W++PQ+ ++K N D S
Sbjct  829   TTWVKPQMPYIKCNFDAS  846



>emb|CCA66178.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1381

 Score =   258 bits (658),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 149/428 (35%), Positives = 233/428 (54%), Gaps = 11/428 (3%)
 Frame = +3

Query  1092  GTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKA  1271
             G +K  + +    F+ +  LP G N   I L+P + NP     +R I +    YK++ K 
Sbjct  461   GIIKHDIYEMVHKFWESSRLPQGSNVAYIALIPKMSNPKNFKDYRPISMVGCLYKIIAKV  520

Query  1272  MTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAY  1451
             M  RL+  M  LIGP Q+S++ GRQI +  LV  EV++S + KSG   ++  K+D  KAY
Sbjct  521   MAKRLQKIMSSLIGPLQSSYIEGRQILDGALVAGEVIDSCK-KSGVEAIL-FKLDFHKAY  578

Query  1452  DRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSP  1631
             D +SWSF++  L +  F   W + IM+CV+T+  +I  +   S  F L+RG+RQGDPLSP
Sbjct  579   DSVSWSFLKWILMQMRFPEQWCQWIMTCVTTASASILVNGSPSTPFKLKRGLRQGDPLSP  638

Query  1632  LLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKK  1811
              LFVL  E L+ +I ++   G W G+++ R G  I+HL + DD + F +A L     +K 
Sbjct  639   FLFVLIGEALNQVILKATNMGLWSGVEVCRNGLKITHLQYADDTLVFSDARLESLKNIKM  698

Query  1812  CLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSL----GIPIVNDLGRYLGVPSIH  1979
              L  F   SG ++++ KS I     +   + +A +S L     IP       YLG+P   
Sbjct  699   ALILFHLASGLQVNFHKSSIIGMNTSKTWLNEAANSLLCKTGDIPFT-----YLGLPIGE  753

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
                K  ++  ++++I  +L  WK R LS  GR TLI+S LS +P Y M    +P+GV+ +
Sbjct  754   NIHKIKAWDPIINKISMKLATWKGRMLSIGGRLTLIKSSLSNLPLYFMSLFPIPKGVVEK  813

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             + +++R FLW      R   L++WK     KD G LGI  +   N A+ +K  W+L++  
Sbjct  814   INKITRRFLWSGDMEKRSIPLVAWKIAQLPKDMGGLGIGNIFHKNSAMLSKWMWRLLSDS  873

Query  2340  DGLCVKIM  2363
               +  +++
Sbjct  874   SPIWCQVV  881


 Score = 66.6 bits (161),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 79/316 (25%), Positives = 136/316 (43%), Gaps = 42/316 (13%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVL-----  384
             F+D++    L+++  +   +TW +G S      + LDR   N EW    P++ V      
Sbjct  164   FKDFVQDSHLLEIPPACGGFTWFRGNSR-----SILDRLFVNPEWITNLPNLRVSLLQRG  218

Query  385   ---HLPMVNSYHTLG-ESRRFRFNAAW*THPNYQE*VSSTWKSDVSLE--ANKSNLSKQL  546
                H P++     L    + FRF   W + P   + V + W+   +L        + K+L
Sbjct  219   LSDHCPLLVHNKELDWGPKPFRFQNCWLSDPECLKIVKAVWQDAEALHTIGKLKEVKKRL  278

Query  547   DDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQ----EE  714
               WN    GNI  +   +    S +Q   S+    DL   + + R+E    L++     E
Sbjct  279   KSWNLTEFGNIDSK---IKKFESEIQHLDSINNTRDLDTQELENRKEAQVELWKWIKRRE  335

Query  715   LLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFH---  885
             + W   SR  W+  GDRNT F+HA  + ++  +++  ++        DG  I EP     
Sbjct  336   MYWAQNSRVTWLKEGDRNTMFFHAIASNKRRKNSITTVE-------VDGLKIDEPSRIKW  388

Query  886   ---AFYMDLFSEDSTTQ--LEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKA  1047
                 ++  +F E+   +   EDLN   F  +   Q   +   F+ +++ EAV   +  KA
Sbjct  389   EATTYFKKIFKEEHGCRPLFEDLN---FKCVTHEQAEQLTLPFSCEEIDEAVSTCSSDKA  445

Query  1048  PSSDGFQTSFYQNSWA  1095
             P  DGF   F +++W 
Sbjct  446   PGPDGFNFKFIKSAWG  461



>gb|AAP54617.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|EAZ16681.1| hypothetical protein OsJ_32156 [Oryza sativa Japonica Group]
Length=1339

 Score =   294 bits (752),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 152/437 (35%), Positives = 239/437 (55%), Gaps = 0/437 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP        G +++ +      F     +P G  D+V+ L+P + N   +++FR I LC
Sbjct  424   FPALFYQTHWGILEEHICNAVRGFLLGEEIPEGLCDSVVVLIPKVNNASHLSKFRPISLC  483

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLM  1421
             NV YK+ +K +  RLK  +  ++  FQ++FV GR IT++ LV  E L+++R +  K    
Sbjct  484   NVLYKIASKVLANRLKPFLPDIVSEFQSAFVPGRLITDSALVAYECLHTIRKQHNKNPFF  543

Query  1422  VIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLER  1601
              +KID+ KAYDR+ W+++   L K GFS DWI  +M CVS+ R A+  +  L+K  +  R
Sbjct  544   ALKIDMMKAYDRVEWAYLSGCLSKLGFSQDWINTVMRCVSSVRYAVKINGELTKPVVPSR  603

Query  1602  GIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEA  1781
             GIRQGDP+SP LF+L  E LS L+ +    G+ +G+K  R GP ISHL F DD +FF +A
Sbjct  604   GIRQGDPISPYLFLLCTEGLSCLLHKKEVAGELQGIKNGRHGPPISHLLFADDSIFFAKA  663

Query  1782  SLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYL  1961
                    +K  L  +CS SGQ+++  KS IFF K     ++ ++ S L +        YL
Sbjct  664   DSRNVQALKNTLRSYCSASGQKINLHKSSIFFGKRCPDAVKISVKSCLQVDNEVLQDSYL  723

Query  1962  GVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLP  2141
             G+P+  G    + +  L  RI  R+ GW +R LS  G  T++++V  AIP Y M    +P
Sbjct  724   GMPTEIGLATTNFFKFLPERIWKRVNGWTDRPLSRAGMETMLKAVAQAIPNYVMSCFRIP  783

Query  2142  QGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGW  2321
               +  +++    D  WG   G +K +  SW  ++  K  G +G +     NQA+  +  W
Sbjct  784   VSICEKMKTCIADHWWGFEDGKKKMHWKSWSWLSTPKFLGGMGFREFTTFNQAMLGRQCW  843

Query  2322  KLMNKEDGLCVKIMEAK  2372
             +L+   D LC ++++ +
Sbjct  844   RLLTDPDSLCSRVLKGR  860


 Score =   110 bits (274),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 90/309 (29%), Positives = 155/309 (50%), Gaps = 30/309 (10%)
 Frame = +1

Query  244   GLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYH---T  414
             GLIDLG+ GP +TW     + +    RLDRA+ N E+     D  V ++   +S H   +
Sbjct  131   GLIDLGFVGPKFTWSNKQDANSNSKVRLDRAVANGEFSRYFEDCLVENVITTSSDHYAIS  190

Query  415   LGESRR------------FRFNAAW*THPNYQE*VSSTWK----SDVSLEANKSNLSK--  540
             +  SRR            FRF AAW    +Y+E V ++W+      V L    S L +  
Sbjct  191   IDLSRRNHGQRRIPIQQGFRFEAAWLRAEDYREVVENSWRISSAGCVGLRGVWSVLQQVA  250

Query  541   -QLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEEL  717
               L DW+K + G++ R+  ++  ++  +++S        +I+ ++ + ++L E+  +EE+
Sbjct  251   VSLKDWSKASFGSVRRKILKMERKLKSLRQS---PVNDVVIQEEKLIEQQLCELFEKEEI  307

Query  718   LWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYM  897
             +   RSR +W+  GDRNT F+HA  + R+  + ++ L  + G      +GI      FY 
Sbjct  308   MARQRSRVDWLREGDRNTAFFHARASARRRTNRIKELVRDDGSRCISQEGIKRMAEVFYE  367

Query  898   DLFSEDSTTQLEDLNDAFFPPLHTSQWL--AINAHFTVKDLE-AVFEMAQFKAPSSDGFQ  1068
             +LFS +    +E++ DA   P     ++   +   +T ++++ A+F+M   KAP  DGF 
Sbjct  368   NLFSSEPCDSMEEVLDAI--PNKVGDFINGELGKQYTNEEIKTALFQMGSTKAPGPDGFP  425

Query  1069  TSFYQNSWA  1095
               FYQ  W 
Sbjct  426   ALFYQTHWG  434



>gb|AAG13524.1|AC068924_29 putative non-LTR retroelement reverse transcriptase [Oryza sativa 
Japonica Group]
Length=1382

 Score =   294 bits (752),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 152/437 (35%), Positives = 239/437 (55%), Gaps = 0/437 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP        G +++ +      F     +P G  D+V+ L+P + N   +++FR I LC
Sbjct  467   FPALFYQTHWGILEEHICNAVRGFLLGEEIPEGLCDSVVVLIPKVNNASHLSKFRPISLC  526

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLM  1421
             NV YK+ +K +  RLK  +  ++  FQ++FV GR IT++ LV  E L+++R +  K    
Sbjct  527   NVLYKIASKVLANRLKPFLPDIVSEFQSAFVPGRLITDSALVAYECLHTIRKQHNKNPFF  586

Query  1422  VIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLER  1601
              +KID+ KAYDR+ W+++   L K GFS DWI  +M CVS+ R A+  +  L+K  +  R
Sbjct  587   ALKIDMMKAYDRVEWAYLSGCLSKLGFSQDWINTVMRCVSSVRYAVKINGELTKPVVPSR  646

Query  1602  GIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEA  1781
             GIRQGDP+SP LF+L  E LS L+ +    G+ +G+K  R GP ISHL F DD +FF +A
Sbjct  647   GIRQGDPISPYLFLLCTEGLSCLLHKKEVAGELQGIKNGRHGPPISHLLFADDSIFFAKA  706

Query  1782  SLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYL  1961
                    +K  L  +CS SGQ+++  KS IFF K     ++ ++ S L +        YL
Sbjct  707   DSRNVQALKNTLRSYCSASGQKINLHKSSIFFGKRCPDAVKISVKSCLQVDNEVLQDSYL  766

Query  1962  GVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLP  2141
             G+P+  G    + +  L  RI  R+ GW +R LS  G  T++++V  AIP Y M    +P
Sbjct  767   GMPTEIGLATTNFFKFLPERIWKRVNGWTDRPLSRAGMETMLKAVAQAIPNYVMSCFRIP  826

Query  2142  QGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGW  2321
               +  +++    D  WG   G +K +  SW  ++  K  G +G +     NQA+  +  W
Sbjct  827   VSICEKMKTCIADHWWGFEDGKKKMHWKSWSWLSTPKFLGGMGFREFTTFNQAMLGRQCW  886

Query  2322  KLMNKEDGLCVKIMEAK  2372
             +L+   D LC ++++ +
Sbjct  887   RLLTDPDSLCSRVLKGR  903


 Score =   109 bits (273),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 90/309 (29%), Positives = 155/309 (50%), Gaps = 30/309 (10%)
 Frame = +1

Query  244   GLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYH---T  414
             GLIDLG+ GP +TW     + +    RLDRA+ N E+     D  V ++   +S H   +
Sbjct  174   GLIDLGFVGPKFTWSNKQDANSNSKVRLDRAVANGEFSRYFEDCLVENVITTSSDHYAIS  233

Query  415   LGESRR------------FRFNAAW*THPNYQE*VSSTWK----SDVSLEANKSNLSK--  540
             +  SRR            FRF AAW    +Y+E V ++W+      V L    S L +  
Sbjct  234   IDLSRRNHGQRRIPIQQGFRFEAAWLRAEDYREVVENSWRISSAGCVGLRGVWSVLQQVA  293

Query  541   -QLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEEL  717
               L DW+K + G++ R+  ++  ++  +++S        +I+ ++ + ++L E+  +EE+
Sbjct  294   VSLKDWSKASFGSVRRKILKMERKLKSLRQS---PVNDVVIQEEKLIEQQLCELFEKEEI  350

Query  718   LWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYM  897
             +   RSR +W+  GDRNT F+HA  + R+  + ++ L  + G      +GI      FY 
Sbjct  351   MARQRSRVDWLREGDRNTAFFHARASARRRTNRIKELVRDDGSRCISQEGIKRMAEVFYE  410

Query  898   DLFSEDSTTQLEDLNDAFFPPLHTSQWL--AINAHFTVKDLE-AVFEMAQFKAPSSDGFQ  1068
             +LFS +    +E++ DA   P     ++   +   +T ++++ A+F+M   KAP  DGF 
Sbjct  411   NLFSSEPCDSMEEVLDAI--PNKVGDFINGELGKQYTNEEIKTALFQMGSTKAPGPDGFP  468

Query  1069  TSFYQNSWA  1095
               FYQ  W 
Sbjct  469   ALFYQTHWG  477



>ref|XP_010451797.1| PREDICTED: uncharacterized protein LOC104733977 [Camelina sativa]
Length=1377

 Score =   274 bits (700),  Expect(3) = 2e-78, Method: Compositional matrix adjust.
 Identities = 150/431 (35%), Positives = 231/431 (54%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             K+  TV   +IK    FFSTG LP   N T +CL+P  PN   ++  R I LC+V YK++
Sbjct  465   KYWSTVGTDIIKEVQGFFSTGVLPQDWNHTQLCLIPKKPNANQMSDMRPISLCSVLYKIV  524

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDL  1439
             +K +  RL   +  L+   Q +FV GR I++N+L+  EV+++L++ S     ++ +K D+
Sbjct  525   SKVICTRLTRCLPSLVSETQGAFVAGRLISDNILIAHEVVHALKTHSSFNEDVIAVKTDM  584

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+   L K GF   W+  IMSCV +   ++  +     +    RGIRQGD
Sbjct  585   SKAYDRVEWDFLEHLLLKMGFHNQWVGWIMSCVRSVTFSVLINGGDYGYIKPGRGIRQGD  644

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  E L H + +S +  +  G       P I HL F DD +F   A+  +  
Sbjct  645   PLSPFLFILCAEALIHSMCRSQQQDRLTGFSFNETCPTIQHLLFADDSLFICRATKEECE  704

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              + +CL  +   SGQ +++ KS I F K TS  ++  +  +L I      G YLG+P   
Sbjct  705   ELMRCLKLYGKASGQVINFTKSAITFGKKTSDAVKLMVKQTLNIHEEGGSGSYLGLPECF  764

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
                KQ     +  ++Q RL GW  ++LS  G+  L+++V  A+P Y M    L + +  +
Sbjct  765   SGSKQALLGFIGEKLQNRLQGWHAKSLSLGGKEVLLKAVGMALPVYAMSCFRLSKNLCRK  824

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             L      F W + +G RK   I+WKK+ +SK +G LG + L   NQAL AK  W+++N  
Sbjct  825   LTSAMCKFWWSNCQGKRKIAWIAWKKLCKSKSEGGLGFKDLGDFNQALLAKQAWRILNNP  884

Query  2340  DGLCVKIMEAK  2372
               L  +  +++
Sbjct  885   GSLVSRFYKSR  895


 Score = 49.3 bits (116),  Expect(3) = 2e-78, Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 67/133 (50%), Gaps = 5/133 (4%)
 Frame = +1

Query  706   QEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFG-EWISDG-DGILEP  879
             +EE+ W  +SRE W+ +GD+NT ++H +   ++  + +  L D+ G E   +G  G +  
Sbjct  338   EEEVYWKLKSRESWLQAGDKNTAYFHGSVKYKRLKNRLTLLIDSNGVECFEEGSKGTIAA  397

Query  880   FHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSS  1056
                ++ DLF   + T  E+L +     +       +    + +++ +A F +    AP +
Sbjct  398   --EYFSDLFQSSNPTNFEELLEGMEERVTEDMNRRLIVDVSAQEIRQAAFNIKGDSAPGA  455

Query  1057  DGFQTSFYQNSWA  1095
             DG+  +F++  W+
Sbjct  456   DGWTGAFFRKYWS  468


 Score = 21.9 bits (45),  Expect(3) = 2e-78, Method: Compositional matrix adjust.
 Identities = 10/36 (28%), Positives = 16/36 (44%), Gaps = 0/36 (0%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             S  W+ IL    +L  G  K + +   T  W + W+
Sbjct  912   SYAWRSILHGRELLKSGLMKSIGDGCDTFVWKNKWL  947



>gb|AAG03119.1|AC004133_13 F5A9.24 [Arabidopsis thaliana]
Length=1254

 Score =   254 bits (650),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 155/463 (33%), Positives = 247/463 (53%), Gaps = 14/463 (3%)
 Frame = +3

Query  1086  FMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLT  1265
             +  TV + +      FF+ G +P   N T +CL+P   +P  +   R I LC+V YK+++
Sbjct  425   YWSTVGNQVTSEVKKFFADGIMPAEWNYTHLCLIPKTQHPTEMVDLRPISLCSVLYKIIS  484

Query  1266  KAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDLE  1442
             K M  RL+  +  ++   Q++FV  R IT+N+LV  E+++SL+         M +K D+ 
Sbjct  485   KIMAKRLQPWLPEIVSDTQSAFVSERLITDNILVAHELVHSLKVHPRISSEFMAVKSDMS  544

Query  1443  KAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDP  1622
             KAYDR+ WS++RS L   GF   W+  IM CVS+   ++  +       +L+RG+RQGDP
Sbjct  545   KAYDRVEWSYLRSLLLSLGFHLKWVNWIMVCVSSVTYSVLINDCPFGLIILQRGLRQGDP  604

Query  1623  LSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASV  1802
             LSP LFVL  E L+HL+ ++   G  +G++ +  GP + HL F DD +F  +AS  Q+ V
Sbjct  605   LSPFLFVLCTEGLTHLLNKAQWEGALEGIQFSENGPMVHHLLFADDSLFLCKASREQSLV  664

Query  1803  VKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHG  1982
             ++K L  + + +GQ ++  KS I F +    +++  I + LGI      G YLG+P    
Sbjct  665   LQKILKVYGNATGQTINLNKSSITFGEKVDEQLKGTIRTCLGIFTEGGAGTYLGLPECFS  724

Query  1983  RLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRL  2162
               K D    L  R++ +L  W  R LS  G+  L++SV  A+P + M    LP      L
Sbjct  725   GSKVDMLHYLKDRLKEKLDVWFTRCLSQGGKEVLLKSVALAMPVFAMSCFKLPITTCENL  784

Query  2163  ERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKED  2342
             E     F W S   +RK +  SW+++   KD G LG + +   NQAL AK  W+L++  D
Sbjct  785   ESAMASFWWDSCDHSRKIHWQSWERLCLPKDSGGLGFRDIQSFNQALLAKQAWRLLHFPD  844

Query  2343  GLCVKIMEAKV------------QLPSLPSQACQMYGRVFLSR  2435
              L  ++++++             Q PS   ++  ++GR  LS+
Sbjct  845   CLLSRLLKSRYFDATDFLDAALSQRPSFGWRSI-LFGRELLSK  886


 Score = 68.9 bits (167),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 74/315 (23%), Positives = 135/315 (43%), Gaps = 34/315 (11%)
 Frame = +1

Query  217   GFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEW------------KI  360
              F + I    L+++   G  +TW  G    ++   RLDRA  N EW              
Sbjct  125   AFNEMIKGCDLVEMPAHGNGFTW-AGRRGDHWIQCRLDRAFGNKEWFCFFPVSNQTFLDF  183

Query  361   RSPDVEVLHLPMVNSYHTLGESRR--FRFNAAW*THPNYQE*VSSTWK-----SDVSLEA  519
             R  D    H P++    +  +S R  FRF+  +    + +E +  TW      +++S+  
Sbjct  184   RGSD----HRPVLIKLMSSQDSYRGQFRFDKRFLFKEDVKEAIIRTWSRGKHGTNISVAD  239

Query  520   NKSNLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkld--likldrklrreld  693
                   K L  W K    N        L +I+ ++ +L   Q L   + +    L+++L 
Sbjct  240   RLRACRKSLSSWKKQNNLN-------SLDKINQLEAALEKEQSLVWPIFQRVSVLKKDLA  292

Query  694   eilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGIL  873
             +   +EE  W  +SR++W+ SG+RN++++HAA    +    + +LKD  G   +      
Sbjct  293   KAYREEEAYWKQKSRQKWLRSGNRNSKYFHAAVKQNRQRKRIEKLKDVNGNMQTSEAAKG  352

Query  874   EPFHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAP  1050
             E   A++ +LF   + +   D      P +      ++    + +++ EAVF +    AP
Sbjct  353   EVAAAYFGNLFKSSNPSGFTDWFSGLVPRVSEVMNESLVGEVSAQEIKEAVFSIKPASAP  412

Query  1051  SSDGFQTSFYQNSWA  1095
               DG    F+Q+ W+
Sbjct  413   GPDGMSALFFQHYWS  427



>ref|XP_010692477.1| PREDICTED: uncharacterized protein LOC104905588 [Beta vulgaris 
subsp. vulgaris]
Length=1260

 Score =   292 bits (748),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 153/431 (35%), Positives = 248/431 (58%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             +F   V D +  F S+       P+  N+T I L+P + NP    +FR I LCNV YK++
Sbjct  367   RFWHIVGDDVTSFISNILHGHSSPSCVNNTNIALIPKVKNPTKAAEFRPIALCNVLYKLM  426

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKS-GKGGLMVIKIDL  1439
             +KA+ +RLKS +  +I   Q++FV GR IT+N L+  EV +S+++++  + G + +K+D+
Sbjct  427   SKAIVMRLKSFLPEIISENQSAFVPGRLITDNALIAMEVFHSMKNRNRSRKGTIAMKLDM  486

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+R  L   GF   W+  IM  VS+   +   +  +    +  RG+RQGD
Sbjct  487   SKAYDRVEWGFLRKLLLTMGFDGRWVNLIMEFVSSVTYSFIINGSVCGSVVPARGLRQGD  546

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF++  +  S +I++ V++ Q  G K +R GP ISHLFF DD + F  A+  + +
Sbjct  547   PLSPYLFIMVADAFSKMIQRKVQDKQLHGAKASRSGPEISHLFFADDSLLFTRANRQECT  606

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             ++   LN++   SGQ+++Y KS + +S+  SV  +  +++ L +  V+   +YLG+PSI 
Sbjct  607   IIVDILNQYELASGQKINYEKSEVSYSRGVSVSQKDELTNILNMRQVDRHEKYLGIPSIS  666

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+  +  L+ RI  +L GWK + LS  G+  L++SV+ AIP Y M     P  ++ +
Sbjct  667   GRSKKAIFDSLIDRIWKKLQGWKEKLLSRAGKEVLLKSVIQAIPTYLMGVYKFPVFIIQK  726

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             ++     F WGSS   RK +  +W  +   K  G +G + L   N AL  +  W+L  + 
Sbjct  727   IQSAMARFWWGSSDTQRKIHWKNWDSMCNLKCFGGMGFKDLTIFNDALLGRQAWRLTREP  786

Query  2340  DGLCVKIMEAK  2372
               L  ++M+AK
Sbjct  787   QSLLGRVMKAK  797



>ref|XP_010468391.1| PREDICTED: uncharacterized protein LOC104748447 [Camelina sativa]
Length=850

 Score =   287 bits (734),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 155/438 (35%), Positives = 244/438 (56%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             F +     F   + + + +    FF T +L    N+T + L+P I  P  V  +R I LC
Sbjct  17    FSSSFYQSFWTIIGEDVCRSIRSFFETSYLHPRQNETHVRLIPKISGPRKVGDYRPIALC  76

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGL  1418
             N  YK++ K +T RL+  +  LI PFQ +FV  R I++NVL+  E+L+ LR S++ K   
Sbjct  77    NTHYKIIAKILTGRLQPILPELISPFQCAFVPNRAISDNVLITHEILHFLRTSEAKKFCS  136

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
             M +K D+ KAYDR+ W F++S L+K GFS  WI  I +CVS+   +   +       +  
Sbjct  137   MAVKTDMSKAYDRIEWGFLKSVLEKLGFSERWISWISACVSSVSYSFLINGSPQGQVIPS  196

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP LF+L  E LS L  ++   G   G+K++R  P ++HL F DD +FF +
Sbjct  197   RGLRQGDPLSPYLFILCTEVLSGLCVKAQDQGILSGIKVSRASPPVNHLLFADDTMFFCK  256

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             ++      + + L ++  +SGQ ++  KS I FS  T  E +  + +SL I     LG Y
Sbjct  257   SNARCCQALTQILAKYEKVSGQCINLTKSTITFSSKTPAEAKVRVKNSLNITQEGGLGNY  316

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG+P   GR K+D +A ++ +++ R+  W  R LS  G+  L+ +VL+A+P Y M    L
Sbjct  317   LGLPENFGRKKRDIFASIVDKVRQRVHSWPGRFLSGAGKQVLLTTVLTALPIYPMSCFKL  376

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P  +  +++ +   F W      +K   +SW+ +T+ K  G LG + L+  N AL AK G
Sbjct  377   PVSLCKQIQSVLTRFWWDDKPEVKKMCWVSWESLTQPKYLGGLGFRDLEKFNDALLAKTG  436

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W+L+ + D L  +++  K
Sbjct  437   WRLLTQPDSLLTRVLLGK  454



>gb|AAF97969.1|AC000103_19 F21J9.30 [Arabidopsis thaliana]
Length=1270

 Score =   254 bits (648),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 155/463 (33%), Positives = 247/463 (53%), Gaps = 14/463 (3%)
 Frame = +3

Query  1086  FMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLT  1265
             +  TV + +      FF+ G +P   N T +CL+P   +P  +   R I LC+V YK+++
Sbjct  422   YWSTVGNQVTSEVKKFFADGIMPAEWNYTHLCLIPKTQHPTEMVDLRPISLCSVLYKIIS  481

Query  1266  KAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDLE  1442
             K M  RL+  +  ++   Q++FV  R IT+N+LV  E+++SL+         M +K D+ 
Sbjct  482   KIMAKRLQPWLPEIVSDTQSAFVSERLITDNILVAHELVHSLKVHPRISSEFMAVKSDMS  541

Query  1443  KAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDP  1622
             KAYDR+ WS++RS L   GF   W+  IM CVS+   ++  +       +L+RG+RQGDP
Sbjct  542   KAYDRVEWSYLRSLLLSLGFHLKWVNWIMVCVSSVTYSVLINDCPFGLIILQRGLRQGDP  601

Query  1623  LSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASV  1802
             LSP LFVL  E L+HL+ ++   G  +G++ +  GP + HL F DD +F  +AS  Q+ V
Sbjct  602   LSPFLFVLCTEGLTHLLNKAQWEGALEGIQFSENGPMVHHLLFADDSLFLCKASREQSLV  661

Query  1803  VKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHG  1982
             ++K L  + + +GQ ++  KS I F +    +++  I + LGI      G YLG+P    
Sbjct  662   LQKILKVYGNATGQTINLNKSSITFGEKVDEQLKGTIRTCLGIFTEGGAGTYLGLPECFS  721

Query  1983  RLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRL  2162
               K D    L  R++ +L  W  R LS  G+  L++SV  A+P + M    LP      L
Sbjct  722   GSKVDMLHYLKDRLKEKLDVWFTRCLSQGGKEVLLKSVALAMPVFAMSCFKLPITTCENL  781

Query  2163  ERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKED  2342
             E     F W S   +RK +  SW+++   KD G LG + +   NQAL AK  W+L++  D
Sbjct  782   ESAMASFWWDSCDHSRKIHWQSWERLCLPKDSGGLGFRDIQSFNQALLAKQAWRLLHFPD  841

Query  2343  GLCVKIMEAKV------------QLPSLPSQACQMYGRVFLSR  2435
              L  ++++++             Q PS   ++  ++GR  LS+
Sbjct  842   CLLSRLLKSRYFDATDFLDAALSQRPSFGWRSI-LFGRELLSK  883


 Score = 68.9 bits (167),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 74/315 (23%), Positives = 135/315 (43%), Gaps = 34/315 (11%)
 Frame = +1

Query  217   GFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEW------------KI  360
              F + I    L+++   G  +TW  G    ++   RLDRA  N EW              
Sbjct  122   AFNEMIKGCDLVEMPAHGNGFTW-AGRRGDHWIQCRLDRAFGNKEWFCFFPVSNQTFLDF  180

Query  361   RSPDVEVLHLPMVNSYHTLGESRR--FRFNAAW*THPNYQE*VSSTWK-----SDVSLEA  519
             R  D    H P++    +  +S R  FRF+  +    + +E +  TW      +++S+  
Sbjct  181   RGSD----HRPVLIKLMSSQDSYRGQFRFDKRFLFKEDVKEAIIRTWSRGKHGTNISVAD  236

Query  520   NKSNLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkld--likldrklrreld  693
                   K L  W K    N        L +I+ ++ +L   Q L   + +    L+++L 
Sbjct  237   RLRACRKSLSSWKKQNNLN-------SLDKINQLEAALEKEQSLVWPIFQRVSVLKKDLA  289

Query  694   eilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGIL  873
             +   +EE  W  +SR++W+ SG+RN++++HAA    +    + +LKD  G   +      
Sbjct  290   KAYREEEAYWKQKSRQKWLRSGNRNSKYFHAAVKQNRQRKRIEKLKDVNGNMQTSEAAKG  349

Query  874   EPFHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAP  1050
             E   A++ +LF   + +   D      P +      ++    + +++ EAVF +    AP
Sbjct  350   EVAAAYFGNLFKSSNPSGFTDWFSGLVPRVSEVMNESLVGEVSAQEIKEAVFSIKPASAP  409

Query  1051  SSDGFQTSFYQNSWA  1095
               DG    F+Q+ W+
Sbjct  410   GPDGMSALFFQHYWS  424



>ref|XP_009361334.1| PREDICTED: uncharacterized protein LOC103951630 [Pyrus x bretschneideri]
Length=1297

 Score =   292 bits (748),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 161/438 (37%), Positives = 243/438 (55%), Gaps = 9/438 (2%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             F N L+    G V+D ++  +         P   N T I LVP I NP  V QFR I LC
Sbjct  379   FWNSLMDDVNGIVQDYMLGVSD--------PQRLNSTHIVLVPKISNPDSVGQFRPISLC  430

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGL-  1418
             N SYK+++K +  RLK  +  +I P Q++FV+GRQI +N+ +  E+ + L+ +  K    
Sbjct  431   NYSYKIVSKILANRLKPLLSEIISPTQSAFVMGRQIQDNIGIAHEMFHFLKLRKAKSKFE  490

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
             M +K+D+ KAYDR+ W F+ + ++K GF   W   +M  V T   AI  + +  K F+  
Sbjct  491   MGVKLDMHKAYDRVEWDFLEAVMEKLGFCSQWRNLVMGYVKTVEFAIILNGQPGKQFIPT  550

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RGIRQGDPLSP LF+L  E L  LI+Q+V+     G++     P ISHLFF DD + F  
Sbjct  551   RGIRQGDPLSPYLFILVGEVLDKLIQQAVERRMLMGIQPNYGCPIISHLFFADDTLIFMR  610

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A     + +KK L ++CS SGQ ++Y KS +FF  N    +   +   +GIP+  + G+Y
Sbjct  611   ADKKNCNSLKKILADYCSASGQLVNYQKSCLFFGANVPRCLSIELGHFVGIPLAEEPGKY  670

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG+PS  GR K+   A +  RI A++ GWK  TLS  G+  +I++V+ AIP Y M     
Sbjct  671   LGLPSFWGRSKKQGLAFVKERILAKVQGWKQYTLSQAGKEIMIKAVIQAIPAYPMHLFKF  730

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P  + S  + L  +F WG S G +  + +S   +   K +  +G +     N AL AK  
Sbjct  731   PTTLCSDFDALIAEFWWGKSGGQKGIHWVSRGILGYPKQEEGMGFRNFQAFNDALLAKQC  790

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W+L++  + L  ++++A+
Sbjct  791   WRLIHDPNSLWAQLLKAR  808


 Score = 87.8 bits (216),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 72/293 (25%), Positives = 125/293 (43%), Gaps = 44/293 (15%)
 Frame = +1

Query  247   LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLH--------LPMVN  402
             L+DL ++GP +TW +G+ +      RLDR L N +W+   P+  V+H        +P++ 
Sbjct  121   LMDLDFNGPCFTW-RGMRNGQLVEERLDRGLANRQWQDCWPNTMVIHETAIGSDHIPIII  179

Query  403   SYH--TLGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQLDDWNKHTIGN  576
               H   +   + FRF A W      ++ V    +    L+   + L    ++W K+    
Sbjct  180   QGHPRAVKTKKLFRFEAYWAKEERCKDTVEFKARGR-ELDGLINRLGVLQNNWRKN----  234

Query  577   IFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREEWIVS  756
              +    RV ARI  +                             EE  W  RSR +W+  
Sbjct  235   -WEEIKRVSARIDRLGEI--------------------------EEQFWQQRSRVKWLKE  267

Query  757   GDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTTQLED  936
             GD NT F+H +T  R+  + + ++KD  G+WI +   + +     + +LFS   + +   
Sbjct  268   GDANTAFFHQSTLQRRRRNKLVKIKDGNGDWIDNPSEVQKYIEDHFKNLFSTSGSREWGR  327

Query  937   LNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSFYQNSW  1092
               D   P +       +    ++++++ A  +M   KAP  DGFQ  FY + W
Sbjct  328   TLDCLQPKVSDEMNSGLIKPVSLEEIQTAALQMGGLKAPGPDGFQGIFYHSFW  380



>ref|XP_010667308.1| PREDICTED: uncharacterized protein LOC104884364 [Beta vulgaris 
subsp. vulgaris]
Length=1286

 Score =   292 bits (747),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 161/438 (37%), Positives = 243/438 (55%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             +P     K+   V +S+ K    FF  G L    N T + L+P +  P   N FR I LC
Sbjct  363   YPPFFFQKYWSLVGNSVFKAVRAFFHLGKLLKEVNHTFVTLIPKVEAPSSPNHFRPISLC  422

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLM  1421
             +  YK++ K M  RLK  +  +I P Q +FV  R I +N+L+  EV +S R KSG  G +
Sbjct  423   STIYKVIAKIMASRLKMVLGKIIHPLQGAFVPERLIQDNILLAHEVFHSFRKKSGSSGWL  482

Query  1422  VIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLER  1601
              IK+D+EKAYDRL W+FI +  +K GF   WI  +  C+ST   ++  +      F   R
Sbjct  483   AIKLDMEKAYDRLEWNFIFAVFKKLGFCDRWIDWLKECISTVSFSVLVNGIPGDIFTPSR  542

Query  1602  GIRQGDPLSPLLFVLYVERLS-HLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             GIRQGDPLSP +F+L  E L+  L   S +  +  G+K+   G  I  L F DD++ F +
Sbjct  543   GIRQGDPLSPYIFILCAELLARQLFCASTEGSRLVGVKLGHSGVKIPFLTFADDIMIFAK  602

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             AS+     ++  L+ +C +SGQ ++Y KS    S NT   +  A +  L +   + LG+Y
Sbjct  603   ASVESCREIRGILDTYCRMSGQLVNYNKSAYQCSPNTDPILASAFAQVLQMGEASSLGKY  662

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG P I  ++  +++ ++  ++QA+L+ WK  +LS  GR+ LIQS L+    Y MQ   L
Sbjct  663   LGCPIIDSKVTNNTFGEIQEKVQAQLSKWKANSLSQAGRTILIQSNLATKANYQMQCFSL  722

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P  +L  L++  R+F W  S  ++  NLI W+KV +SK +G LG+++   MN AL  KL 
Sbjct  723   PTHILHSLDKSYRNFFWNKSPESKSPNLIGWEKVCKSKREGGLGLRKAKVMNMALQFKLL  782

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             WK++  +  L V ++  K
Sbjct  783   WKILVSQGNLWVDLVSKK  800


 Score = 56.6 bits (135),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 96/233 (41%), Gaps = 38/233 (16%)
 Frame = +2

Query  2756  HYSRGL-STYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRN  2932
             H +R + S +  +WN    L +P +I+ FLW   +D   T  +       S + C  C +
Sbjct  938   HLTRPIASPFSWIWN----LLIPPKIKFFLWKICNDGLPTKKRLEISHVFSPLECIFCNH  993

Query  2933  LPEDIDHIMQRCPIANSV---------WESLIPYDHRRL*DQDYTNWFDEGISELSSGNR  3085
               E++ H+   CP    V         W SL P       D  +  +       LS+ N+
Sbjct  994   HSENLMHLFLECPFCIDVFDLLGLHHGWPSLPPKPS----DLSFVEF-------LSNMNK  1042

Query  3086  --KHEQRVTFAVTMWWLWKWRNDLVFS-------GTNINLAARIKWIRDQVEEINISFSK  3238
                 E     A+T W++W  RN + F        GT++ +      I +  E + ++ S 
Sbjct  1043  VVSLEDIAKIAITWWFIWYARNGVSFRQEPCSPIGTSLMVWKFYSRIVENFEGVKLAISN  1102

Query  3239  AKGLIAP-IESICWRQLKWIRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQG  3394
              +    P +  I  + + W+ P  G+ K N DGS +   S A  G  IRD+ G
Sbjct  1103  VRS--PPRMRKIPRKNISWVAPPSGFCKLNFDGSKLNDGS-ASLGFIIRDEFG  1152


 Score = 32.3 bits (72),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 27/108 (25%), Positives = 45/108 (42%), Gaps = 0/108 (0%)
 Frame = +1

Query  3415  AQHWA*PKGI*LAKTMGLNHMIF*NRFLRYCGGFLQGQIL*EPVDNILAACRKEIRSIPV  3594
             A+ WA  +GI  A  +G+  +I     L       +   +   + +I+    ++++    
Sbjct  1171  AEAWALREGIRGACNLGIEKLIIEGDNLSVIQAIKRIWKIPWTIHSIILDAGEDLKQFSE  1230

Query  3595  WKVLHAVREQNRAADLLAHMATTISRGTSILHDPCDELLDVLNDDCLG  3738
               + H VRE N AAD LAH   + S  T     P      ++  D LG
Sbjct  1231  VHINHEVREGNAAADWLAHRGHSCSNLTYWFDSPDSSFSVIIRKDALG  1278



>gb|EEE59033.1| hypothetical protein OsJ_10782 [Oryza sativa Japonica Group]
Length=850

 Score =   286 bits (731),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 156/456 (34%), Positives = 246/456 (54%), Gaps = 7/456 (2%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP +   +    +K  +     +FF  G +  G NDT I L+P +  P  + +FR I LC
Sbjct  174   FPARFFQRNWAVLKKEVTTAVRNFFLQGVMLAGVNDTSIVLIPKVSKPEQLKEFRPISLC  233

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGG-L  1418
             NV YK+++K M  RL+  ++ +I   Q++F+  R IT+N L+  E ++ ++ ++  G   
Sbjct  234   NVIYKVVSKCMVNRLRPILKDIISVTQSAFIPERLITDNALIAFECIHHIQKETSAGKQF  293

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
                K+DL KAYDR+ W F+R  L K GF   W+  +M+CV+T + ++SF+  L + F   
Sbjct  294   CAYKLDLAKAYDRVDWDFLRGALTKVGFCSTWVEWVMACVTTVKYSVSFNGNLLEPFSPS  353

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP LF+   + LS ++ Q V+ G+ + +K+ R+ P +SHL F DD + F  
Sbjct  354   RGLRQGDPLSPYLFLFVADGLSTILSQDVQAGRLEELKVCRRAPGVSHLLFADDSLLFFR  413

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A   QASVV++ L  +   +GQ LS  K  +  S +   ++ + I   L +       +Y
Sbjct  414   ACPQQASVVRQALALYQRCTGQLLSSSKCSLLASAHCPTDVLEDIKIVLQVETSTFESKY  473

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG+P+  GR+  + +  +  R+  RL  W  + +S   + TLI+SV  AIP Y +    L
Sbjct  474   LGLPTPEGRMSAERFKAIKERLVKRLNSWVEKFMSLGAKDTLIKSVAQAIPTYVLGLFRL  533

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P        +L RDF WG  +  RK +  +W  +T  K  G LG + L   NQAL  K  
Sbjct  534   PVSTCEAYTKLIRDFWWGDEENKRKIHWTAWDIITRPKGLGGLGFRDLKLFNQALLGKQA  593

Query  2319  WKLMNKEDGLCVKIMEAKVQLPSLPSQACQMYGRVF  2426
             W+L+     LC +I++AK   P+     C++   VF
Sbjct  594   WRLIQFPGSLCARILKAKY-FPN-----CELVDAVF  623


 Score = 81.3 bits (199),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 70/132 (53%), Gaps = 1/132 (1%)
 Frame = +1

Query  703   YQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPF  882
             Y+EE++W  RSR  W+  GDRNT+F+H   A R   + + RLK     ++ + + +    
Sbjct  53    YREEIMWLQRSRVAWLKEGDRNTKFFHRQAAWRSKKNKITRLKAEDSRFVENKEEMEHMA  112

Query  883   HAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSD  1059
               F+  L+ +D++    +L DA  P +       +   F+  ++ +A+F++   KAP  D
Sbjct  113   REFFQTLYLKDNSVDPRELIDALTPRVDDGMNAGLCKPFSYDEIADALFQIGPLKAPGPD  172

Query  1060  GFQTSFYQNSWA  1095
             GF   F+Q +WA
Sbjct  173   GFPARFFQRNWA  184



>gb|EEC75230.1| hypothetical protein OsI_11503 [Oryza sativa Indica Group]
Length=746

 Score =   283 bits (724),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 155/453 (34%), Positives = 245/453 (54%), Gaps = 7/453 (2%)
 Frame = +3

Query  1071  QLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVS  1250
             ++ P     +K  +     +FF  G +  G NDT I L+P +  P  + +FR I LCNV 
Sbjct  72    KIFPAQWAVLKKEVTTAVRNFFLQGVMLAGVNDTSIVLIPKVSKPEQLKEFRPISLCNVI  131

Query  1251  YKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGG-LMVI  1427
             YK+++K M  RL+  ++ +I   Q++F+  R IT+N L+  E ++ ++ ++  G      
Sbjct  132   YKVVSKCMVNRLRPILKDIISVTQSAFIPERLITDNALIAFECIHHIQKETSAGKQFCAY  191

Query  1428  KIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGI  1607
             K+DL KAYDR+ W F+R  L K GF   W+  +M+CV+T + ++SF+  L + F   RG+
Sbjct  192   KLDLAKAYDRVDWDFLRGALTKVGFCSTWVEWVMACVTTVKYSVSFNGNLLEPFSPSRGL  251

Query  1608  RQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASL  1787
             RQGDPLSP LF+   + LS ++ Q V+ G+ + +K+ R+ P +SHL F DD + F  A  
Sbjct  252   RQGDPLSPYLFLFVADGLSTILSQDVQAGRLEELKVCRRAPGVSHLLFADDSLLFFRACP  311

Query  1788  HQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGV  1967
              QASVV++ L  +   +GQ LS  K  +  S +   ++ + I   L +       +YLG+
Sbjct  312   QQASVVRQALALYQRCTGQLLSSSKCSLLASAHCPTDVLEDIKIVLQVETSTFESKYLGL  371

Query  1968  PSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQG  2147
             P+  GR+  + +  +  R+  RL  W  + +S   + TLI+SV  AIP Y +    LP  
Sbjct  372   PTPEGRMSAERFKAIKERLVKRLNSWVEKFMSLGAKDTLIKSVAQAIPTYVLGLFRLPVS  431

Query  2148  VLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKL  2327
                   +L RDF WG  +  RK +  +W  +T  K  G LG + L   NQAL  K  W+L
Sbjct  432   TCEAYTKLIRDFWWGDEENKRKIHWTAWDIITRPKGLGGLGFRDLKLFNQALLGKQAWRL  491

Query  2328  MNKEDGLCVKIMEAKVQLPSLPSQACQMYGRVF  2426
             +     LC +I++AK   P+     C++   VF
Sbjct  492   IQFPGSLCARILKAKY-FPN-----CELVDAVF  518



>ref|XP_009102759.1| PREDICTED: uncharacterized protein LOC103828873 [Brassica rapa]
Length=1081

 Score =   289 bits (739),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 158/436 (36%), Positives = 240/436 (55%), Gaps = 1/436 (0%)
 Frame = +3

Query  1068  NQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNV  1247
             ++ L  F G     + +   +FF +  L    N T ICL+P    P  + +FR I LCNV
Sbjct  320   DEALRNFGGITAGEIFRMVREFFMSETLDPRLNQTNICLIPKTERPCEMTEFRPISLCNV  379

Query  1248  SYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMV  1424
             SYK+++K ++ RLK  +  LI   Q++FV  R IT+N+LV QEV ++LR+  S K   + 
Sbjct  380   SYKVVSKILSNRLKRHLPGLISETQSAFVAKRLITDNILVAQEVFHALRTNPSCKSKFVA  439

Query  1425  IKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERG  1604
             IK D+ KAYDR+ WSF+ + ++K GF+  WI  I  C+S+    +  +          RG
Sbjct  440   IKTDMSKAYDRVEWSFLEALMRKMGFTDRWIAWIHLCISSVSYNVLINGEPKGNITPSRG  499

Query  1605  IRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEAS  1784
             IRQGDPLSP LF++  E L   I+ + + G+  G+KI R  P ISHL F DD +FF +A 
Sbjct  500   IRQGDPLSPFLFIILTEALISQIQGAEREGRITGLKIARDSPPISHLLFADDSLFFCKAD  559

Query  1785  LHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLG  1964
               Q   + K + E+   SGQ+L+  KS IFF      E++  +  +LGI     +G YLG
Sbjct  560   TQQCRELMKIIEEYGRASGQQLNVAKSSIFFGSKVPPELKTELKEALGITREGGMGVYLG  619

Query  1965  VPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQ  2144
             +P      K+ ++A +  R+ +RL  W  + LS  G+  LI+SV  A+P Y M   LLPQ
Sbjct  620   LPEKICGSKRQAFAFIQERLMSRLNSWSAKLLSKGGKEVLIKSVAQAMPSYVMSCFLLPQ  679

Query  2145  GVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWK  2324
              ++ +L      F W + + NR  + ++W K+    ++G LG + L   N AL AK  W+
Sbjct  680   DIIKKLTSAIARFWWSTKQNNRGLHWVAWNKICLPTEKGGLGFRDLKNFNLALLAKQLWR  739

Query  2325  LMNKEDGLCVKIMEAK  2372
             L+     L  K+++ +
Sbjct  740   LVQYPTSLLAKVLKER  755


 Score = 62.4 bits (150),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 111/249 (45%), Gaps = 25/249 (10%)
 Frame = +1

Query  214  LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWK--IRSPDVEVL-  384
            + F+  +   G+ID    G  ++W+   SS   +  +LDRA+ N +W       +VE L 
Sbjct  72   MPFKTMLANCGMIDFPSKGNPFSWVGNRSSGKVQ-CKLDRAVGNEDWHHIYSHTNVEYLR  130

Query  385  -----HLPMVNSYHT-LGESRR-FRFNAAW*THPNYQE*VSSTWKSDVSLEA-----NKS  528
                 H P++  + +  G+ RR F+F+  W     ++E +   W    +L         +
Sbjct  131  LWGSDHRPILTRFLSKRGKGRRGFKFDKRWIDRDGFRETILKGWSDPGNLHPPDLHERIA  190

Query  529  NLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrre--ldeil  702
               K +  W +    N        +ARI  ++  L   Q  D I  D  L+ +  L    
Sbjct  191  MCRKAIAQWKRANPLNF-------VARIEELKEKLEKAQLDDTISNDEILQLKWDLCSAF  243

Query  703  YQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPF  882
              EEL W  +SR  W+  GDRNT+F+HA T  R++ + + +LK+  G W    + I +  
Sbjct  244  RDEELYWKQKSRANWLKEGDRNTKFFHATTKQRRARNRLTKLKNPRGGWAEKEEDIEKVA  303

Query  883  HAFYMDLFS  909
              ++  LF+
Sbjct  304  EEYFQVLFT  312



>ref|XP_007203452.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
 gb|EMJ04651.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
Length=1755

 Score =   290 bits (743),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/441 (34%), Positives = 247/441 (56%), Gaps = 5/441 (1%)
 Frame = +3

Query  1065  PNQLLP----KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSI  1232
             P+ L P    K+   V D ++     F  +  +    N T + L+P +  P  + Q R I
Sbjct  866   PDGLPPLFYQKYWRIVGDDVVAAVRAFLQSNEMLRQLNHTFVTLIPKVKEPRTMAQLRPI  925

Query  1233  GLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKS-GK  1409
              LCNV Y++  K +  R+K  M+ +I   Q++FV GR IT+N +V  E+ + L+ +  G+
Sbjct  926   SLCNVLYRIGAKTLANRMKFVMQSVISESQSAFVPGRLITDNSIVAFEIAHFLKQRRRGR  985

Query  1410  GGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWF  1589
              G + +K+D+ KAYDR+ W F+   +   GF   W+R +M CV+T   +   +   ++  
Sbjct  986   KGSLALKLDMSKAYDRVEWEFLEKMMLAMGFPILWVRMVMDCVTTVSYSFLVNGEPTRIL  1045

Query  1590  MLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVF  1769
                RG+RQGDPLSP LF+L  E  + L+ ++ + GQ +G+ I R  P +SHLFF DD   
Sbjct  1046  YPTRGLRQGDPLSPYLFLLCAEGFTTLLSKAERQGQLQGIVICRGAPTVSHLFFADDSFV  1105

Query  1770  FGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDL  1949
             F +A+ +   V+K     +   SGQ+++  KS + FS N  ++ Q  ++S LG+P V+  
Sbjct  1106  FAKATDNNCGVLKHIFEVYEHASGQQINCQKSCVAFSANIHMDTQSRLASVLGVPRVDSH  1165

Query  1950  GRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQS  2129
               YLG+P + GR K   +  L  R+  +L GW+ +TLS  G+  L++ V  +IP Y M  
Sbjct  1166  ATYLGLPMMLGRNKTVCFRYLKERVWKKLQGWREQTLSIAGKEVLLKVVAQSIPLYVMSC  1225

Query  2130  SLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFA  2309
              LLPQG+   +E++   F WG    NRK + + W+++ ++K +G +G + L   N A+ A
Sbjct  1226  FLLPQGLCHEIEQMMARFWWGQQGENRKIHWMRWERLCKAKTEGGMGFRCLQAFNMAMLA  1285

Query  2310  KLGWKLMNKEDGLCVKIMEAK  2372
             K GW+L++    L  ++++AK
Sbjct  1286  KQGWRLVHNPHSLASRLLKAK  1306


 Score = 31.2 bits (69),  Expect(2) = 1e-77, Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 0/42 (0%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQATL  2530
             S VWK I  +  +L  GS+  + + +S   W D W+ + AT 
Sbjct  1323  SCVWKSIWTARKVLEMGSRFQIGDGKSVRIWGDKWVPRPATF  1364


 Score =   116 bits (291),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 95/315 (30%), Positives = 155/315 (49%), Gaps = 31/315 (10%)
 Frame = +1

Query  217   GFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPM  396
             GF++ + + G  DLG++G  +TW        F   RLDRAL    W+   P   V HL  
Sbjct  572   GFRNIVDKLGFRDLGFNGYKFTWKCRFGD-GFVRVRLDRALATTSWQNLFPGFSVQHLDP  630

Query  397   VNSYH----------TLGESR--RFRFNAAW*THPNYQE*VSSTWKSD------VSLEAN  522
               S H          T  +SR  RF F A W TH + ++ +   W+S       V L+  
Sbjct  631   SRSDHLPILVRIRHATCQKSRYRRFHFEAMWTTHVDCEKTIKQVWESVGNLDPMVGLDKK  690

Query  523   KSNLSKQLDDWNKHTIGNIFRRK*RVL-ARISGVQRSLSVYQkldlikl---drklrrel  690
                ++  L  W+K T G+I + + RVL A+++      S++Q     ++    R +++ L
Sbjct  691   IKQMTWVLQRWSKSTFGHI-KEETRVLRAKLA------SLFQAPYSERVEEDRRVVQKSL  743

Query  691   deilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGI  870
             DE+L + EL W  RSRE W+ +GD+NT ++H     R+  + ++ L+D+ G W +   GI
Sbjct  744   DELLAKNELYWCQRSRENWLKAGDKNTSYFHQKATNRRRRNIIKGLEDSNGCWRTSRQGI  803

Query  871   LEPFHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKA  1047
                   ++ DLF    ++ +E++  A  P +       + A F+ +++ +AVF+M   KA
Sbjct  804   TSIVIDYFGDLFRSSGSSMMEEILSALEPKVTADMQQVLIADFSYQEIKDAVFQMQPSKA  863

Query  1048  PSSDGFQTSFYQNSW  1092
             P  DG    FYQ  W
Sbjct  864   PGPDGLPPLFYQKYW  878



>ref|XP_010513204.1| PREDICTED: uncharacterized protein LOC104789164 [Camelina sativa]
Length=1030

 Score =   263 bits (671),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 149/452 (33%), Positives = 236/452 (52%), Gaps = 1/452 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             +F  ++K  L+    +FF TG      N+T ICL+  +  P  + +FR I LCNVSYK++
Sbjct  143   RFWPSLKGDLVALVKNFFRTGGFDPRLNETNICLITKVDQPQRMTEFRPISLCNVSYKII  202

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDL  1439
             +KA+  RLK  +  ++   Q++FV GR IT+N+LV QE+ + L +    K   +  K D+
Sbjct  203   SKALCFRLKRFLPSMVSETQSAFVSGRLITDNILVAQEMFHGLNTNPRCKSEFLAFKTDM  262

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+ + + K GF   WI  IM CVS+    +  + +     + +R +RQGD
Sbjct  263   SKAYDRVEWDFLEAVMIKLGFDRRWISWIMWCVSSVSYQVLLNGQPRGSILPKRDLRQGD  322

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  E L   I+++ +  +  G+ I R  P ISHL F DD +FF +A   +  
Sbjct  323   PLSPYLFILCTEVLIANIKKAEREKRLTGISIARDYPSISHLLFADDSLFFCKAEESECK  382

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             VV   +  +   SGQ ++  KS I F K    +++  I + +GI     +G YLG+P   
Sbjct  383   VVMDIIGNYGKASGQEVNLEKSSIMFGKKVPSDVRSRIKTVIGISREGGMGSYLGIPENL  442

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
                K + +  +  R+  R+ GW  + LS  G+  +I+SV  A+P + M    L Q + S 
Sbjct  443   QGSKTEVFRYVNDRLDDRVNGWSAKILSKGGKEIMIKSVALALPTHVMSCYKLTQELTSS  502

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             L      F W S+   R  + ++W K+ + K  G L  + L+  N A+ AK  W+L++  
Sbjct  503   LTSAISKFWWKSNDKARGMHWVAWDKLCKDKCDGGLVFRALEEFNDAMLAKQYWRLIHYP  562

Query  2340  DGLCVKIMEAKVQLPSLPSQACQMYGRVFLSR  2435
             + L  ++M  +      P  A + Y   F  R
Sbjct  563   NSLMARVMRGRYFRRKHPLLATKPYSPSFAWR  594


 Score = 58.5 bits (140),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 63/130 (48%), Gaps = 3/130 (2%)
 Frame = +1

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             EEL W  +SR+ W+  GD+NT+++HA+T  R+  + +  L      W     G +EP  +
Sbjct  17    EELYWQQKSRKFWLRVGDKNTKYFHASTKQRRVRNKIVGLFGPDNVWDESPLG-MEPIAS  75

Query  889   FYM-DLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDG  1062
              Y  DLF     + + D+     P +  +   ++    T  ++ +A+F M   K+P  DG
Sbjct  76    IYFEDLFKRSDVSGISDILQEISPIITDAMNRSLTREITEAEVRKALFAMHPEKSPCPDG  135

Query  1063  FQTSFYQNSW  1092
                 F+Q  W
Sbjct  136   MTALFFQRFW  145



>gb|AAB84340.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1094

 Score =   271 bits (693),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 154/456 (34%), Positives = 249/456 (55%), Gaps = 12/456 (3%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             VK+ +I     FF TG LP   N T +CL+P I  P  +   R I LC+V YK+++K ++
Sbjct  192   VKNQIISDIELFFQTGILPEDWNHTHLCLIPKITKPARMADIRPISLCSVMYKIISKILS  251

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDLEKAYD  1454
              RLK  + +++ P Q++FV  R +++N+++  E++++LR+        MV K D+ KAYD
Sbjct  252   ARLKKYLPVIVSPTQSAFVAERLVSDNIILAHEIVHNLRTNEKISKDFMVFKTDMSKAYD  311

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             R+ W F++  L   GF+  WI  +M+CVS+   ++  + +        RG+RQGDPLSP 
Sbjct  312   RVEWPFLKGILLALGFNSTWINWMMACVSSVSYSVLINGQPFGHITPHRGLRQGDPLSPF  371

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LFVL  E L H++ Q+ K G+  G++    GP ++HL F DD +   +AS  + + +  C
Sbjct  372   LFVLCTEALIHILNQAEKIGKISGIQFNGTGPSVNHLLFADDTLLICKASQLECAEIMHC  431

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L+++  +SGQ ++  KS I F    + E +Q I +  GI      G+YLG+P      KQ
Sbjct  432   LSQYGHISGQMINSEKSAITFGAKVNEETKQWIMNRSGIQTEGGTGKYLGLPECFQGSKQ  491

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
               +  +  ++Q+RL+GW  +TLS  G+  L++S+  A P Y M    L + + ++L  + 
Sbjct  492   VLFGFIKEKLQSRLSGWYAKTLSQGGKDILLKSIAMAFPVYAMTCFRLSKTLCTKLTSVM  551

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
              DF W S +  +K + I  +K+   K  G  G + L   NQAL AK   +L    D L  
Sbjct  552   MDFWWNSVQDKKKIHWIGAQKLMLPKFLGGFGFKDLQCFNQALLAKQASRLHTDSDSLLS  611

Query  2355  KIMEAKVQLPS---------LPSQACQ--MYGRVFL  2429
             +I++++  + S          PS A Q  +YGR  L
Sbjct  612   QILKSRYYMNSDFLSATKGTRPSYAWQSILYGRELL  647


 Score = 50.1 bits (118),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 63/135 (47%), Gaps = 11/135 (8%)
 Frame = +1

Query  706   QEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFG--EWISDGDGILEP  879
             +EE  W  +SR++W+V GD+N++F+ A     + ++++R L D  G  + ++   G +  
Sbjct  60    EEEDFWRLKSRDKWMVGGDKNSKFFQATVKANRVSNSLRFLVDENGNEQTVNREKGKIAV  119

Query  880   FHAFYMDLFSEDSTTQ----LEDLNDAFFPPLHTSQWLAINAHFTVKDLEAVFEMAQFKA  1047
                F+ DLFS    +     LE  N      ++      +N     K   AVF +    A
Sbjct  120   --TFFEDLFSSSYPSSMDSVLEGFNKRVTEDMNQDLTKKVNEQEIYK---AVFSINAESA  174

Query  1048  PSSDGFQTSFYQNSW  1092
             P  DGF   F+Q  W
Sbjct  175   PGPDGFTALFFQRQW  189



>gb|EAZ03196.1| hypothetical protein OsI_25347 [Oryza sativa Indica Group]
Length=858

 Score =   285 bits (729),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 151/409 (37%), Positives = 235/409 (57%), Gaps = 1/409 (0%)
 Frame = +3

Query  1149  LPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTS  1328
             +P G NDT I L+P +     +  FR I LCNV YK+++K +  RL+  +  L+ P Q++
Sbjct  1     MPEGVNDTAIVLIPKVDRLAELKDFRPISLCNVIYKVVSKCLVNRLRLLLDDLVSPSQSA  60

Query  1329  FVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFS  1505
             FV GR IT+N L+  E  + ++ +K+        K+ L KAYDR+ WSF+   + K GF+
Sbjct  61    FVPGRLITDNALLAFECFHHIKKNKNLDNASCAYKLYLSKAYDRVDWSFLEQAMYKLGFT  120

Query  1506  PDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSV  1685
               W+  +M+C++T R A+ F+  L   F   RG+RQGDPLSP LF+   + LS L+E+ V
Sbjct  121   HRWVSWLMTCITTVRYAVKFNGTLLSTFAPTRGLRQGDPLSPFLFLFVADGLSLLLEEQV  180

Query  1686  KNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS  1865
               G    +K+ R+ P ISHL F DD + F + +  QA+ VK+ LN + S +GQ+++ MK 
Sbjct  181   NQGAISPVKVCRQAPGISHLLFADDTLLFFKENADQATKVKEVLNRYASGTGQQINPMKC  240

Query  1866  *IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGW  2045
              I F + +    QQ+I   L +   N   +YLG P+  GR+ +  +  L  +I  R+  W
Sbjct  241   SIMFGEVSPASTQQSIKDILQVVSPNFEDKYLGFPTPDGRMHKGRFQKLQDKIWKRIIQW  300

Query  2046  KNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLI  2225
                 LS  G+  LI++VL AIP Y M    LP  +   L + +R+F WG++KG +  +  
Sbjct  301   GENFLSSGGKEILIKAVLQAIPVYVMGLFKLPDSMCEDLMKATRNFWWGANKGKQTTHWR  360

Query  2226  SWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
             SW  + +SK  G +G + +   NQAL A+  W L++  D LC ++++AK
Sbjct  361   SWDCLMKSKQSGGMGFRDMKLFNQALLARQAWHLLDSPDSLCARVLKAK  409



>ref|XP_010495329.1| PREDICTED: uncharacterized protein LOC104772406 [Camelina sativa]
Length=1131

 Score =   250 bits (639),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/368 (36%), Positives = 208/368 (57%), Gaps = 1/368 (0%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             VK  L+   + FF      +G N T ICL+P +  P  + + R I LCNV YK+L+K + 
Sbjct  401   VKTDLVSLVNSFFEENAFESGLNQTHICLIPKVTKPTRMAELRPISLCNVGYKVLSKVLC  460

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDLEKAYD  1454
              RLK+ +  LI   Q++FV GR I++N+L+ QE+ + LR+  S KG  M IK D+ KAYD
Sbjct  461   NRLKTILPRLISETQSAFVPGRLISDNILIAQEMFHGLRTNNSCKGKFMAIKTDMSKAYD  520

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             R+ W F+ +  ++ GF+  WI  IM CVS+ +  +  + +     + ERG+RQGDPLSP 
Sbjct  521   RVEWGFLGALFRRMGFAEKWISWIMLCVSSVQYQVLVNGQPHGQIIPERGLRQGDPLSPY  580

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LF+L  E L   I ++  + +  G+K+  K P I+HL F DD +FF +    Q  VV   
Sbjct  581   LFILCTEVLIANIRKAEVDKRITGIKVANKCPPITHLLFADDSLFFFKVYKDQCGVVLDI  640

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L ++ + SGQ++++ KS + F        +  +   LGI  +  +G YLG+P   G  K 
Sbjct  641   LKQYEAASGQQINFAKSSLQFGHTVDDPARLEMQGILGISNLGGMGSYLGIPESLGGSKT  700

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
                + +  R+Q+R TGW  R LS  G+  +++SV +A+P + M    LP+ + S+L    
Sbjct  701   KVVSFVRDRLQSRTTGWTARLLSKGGKEVMVKSVATAVPSFVMSCYRLPKTITSKLTSAV  760

Query  2175  RDFLWGSS  2198
              +F W +S
Sbjct  761   ANFWWSTS  768


 Score = 70.1 bits (170),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 123/304 (40%), Gaps = 30/304 (10%)
 Frame = +1

Query  241   EGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYH---  411
             +G  +  Y G   +W +G         RLDRAL N +W    PD    +LP V S H   
Sbjct  105   KGGPEFPYLGDCLSW-RGWRDKKPIRCRLDRALGNEDWHDLFPDTITEYLPRVASDHMPL  163

Query  412   --TLGESR-----RFRFNAAW*THPNYQE*VSSTW-----KSDVSLEANKSNLSKQLDDW  555
                +G  R      F F+  W       E +SS W     +   S      +  + +  W
Sbjct  164   LGCIGAKRPRGRRNFMFDRRWVGKEGLMEAISSGWGAPPVRGSPSFVNKVVSCRRAISCW  223

Query  556   NKHTIGNIFRRK*RVLARISGVQRSL-SVYQkldlikldrklrreldeilYQ-EELLWF*  729
              K           RVL  I  +++ L + +                    Y+ EE+ W+ 
Sbjct  224   RKEQAPYG-----RVL--IEDIKKELEAAHADDTTSPKVIAELTGRLREAYKDEEMHWYL  276

Query  730   RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFS  909
             +SR  W+  GD+NT+++HA T  R++ + +  L D    W +D   + E   +++ DLFS
Sbjct  277   KSRNRWMRVGDKNTKYFHAQTKQRRARNRIVGLYDKHDVWSTDDVTVKETAVSYFGDLFS  336

Query  910   EDSTTQLEDL---NDAFFPPLHTSQWLAINAHFTVKDLEAVFEMAQFKAPSSDGFQTSFY  1080
               + +  +++     +    +   +  A      V+  +A+F M   KAP  DG    F+
Sbjct  337   TINPSSFDEVLLEVKSVITAVDNERLTAPATEAEVR--KALFMMHPDKAPGPDGMTALFF  394

Query  1081  QNSW  1092
             Q +W
Sbjct  395   QKAW  398


 Score = 51.6 bits (122),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 50/117 (43%), Gaps = 5/117 (4%)
 Frame = +2

Query  2810  LKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCPIANSVW  2989
             ++ P +++ F+W A   C   +    RRG   +V C  C    E ++H++  CP A   W
Sbjct  952   VRCPPKLKHFMWQALTGCISVSANLRRRGVACDVGCSRCGAEEETVNHVLFLCPPARQAW  1011

Query  2990  -ESLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWRNDLVF  3157
              ++ +P   +    +      D  I      N    Q   F   MW++WK RN  VF
Sbjct  1012  AQAHVPVGPQHFPTESVYANVDHFIGR----NNPGSQVDFFPWLMWYIWKARNAKVF  1064


 Score = 22.7 bits (47),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 13/20 (65%), Gaps = 0/20 (0%)
 Frame = +3

Query  2697  NGLG*DVAYSGKFSVKSTYD  2756
             + LG     SG++SVKS YD
Sbjct  904   DSLGWHFTKSGRYSVKSGYD  923



>ref|XP_009123326.1| PREDICTED: uncharacterized protein LOC103848097 [Brassica rapa]
Length=1740

 Score =   248 bits (634),  Expect(3) = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/431 (34%), Positives = 227/431 (53%), Gaps = 18/431 (4%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             K+ G V D + K   DFFS G  P   N T +CL+P I +P  ++  R I LC++ YK++
Sbjct  841   KYWGIVGDQVTKEVKDFFSYGLFPAEWNFTHLCLLPKIDDPIFMSDLRPISLCSILYKII  900

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDL  1439
             +K +  RLK  M  ++ P Q++FV  R IT+N+L+  E++++LR+        M IK D+
Sbjct  901   SKILVSRLKPLMPNIVSPTQSAFVEERLITDNILIAHEIIHALRTNVKFSKEFMAIKSDM  960

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KA+DR+ W ++R+ L   GF+ DWI  IM CVST   A   +  +   F+L +  R+G 
Sbjct  961   SKAFDRVEWGYLRALLSALGFNQDWIEKIMFCVSTVSYATLIND-VPHGFILPK--REG-  1016

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
                          L HLI ++V+NG  +G++   +GP I HL F DD +   +AS  QA 
Sbjct  1017  -------------LIHLIHKAVENGSLQGIQFCEEGPMIHHLLFADDCLLISKASPDQAR  1063

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              + + L  +   +GQ ++  KS I F       ++ AI    GI      G YLG+P   
Sbjct  1064  KLMEILKIYERATGQLVNVSKSAITFGAKLKENLKVAIKEITGIEKEGGSGSYLGLPECF  1123

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
                K    A +  R++ RL+GW  + LS  G+  LI++V  A+  Y M    L +     
Sbjct  1124  SGSKTKILAYIYDRLKGRLSGWFLKLLSLGGKEILIKAVAMAMLVYAMSCFKLTKIFCEN  1183

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             L +   DF W S +  RK + +SW K+  +KDQG LG + +   NQAL AK  W+++   
Sbjct  1184  LTKAMADFWWNSLEHKRKLHWLSWSKLCLAKDQGGLGFKDIQSFNQALLAKQAWRILAFP  1243

Query  2340  DGLCVKIMEAK  2372
             D L  K+ +++
Sbjct  1244  DSLFAKVFKSR  1254


 Score = 63.9 bits (154),  Expect(3) = 2e-77, Method: Compositional matrix adjust.
 Identities = 73/313 (23%), Positives = 129/313 (41%), Gaps = 28/313 (9%)
 Frame = +1

Query  214   LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVL---  384
             L F + +    +++L  SG ++TW     + + + ++LDR   N  W    P    +   
Sbjct  541   LPFNEMLEIGEMVELQSSGDSFTWGGNRGTLSIQ-SKLDRCFGNKMWHRLFPVSNQVFLD  599

Query  385   -----HLPMVNSYHTLGESRR--FRFNAAW*THPNYQE*VSSTWKSD------VSLEANK  525
                  H P++    ++  +RR  FRF+  +       E +   W ++        LE  K
Sbjct  600   KRGSDHRPVLVKLSSVSVARRGQFRFDGRFLHKKGVSEVLKKAWLTNHPYFEATVLERLK  659

Query  526   SNLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilY  705
                 K L  W K    N   +  ++   +   Q SLS             L++EL +   
Sbjct  660   C-CRKALSTWKKKECLNSRDKINQIQFALEREQSSLSA-----STTTINFLKKELVKAYK  713

Query  706   QEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFH  885
             +EE  W  R +E+W   GD NT++YHA+    ++   + +LKD+ G+     +   +   
Sbjct  714   EEEEYWQQRCKEQWATKGDLNTKYYHASVKHNRARKRIVKLKDDLGQDHFSEEAKGDVAS  773

Query  886   AFYMDLFSEDSTTQLEDLNDAF---FPPLHTSQWLAINAHFTVKDLEAVFEMAQFKAPSS  1056
             A++ +LF   +  +  +L + F     P        + ++  VK  EAVF +    AP  
Sbjct  774   AYFTNLFKSANNGEFSELFEGFSAKVTPAMNDSLSKVVSNAEVK--EAVFSIKPGSAPGP  831

Query  1057  DGFQTSFYQNSWA  1095
             DG    F+Q  W 
Sbjct  832   DGMTGLFFQKYWG  844


 Score = 29.3 bits (64),  Expect(3) = 2e-77, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 5/65 (8%)
 Frame = +2

Query  2387  SAKSGM--SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIG---KQATLLSRIRYD  2551
             SAK G   S  W+ I     +L++G +K V N  +   W+D WI    ++A L+  I  D
Sbjct  1263  SAKIGSRPSYAWRSIQFGKELLVQGLRKQVGNGETIFVWVDRWIEGDVRRAPLMKNIFVD  1322

Query  2552  PFDRV  2566
                +V
Sbjct  1323  LLLKV  1327


 Score = 55.5 bits (132),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 52/201 (26%), Positives = 85/201 (42%), Gaps = 20/201 (10%)
 Frame = +2

Query  2825  RIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCPIANSVWE-SLI  3001
             +I+ F W A  +         +RG   +     C    E I+HI+ +C IA  VW  + +
Sbjct  1420  KIKMFFWRAMSNAIPVGELLVKRGIKMDPCRQSCGFQGESINHIIFQCSIARQVWALANV  1479

Query  3002  PYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWRNDLVFSG---TNI  3172
             PY         + + F   I  ++      E R      +W+LWK+RN ++F     T +
Sbjct  1480  PYPENGFDKVSHFSNFHSLILMMNDAIIPEEVRNAIPWIVWYLWKYRNGIIFGDRQMTTL  1539

Query  3173  NLAARI-----KWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGWVKANIDGS  3337
             +L  +I      W+  Q+ E N    + +  +   +S       W  P  GW+K NI   
Sbjct  1540  DLVKKIFEEADFWLLAQLNEKNREQEEHEAGLDVSKS-------WSVPPKGWLKGNIGVH  1592

Query  3338  SIPSNSIARCGG--FIRDDQG  3394
                + S ARCG    +R+D+G
Sbjct  1593  W--NRSQARCGAAWVVRNDKG  1611



>ref|XP_010472440.1| PREDICTED: uncharacterized protein LOC104752070 [Camelina sativa]
Length=1126

 Score =   257 bits (657),  Expect(3) = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/431 (32%), Positives = 227/431 (53%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             K+   V    I     FF TG +P G N T +CL+P  PN   ++  R I LC+V YK++
Sbjct  318   KYWHIVGADNIAEVQGFFQTGVMPQGWNHTQLCLIPKKPNANQMSDMRPISLCSVLYKIV  377

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDL  1439
             +K +  RL   +  L+   Q +FV GR I++N+L+  E++++L++        + +K D+
Sbjct  378   SKVLCSRLTRCLPDLVSETQGAFVAGRLISDNILIAHEIVHALKTNVKFDEHFIAVKTDM  437

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+     K GF+  W++ IM CV +   ++  +          RGIRQGD
Sbjct  438   SKAYDRVEWDFLEKLFIKMGFAVKWVQWIMMCVRSVSFSVLINGCDFGLIKPGRGIRQGD  497

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  E L + +++S +  +  G +     P I +L F DD +F  +++  +  
Sbjct  498   PLSPFLFILCAEALVYALQRSHQQERLTGFRFNESCPVIQNLLFADDSLFVCQSTKEECE  557

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              +  CL  +   SGQ ++  KS + F K  S E +  +  +L I      G YLG+P   
Sbjct  558   ELMLCLQSYGKASGQMINLSKSAVTFGKRISEETKNVVKQTLSIYEEGGTGTYLGLPECF  617

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
                KQ     +  ++Q RL GW  ++LS  G+  L+++V  A+P Y M    L + +  +
Sbjct  618   SGSKQALLGFIGDKLQNRLQGWFAKSLSLGGKEVLLKAVAMALPVYAMSCFRLSKNLCRK  677

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             L     +F W + +G RK   ++WKK+ +SK +G LG + L   NQAL AK  W+++N  
Sbjct  678   LTSAMCEFWWSNCQGRRKIAWVAWKKLCKSKSEGGLGFKDLGDFNQALLAKQAWRILNNP  737

Query  2340  DGLCVKIMEAK  2372
             D L  +  +++
Sbjct  738   DSLVTRFYKSR  748


 Score = 56.6 bits (135),  Expect(3) = 3e-77, Method: Compositional matrix adjust.
 Identities = 63/280 (23%), Positives = 118/280 (42%), Gaps = 33/280 (12%)
 Frame = +1

Query  319   ARLDRALCNIEWKIRSPDVEVLHLPMVNSYHTLGESR----------RFRFNAAW*THPN  468
              RLD +  N  W    P V   +L ++ S H    +R          RF F+  W   P+
Sbjct  52    CRLDHSFGNSGWFDLFPRVNTEYLDLLGSDHRPIITRLVDADSRFRGRFMFDKRWINKPD  111

Query  469   YQE*VSSTWKSDVSLE-----ANKSNLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSL  633
              ++ +   W++   +      A+ S   + L  W K  + N         ++I  +++ L
Sbjct  112   TEKIIREQWEAGNRMTSSLVMASLSQCRRALSRWKKTHMTN-------SASQIQLLRKDL  164

Query  634   SVYQkldlikldrklrre--ldeilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKS  807
                         R  + +  L+    +EE+ W  +SRE W+  GD+NT ++H +   ++ 
Sbjct  165   EFESTKTHPNFRRLQQIKWALNVAFREEEVYWKTKSRETWLQIGDKNTAYFHGSVKYKRL  224

Query  808   ASTVRRLKDNFG----EWISDGDGILEPFHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQ  975
              + +  L D  G    E  S GD   E    ++  LF   + T +EDL +   P +    
Sbjct  225   KNRLVSLIDKNGVECFEEGSKGDIAAE----YFSQLFQTSNPTGIEDLLEGMEPRVSEDM  280

Query  976   WLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQTSFYQNSW  1092
              + + A  + +++ +A F +    AP +DG+  +F++  W
Sbjct  281   NVRLTAPVSAQEIKQAAFNIKGDSAPGADGWTGAFFRKYW  320


 Score = 27.3 bits (59),  Expect(3) = 3e-77, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 26/57 (46%), Gaps = 3/57 (5%)
 Frame = +2

Query  2390  AKSGMSNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI---GKQATLLSRIRYD  2551
             A S  S  W+ IL    +L  G  K + +   TL W D WI     +A   S+I +D
Sbjct  760   AGSRPSYAWRSILHGRDLLKAGLMKSIGDGCDTLVWRDKWIMDKHPRAPFRSQIFFD  816



>ref|XP_010681744.1| PREDICTED: uncharacterized protein LOC104896672 [Beta vulgaris 
subsp. vulgaris]
Length=945

 Score =   285 bits (729),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 149/438 (34%), Positives = 243/438 (55%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             + ++   ++   V   + K   DFF+ GHL    N T+I L+P   NP   NQFR I LC
Sbjct  188   YGSKFFQQYWDIVGPDICKAIHDFFNHGHLLRSVNHTLITLIPKTANPEKPNQFRPISLC  247

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLM  1421
                YK+++K +  RL+  +  +I PFQ +F  GR I +NVL+ QE++N       + G  
Sbjct  248   TTLYKIISKILVERLRPILVKIISPFQNAFTPGRLIHDNVLIVQEIMNIFNKSKSRKGWF  307

Query  1422  VIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLER  1601
              +K+D+EKAYDR+ W F+   L+  GF   WI+ IM C+ST   ++  +   +  F   R
Sbjct  308   ALKLDMEKAYDRIEWDFLAHALKSYGFHQQWIKWIMQCISTVSYSLVINQDTTSVFHPSR  367

Query  1602  GIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWK-GMKITRKGPCISHLFFVDDLVFFGE  1778
             G+ QGDPLSP LF+L ++ L   ++ + +N +   G+K+      I  LFF DD + F +
Sbjct  368   GLHQGDPLSPYLFILCMDVLCRQLDFAAQNSKSGIGIKLAPHAQIIPGLFFADDGLLFCK  427

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A+L  A+ +K  L+ FC  SGQ +++ KS I FSK      +++I++   +   + LGRY
Sbjct  428   ANLDSANRLKNILDFFCINSGQLVNFHKSSIMFSKQIPNSRRRSIAAIFNMTPKDFLGRY  487

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LGV   + +   + +  L+ ++  ++  W N  LS  G+S LIQS L + P Y M ++ L
Sbjct  488   LGVIFSNYKPMPNDFHHLIQKVDNKINSWHNHYLSKPGKSVLIQSHLESSPAYLMATTQL  547

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P+ + S ++ ++R F W SS      +LI+W K+   K  G L  ++   +N+A  AK+G
Sbjct  548   PKKICSTIDNINRKFFWRSSTNASGLSLIAWSKICRPKKYGGLNFRKTAQVNEAYLAKMG  607

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W++++ +  L   +M  K
Sbjct  608   WRILSDQHSLWPNLMRQK  625


 Score = 34.7 bits (78),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 0/47 (0%)
 Frame = +2

Query  2390  AKSGMSNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQATL  2530
             AKS  S++WK IL+S  +L KG +  +    +  FW D+W   Q+ +
Sbjct  637   AKSKDSHIWKSILRSRELLRKGIRWKIGTGTNVYFWSDNWCANQSII  683



>ref|XP_007207799.1| hypothetical protein PRUPE_ppa024472mg, partial [Prunus persica]
 gb|EMJ08998.1| hypothetical protein PRUPE_ppa024472mg, partial [Prunus persica]
Length=920

 Score =   285 bits (729),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 151/439 (34%), Positives = 241/439 (55%), Gaps = 1/439 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP     KF   VKD +   AS FF+        N T I L+P + +P L  Q+R I LC
Sbjct  32    FPGVFYQKFWPIVKDIVSGAASGFFNGNDQIKVLNRTHIALIPKVLDPVLPEQYRPISLC  91

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKS-GKGGL  1418
             N +YK+L K +  RL S +  LI P Q +FV  R I +N+ +  E  + L+ K+ G    
Sbjct  92    NYAYKILAKLLANRLSSLLPFLISPNQNAFVADRVIQDNISIAHEAYHHLKLKTRGSRHE  151

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
             + +K+D+ KAYDR+ W F+ + L K GF   W+R IM+CVS+   ++  + +    F   
Sbjct  152   LGLKVDMNKAYDRVEWDFLEALLCKLGFCDHWVRLIMACVSSVSYSVLINGKPGPTFRPS  211

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP LF+L  +  S  + + +  G  KG+K+ ++ P +SHL F DD +FF  
Sbjct  212   RGLRQGDPLSPYLFLLVSDVFSKNLSKCISGGWIKGIKMAQRSPVLSHLLFADDSLFFLR  271

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A +         LN +C+ SGQ +++ KS ++FS NT  E++  I S L +   ++ G Y
Sbjct  272   ADVTNCRRFMHLLNRYCAASGQLVNHEKSCLYFSSNTPAELKTTIGSILAVEGTDNPGNY  331

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG+P++ GR K+ +   +  R++ ++ GWK  +LS  G+  LI+++ +AIP + MQ    
Sbjct  332   LGMPTMWGRSKKAAMNYVKERVKDKILGWKQSSLSLAGKEVLIKAIATAIPTFPMQCFKF  391

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
              +G+   +      F WG    + K +  SW  +   K  G LG + L+  N AL  K  
Sbjct  392   TKGLCDEINSEMAKFWWGKPNSDTKIHWKSWSALCLPKSDGGLGFRDLNTFNLALLGKQA  451

Query  2319  WKLMNKEDGLCVKIMEAKV  2375
             W+L+++ +    K+++A +
Sbjct  452   WRLIHEPNSYWAKLIKASL  470



>gb|AAD15377.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1044

 Score =   265 bits (676),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 146/427 (34%), Positives = 238/427 (56%), Gaps = 1/427 (0%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             TV  +++     FFS+  L    N T I L+P I +   +  +R I LC V YK+++K +
Sbjct  288   TVGPNIVLEIQSFFSSSTLQPTINKTHITLIPKIQSLKRMVDYRPIALCTVFYKIISKLL  347

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRS-KSGKGGLMVIKIDLEKAY  1451
             + RL+  ++ +I   Q++FV  R   +NVL+  E L+ L+S  + K   M +K ++ KAY
Sbjct  348   SRRLQPILQEIISENQSAFVPKRASNDNVLITHEALHYLKSLGAEKRCFMAVKTNMSKAY  407

Query  1452  DRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSP  1631
             DR+ W FI+  +Q+ GF   WI  I+ C++T   +   +         ERG+RQGDPLSP
Sbjct  408   DRIEWDFIKLVMQEMGFHQTWISWILQCITTVSYSFLLNGSAQGAVTPERGLRQGDPLSP  467

Query  1632  LLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKK  1811
              LF++  E LS L  ++  +G   G+++++  P ++HL F DD +FF  + L        
Sbjct  468   FLFIICSEVLSGLCRKAQLDGSLLGLRVSKGNPRVNHLLFADDTIFFCRSDLKSCKTFLC  527

Query  1812  CLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLK  1991
              L ++   SGQ ++  KS I FS+ T   I+      LGI +V  LG+YLG+P + GR K
Sbjct  528   ILKKYEEASGQMINKSKSAITFSRKTPDHIKTEAQQILGIQLVGGLGKYLGLPKMFGRKK  587

Query  1992  QDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERL  2171
             +D +  ++ RI+ R   W +R LS  G++T+++SVL+++P YTM    L   +  R++  
Sbjct  588   RDLFNQIVDRIRQRSLSWSSRFLSTAGKTTMLKSVLASMPTYTMSCFKLLVSLCKRIQSA  647

Query  2172  SRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLC  2351
                F W SS   +K   I+W K+ ++K +G LG + +   N AL AKL W+++     + 
Sbjct  648   LTHFWWDSSADKKKMCWIAWSKMAKNKKEGGLGFKDITNFNDALLAKLSWRIVQSPSCVL  707

Query  2352  VKIMEAK  2372
             V+I+  K
Sbjct  708   VRILLGK  714


 Score = 55.1 bits (131),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 60/128 (47%), Gaps = 7/128 (5%)
 Frame = +1

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             EE  W  RSR+ W+  GD+N+ ++HA T  R   +    ++   G    +  GIL     
Sbjct  166   EEEYWKQRSRQLWLALGDKNSGYFHAITRGRTVINKFSVIEKEDGVPEYEEAGILNVISE  225

Query  889   FYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLEAVFEMAQFKAPSSDGFQ  1068
             ++  LFS +   +   + +A  P +   Q    N    +K   A F +   KAP  DGF 
Sbjct  226   YFQKLFSANEGARAATIKEAIKPFISPEQ----NPE-EIKS--ACFSIHADKAPGPDGFS  278

Query  1069  TSFYQNSW  1092
              SF+Q++W
Sbjct  279   ASFFQSNW  286



>gb|ABF95850.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=940

 Score =   285 bits (730),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 156/456 (34%), Positives = 246/456 (54%), Gaps = 7/456 (2%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP +   +    +K  +     +FF  G +  G NDT I L+P +  P  + +FR I LC
Sbjct  174   FPARFFQRNWAVLKKEVTTAVRNFFLQGVMLAGVNDTSIVLIPKVSKPEQLKEFRPISLC  233

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGG-L  1418
             NV YK+++K M  RL+  ++ +I   Q++F+  R IT+N L+  E ++ ++ ++  G   
Sbjct  234   NVIYKVVSKCMVNRLRPILKDIISVTQSAFIPERLITDNALIAFECIHHIQKETSAGKQF  293

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
                K+DL KAYDR+ W F+R  L K GF   W+  +M+CV+T + ++SF+  L + F   
Sbjct  294   CAYKLDLAKAYDRVDWDFLRGALTKVGFCSTWVEWVMACVTTVKYSVSFNGNLLEPFSPS  353

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP LF+   + LS ++ Q V+ G+ + +K+ R+ P +SHL F DD + F  
Sbjct  354   RGLRQGDPLSPYLFLFVADGLSTILSQDVQAGRLEELKVCRRAPGVSHLLFADDSLLFFR  413

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A   QASVV++ L  +   +GQ LS  K  +  S +   ++ + I   L +       +Y
Sbjct  414   ACPQQASVVRQALALYQRCTGQLLSSSKCSLLASAHCPTDVLEDIKIVLQVETSTFESKY  473

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG+P+  GR+  + +  +  R+  RL  W  + +S   + TLI+SV  AIP Y +    L
Sbjct  474   LGLPTPEGRMSAERFKAIKERLVKRLNSWVEKFMSLGAKDTLIKSVAQAIPTYVLGLFRL  533

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P        +L RDF WG  +  RK +  +W  +T  K  G LG + L   NQAL  K  
Sbjct  534   PVSTCEAYTKLIRDFWWGDEENKRKIHWTAWDIITRPKGLGGLGFRDLKLFNQALLGKQA  593

Query  2319  WKLMNKEDGLCVKIMEAKVQLPSLPSQACQMYGRVF  2426
             W+L+     LC +I++AK   P+     C++   VF
Sbjct  594   WRLIQFPGSLCARILKAKY-FPN-----CELVDAVF  623


 Score = 81.3 bits (199),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 70/132 (53%), Gaps = 1/132 (1%)
 Frame = +1

Query  703   YQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPF  882
             Y+EE++W  RSR  W+  GDRNT+F+H   A R   + + RLK     ++ + + +    
Sbjct  53    YREEIMWLQRSRVAWLKEGDRNTKFFHRQAAWRSKKNKITRLKAEDSRFVENKEEMEHMA  112

Query  883   HAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSD  1059
               F+  L+ +D++    +L DA  P +       +   F+  ++ +A+F++   KAP  D
Sbjct  113   REFFQTLYLKDNSVDPRELIDALTPRVDDGMNAGLCKPFSYDEIADALFQIGPLKAPGPD  172

Query  1060  GFQTSFYQNSWA  1095
             GF   F+Q +WA
Sbjct  173   GFPARFFQRNWA  184



>ref|XP_008372934.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=961

 Score =   286 bits (731),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 156/438 (36%), Positives = 240/438 (55%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP          V   +      F+ +G L    N T + L+P +  P  + QFR I LC
Sbjct  29    FPGSFYHDNWEVVGQDVGNMIKAFWHSGKLLRNLNHTNLVLIPKVACPKNLKQFRPIALC  88

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGL-  1418
             NVSYK+L K +T RLK  M  +I   Q++FV G+QI +N LV  E+L+SL  +S +  + 
Sbjct  89    NVSYKILAKVLTNRLKRVMPTVICDNQSAFVAGKQIQDNXLVVHEILHSLMHQSKEDTMG  148

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
             M IK+D+ KAYDR+ W F+ + + K GF   +   I  C+S+  L+I  +   + +   +
Sbjct  149   MAIKLDMAKAYDRVEWDFLLAMMSKLGFDQRFCDRIKECISSVSLSILLNGNPTGYIKPQ  208

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP LF+L  E  S LI + ++NG   G++++  G  ISHLFF DD V F  
Sbjct  209   RGLRQGDPLSPYLFLLCTEGFSXLIRKGLENGSLHGIRVSPTGRPISHLFFADDSVLFCN  268

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             AS+  A  V + L  + S SGQ ++  KS I FS  T   +++ I   L I      G+Y
Sbjct  269   ASVEDAXGVGEILRAYASGSGQEINMTKSSIMFSPKTKKRVKKEIVHVLNIQSREGFGKY  328

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG+ +  G  K+  + ++  RI++R+ GW  + LS  G+  LI++V  A+P Y M    L
Sbjct  329   LGLQADFGLSKKAVFGEIRERIESRMVGWAEQFLSQAGKEILIKAVAMAMPNYAMSCFKL  388

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P GV   +E+  R++ W  S   +  + ++W+K+   K  G LG + +   N AL AK+G
Sbjct  389   PIGVCKDIEKAVRNYWWRGSGDRKGIHWVAWEKIRSQKRNGGLGFKDIQCFNLALLAKIG  448

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W++  + + L   ++  K
Sbjct  449   WRITLQPBSLJANVLREK  466


 Score = 61.2 bits (147),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 57/214 (27%), Positives = 89/214 (42%), Gaps = 10/214 (5%)
 Frame = +2

Query  2777  TYRRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHI  2956
             +   VWN I +L+VP +++ F+W   ++         RR      FC  C    E  +H+
Sbjct  620   SLSHVWNKIWNLEVPNKMKFFVWKCCNNALAVRRNLKRRXLRVXNFCEGCMQPDETENHL  679

Query  2957  MQRCPIANSVWE-SLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLW  3133
               RC I++  W  S +  +   L   D+   +      +     + E    F   +W LW
Sbjct  680   FFRCEISHIFWFCSPLQINSLELEGNDFLASWGSFCGRVKGKENEXELMQEFVFGLWHLW  739

Query  3134  KWRNDLVFSG-TNINLAARIKWIR--DQVEEINISFSK----AKGLIAPIESICWRQLKW  3292
             K RNDL+F G T+  L     W+R  D+  E  +  +       GL +P  +   R  +W
Sbjct  740   KNRNDLIFKGVTHQPLDILGLWMRNLDEYREAGLQRTNDDQPTVGLASPAPA--GRTGQW  797

Query  3293  IRPQVGWVKANIDGSSIPSNSIARCGGFIRDDQG  3394
              +P  G +K N D +     S A  G   RD  G
Sbjct  798   KKPGFGTIKVNTDAAWRKETSCAGVGWVARDFAG  831



>ref|XP_010688579.1| PREDICTED: uncharacterized protein LOC104902491 [Beta vulgaris 
subsp. vulgaris]
Length=1325

 Score =   290 bits (741),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 153/425 (36%), Positives = 237/425 (56%), Gaps = 1/425 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             F      KF   V   +I F   +++     +  N T + L+P    P  +  FR I LC
Sbjct  417   FHALFFQKFWHIVGRDIISFVLRWWNGDVDLSSINRTCVVLIPKCATPLSMKDFRPISLC  476

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGL  1418
              V YK+L+K +  +LK  +  +I P Q++FV  R IT+N LV  E+ ++++ K G   G+
Sbjct  477   TVLYKILSKTLANKLKKFLPTIISPNQSAFVPRRLITDNALVAFEIFHAMKRKDGTNSGV  536

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
               +K+D+ KAYDR+ W F+   ++K GF  +WI  +M+CVS+       +  +    +  
Sbjct  537   CALKLDMSKAYDRVEWCFLEKVMEKMGFCAEWIVRVMACVSSVAFTFKINGVVQGSLVPS  596

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDP+SP LF+L  +  S LI ++    +  G +I R  P ISHLFF DD + F  
Sbjct  597   RGLRQGDPISPYLFLLCADAFSTLITKAANEKKIHGAQICRGAPRISHLFFADDSILFTN  656

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             AS+H+ SVV   ++++   SGQ+++  K+ + FS+N    ++  I + LG+  V    +Y
Sbjct  657   ASVHECSVVADIISKYERASGQQVNLSKTEVVFSRNVGRGVRNEIVNVLGVNEVEKQEKY  716

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG+P+I GR K+ ++A +  RI  +L GWK + LS  G+  LI++V+ AIP Y M    L
Sbjct  717   LGLPTIIGRSKKVTFACIKERIWKKLQGWKEKLLSRPGKEVLIKAVVQAIPTYMMSVFCL  776

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P G++  +  L   F WGS +G RK +   W+ +   K  G LG + L   NQAL AK  
Sbjct  777   PSGLIDEIHSLIARFWWGSKEGERKMHWHKWEALCMPKSMGGLGFRDLHCFNQALLAKQA  836

Query  2319  WKLMN  2333
             W+L N
Sbjct  837   WRLCN  841


 Score =   106 bits (264),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 92/296 (31%), Positives = 133/296 (45%), Gaps = 20/296 (7%)
 Frame = +1

Query  253   DLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHT------  414
             DLGY G  +TW +G S       RLDR L N EW    P  E+LHLP   S H       
Sbjct  135   DLGYKGCPFTWQRGNSPTTLIRERLDRMLANEEWCNLFPSWEMLHLPRYRSDHAPLLLKT  194

Query  415   ------LGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNL---SKQLDDWNKHT  567
                       + F+F A W +     + V   W  D   E   S L   S++L DW   T
Sbjct  195   GVNDAFCRGQKLFKFEALWLSKEECGKIVEDAW-GDGEGEDMGSRLEFVSRRLSDWAVAT  253

Query  568   IGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSREEW  747
              GN+ +RK   L  ++ +Q+          ++  R +  +LDEI   EE  W  R+R   
Sbjct  254   FGNLKKRKKEALHLLNRLQQRAP---DATTLEHCRVVSTDLDEIHKLEESYWHARARTNE  310

Query  748   IVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTTQ  927
             +  GD+NT+++H   + RKS +T++ L D  G W    D I E    ++  LFS  +   
Sbjct  311   LRDGDKNTKYFHHKASQRKSRNTIKGLLDENGVWKKGKDEIGEIVSNYFQQLFSSGNPVD  370

Query  928   LEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSFYQNSW  1092
             +E   +     +  S  + + A  T +D+  A+F M   KAP  DGF   F+Q  W
Sbjct  371   METALEGMQCCVTDSMNVELMAPPTGEDIRLALFSMHPNKAPGVDGFHALFFQKFW  426



>ref|XP_010058565.1| PREDICTED: uncharacterized protein LOC104446406 [Eucalyptus grandis]
Length=1621

 Score =   251 bits (640),  Expect(3) = 4e-77, Method: Compositional matrix adjust.
 Identities = 158/425 (37%), Positives = 229/425 (54%), Gaps = 5/425 (1%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             V  S+I    DFF TG L    N T+I LVP IPN   V+ FR I  CN  YK +TK + 
Sbjct  930   VGASVILAVRDFFVTGELLKQINTTIIALVPKIPNASTVHDFRPIACCNTIYKCITKLIA  989

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
              RL   +  +I   Q +FV GR I++N+LV QE+ +       +    VIK+D  KAYD 
Sbjct  990   NRLSRVLPSIISLPQNAFVKGRHISDNILVAQELFSGFHHDPYRPKC-VIKVDFRKAYDT  1048

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             ++W FI   LQ  GF   +I  IMSCV   + ++S +  L  +F   RGIRQGDP+SP +
Sbjct  1049  VNWEFIEVCLQAFGFPQHFIDRIMSCVRFPKFSVSLNGELHGFFASGRGIRQGDPMSPYI  1108

Query  1638  FVLYVERLSHLIE-QSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             F L +E  S L++ Q+ + G   G     K   +SHLFF DD++ F EASL    ++K  
Sbjct  1109  FTLVIEVFSGLLDIQTSRLG--FGFFWRCKSTKLSHLFFADDVLLFSEASLASIDLLKAG  1166

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             ++ F S SG   +  KS +F +  +S +++  I + LG  + +   +YLGVP I  RL +
Sbjct  1167  IDSFSSWSGLEPNLNKSEVFIAGGSS-DLRSGILNKLGFQVGSLPFQYLGVPIISARLGK  1225

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
                  L++ I AR+  W +R LS  GR  LI+SVL +I  +      LP  VL ++E++ 
Sbjct  1226  ADCVMLVNAITARVQSWTHRFLSLAGRLQLIKSVLYSIQGFWASVFFLPCAVLDKIEKIL  1285

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
             R FLW           ++W  V   +++G LGI+ L   N AL  K  WKL + ++ L  
Sbjct  1286  RQFLWKGPMLGPGGAKVAWCDVCLPREEGGLGIRSLKENNVALMLKHIWKLFSDKESLWC  1345

Query  2355  KIMEA  2369
             K + +
Sbjct  1346  KWVHS  1350


 Score = 66.6 bits (161),  Expect(3) = 4e-77, Method: Compositional matrix adjust.
 Identities = 79/313 (25%), Positives = 132/313 (42%), Gaps = 26/313 (8%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEW---------KIRSPD  372
             F+D + + GL DL Y+G  YTW    + PN K  ++DR L N  W            +P 
Sbjct  619   FKDCLTQAGLDDLRYTGYRYTWTTS-TGPNRKQRKIDRVLVNGCWNSTFSYSEASFLAPS  677

Query  373   VEVLHLPM-VNSYHTLGESRRFRFNAAW*THPNYQE*VSSTWKSDV------SLEANKSN  531
             +   H PM V        S+ F+F   W THP++   VS  W S +      +L A    
Sbjct  678   ISD-HSPMLVKIMQVPKSSKPFKFFNFWMTHPDFLSLVSEAWLSPIQGSPMFTLCAKLRL  736

Query  532   LSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSV-YQkldlikldrklrreldeilYQ  708
             L  +L   NK    ++  R       +   Q +L        L + +++  +   ++  Q
Sbjct  737   LKCKLKQLNKEAFSDLSMRTAEARRALHATQDALQADPSNGRLAEAEKQQIQVFTDLRLQ  796

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDG-ILEPFH  885
             EE  +  +SR  W+  GD NT+++H    V K     R +    G  I+D    + + F 
Sbjct  797   EESFYRQKSRVRWLKDGDLNTKYFH--QVVNKRHLQNRIISVTNGNTITDEPSEVQKIFV  854

Query  886   AFYMDLFSED---STTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPS  1053
               + DL +     +   +E++       L   Q   ++      ++ + +F +A  KAP 
Sbjct  855   DHFRDLLTATPAVACPTMEEIRAVLKQTLDVDQVRFLSTPILDDEIKDTLFSLATGKAPG  914

Query  1054  SDGFQTSFYQNSW  1092
              DGF   F+++SW
Sbjct  915   PDGFNVEFFKHSW  927


 Score = 23.1 bits (48),  Expect(3) = 4e-77, Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 0/33 (0%)
 Frame = +2

Query  2411  VWKGILKSAPILLKGSKKLVKNDRSTLFWLDSW  2509
              WK +L+   I  +  +  + N RS  FW D W
Sbjct  1370  AWKKLLRLRSIYQQHFRWRIGNGRSVSFWFDPW  1402



>ref|XP_008355389.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=883

 Score =   283 bits (725),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 149/389 (38%), Positives = 228/389 (59%), Gaps = 3/389 (1%)
 Frame = +3

Query  1212  VNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL  1391
             + QFR I LCNV YK+L K +T RLK  M  +IG  Q++FV G+QI +N+LV  E+L+SL
Sbjct  1     MTQFRPIALCNVIYKILAKVITNRLKKIMPKVIGENQSAFVAGKQIQDNILVVHEILHSL  60

Query  1392  --RSKSGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISF  1565
               +SK  + G M IK+D+ KAYDR+ W F+ S + K GF+P +   +  C+ST   +I  
Sbjct  61    NHQSKDMQKG-MAIKLDMAKAYDRVEWDFLLSMMYKLGFAPFFCNRVKECISTVSFSILI  119

Query  1566  DSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHL  1745
             +   + +   +RG+RQGDPLSP LF++  E  S LI++ ++ G   G + T  G  ++HL
Sbjct  120   NGSPTGYIQPQRGLRQGDPLSPFLFLICTEGFSSLIKKGMECGVLHGYRFTPNGSPLTHL  179

Query  1746  FFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSL  1925
             FF DD V FG A++ +A  V   LN +   SGQ ++  KS IFF  +TS  I++ I ++L
Sbjct  180   FFADDSVLFGNATVEEAQGVVDILNTYAXGSGQEINLSKSSIFFGTSTSKRIKKRIGNTL  239

Query  1926  GIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSA  2105
             GIP  +  G+YLG+ +  G  K+  + ++  +++ARL GW  + LS  G+  LI++V   
Sbjct  240   GIPHKDGFGKYLGLQADFGLSKKAVFXEIRDKMEARLAGWSEQFLSQAGKEVLIKAVAMX  299

Query  2106  IPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD  2285
             +P + M    LP GV   +E+  R + W  +   R C+  SW K+ + K  G LG + + 
Sbjct  300   LPNFAMSCFKLPIGVCRDMEKAVRSYWWRGNSQKRGCHWASWDKLMKQKSAGGLGFKDIQ  359

Query  2286  *MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
               N A  AK+GW+L+     L   ++  K
Sbjct  360   CFNLAFLAKIGWRLIQNPTSLLANVLRDK  388


 Score = 68.6 bits (166),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 92/202 (46%), Gaps = 10/202 (5%)
 Frame = +2

Query  2762  SRGLSTYRR----VWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICR  2929
              RG S+  R     W  I  L+VP +I+ FLW   +          RR    E  CG+C 
Sbjct  533   GRGASSMLRKNNLTWKRIWKLQVPNKIKFFLWKCCNKALAVRHNLQRRQIRVENICGVCN  592

Query  2930  NLPEDIDHIMQRCPIANSVW-ESLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVT  3106
                E  +H+  +C  ++  W  S +  +   L   D+   +D+  +   + ++  E    
Sbjct  593   TFDESENHLFFQCDFSHRFWFGSPLHINSHELAGADFLENWDKICTSTKNMDKAEEILQE  652

Query  3107  FAVTMWWLWKWRNDLVFSGTN-INLAARIKW---IRDQVEEINISFSKAKGLIA-PIESI  3271
              A  +W LWK RND+VF+G +  +L   + W   I +  E +++S      LI+  +++ 
Sbjct  653   VAFGLWRLWKNRNDVVFNGVHRQHLEVMMLWRKNIYEFREALSLSLKCEDQLISNNLKTE  712

Query  3272  CWRQLKWIRPQVGWVKANIDGS  3337
                +L W +P+ G +K N D +
Sbjct  713   QSPRLHWTKPKFGTIKVNTDAA  734



>gb|EEE52912.1| hypothetical protein OsJ_35521 [Oryza sativa Japonica Group]
Length=1003

 Score =   285 bits (729),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 147/409 (36%), Positives = 229/409 (56%), Gaps = 1/409 (0%)
 Frame = +3

Query  1149  LPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTS  1328
             +P G N T I L+P       +  FR I LCNV YK++ K +   L+  +  +I   Q++
Sbjct  500   MPEGVNTTAIVLIPKKKESKELKDFRPISLCNVIYKVVAKCLVNHLRPILESIISQEQSA  559

Query  1329  FVLGRQITNNVLVYQEVLNSL-RSKSGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFS  1505
             F+ GR IT+N L+  E  +++ +SK         K+DL KAYDR+ W ++   L + GFS
Sbjct  560   FIPGRMITDNALIAFECFHNIAQSKRESQEFCAYKLDLAKAYDRVDWQYLEGVLDRMGFS  619

Query  1506  PDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSV  1685
               WI+ +M+CV++ R A+ F+  + K F   RG+RQGDPLSP LF+   + LS ++  +V
Sbjct  620   NTWIQWMMACVTSVRYAVRFNGSMLKSFQPSRGLRQGDPLSPYLFLFVADGLSTILSSAV  679

Query  1686  KNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS  1865
             + G    +K+ R+ P ISHL F DD + F +A++ QA+VVK+ LN +   + Q LS  K 
Sbjct  680   RTGDLVPLKVCRQAPGISHLLFADDSLLFFKANVEQATVVKEALNLYERCTSQLLSPAKC  739

Query  1866  *IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGW  2045
              + F K+ S + Q  I S L +   +   +YLG+P+  GR+K D +  +  R   RL  W
Sbjct  740   SMLFGKHCSDQTQPGIKSLLDVQQNSFEDKYLGLPTPEGRMKADRFQSIKERFFKRLIDW  799

Query  2046  KNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLI  2225
               + L   G+  LI+SV+ A+P Y M    LP        +L R F WG  +  RK +  
Sbjct  800   AEKHLPMGGKEVLIKSVIQALPTYMMSVFKLPPSFCEEYMQLVRKFWWGEDRSQRKVHWA  859

Query  2226  SWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
             SW+++ + K  G +G + +   NQAL A+  W+L+   D LC ++++AK
Sbjct  860   SWQQLIKPKSMGGMGFKDMKIFNQALLARQAWRLVQFPDSLCARVLKAK  908


 Score = 59.3 bits (142),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 63/265 (24%), Positives = 108/265 (41%), Gaps = 23/265 (9%)
 Frame = +1

Query  214  LGFQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP  393
            L F++ +    + DLG+ G  +T+            RLDRA+ +  W +  P  +V HL 
Sbjct  237  LDFREILSHCDVFDLGFIGTPWTYDNKRKGGYNVRVRLDRAVASQSWSVLYPQAQVRHLV  296

Query  394  MVNSYHTL------------GESRRFRFNAAW*THPNYQE*VSSTWK-----SDVSLEAN  522
               S H                SR  R+   W    +  E + + W+     +D+   ++
Sbjct  297  SSRSDHCPILVQCTPDEDKDKPSRCMRYEILWEREESLSEEIRTAWEQHHAATDLGSVSS  356

Query  523  KSNLSK-QLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldei  699
            K  L    L  W++   G++ +     L  +      L +  +    +  +   R ++EI
Sbjct  357  KLKLVMGALQHWSREKFGSVNKE----LGALRKKMEELQLGGRHTHDQEYQSCSRRMEEI  412

Query  700  lYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEP  879
            LY+EE++W  RSR  W+  GDRNT F H   A R   + + +L    G W      +   
Sbjct  413  LYREEMMWLQRSRVAWLREGDRNTSF-HRKAAWRHRKNKISKLFLPDGSWTDQRKEMETM  471

Query  880  FHAFYMDLFSEDSTTQLEDLNDAFF  954
               F+ DL+++D     + L D   
Sbjct  472  ATNFFKDLYTKDPLVTPQPLLDLIM  496



>ref|XP_010058837.1| PREDICTED: uncharacterized protein LOC104446716 [Eucalyptus grandis]
Length=1688

 Score =   241 bits (616),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 156/431 (36%), Positives = 224/431 (52%), Gaps = 13/431 (3%)
 Frame = +3

Query  1092  GTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKA  1271
             G V   + +   DFFS G L    N T++ L+P +PN   VN FR I  CN  YK++TK 
Sbjct  419   GIVGSLVTEAVKDFFSVGSLLKEVNATILTLIPKVPNACEVNDFRPIACCNTIYKLITKI  478

Query  1272  MTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAY  1451
             +  R+   ++ ++ P Q +FV GR+I +N+L+ QE+    +         V K+D  KAY
Sbjct  479   LANRIAPVLQDIVSPSQNAFVKGRRIRDNILLAQELFAGFQLDLYLPRCAV-KVDFRKAY  537

Query  1452  DRLSWSFIRSTLQKAGFSPDWI-RNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLS  1628
             D + W F+  TL    F P WI R IM+CV T R +IS +  L  +F   RG+RQGDP+S
Sbjct  538   DTIDWDFLELTLTAFRF-PLWIIRRIMACVRTPRFSISINGELHGFFPGGRGLRQGDPMS  596

Query  1629  PLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVK  1808
             P LF L +E  S ++ Q     ++K      K P ++HLFF DD+  F +A    A ++K
Sbjct  597   PYLFTLIMEIFSGILNQRSSAKEFK-YYWRCKSPKLTHLFFADDVFLFCQADWKSAVILK  655

Query  1809  KCLNEFCSLSGQRLSYMKS*IFFSKNTSV---EIQQAISSSLG-IPIVNDLGRYLGVPSI  1976
             + L+ F S SG   +  KS IF S         I Q      G +PI     RYLGVP I
Sbjct  656   RSLDIFSSWSGLIPNKNKSDIFLSGGDPALCNRILQEFGFQEGKLPI-----RYLGVPII  710

Query  1977  HGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLS  2156
               RL +     L+ RI AR   W +R LSF GR  LI+SVL AI  +      LP  V+ 
Sbjct  711   SKRLTKADCTQLIDRITARARSWSHRFLSFAGRLQLIRSVLHAIQTFWASVFTLPSSVIL  770

Query  2157  RLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNK  2336
              +E + R FLW  +  ++    +SW +V   K++G LGI+ +   N+A   K  W L   
Sbjct  771   GIESILRRFLWKGTSLDKGGAKVSWAEVCLPKEEGGLGIRSIKDCNKASMLKFIWILFTD  830

Query  2337  EDGLCVKIMEA  2369
             ++ L  + + +
Sbjct  831   KESLWCRWIHS  841


 Score = 75.9 bits (185),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 71/136 (52%), Gaps = 8/136 (6%)
 Frame = +1

Query  706   QEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFH  885
             QEE  +  +SR  W+  GDRNT+F+H     R   + +  +KD  G  ISD D + + F 
Sbjct  286   QEESFFKQKSRIRWLKEGDRNTKFFHNCVKARHLNNRILSVKDTAGTVISDPDLVPQVFL  345

Query  886   AFYMDLFSED---STTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE---AVFEMAQFKA  1047
             +F+ DL +     +   +++L      PL  SQ  A+ +   V DLE    +F +A+ KA
Sbjct  346   SFFSDLLAPRVGLAKPDIQELTSLIRKPLSDSQVCALAS--PVSDLEIKKTLFSLAKGKA  403

Query  1048  PSSDGFQTSFYQNSWA  1095
             P  DGF   F++++W 
Sbjct  404   PGPDGFTVEFFKSNWG  419



>ref|XP_009111228.1| PREDICTED: uncharacterized protein LOC103836687 [Brassica rapa]
Length=878

 Score =   282 bits (722),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 158/438 (36%), Positives = 242/438 (55%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             F       F   +   + K    FF +G +    N T + L+P I     V ++R I LC
Sbjct  16    FSASFYQSFWDIIGGDVSKDIQAFFDSGDMDARQNATHVRLIPKITGARKVAEYRPIALC  75

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGL  1418
             N  YK++ K +T RL+  +  LI   Q++FV GR I++NVL+  EVL+ L+ S +     
Sbjct  76    NTHYKIIAKILTRRLQPMLPSLISEQQSAFVKGRAISDNVLITHEVLHYLQQSGATVRCS  135

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
             M IK D+ KAYDR+ WSF+R+ L + GF   WI  +M+CVS+   +   +       +  
Sbjct  136   MAIKTDMSKAYDRIEWSFLRNVLARFGFHEIWISWVMACVSSVSYSYLVNGEAQGCVLPS  195

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RGIRQGDPLSP LF+L  E LS L  ++   G+  G+K+ R  P I+HL F DD +FF  
Sbjct  196   RGIRQGDPLSPYLFILCTEVLSGLCRKAQLKGEVIGVKVARNSPAINHLLFADDTMFFSR  255

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
                   + + + L ++ + SGQ ++  KS I FS  T  E+++ +     I     LG+Y
Sbjct  256   TDSRSCASLIEILRKYEAASGQSINLNKSTITFSAKTPSEVKRRVRDLFNIHNEGGLGKY  315

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG+P   GR K+D +A L+ RI+ +   WK+R LS  G+  L++S+L+A+P Y+M    L
Sbjct  316   LGLPEHFGRRKRDIFAALIDRIRQKAHSWKSRFLSGAGKLVLLKSILAAMPTYSMSCFKL  375

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             PQ ++ +L+ +   F W  S   RK   +SW+K++  K+ G LG + +   N AL AK+ 
Sbjct  376   PQSIIKQLQSVLTRFWWDLSPEIRKMCWVSWEKLSVPKNAGGLGFREIAQFNDALLAKVS  435

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W+++    GL  KI+  K
Sbjct  436   WRILRNPSGLLAKILLGK  453



>gb|EEE50824.1| hypothetical protein OsJ_31232 [Oryza sativa Japonica Group]
Length=1594

 Score =   287 bits (734),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 151/411 (37%), Positives = 238/411 (58%), Gaps = 1/411 (0%)
 Frame = +3

Query  1143  GHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQ  1322
             G +P G ND  I L+P +  P L+   R I LCNV YK+++K +  RLK  +  +I P Q
Sbjct  707   GAIPEGWNDITIVLIPKVKKPELIKDLRPISLCNVCYKLVSKVLANRLKKILPDVISPAQ  766

Query  1323  TSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAG  1499
             ++FV GR I++N+L+  E+ + +R+K SG+ G    K+D+ KAYDR+ WSF+   + K G
Sbjct  767   SAFVPGRLISDNILIADEMTHYMRNKRSGQVGYAAFKLDMSKAYDRVEWSFLHDMMLKLG  826

Query  1500  FSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQ  1679
             F  DW+  IM CVST    I  +  LS+ F  ERG+RQGDPLSP LF+L  E  S L+ +
Sbjct  827   FHTDWVNLIMKCVSTVTYRIRVNGELSESFSPERGLRQGDPLSPYLFLLCAEGFSALLSK  886

Query  1680  SVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYM  1859
             + + G+  G++I +  P +SHL F DD +    A+  +A  ++  L  +   SGQ ++  
Sbjct  887   TEEEGRLHGIRICQGAPSVSHLLFADDSLILCRANGGEAQQLQTILQIYEECSGQVINKD  946

Query  1860  KS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLT  2039
             KS + FS NTS   + A+ ++L +       +YLG+P   GR +   ++ L  RI  R+ 
Sbjct  947   KSAVMFSPNTSSLEKGAVMAALNMQRETTNEKYLGLPVFVGRSRTKIFSYLKERIWQRIQ  1006

Query  2040  GWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCN  2219
             GWK + LS  G+  LI++V  AIP + M    L + +  ++ ++   + W + + + K +
Sbjct  1007  GWKEKLLSRAGKEILIKAVAQAIPTFAMGCFELTKDLCDQISKMIAKYWWSNQEKDNKMH  1066

Query  2220  LISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
              +SW K+T  K+ G LG + +   N A+ AK GW+L+   D LC +++ AK
Sbjct  1067  WLSWNKLTLPKNMGGLGFRDIYIFNLAMLAKQGWRLIQDPDSLCSRVLRAK  1117


 Score = 30.4 bits (67),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (3%)
 Frame = +1

Query  982   AINAHFTVKDL-EAVFEMAQFKAPSSDGFQTSFYQNSW  1092
             ++ A FT +++ EA+  +   KAP  DG    FY+  W
Sbjct  652   SLRAEFTREEVKEALDAIGDLKAPGPDGMPAGFYKACW  689


 Score = 60.1 bits (144),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 83/207 (40%), Gaps = 12/207 (6%)
 Frame = +2

Query  2792  WNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCP  2971
             W  +  L VP +I+ FLW   H+          RG   +  C +C    ED  H+  +C 
Sbjct  1275  WKKLWKLGVPGKIKHFLWRMCHNTLALRANLQHRGMDVDTRCVMCGRYNEDAGHLFFKCK  1334

Query  2972  IANSVWESLIPYDHRRL*DQDYTNWFDEGISELSSGN-RKHEQRVTFAVTMWWLWKWRND  3148
                 VW++L   + R + +Q  +     G + L S   R   +R +  V +W  WK RN+
Sbjct  1335  PVKKVWQALNLEELRSMLEQQTS-----GKNVLQSIYCRPEIERTSAIVCLWQWWKERNE  1389

Query  3149  LVFSGTNINLAARIKWIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGWVKANI  3328
             +   G   + A     I  Q  E      K K   +P    C     W RP + +VK N 
Sbjct  1390  VREGGIPRSPAELSHLIMSQAGEFVRMNVKEK---SPRTGEC---AVWRRPPLNFVKINT  1443

Query  3329  DGSSIPSNSIARCGGFIRDDQGC*LKG  3409
             DG+   +      G  IRD  G  L+ 
Sbjct  1444  DGAYSSNMKQGGWGFVIRDQTGAVLQA  1470



>ref|XP_007031450.1| LINE-type retrotransposon LIb DNA, Insertion at the S11 site-like 
protein [Theobroma cacao]
 gb|EOY02376.1| LINE-type retrotransposon LIb DNA, Insertion at the S11 site-like 
protein [Theobroma cacao]
Length=620

 Score =   276 bits (706),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 143/393 (36%), Positives = 228/393 (58%), Gaps = 0/393 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             ++   V   L ++  + F+   + +    ++I L+P    P   +Q R I L  V +K+L
Sbjct  36    QWQQVVGQKLFEYVQNVFNGTEIGSNMCSSLIVLIPKGEAPEYSSQCRPISLLPVIFKVL  95

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLE  1442
              K +  RLK  M +LI   Q SF+L   I +N++V QEV++S   K G+ G M++KIDLE
Sbjct  96    VKVVANRLKPFMNLLIEETQASFILETHIVDNIIVVQEVVHSFHEKQGRRGWMMVKIDLE  155

Query  1443  KAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDP  1622
             KAYDRL W FI  +L +A    + I  ++   +     I ++    + F   RG+R GDP
Sbjct  156   KAYDRLRWEFIYDSLVEAQIPENIIDILIRSWNAHSSHILWNGTCFEKFFPSRGVRLGDP  215

Query  1623  LSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASV  1802
             L+P LFVL +E+L+H I+Q+V+   WK +++ + GP +++LFF+DDL+   EAS  Q  V
Sbjct  216   LAPYLFVLCIEKLAHGIKQAVEQEMWKPIRLGKHGPPLTYLFFMDDLILLAEASESQMEV  275

Query  1803  VKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHG  1982
             +K  L +FC+    ++   KS  F SKN  +E+   +    G    + +G+Y+GVP +HG
Sbjct  276   IKGVLEDFCACLRGKVCIAKSTFFCSKNVPMELNIKVKDCSGFSYSDSMGKYIGVPLLHG  335

Query  1983  RLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRL  2162
             R     Y  L+ ++++RL  WK  +LS  GR TL+QSVL++IP YTMQ+  +P  +  ++
Sbjct  336   RKTAHIYKSLIDKVRSRLCAWKASSLSSTGRLTLVQSVLTSIPLYTMQTISIPLEICKKI  395

Query  2163  ERLSRDFLWGSSKGNRKCNLISWKKVTESKDQG  2261
             E L R+FLW     ++K +L+ W  + + K QG
Sbjct  396   ELLCRNFLWHGDGQSKKVHLLRWSTLCKPKAQG  428



>ref|XP_009149314.1| PREDICTED: uncharacterized protein LOC103872634 [Brassica rapa]
Length=954

 Score =   283 bits (723),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 149/447 (33%), Positives = 248/447 (55%), Gaps = 12/447 (3%)
 Frame = +3

Query  1131  FFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLI  1310
             FF++  +P+G N T + L+P IPNP  +   R I LC+V YK+++K +  RLK  +  +I
Sbjct  105   FFNSSVIPSGWNHTQLSLLPKIPNPTQMGDMRPISLCSVQYKIISKILCDRLKCILPDII  164

Query  1311  GPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDLEKAYDRLSWSFIRSTL  1487
                Q +FV GR I++N+++  E ++ LR+ +      M IK D+ KAYDR+ W F+   L
Sbjct  165   SDTQGAFVQGRLISDNIVIAHEFVHGLRTNASVSKEFMAIKTDMSKAYDRVEWCFMEELL  224

Query  1488  QKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSH  1667
             +K GF   W+R +M+C+++   ++  + R   +   ERGIRQGDPLSP LF+L  E L  
Sbjct  225   EKMGFDRVWVRWVMACITSVSYSVLLNGRSHGFIKPERGIRQGDPLSPFLFILCAEALVS  284

Query  1668  LIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQR  1847
              +  + ++G+  G+ ++  GP + HL F DD +   +A+  + + +  CL E+   SGQR
Sbjct  285   KLNHAEESGRLTGIGLSANGPRVHHLLFADDSLLLCKANELEGTEIMNCLKEYGDASGQR  344

Query  1848  LSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQ  2027
             +++ KS + F        +  +   LGI      G YLG+P      K++  + +  ++Q
Sbjct  345   INFQKSSVIFGSQVLDSTKANVKRVLGIDREGGEGTYLGLPECFKGSKRELLSFIREKLQ  404

Query  2028  ARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGN  2207
             +RL GW  +TLS  G+  L++SV  ++P Y M    LP+ V +++     +F WG   G 
Sbjct  405   SRLHGWFAKTLSLGGKEVLLKSVAMSLPVYAMSMFKLPKDVCAKITSAMTEFWWGGGNGK  464

Query  2208  RKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAKV----  2375
             RK   +SWKK+ + K +G LG   +   NQ+L  K  W++M+  + L  +++++K     
Sbjct  465   RKIAWVSWKKLCKQKKEGGLGFHDIVKFNQSLLGKQAWRIMSNPNSLVARVLKSKYFPNV  524

Query  2376  -----QLPSLPSQACQ--MYGRVFLSR  2435
                   L S PS A +  ++GR  LS+
Sbjct  525   DFLQSSLGSRPSYAWRSILHGRDVLSK  551


 Score = 60.8 bits (146),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 52/221 (24%), Positives = 95/221 (43%), Gaps = 19/221 (9%)
 Frame = +2

Query  2783  RRVWNYI*SLKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQ  2962
             +++W+ +  +K P +I+ FLW A         +   RG   +  C +C +  E I H++ 
Sbjct  672   KKLWSSLWKIKAPAKIKHFLWKALSGAVAVMDRLRSRGIQVDTTCKVCNSGIETICHLLF  731

Query  2963  RCPIANSVWE-SLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRV---TFAVTMWWL  3130
              CP+A   WE S I            TN     I  L   ++K  + +   +F   +W L
Sbjct  732   TCPMAKDTWERSAITLPAAGF----STNSVFLNIYHLLEQSKKFPKNLNVNSFPWILWHL  787

Query  3131  WKWRNDLVFSGTNINLAARIKWIRDQVE---EINISFSKAKGLIAPI-ESICWRQLKWIR  3298
             WK RN L F     +    +   +++     E+N   ++A  +  P  +S+      W +
Sbjct  788   WKARNGLAFERIQYSSVFVVTRAKEEANVWFEVNSPRTEASQVPHPTGDSVS----SWAK  843

Query  3299  PQVGWVKANIDGSSIPSNSIARCGGFIRDDQGC*LKGFMHN  3421
             P  G++K N+  S +  +        +RD++G   K  +H+
Sbjct  844   PPTGFLKCNVGVSWVSQHVHCGVAWILRDNKG---KAILHS  881



>ref|XP_010668002.1| PREDICTED: uncharacterized protein LOC104884990 [Beta vulgaris 
subsp. vulgaris]
Length=1509

 Score =   239 bits (610),  Expect(3) = 3e-76, Method: Compositional matrix adjust.
 Identities = 140/428 (33%), Positives = 227/428 (53%), Gaps = 3/428 (1%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             +K+ +     +F+ T HLP GCN  ++ L+P    P     FR I +    YK+++K + 
Sbjct  591   IKEDIYAIVFEFWQTSHLPKGCNTALVALIPKTNPPNGFKDFRPISMIGCVYKIISKILA  650

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
              RL+  M  L+G  Q++F+ GRQI +  L+  EV+ S   K  K    + KID  KA+D 
Sbjct  651   RRLQQVMAHLVGSHQSAFIKGRQILDGALIAGEVIES--CKRNKVDATIFKIDFHKAFDS  708

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             +SW F+  TL +  F   W   I +CV ++  +I  +   +    L RG+RQGDPLSP L
Sbjct  709   VSWGFMEWTLTQMNFPKQWREWIRACVLSASASILINGSPTSPIKLRRGLRQGDPLSPFL  768

Query  1638  FVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCL  1817
             F L  E L+ LI+++V    W+G++I R G  I+HL + DD V F    L     +K+ L
Sbjct  769   FTLIAEPLNLLIKKAVSLSLWEGVEICRGGLKITHLQYADDTVLFCPPKLEFLENIKRVL  828

Query  1818  NEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQD  1997
               F   SG ++++ KS      N   ++   ++S L   + +    YLG+P      + +
Sbjct  829   ILFHLASGLQINFHKS-SLMGINIEPKLLDHMASQLLCKVGSLPFVYLGLPIGGSASRIN  887

Query  1998  SYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSR  2177
              +  ++++I+ +L  WK   LS  GR TLI+S L+++P Y M    +P+GV+ ++ +L R
Sbjct  888   LWEPVIAKIEKKLASWKGNLLSIGGRVTLIKSCLASLPLYYMSLLPMPKGVIEKIIQLQR  947

Query  2178  DFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVK  2357
             +FLW  S   +   L+SW  +   K  G L I  L   N AL  K  W+ +++ + L  +
Sbjct  948   NFLWRGSLEKKALPLVSWNVLELPKQYGGLSIGNLHNKNTALLFKWLWRFIHEPNSLWRQ  1007

Query  2358  IMEAKVQL  2381
             I++AK  +
Sbjct  1008  IVQAKYDI  1015


 Score = 73.2 bits (178),  Expect(3) = 3e-76, Method: Compositional matrix adjust.
 Identities = 84/305 (28%), Positives = 126/305 (41%), Gaps = 40/305 (13%)
 Frame = +1

Query  247   LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLP---------MV  399
             LI++  S   +TW +G S      ++LDR     +W    P + V HL          +V
Sbjct  301   LIEIPSSNSKFTWFRGQSK-----SKLDRVFVQAQWISAYPLIRVSHLQRGLSDHCPILV  355

Query  400   NSYHTLGESRRFRFNAAW*THPNYQE*VSSTW-KSDVSLEANKSNLSK-QLDDWNKHTIG  573
              S       R FRF   W +HP   + +S TW KS      +K  L K  L  WN    G
Sbjct  356   QSKEKNWGPRPFRFLNCWLSHPGCMKTISDTWAKSQNMTFMDKLRLLKTNLKKWNAAEFG  415

Query  574   NIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQE--------ELLWF*  729
              I         +IS  +  +  Y  +   ++  K   E  +    E        E  W  
Sbjct  416   IIEE-------KISFFENKIHEYDLIANNRMLDKAELEERKAAQIELWQWSKRNESFWAQ  468

Query  730   RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGE-WISDGDGILEPFHAFYMDLF  906
              SR +WI  GDRNTR++H   ++R+  + +  LK+  GE  I D   I      F+ +LF
Sbjct  469   HSRAKWIREGDRNTRYFHVMASIRRRKNNIEYLKE--GEHMIEDPTEIKMAATNFFKNLF  526

Query  907   SEDSTTQ--LEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSF  1077
             +E+   +   E L+   F  L       +   F+  +++ AV      K+P  DGF   F
Sbjct  527   TEEHEIRPVFEGLD---FKRLGEQHEHILTDPFSTAEIDAAVAACDSSKSPGPDGFNFMF  583

Query  1078  YQNSW  1092
              +NSW
Sbjct  584   IKNSW  588


 Score = 25.4 bits (54),  Expect(3) = 3e-76, Method: Compositional matrix adjust.
 Identities = 11/42 (26%), Positives = 21/42 (50%), Gaps = 0/42 (0%)
 Frame = +2

Query  2399  GMSNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWIGKQA  2524
             G+ N+ +    +  I     +K + +  ST+FW D W+G+  
Sbjct  1035  GICNLIQSSSHAYQIATHMIRKNIGDGSSTMFWHDVWVGEHP  1076



>ref|XP_008392963.1| PREDICTED: uncharacterized protein LOC103455142 [Malus domestica]
Length=1279

 Score =   238 bits (608),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 141/426 (33%), Positives = 218/426 (51%), Gaps = 36/426 (8%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             TV   +IK    F+ +G +    N T + L+P +  P  + Q+R I LCNV YK++ K +
Sbjct  419   TVGKDVIKIVKAFWHSGTILRKLNHTNLVLIPKVKCPRNMTQYRPIALCNVIYKVIAKVL  478

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYD  1454
             T RLK+ M                                 K+G    M IK+D+ KAYD
Sbjct  479   TNRLKTVM--------------------------------PKTG----MAIKLDMAKAYD  502

Query  1455  RLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPL  1634
             R+   F+ S + K GF+P +   I  C+ST+  +I  +   +   +  RG+R GDPLSP 
Sbjct  503   RVXXVFLLSMMAKLGFAPLFCNWIKECISTASFSILVNGNPTGLVLPXRGLRXGDPLSPY  562

Query  1635  LFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             LF+L  E LS LI + +  G   G  ++  G  ISHLFF DD V FG AS+ +A  + + 
Sbjct  563   LFLLCTEGLSMLIRRGIDRGALHGXXVSANGTPISHLFFADDSVLFGHASVEEARGMVEV  622

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L  +   SGQ ++  KS IFF   TS  +++ I  ++GI   +  GRYLG+ S  G  K+
Sbjct  623   LRTYARGSGQAVNLSKSSIFFGSKTSNRVRKXIGRTMGIQCKSGFGRYLGLQSDFGHSKK  682

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
               + ++  R+++ L GW  + LS  G+  L+++V  A+P Y M    LP GV   LE+  
Sbjct  683   VVFEEVRDRLESXLAGWAEQFLSQAGKEVLVKAVAMAMPNYAMSCFKLPIGVCRDLEKAI  742

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
             R+F W  S+  +  + IS +++ + K  G  G + +   N A  AK+GW+L+     L  
Sbjct  743   RNFWWRGSEQRKXVHWISXERLMKQKRVGGXGFRDIQCFNXAFLAKIGWRLIQNPGSLLA  802

Query  2355  KIMEAK  2372
              +++ K
Sbjct  803   TVLQEK  808


 Score = 77.8 bits (190),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 70/129 (54%), Gaps = 1/129 (1%)
 Frame = +1

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             EE  W  +SR +W+  GD+N++F+HA T  R+  + ++ L+D  G W  D   I     +
Sbjct  289   EEAYWRVKSRAQWLKEGDKNSKFFHAQTLKRRRFNQIKGLEDVNGVWQEDEAAISSIATS  348

Query  889   FYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGF  1065
             ++  LF   S   ++++ +   P +     +A+ A  T ++++ AVF++   +AP  DG+
Sbjct  349   YFEVLFKSSSPGXIDEIGECLAPRVTAEDNIALTAAVTEEEIKTAVFQIPPIRAPGPDGY  408

Query  1066  QTSFYQNSW  1092
                FYQ+ W
Sbjct  409   SGCFYQDHW  417



>ref|XP_010693613.1| PREDICTED: uncharacterized protein LOC104906541 [Beta vulgaris 
subsp. vulgaris]
Length=1067

 Score =   284 bits (726),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 154/438 (35%), Positives = 244/438 (56%), Gaps = 1/438 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP     ++   V +S+      FF +G L    N T I L+P + +P   NQFR I LC
Sbjct  302   FPPYFFQQYWSLVGNSVCHAVRAFFFSGTLLKEVNHTFITLIPKVESPSNPNQFRPISLC  361

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLM  1421
             +  YK++ K M  RLK  +  +I P Q +FV  R I +NVL+  EV +S + K+G  G +
Sbjct  362   STIYKVIAKIMASRLKIVLGKIIHPLQGAFVPERLIQDNVLIAHEVFHSFKKKTGNQGWL  421

Query  1422  VIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLER  1601
              IK+D+EKAYDRL W+FI +  +K GF   W+  +  C+S+   ++  +      F   R
Sbjct  422   AIKLDMEKAYDRLEWNFIFAVFKKLGFCERWVGWMKECISSVSFSVLVNGIPGDVFYPSR  481

Query  1602  GIRQGDPLSPLLFVLYVERLSHLIEQSVKNG-QWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             GIRQGDPLSP +F+L  E L+  +  + + G +  G+ +      I  L F DD + F +
Sbjct  482   GIRQGDPLSPYIFILCAEILARQLHAASREGPKLVGVALGHSRVKIPFLTFADDTMIFAK  541

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A++   +V+++ L+++C +SGQ ++Y KS    S NT   +  + +S L +     LG+Y
Sbjct  542   ATVDSCTVIREILDDYCRMSGQLVNYNKSAYQCSPNTDPILATSFTSFLRMGEACSLGKY  601

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG P I  ++  +++ ++  ++Q +L+ WK  +LS  GR+ LIQS L+    Y MQ  LL
Sbjct  602   LGCPIIDSKVTNNTFGNIQEKVQGQLSKWKANSLSQAGRTVLIQSNLATKANYQMQCFLL  661

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P  ++  L++  R+F W  S  ++  NLI W K+ + K  G LG+++   MN AL  KL 
Sbjct  662   PPHIVESLDKSYRNFFWNKSSESKSPNLIGWDKICKPKQNGGLGLRKAKVMNMALQFKLL  721

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             WK++   D L V ++  K
Sbjct  722   WKILFCPDNLWVNLVSKK  739


 Score = 80.1 bits (196),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/303 (21%), Positives = 136/303 (45%), Gaps = 20/303 (7%)
 Frame = +1

Query  247   LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHT----  414
              I+L + G  +TW +  S P+    RLD+ + N+++    P+V+V H     S H     
Sbjct  10    CIELPFLGSGFTWKKKRSGPDNILERLDKGVANLDFLNVFPNVKVQHHAFTTSDHCQVSV  69

Query  415   ---LGESRR---FRFNAAW*THPNYQE*VSSTWKSDVS------LEANKSNLSKQLDDWN  558
                + + R+   FRF+ AW T  +++  +   W +         L      L ++  +W 
Sbjct  70    KLDILQGRKSPPFRFDKAWTTRKDFEVIIKKAWSTRFHGSYMFRLTKKCKLLKEKAKNWA  129

Query  559   KHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQ-EELLWF*RS  735
                 GN+ R+   V +++  +Q +L        +             L + +EL W  ++
Sbjct  130   TTRFGNVIRQLKVVESKLKCIQDNLLANPSCPFLAAKLDKFHLKQVRLLELQELYWKTKA  189

Query  736   REEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSED  915
             +   +   D NT+++HA  ++R++ + +  ++D+ G  ++D   +   F   ++  F+ +
Sbjct  190   KSNHLKLSDSNTKYFHACASIRRNRNFISSIEDDTGVVLTDPKDVENCFTNSFVQRFTAN  249

Query  916   STTQLEDLNDAFFPPLHTSQW--LAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSFYQN  1086
                  ++  D        S+   + + +  + ++++ AVFE+A  KAP  DGF   F+Q 
Sbjct  250   QECFFDEHCDFSLLESIISEEDNMLLCSEVSAEEIKNAVFELAPDKAPGPDGFPPYFFQQ  309

Query  1087  SWA  1095
              W+
Sbjct  310   YWS  312



>gb|KHN25562.1| LINE-1 reverse transcriptase like [Glycine soja]
Length=1033

 Score =   255 bits (652),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 141/438 (32%), Positives = 241/438 (55%), Gaps = 11/438 (3%)
 Frame = +3

Query  1071  QLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVS  1250
             + + +F  T+K   ++F  +F   G  P G N + I L+P I +P  +N++R I L    
Sbjct  326   KFIKQFWNTIKPDFLRFLDEFHVNGIFPRGSNASFIALIPKILDPQTLNEYRPISLIGCM  385

Query  1251  YKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIK  1430
             YK+L K +  RLK  M  +I   Q++F+ GR + ++V+V  E +    +K  +   +V K
Sbjct  386   YKILAKILANRLKKVMPHIIHETQSAFIEGRHMLHSVVVANEAVEE--AKRCQKPCIVFK  443

Query  1431  IDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIR  1610
             +D EKAYD +SW F+   L++ GF   WI+ I  C+ ++ +++  +   +  F+ +RG+R
Sbjct  444   VDYEKAYDSVSWDFLIYMLRRMGFCSKWIQWIEGCLRSASVSVLVNGSPTAEFIPQRGLR  503

Query  1611  QGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLH  1790
             QGDPLSPLLF +  E L+ ++ Q+  NG ++G  +      ++ L + DD +FFGEA++ 
Sbjct  504   QGDPLSPLLFNIVAEALNGIVSQARANGLFRGFLVGSDKVEVNILQYADDTIFFGEATME  563

Query  1791  QASVVKKCLNEFCSLSGQRLSYMKS---*IFFSKNTSVEIQQAISSS-LGIPIVNDLGRY  1958
                 VK  L  F  +SG ++++ KS       S+   +E  + ++ S L  P V     Y
Sbjct  564   NVRAVKAILRVFEMVSGLKINFAKSGFGAFGMSEQWKIEAAEYLNCSLLSFPFV-----Y  618

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LGVP      +  ++  ++ + + +L  WK R LSF GR TLI++VL++IP Y      +
Sbjct  619   LGVPIGANPRRYQTWDPIIRKCERKLEKWKQRHLSFGGRVTLIKAVLTSIPIYFFSFFRV  678

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P+ V  +L  L R FLWG     +K   I W+ V   K+ G LG++ ++  N +L  K  
Sbjct  679   PKKVEDKLVSLQRRFLWGGDHEQKKIAWIKWETVCLPKEDGGLGVKEINSFNLSLLGKWK  738

Query  2319  WKLMNKEDGLCVKIMEAK  2372
             W+L +++  L  +++++K
Sbjct  739   WELFHQQGELWARVLQSK  756


 Score = 60.5 bits (145),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 125/300 (42%), Gaps = 20/300 (7%)
 Frame = +1

Query  247   LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVL--------HLP-MV  399
             L +   +  A T   GLS      ++LDR L +IEW  + P             H P M+
Sbjct  35    LTEKDLTAVAVTIGPGLSLCLRARSKLDRFLISIEWFNKWPATYQSKLQRNFSDHYPIML  94

Query  400   NSYHTLGESRRFRFNAAW*THPNYQE*VSSTWKS-------DVSLEANKSNLSKQLDDWN  558
              S +     + FR    W    ++QE V  +W S          L+     L  +L +WN
Sbjct  95    RSKYEDWGPKPFRILDCWLNDKSFQEMVQQSWNSVQFGGWGGYVLKEKIKALKGKLREWN  154

Query  559   KHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQ-EELLWF*RS  735
             +   G+ F++  ++   ++ ++   +  Q      + RK  +E   +  Q  E L   ++
Sbjct  155   REHFGDTFKKYQKIEDELNKLEEDTAGRQLTQHEVVTRKRLQEDLWVAAQSHESLLRQKA  214

Query  736   REEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSED  915
             R +WI  GD N+R++H      +  + ++ LK N G WI +   + E   AF+   F E 
Sbjct  215   RSKWIREGDCNSRYFHLMINATRRNNCLKGLKIN-GTWIEEPAIVKEAVRAFFSQRFQE-  272

Query  916   STTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDGFQTSFYQNSW  1092
             +T     L+   F  + + Q   +   F   +++ AV+     K+P  DG    F +  W
Sbjct  273   ATRIRPTLDGLRFQTIESYQNEMLVGRFQEDEVKRAVWNCGSDKSPGPDGINFKFIKQFW  332



>ref|XP_010513448.1| PREDICTED: uncharacterized protein LOC104789452 [Camelina sativa]
Length=1025

 Score =   275 bits (704),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 155/445 (35%), Positives = 244/445 (55%), Gaps = 1/445 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             K    VK+ L+   + FF  G      N T ICL+P +  P  + + R I LCNV YK++
Sbjct  185   KAWSIVKEDLVAMVNRFFVEGVFDKSLNRTHICLIPKVAKPTRMAEMRPISLCNVGYKII  244

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDL  1439
             +K +  RLK  +  LI   Q++FV GR I++N+L+ QE+ + LR + S KG  M IK D+
Sbjct  245   SKILCQRLKVVLPELISEMQSAFVPGRLISDNILIAQEMFHGLRKNPSCKGKFMAIKTDM  304

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+   FI + L K GF   WI  IM CV++    +  + + +   + ERG+RQGD
Sbjct  305   SKAYDRVERGFIEALLWKMGFGGTWISRIMFCVTSVEYKVLLNGQSNGRIVPERGLRQGD  364

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  E L   I ++ ++ Q  G+K+  K P I+HL FVDD +FF +    Q  
Sbjct  365   PLSPYLFILCKEVLVANIRRAERDKQIIGIKVANKCPPITHLLFVDDSLFFCKVDKAQCE  424

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
             V+   L ++ ++SGQ++++ KS I F       ++  +   LGI  +  +  YLG+P   
Sbjct  425   VILDILKQYEAVSGQQINFDKSSIQFGHKVDEAVRTELQGVLGISNLGGMCSYLGLPESL  484

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             G  K   ++ +  R+Q R TGW  + LS  G+  +I+SV +A+P + M    LP+ + S+
Sbjct  485   GGSKTKVFSFVRDRLQGRTTGWSAKLLSKVGKEVMIKSVATAVPTFVMSCFRLPKTITSK  544

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             L  +  +F W +S      + ++W K+  SK    LG +++D  N AL AK  W+L++  
Sbjct  545   LTSVVANFWWSASGQFGGMHWLAWDKLCCSKQTEGLGFRQVDDFNSALLAKQLWRLIDAP  604

Query  2340  DGLCVKIMEAKVQLPSLPSQACQMY  2414
             D L  +  + +    S P +  + Y
Sbjct  605   DTLFARAFKGRYYQNSNPMEPIRSY  629


 Score = 40.4 bits (93),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 36/135 (27%), Positives = 56/135 (41%), Gaps = 32/135 (24%)
 Frame = +1

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             EE+ W  +SR  W+  GD+NT                   KDN   W +  D I     +
Sbjct  80    EEIYWDQKSRNRWMRVGDKNT-------------------KDNV--WSTKDDDICNVAVS  118

Query  889   FYMDLFSEDSTTQLED-LNDAFFPPLHTSQWLAINAHFTVKDLE-----AVFEMAQFKAP  1050
             ++ +LF+       ED L +   P + T +   +N       +E     A+F M+  KAP
Sbjct  119   YFEELFTSIHPANFEDPLREV--PTVITDE---VNVSLMAPAMEMEIRKALFMMSPDKAP  173

Query  1051  SSDGFQTSFYQNSWA  1095
               DG    F+Q +W+
Sbjct  174   GLDGMTALFFQKAWS  188



>ref|XP_010672383.1| PREDICTED: uncharacterized protein LOC104888966 [Beta vulgaris 
subsp. vulgaris]
Length=1431

 Score =   287 bits (734),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 166/440 (38%), Positives = 237/440 (54%), Gaps = 4/440 (1%)
 Frame = +3

Query  1065  PNQLLPKFMGTVKDSLIKFASD----FFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSI  1232
             P+   P F   + D + K   +    +F    +P      VICL+P    P  V   R I
Sbjct  515   PDGFHPVFFQKMWDIVGKDVCENIRSWFYHRKVPQEMCQAVICLIPKQNPPETVKHLRPI  574

Query  1233  GLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKG  1412
              LCN  YK+ TK +  RLK  +   I P Q SF+ GR    N++V  E+L+S+  K GK 
Sbjct  575   SLCNTLYKLTTKVIVNRLKPLIPYWISPNQNSFIKGRGPDVNLVVATEILHSMNKKKGKW  634

Query  1413  GLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFM  1592
             G   +KIDLEKAYDR+ WSF+R+ LQ    +   I  IMSCVS S  +I  + R S  F 
Sbjct  635   GWFALKIDLEKAYDRIEWSFVRTCLQNLDLNDQSIDLIMSCVSQSSSSILMNGRRSNTFK  694

Query  1593  LERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFF  1772
               RG+RQGDP+SP LF + +E LSH+I Q+  +  W    + +    +SHL F DDL+ F
Sbjct  695   HSRGLRQGDPMSPYLFNICLESLSHMINQATIDKTWAPFWVGKDRVPVSHLMFADDLLIF  754

Query  1773  GEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLG  1952
             G         V++ L  FC +SGQ+++  KS + FS NTS E +     +L I    +LG
Sbjct  755   GRVDESTTFAVRETLRAFCEISGQKINESKSRLIFSPNTSTEHRSLFQQTLNIEENANLG  814

Query  1953  RYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSS  2132
              YLG+P  H R  ++    ++ +++ +L  WK + LS  GR  LI S LS IP Y MQ+ 
Sbjct  815   TYLGLPLSHKRPSKNQVQFVVDKVKKKLANWKTKYLSRAGRLCLISSTLSTIPAYYMQAM  874

Query  2133  LLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAK  2312
              LP   L  L+R+  +FLWG  +  ++ +L+  ++    K  G LG++    MN+A  AK
Sbjct  875   ALPAATLKDLDRVCNNFLWGDVENQKRIHLVGMERTFRPKTMGGLGVRNQTLMNKAYMAK  934

Query  2313  LGWKLMNKEDGLCVKIMEAK  2372
             LGWKL    + L  K + +K
Sbjct  935   LGWKLSQGPENLAQKCITSK  954


 Score = 87.0 bits (214),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 107/201 (53%), Gaps = 21/201 (10%)
 Frame = +1

Query  514   EANKSNLSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkld-likldrklrrel  690
             E++ S+L+    DWN +T GN+++RK +VLAR+ G Q++L      + L +L++ L+ EL
Sbjct  340   ESSISDLAVGAADWNINTFGNVYKRKRKVLARLHGAQKALHDKPYSNFLHELEKDLQNEL  399

Query  691   deilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGI  870
              +IL QEE LW  +++ E I  G+RNTRF+H +  ++++AS +  L++  G  I D D +
Sbjct  400   IQILMQEEALWAAKNKSERIREGERNTRFFHRSVMIKRNASRIFSLRNEVGLDIHDPDQL  459

Query  871   LEPFHAFYMDLFSED------STTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLEAVF-E  1029
                   F+  L+S +       T     L D  +PP             + +++ A   +
Sbjct  460   RSHVQCFFESLYSTEHKKCDWGTNASRGLIDIAYPP-------------SDEEIRASLKQ  506

Query  1030  MAQFKAPSSDGFQTSFYQNSW  1092
             M   KAP  DGF   F+Q  W
Sbjct  507   MKPIKAPGPDGFHPVFFQKMW  527



>ref|XP_008801646.1| PREDICTED: uncharacterized protein LOC103715697 [Phoenix dactylifera]
Length=1203

 Score =   284 bits (727),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 156/437 (36%), Positives = 235/437 (54%), Gaps = 0/437 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP     ++   V   +I+    FF T  + +    T + L+P   +P     +R I LC
Sbjct  314   FPPVFFRRYWMLVGQDVIEAIQQFFHTAAMSSDWQRTFVALIPKRQDPTEPGHYRPISLC  373

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLM  1421
             +  YK   K + +RL+  +  LI P Q +FV GR IT+NVL+ QE +  L     +  LM
Sbjct  374   STLYKATAKILAVRLRDILPRLISPEQGAFVAGRSITDNVLIAQEFMYDLGRAPRRRSLM  433

Query  1422  VIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLER  1601
              IK+D+E+AYDRLSW F++ + Q  GF   WIR +M CV     AI  +   S +F    
Sbjct  434   GIKLDMERAYDRLSWDFVQHSFQSFGFHETWIRWVMGCVRGPSFAILVNGTPSHFFESSV  493

Query  1602  GIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEA  1781
             G+RQG PLSPLLF+   + LS  +  +  + Q +  +  R    ISHL F DD +   +A
Sbjct  494   GLRQGCPLSPLLFITCADSLSRALRGASDSQQLEAYRPARGTRPISHLLFADDSLLLAQA  553

Query  1782  SLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYL  1961
             +   A V++  + ++C+ SGQR+++ K+ I F      +++ AI   LG+   +   RYL
Sbjct  554   TRQAAQVIRSIVFDYCAASGQRVNFAKTTIHFCPKIIPQVKAAIMEILGVRQQDSGLRYL  613

Query  1962  GVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLP  2141
             GVP    RL++     L +  + RL GW+  TLS  GR TL ++VLS+IP Y M SS+LP
Sbjct  614   GVPITGRRLRRGDCLSLETSFRHRLEGWQTHTLSMMGRVTLARTVLSSIPIYLMSSSILP  673

Query  2142  QGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGW  2321
               +L  LERL RDF+WG        +L++W+ V +   QG LG+  L    +AL  +   
Sbjct  674   VALLRSLERLIRDFIWGRRGDRGGIHLMAWEVVCQPIRQGGLGVTSLTLRQEALAMRHAA  733

Query  2322  KLMNKEDGLCVKIMEAK  2372
             + + + D +C  +M AK
Sbjct  734   RFLLEPDSMCSSLMRAK  750


 Score =   116 bits (291),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 92/314 (29%), Positives = 145/314 (46%), Gaps = 28/314 (9%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             FQ++I   GLIDLG+ GP YTW            RLDRA    EW    P+  V HLP +
Sbjct  15    FQEFITVNGLIDLGFVGPRYTWCNNQQGSARVWERLDRAFATAEWIQEFPEYRVNHLPRI  74

Query  400   NSYH---------TLGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEA------NKSNL  534
              S H         ++     FRF   W  +P   E VS  W   V  +A           
Sbjct  75    ASDHSPILVSTEISIPYRCPFRFEKFWCCYPRSWEVVSEAWGMPVRGDAMYRVSRRLELT  134

Query  535   SKQLDDWNKHTIGNIFRRK*RVLARISGV--QRSLSVYQkldlikldrklrreldeilYQ  708
              ++L  WN+  +GNIFRR   +   I+ +  Q +L        +   R L    D +L Q
Sbjct  135   RRRLIRWNREEVGNIFRRIEEIEEAITRLQSQEALRGGLLAGEMTELRSLLSLHDSLLRQ  194

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             +E+ W  +SR +WI+ GDRNT+F++ +T +R+  + +R ++++ G+   + D I+     
Sbjct  195   QEIFWRQKSRVQWILEGDRNTKFFYRSTLIRRQRNKIRIIREDDGQLTEEPDRIIRVVEQ  254

Query  889   FYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL------EAVFEMAQFKAP  1050
             F+   ++E + + +    D   P +  S   A      ++ +      EAV+ +A  KAP
Sbjct  255   FFRARWTEQTGSGIS--TDLPLPSVGVS---AEETSVLIRPVSGREIQEAVWSLAGDKAP  309

Query  1051  SSDGFQTSFYQNSW  1092
               DGF   F++  W
Sbjct  310   GPDGFPPVFFRRYW  323



>ref|XP_004296207.1| PREDICTED: uncharacterized protein LOC101297422 [Fragaria vesca 
subsp. vesca]
Length=1096

 Score =   261 bits (667),  Expect(3) = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/404 (35%), Positives = 231/404 (57%), Gaps = 1/404 (0%)
 Frame = +3

Query  1164  NDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGR  1343
             N T + L+P +  P  + Q R I LCNV YK+ +K +   LK  +  +I PFQ++FV GR
Sbjct  250   NCTWVTLIPKVKKPENMQQLRPISLCNVIYKIGSKLLANSLKPLLDSIISPFQSAFVPGR  309

Query  1344  QITNNVLVYQEVLNSLRSKS-GKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIR  1520
              I++N L+  E+ + L+ +  GK G   +K+D+ KAYDR+ W F+   L K GF  +W R
Sbjct  310   LISDNSLLAFEISHCLKKRRRGKVGYGALKLDMNKAYDRVEWRFLEVMLIKLGFCMEWTR  369

Query  1521  NIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQW  1700
              I+ CV T   +   +       +  RG+RQGD +SP LFV+Y E LS  +  +  + + 
Sbjct  370   MILRCVRTVSYSFIINGDPVGQVVPSRGLRQGDAISPYLFVIYAEFLSRQLVSAEGDDEI  429

Query  1701  KGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFS  1880
             +G+++    P ISHL F DD   F +A       V   L+ + +LS Q++S  KS I FS
Sbjct  430   QGVRVCTGAPTISHLLFADDSFIFFKAEERGCRKVGSILSRYETLSRQQVSLAKSKIAFS  489

Query  1881  KNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTL  2060
             +N     Q  +++ LG+  V    +YLG+P+     K+ +++ L  RI+ R  GW+++TL
Sbjct  490   QNVPRWKQDELAAVLGVKRVEKHKKYLGLPTELSYSKEKAFSFLCERIRKRTQGWRDKTL  549

Query  2061  SFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKV  2240
             +  G+  LI++V+ +IP Y M    LP+ + S ++RL   F WG    +RK + ++W+K+
Sbjct  550   TIAGKEVLIKAVVQSIPTYIMSCFELPKHMCSAMQRLMARFWWGDKGDDRKIHWVAWEKL  609

Query  2241  TESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
               +K +G LG + +   N AL AK GW+L+ + + L  ++++A+
Sbjct  610   CTTKAEGGLGFRDMRLFNMALLAKQGWRLIRQPNSLLAQVLKAR  653


 Score = 45.8 bits (107),  Expect(3) = 1e-75, Method: Compositional matrix adjust.
 Identities = 32/130 (25%), Positives = 54/130 (42%), Gaps = 28/130 (22%)
 Frame = +1

Query  706   QEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFH  885
             +E+  W  RSR  W+  GD NT+++H   + R+  +T+R L ++ G  + D DG+     
Sbjct  123   KEQAFWQQRSRVLWLAEGDLNTKYFHQKASNRRKKNTLRGLYNSDGVGLEDLDGV-----  177

Query  886   AFYMDLFSEDSTTQLEDLNDAFFPPLHTSQ-WLAINAHFTVKDLEAVFEMAQFKAPSSDG  1062
                            E++N +    +   + W A+             ++   KAP  DG
Sbjct  178   ----------PRVITEEVNQSLMREVTAEEVWRALK------------QIHPSKAPGPDG  215

Query  1063  FQTSFYQNSW  1092
                 FYQ  W
Sbjct  216   LSPMFYQQFW  225


 Score = 28.9 bits (63),  Expect(3) = 1e-75, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 0/38 (0%)
 Frame = +2

Query  2399  GMSNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             G S  W+ ILK   +L KG +  V N  S   W D WI
Sbjct  668   GCSFTWRSILKGRDLLKKGLRFQVGNGESISVWDDPWI  705



>ref|XP_007210729.1| hypothetical protein PRUPE_ppa021798mg [Prunus persica]
 gb|EMJ11928.1| hypothetical protein PRUPE_ppa021798mg [Prunus persica]
Length=1171

 Score =   222 bits (565),  Expect(3) = 1e-75, Method: Compositional matrix adjust.
 Identities = 140/406 (34%), Positives = 215/406 (53%), Gaps = 32/406 (8%)
 Frame = +3

Query  1164  NDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGR  1343
             N T I  +P + +P  VN FR I  CNVSYK++TK +  RL+  +   I   Q +F  GR
Sbjct  507   NHTNIAFIPKVASPESVNHFRPISFCNVSYKIITKIIVSRLRPILAKSISKNQGAFAPGR  566

Query  1344  QITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRN  1523
              I +N+L+  E+ +  + K+G  G M IKIDLEKAYD L W +IR  L + GFS D+   
Sbjct  567   SIFDNILITHELFHDFKHKNGSRGAMAIKIDLEKAYDLLDWKYIRGCLNQFGFSNDY---  623

Query  1524  IMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVE---RLSHLIEQSVKNG  1694
                    +  ++  +      F   RGIRQGDPLSP +F+L +E   R  +L+ Q+ K  
Sbjct  624   -------TSFSMLINGSPYGHFKASRGIRQGDPLSPYIFILCMEPFIRHFNLLAQNSKTH  676

Query  1695  QWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IF  1874
                G+  ++ G  IS+L F DD + F +++   A  +   L+ F  +SGQR++  KS ++
Sbjct  677   V--GLLSSQGGDRISNLVFADDCLIFAKSTAMAARNINCLLDNFAKVSGQRINLHKSTVY  734

Query  1875  FSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNR  2054
             FS N   + + A+S+ L I     LGRYLG+ +I       +   ++ RI+++  GWK +
Sbjct  735   FSGNVHSQARNALSNLLQIQHKTTLGRYLGIHNIIFWKDPANAKMMIDRIRSKFAGWKAQ  794

Query  2055  TLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLISWK  2234
             TLS  GR TLI++ ++++P +T          LS  +R    F WG+S    K   ++WK
Sbjct  795   TLSRAGRLTLIKASVTSVPNHT----------LSCFKR----FFWGNSI---KVPPVAWK  837

Query  2235  KVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
              +   +  G LG++     N+   AKLGW  +        +IM  K
Sbjct  838   DICLPQSLGGLGVRSAALFNKTALAKLGWICLTDSSNWWAQIMLKK  883


 Score = 81.3 bits (199),  Expect(3) = 1e-75, Method: Compositional matrix adjust.
 Identities = 73/301 (24%), Positives = 117/301 (39%), Gaps = 88/301 (29%)
 Frame = +1

Query  247   LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYH-----  411
             ++ L  +G  +TW  G         RLDRAL N +W    P  E+ +LP+V S H     
Sbjct  263   VVSLAATGVPFTWCNGHHDNTIIYERLDRALANPDWMRLLPHSELQNLPIVRSDHGPIFL  322

Query  412   -TLGESRR----FRFNAAW*THPNYQE*VSSTWKSDV------SLEANKSNLSKQLDDWN  558
                  SRR    F+F A W  H N+ + VS  W           ++   +    QL +WN
Sbjct  323   KCNQISRRIPKTFKFEAMWLAHKNFDQVVSQVWNCSYVGNAAQQIQTCCNTFKHQLKNWN  382

Query  559   KHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLWF*RSR  738
             +   G++F +      RI+  Q +L                         EE+ +  ++R
Sbjct  383   RSVFGDLFHK-----LRIT--QENL-------------------------EEVFYARKAR  410

Query  739   EEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDLFSEDS  918
               W+  GD+NT+++H    +R+  + + R++D           ++EP             
Sbjct  411   ANWLQLGDKNTKYFHTQALIRRKRNQILRVRD---------LNVIEP------------C  449

Query  919   TTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE---AVFEMAQFKAPSSDGFQTSFYQNS  1089
              T L+  N+    P              + DLE   A+  +   K+P  DG Q  FYQ  
Sbjct  450   VTSLD--NENLLAP--------------ISDLELECALKSIGPLKSPGPDGLQAIFYQKC  493

Query  1090  W  1092
             W
Sbjct  494   W  494


 Score = 32.3 bits (72),  Expect(3) = 1e-75, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +2

Query  2393  KSGMSNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             K+  S+ WK IL++  +L KG + +V N +S  FW  +W+
Sbjct  896   KTSHSSTWKAILEARYVLHKGIRWIVGNGQSIPFWTANWV  935



>ref|NP_001174443.1| Os05g0434000 [Oryza sativa Japonica Group]
 dbj|BAH93171.1| Os05g0434000 [Oryza sativa Japonica Group]
Length=1478

 Score =   236 bits (603),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/355 (35%), Positives = 199/355 (56%), Gaps = 1/355 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
              P     KF+    D +        + G +P G NDTV+ L+P    P  +   R I LC
Sbjct  799   IPAIFYKKFLSLAGDKVKDEVLAVLNGGDMPQGWNDTVVVLIPKTKQPDTLKDLRPISLC  858

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSL-RSKSGKGGL  1418
             NV+YK+++K +  RLK  +  +I P Q++FV  R IT NVL+  E+ + L + K GK G+
Sbjct  859   NVAYKLISKVIVNRLKVVLLEIISPSQSAFVPRRLITYNVLLAYELTHYLNQRKKGKNGV  918

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
               IK+D+ KAYDR+ W F+R  + + GF   W+  +M CV++    I  +   S     +
Sbjct  919   AAIKLDMSKAYDRVEWDFLRHMMLRLGFHDQWVNLVMKCVTSVTYRIKINGEHSDQIYPQ  978

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP LF++  E LS L++++  +G+ +G+K+ R  P I+HLFF DD +    
Sbjct  979   RGLRQGDPLSPYLFIICAEGLSALLQKAQADGKIEGIKVCRDTPRINHLFFADDSLVLMR  1038

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A  + A  +++ LN +   SGQ ++  KS + FS NT    +  + S+L I       RY
Sbjct  1039  AGQNDAQELRRVLNIYEVASGQVINKDKSSVLFSPNTLQSDRMEVRSALCINQEAKNERY  1098

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTM  2123
             LG+P   G+ ++ ++  +  ++  R+ GW+ + LS  G+  L+++V  AIP Y M
Sbjct  1099  LGLPVSIGKSRRKAFEYIKRKVWLRIQGWQEKLLSKAGKEILVKAVAQAIPTYAM  1153


 Score = 77.8 bits (190),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 139/306 (45%), Gaps = 34/306 (11%)
 Frame = +1

Query  247   LIDLGYSGPAYTWM--QGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYHT--  414
             L DLG+ G A+TW     L+S N+   RLDRA+ N  W+ R P V V++    +S H   
Sbjct  509   LHDLGFVGDAFTWRNHHHLAS-NYIKERLDRAVANGAWRARFPLVRVINGDPRHSDHRSV  567

Query  415   ---LGESRRF----------RFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLS------  537
                 G + +           +F A W      Q  V   W++  +LE  ++ L       
Sbjct  568   IVETGATEKQQWGQPLEIMQKFEARWLEEEECQARVEEAWEN--ALEGGQTRLMEIQSRV  625

Query  538   -KQLDDWNKHTIGNIFRRK*RVLARISGVQRS-LSVYQkldlikldrklrreldeilYQE  711
              K+L  W++  +G + +R   +   +   +R  +S  Q      L  KL R LD    Q+
Sbjct  626   LKELWAWDRTVLGELKKRVKNLRKELEKCRREPISNRQVNREHLLRYKLERLLD----QQ  681

Query  712   ELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAF  891
              + W  R+   W+  GDRNT+F+HA  + +K  +T+++L+D  G  ++ G+ +       
Sbjct  682   HIYWKQRAHSTWLTKGDRNTKFFHAQASEKKKRNTIQKLQDGHGGLVA-GNQLKSFISNQ  740

Query  892   YMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGFQ  1068
             Y  LF  +  +Q++ +       +       + A +  +++  A+ +M   KAP +DG  
Sbjct  741   YQQLFRSNGCSQMDAVLQCVQARVTPEMREGLAAPYQREEVWVALKDMGDLKAPGADGIP  800

Query  1069  TSFYQN  1086
               FY+ 
Sbjct  801   AIFYKK  806



>emb|CAN81579.1| hypothetical protein VITISV_023185 [Vitis vinifera]
Length=1232

 Score =   244 bits (622),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 147/428 (34%), Positives = 231/428 (54%), Gaps = 7/428 (2%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
              K+ +++   +F          N+T + L+P       +  FR I L    YK+L K + 
Sbjct  351   AKEEIMEMFKEFHEHNSFVKSLNNTFLVLIPKKSGAENLGDFRPISLVGGLYKLLAKVLA  410

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
              RLK  +  ++   Q +FV+GRQI +  L+  EV++S + K  KG  +V K+D+EKAYD 
Sbjct  411   NRLKKVIGKVVSYAQNAFVMGRQILDASLIANEVIDSWQKKKEKG--LVCKLDIEKAYDS  468

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             ++W+F+   L+K GF   W+R + SCVS+++ +I  +   + +F   RG+RQGDPLSP L
Sbjct  469   INWNFLMKVLKKMGFGTKWMRWMWSCVSSAKFSILVNGVPAGFFPSTRGLRQGDPLSPYL  528

Query  1638  FVLYVERLSHLIEQSVKNGQWKGMKI---TRKGPCISHLFFVDDLVFFGEASLHQASVVK  1808
             FV+ +E L  LI ++V+ G   G  I   +R    ISHLFF DD + F EAS  Q S + 
Sbjct  529   FVMGMEVLDVLIRRAVEGGYLSGCNIRGGSRTSLNISHLFFADDTIVFCEASKEQVSHLS  588

Query  1809  KCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRL  1988
               L  F + SG R++  KS I       VE    +++ LG  + +    YLG+P      
Sbjct  589   WILFWFEAASGLRINLAKSEII--PIGEVEDSLELAAELGCRVGSLPSHYLGLPLGVPNR  646

Query  1989  KQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLER  2168
                 +  +  RI+ RL  WK + +S  GR TLI+S L+++P Y M    +P+ V  R+E+
Sbjct  647   ATSMWDGVEERIRRRLALWKRQYISKGGRITLIKSTLASLPTYQMSIFRMPKXVAKRVEK  706

Query  2169  LSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGL  2348
               RDFLWG      K +L+ W  V   K +G LG++R+  +N+AL  K  W+   +++  
Sbjct  707   TQRDFLWGGGNLEGKVHLVKWDAVCTEKHKGGLGLRRIATLNRALLGKWIWRFACEKNNF  766

Query  2349  CVKIMEAK  2372
               +++  K
Sbjct  767   WNQVITTK  774


 Score = 70.1 bits (170),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 80/310 (26%), Positives = 132/310 (43%), Gaps = 42/310 (14%)
 Frame = +1

Query  247   LIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEW----------KIRSPDVEVLHLPM  396
             L+DL   G  +TW  GL++  +  ARLDR L +  W          ++  P  +  H P+
Sbjct  53    LVDLPLQGGEFTWSGGLNNQAW--ARLDRFLVSPSWLDQFSGVTQGRLSRPTSD--HFPI  108

Query  397   VNSYHTLGESRR----FRFNAAW*THPNYQE*VSSTWKSDVSLEANKS--------NLSK  540
             V      G  RR    FRF   W     + + +  TW  ++ +  + S         + K
Sbjct  109   VLEG---GGVRRGPTPFRFENMWLKVEGFND-IIRTWWQEIEVRGSASYRLAVKMKEIKK  164

Query  541   QLDDWNKHTIGNIFRRK*RVLARIS-----GVQRSLSVYQkldlikldrklrreldeilY  705
             +L  WNK   G +   K   L ++        +R LS+ +     +     ++ +     
Sbjct  165   KLKVWNKEVFGRLETNKASALXQLDFWDRVESERILSMEEAELKKEAKDSFKKWVLL---  221

Query  706   QEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFH  885
              EE  W   SRE W+  GDRNT F+H   +  +  + + R+K N GEW+ +   + E   
Sbjct  222   -EEAHWRQHSREIWLKDGDRNTGFFHRMASAHRRNNAMDRIKVN-GEWLVEEQEVREGVV  279

Query  886   AFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-AVFEMAQFKAPSSDG  1062
               +  L SED   Q  D+       +   +  ++   F   ++  A+ EM   K+P  DG
Sbjct  280   NSFQQLLSEDMGWQ-ADIGSIQVNCISQQEAESLETPFAETEIHSALMEMNGDKSPGPDG  338

Query  1063  FQTSFYQNSW  1092
             F  +F+QN+W
Sbjct  339   FTVAFWQNAW  348


 Score = 84.7 bits (208),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 64/108 (59%), Gaps = 0/108 (0%)
 Frame = +3

Query  2001  YADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRD  2180
             +  ++ RI  RL GW+   LSF GR TLIQS L+ +PCY +    +P  V +++ERL RD
Sbjct  1061  WDPVIERILRRLDGWQKTYLSFGGRITLIQSCLTHMPCYFLSLFKIPASVATKIERLQRD  1120

Query  2181  FLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWK  2324
             FLW      ++ +L++W  V +SK +G LG  ++   N AL  K  W+
Sbjct  1121  FLWSGVGEGKRDHLVNWDVVCKSKARGGLGFGKIVLRNVALLGKWLWR  1168



>ref|XP_010667378.1| PREDICTED: uncharacterized protein LOC104884431 [Beta vulgaris 
subsp. vulgaris]
Length=1243

 Score =   284 bits (726),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 148/431 (34%), Positives = 239/431 (55%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             +F   + D +  +  +     H P   N T I L+P + +P +  +FR I LCNV YK++
Sbjct  351   RFWHIIGDEVSDYVCNILHGHHFPADLNRTNIALIPKVKDPKVAAEFRPIALCNVLYKLI  410

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKS-GKGGLMVIKIDL  1439
             +KA+ LRLK  +  ++   Q++FV GR IT+N L+  EV +S++ ++  + G + +K+D+
Sbjct  411   SKAIVLRLKDFLPAIVTENQSAFVPGRLITDNALIAMEVFHSMKHRNRSRRGTIAMKLDM  470

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W F+R  L   GF   W+  IM CVS+   +   +  +    + ERG+RQGD
Sbjct  471   SKAYDRVEWGFLRKMLLTMGFDGRWVNLIMCCVSSVSYSFIINGGVRGSVVPERGLRQGD  530

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP LF+L  +  S +I++  +     G K +R GP I HL F DD + F  A+  +  
Sbjct  531   PLSPYLFILVADVFSKMIQRKTQEKLIHGAKASRSGPEIFHLLFADDSLLFTRATRQECF  590

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              +   LN +   SGQ+++Y KS + FSK  S+  +  +   L +  V    +YLG+PSI 
Sbjct  591   EIVDTLNRYELASGQKINYEKSEVSFSKGVSIAQKVELMGILKMRQVEKHEKYLGIPSIT  650

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
             GR K+  +  L+ RI  +L GWK + LS  G+  L+++V+ A+P Y M    +P  ++ +
Sbjct  651   GRSKKLMFDSLLDRIWKKLQGWKEKLLSRAGKEVLLKAVIQAVPTYLMGVYKIPATIIQK  710

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             ++     F WGSS   RK +  +W+ +   K  G +G + L   N AL  +  W+L+N  
Sbjct  711   IQAAMARFWWGSSDAKRKIHWKNWEAMCTLKCLGGMGFKDLTVFNDALLGRQAWRLINAP  770

Query  2340  DGLCVKIMEAK  2372
               L  ++M+AK
Sbjct  771   HSLLGRVMKAK  781



>ref|XP_009113456.1| PREDICTED: uncharacterized protein LOC103838755 [Brassica rapa]
Length=1143

 Score =   244 bits (623),  Expect(3) = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/438 (33%), Positives = 218/438 (50%), Gaps = 51/438 (12%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             KF   VK+ L +  + F   G + +G NDT ICL+P    P  + QFR I LCNVSYK++
Sbjct  187   KFWDIVKEDLTRMVNQFLFEGTVTSGLNDTNICLIPKTTRPNEMAQFRPISLCNVSYKII  246

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSK-SGKGGLMVIKIDL  1439
             +K +  RLK  +  LI   Q++FV GRQI++N+++ QE+ ++LR+K SG+   M IK D+
Sbjct  247   SKVLCQRLKKVLPGLISETQSAFVAGRQISDNIMIAQEMFHALRTKPSGRNKRMAIKTDM  306

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ WSFI + ++K GFS  WI  IM C+++ +  +  +       +  RG+RQGD
Sbjct  307   SKAYDRMEWSFIEAVMRKMGFSETWITWIMRCITSVKYKVLMNGEPRGNIVPGRGLRQGD  366

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             PLSP +F+L  E L  L+  +   G+  GM++TR  P                       
Sbjct  367   PLSPFIFILCTEALVSLLNHAEIQGKITGMRVTRACP-----------------------  403

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
                                           +V ++Q +   LGI     +G YLG+P   
Sbjct  404   ---------------------------SRINVAMRQELKDVLGIQNEGGMGTYLGIPEDI  436

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
                K   +A L  ++  R+ GW  R LS  G+  LI+S+L A+P Y M + LLP  +   
Sbjct  437   SGSKCKLFAFLKEKLMHRVNGWTGRWLSKGGKEVLIKSILLALPTYVMSTFLLPLEICEN  496

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             L      F W S+   R  +   W+KV   +++G +G + +   N AL AK  W+L+   
Sbjct  497   LASAIAQFWWSSNPPKRGIHWAKWEKVCLPREEGGIGFRMIHEFNLALLAKQLWRLVQFP  556

Query  2340  DGLCVKIMEAKVQLPSLP  2393
             D L  +++  +    S P
Sbjct  557   DSLVARVLRGRYYRLSSP  574


 Score = 68.9 bits (167),  Expect(3) = 2e-75, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 69/133 (52%), Gaps = 9/133 (7%)
 Frame = +1

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             EEL W  +SR  W+  GD+NT+F+HA T  R++ + + +L D  G  + D +G++    +
Sbjct  61    EELFWKQKSRVFWLREGDKNTKFFHALTKQRRARNKITQLLDENGNAVEDEEGLVAIATS  120

Query  889   FYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE-----AVFEMAQFKAPS  1053
             ++  +F    ++  ED+ DA    + TS   A+N + T    E     A+F M   KAP 
Sbjct  121   YFRQIF---ESSNPEDIEDA-LSQVSTSITGAMNDNLTAPVSEWEIKLALFAMHPEKAPG  176

Query  1054  SDGFQTSFYQNSW  1092
              DG    FYQ  W
Sbjct  177   PDGMTALFYQKFW  189


 Score = 21.9 bits (45),  Expect(3) = 2e-75, Method: Compositional matrix adjust.
 Identities = 10/36 (28%), Positives = 17/36 (47%), Gaps = 0/36 (0%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSKKLVKNDRSTLFWLDSWI  2512
             S VW  I  +  +LL G ++ + +      W D W+
Sbjct  584   SYVWTSISAARKLLLLGIRQKIHSGHEVKVWEDPWV  619



>ref|XP_008390125.1| PREDICTED: uncharacterized protein LOC103452416 [Malus domestica]
Length=1072

 Score =   232 bits (591),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/355 (35%), Positives = 198/355 (56%), Gaps = 22/355 (6%)
 Frame = +3

Query  1164  NDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGR  1343
             N T I L+P +P+P  V+Q+R I LCN S+K+L+K +  RL+  + +LI P Q +F+  R
Sbjct  488   NSTYIVLIPKVPHPESVSQYRPISLCNFSFKILSKVLANRLQPLLPLLISPMQNAFIADR  547

Query  1344  QITNNVLVYQEVLNSLR-SKSGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIR  1520
              I  N+ +  E+ + L+  KS +   M +K+D++KA  R+ W F+ + L K GF   W  
Sbjct  548   XIXENLGLAHELFHFLKLRKSQQKFEMCVKLDMQKAXXRVEWDFLEAVLLKLGFCRGWTN  607

Query  1521  NIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQW  1700
              +M+CV T   AI  + +   WF   RG+RQGD LS  LF++  + LS  I++ V++G+ 
Sbjct  608   LVMNCVRTVXFAILLNGQPGNWFSPSRGLRQGDXLSXYLFLMVSDVLSRSIQRGVEDGRL  667

Query  1701  KGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFS  1880
              G+ +  +GP ISHLFF DD +   +A+L     +   LN++C  SGQ ++  KS ++F 
Sbjct  668   GGILMHPRGPSISHLFFADDTLICLQANLRNGENIMHILNKYCLASGQMMNSHKSSVYFG  727

Query  1881  KNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTL  2060
             +NT  +++  + S LG+P+V+D G YLG+P+I GR K+ S A +  R+ A          
Sbjct  728   RNTPDQVRSQLGSLLGMPVVSDPGVYLGLPAIWGRSKRSSLAFVKGRVMA----------  777

Query  2061  SFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCNLI  2225
                        V+ AIP Y M     P  V   L+ +   FLWG   G ++ + I
Sbjct  778   -----------VVQAIPTYPMNLFKFPAAVCKDLDSMXAGFLWGDCGGXKRIHWI  821


 Score = 81.6 bits (200),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 84/306 (27%), Positives = 122/306 (40%), Gaps = 35/306 (11%)
 Frame = +1

Query  244   GLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMVNSYH----  411
              L+DLG++GP +TW +G    N    RLDRA  N+ W+   P   V H   + S H    
Sbjct  170   ALVDLGFNGPKFTW-RGRXYGNLVEERLDRAAANVLWQNLWPHTXVXHXTALCSDHCPIV  228

Query  412   ------TLGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNLSKQLDDWN-----  558
                   T    R FRF A W    + +  V+  W S            + +D WN     
Sbjct  229   VLSQPATRRGKRLFRFEAFWAKEEDCRALVAKCWGS--------PGRGRWIDXWNLKLSI  280

Query  559   --KHTIG---NIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEELLW  723
                H I    N F R+   +  +     SL  +   D  +    +   +D++  Q EL W
Sbjct  281   CKSHLISXSRNKFNRRGLEIEELVQQLDSLQ-HHWEDNAEEIHVVSNRIDQLREQXELYW  339

Query  724   F*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYMDL  903
               RSR  W   GD NT F+H  T  R+  +++ +LKD  G W+ D   +          L
Sbjct  340   MQRSRVNWXREGDANTAFFHRTTLQRRRVNSIVKLKDVDGSWVDDSRRVPXLVXEHXKSL  399

Query  904   FSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKDLE---AVFEMAQFKAPSSDGFQTS  1074
              +        D+ +   P    S+ +  +    V + E   AV +M   KA   DGFQ  
Sbjct  400   XTSVGCRDWGDILNCLEP--LVSELMNNDLIKPVSEEEIKVAVHQMGGLKAXGPDGFQGI  457

Query  1075  FYQNSW  1092
             FY   W
Sbjct  458   FYHXFW  463



>gb|EPS64876.1| hypothetical protein M569_09903, partial [Genlisea aurea]
Length=842

 Score =   219 bits (557),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/411 (33%), Positives = 214/411 (52%), Gaps = 43/411 (10%)
 Frame = +3

Query  1143  GHLPNG-CNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMTLRLKSAMRMLIGPF  1319
             GH   G  N T I L+P +  P  V+QFR I LCNV YK+ +K +  RLK  M  LI   
Sbjct  325   GHQMEGDLNHTHIILIPKVSRPEAVHQFRPISLCNVLYKIASKMVANRLKPIMDSLITEE  384

Query  1320  QTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDRLSWSFIRSTLQKAG  1499
             Q++F+ GR I +NVL+  E+ +SLR ++       +K+D+ KAYDRL WSFIR  L+   
Sbjct  385   QSAFLPGRAIADNVLMAFEINHSLR-RNQSSIFGSLKLDVSKAYDRLEWSFIREVLESMA  443

Query  1500  FSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLLFVLYVERLSHLIEQ  1679
             F   +I  +M  +S+   ++  +   +  F   RGIRQGDPLSP LF+L  + LS +++ 
Sbjct  444   FPARFIDLVMLLISSVTYSVLVNGSTAGRFAPTRGIRQGDPLSPYLFILCADTLSAMLKT  503

Query  1680  SVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKKCLNEFCSLSGQRLSYM  1859
             +       G++I    P ISHL F DD + +  A+L    ++K  L  + + SGQ ++  
Sbjct  504   AASGSPDIGVQIAPGAPRISHLLFADDTIIYVRATLASMCLIKSVLASYEAASGQVINLE  563

Query  1860  KS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQDSYADLMSRIQARLT  2039
             KS +  S+      +  ++ ++GIP+   L                              
Sbjct  564   KSLLILSRGGDEHHRHLLAETVGIPLAPGL------------------------------  593

Query  2040  GWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLSRDFLWGSSKGNRKCN  2219
                       GR+ LI++VL AIP ++M   LLP+  L++L      F W S  G +K +
Sbjct  594   ----------GRAVLIKAVLQAIPVFSMSCFLLPKTFLAKLMGTIARFWW-SGNGAKKLH  642

Query  2220  LISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCVKIMEAK  2372
              + W+++T +   G +G + L   N+AL AK GW+L+++ + LC ++++AK
Sbjct  643   WLPWEQLTSNLAAGGMGFRDLCLFNKALVAKQGWRLVSRPNSLCGRLLKAK  693


 Score = 94.4 bits (233),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 87/310 (28%), Positives = 135/310 (44%), Gaps = 27/310 (9%)
 Frame = +1

Query  235   FREGLID-----LGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIRSPDVEVLHLPMV  399
             FR+ L+D     L + G  +TW     +P+   ARLDRA+ +  W    P+   +HLP  
Sbjct  4     FRQALMDCELRDLPHCGHPFTWTNKRKAPHTVCARLDRAVDSSSWLQLFPNTRTMHLPFG  63

Query  400   NSYH---------------TLGESRRFRFNAAW*THPNYQE*VSSTWKSDVSLEANKSNL  534
              S H               + G +RRFRF A W   P  +  +   W    +L+    + 
Sbjct  64    GSDHAPLWVQFSHASPPAKSFG-ARRFRFEARWMMLPGCETTIRGAWSHQQNLQRKLGST  122

Query  535   SKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQEE  714
                L  W +H I  +     +V A ++ +  S         I  +  L+ EL  +L+QEE
Sbjct  123   RISLLKWYQHQIVPLKTNIKKVEAELARLAVS---PVDDSSIARETLLKAELTALLHQEE  179

Query  715   LLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFY  894
             L W   S+  W+  GDRNT ++HA  + RK  + +  + D+ G   S    I   F  ++
Sbjct  180   LFWKQISKVHWLAKGDRNTAYFHACASARKDFNHISSITDSDGVRHSAPREIHTAFAVYF  239

Query  895   MDLFSEDSTTQLEDLND--AFFPPLHTSQWLAINAHFTVKDL-EAVFEMAQFKAPSSDGF  1065
               LFS    +Q   L+   A    L  +    ++A FT +++  A+  M    AP  DGF
Sbjct  240   SGLFSLSHPSQESILSSTRAITSRLSEAMRDRLSAPFTSEEIWPALKSMKALSAPGPDGF  299

Query  1066  QTSFYQNSWA  1095
                F+Q  WA
Sbjct  300   SPVFFQRYWA  309



>ref|XP_009138624.1| PREDICTED: uncharacterized protein LOC103862701 [Brassica rapa]
Length=1003

 Score =   281 bits (718),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 148/431 (34%), Positives = 240/431 (56%), Gaps = 1/431 (0%)
 Frame = +3

Query  1083  KFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKML  1262
             K+ GTV   + +    FF  G  P   N T +CL+P I +P L+   R I LC+V YKM+
Sbjct  87    KYWGTVGAQVTEEVKKFFLHGVFPKEWNYTHLCLLPKITDPILMTDLRPISLCSVLYKMI  146

Query  1263  TKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSG-KGGLMVIKIDL  1439
             +K M  RLK  +  L+   Q++FV  R IT+N+L+  E++++LR+        M IK D+
Sbjct  147   SKIMVNRLKPMLPDLVSATQSAFVEERLITDNILIAHEMVHALRTNDNFSRDFMAIKSDM  206

Query  1440  EKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGD  1619
              KAYDR+ W+++++ L+  GF+  WI  +M CVS+   +   +++       ERG+RQGD
Sbjct  207   SKAYDRVEWNYLKALLRALGFAEVWIERVMFCVSSVTFSTLINNQAFGCIQPERGLRQGD  266

Query  1620  PLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQAS  1799
             P+SP LF+L  E L H++  + +N + +G++   +GP I H+ F DD +    A+  QA+
Sbjct  267   PMSPFLFILCTEGLIHMLNTAARNDKIQGIRFDEEGPMIHHMLFADDSLLICRANQDQAA  326

Query  1800  VVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIH  1979
              + + L  +   +GQ++S  KS I F      +++  I    GI      G YLG+P   
Sbjct  327   ELMRILKVYEKATGQQVSIAKSAITFGSKVHEDVRNVIKRVTGIQKEGGSGSYLGLPECF  386

Query  1980  GRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSR  2159
                K +  A +  R++ RL+GW  + LS  G+  LI++V  A+P Y M    L +     
Sbjct  387   SGSKTEMLAYIYDRLKDRLSGWFMKQLSLGGKEILIKAVAMAMPIYAMSCFKLTKTSCDN  446

Query  2160  LERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKE  2339
             L R   DF W S +  RK + +SW K++ +KDQG LG + +   NQ+L AK  W+++N+ 
Sbjct  447   LTRAMADFWWNSLEHKRKLHWLSWSKLSLAKDQGGLGFKDIQSFNQSLLAKQAWRILNEP  506

Query  2340  DGLCVKIMEAK  2372
             + L  K+ +++
Sbjct  507   ESLFAKVFKSR  517


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 82/204 (40%), Gaps = 16/204 (8%)
 Frame = +2

Query  2810  LKVPYRIRTFLWLARHDCHMTNTKRARRGFTSEVFCGICRNLPEDIDHIMQRCPIANSVW  2989
             LK P +I+TFLW A  +         +RG   +  C  C    E I+HI+  C +A  VW
Sbjct  678   LKTPPKIKTFLWRALSNAISVGELLVKRGIRLDPCCQACGFQGESINHILFTCHVARQVW  737

Query  2990  E-SLIPYDHRRL*DQDYTNWFDEGISELSSGNRKHEQRVTFAVTMWWLWKWRNDLVFSGT  3166
               + +P          +        S  S+ +   + R       W+LWK RN+L+F G 
Sbjct  738   ALANVPSPPGGFELTSHYANIHHLFSLGSNKSIPSKVRNALPWITWFLWKNRNNLMFEGK  797

Query  3167  NINLAARIK--------WIRDQVEEINISFSKAKGLIAPIESICWRQLKWIRPQVGWVKA  3322
                L   ++        W   Q+EE      +     A     C +  +W+ P  GW+K 
Sbjct  798   QAGLFELVEKCFVESEMWSLAQMEEQKEDAEERGNGTA-----CHK--RWVPPPKGWLKC  850

Query  3323  NIDGSSIPSNSIARCGGFIRDDQG  3394
             NI    +    +A     +RD++G
Sbjct  851   NIGVDWMKGICLAGGAWVLRDEKG  874



>gb|EEC75227.1| hypothetical protein OsI_11496 [Oryza sativa Indica Group]
Length=1059

 Score =   281 bits (719),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 156/456 (34%), Positives = 245/456 (54%), Gaps = 7/456 (2%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP +   +    +K  +     +FF  G +  G NDT I L+P +  P  + +FR I LC
Sbjct  209   FPARFFQRNWAVLKKEVTTAVRNFFLQGVMLAGVNDTSIVLIPKVSKPEQLKEFRPISLC  268

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGG-L  1418
             NV YK+++K M  RL+  ++ +I   Q++F+  R IT+N L+  E ++ ++ ++  G   
Sbjct  269   NVIYKVVSKCMVNRLRPILKDIISVTQSAFIPERLITDNALIAFECIHHIQKETSAGKQF  328

Query  1419  MVIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLE  1598
                K+DL KAYDR+ W F+R  L K GF    +  +M+CV+T + ++SF+  L + F   
Sbjct  329   CAYKLDLAKAYDRVDWDFLRGALTKVGFCSTCVEWVMACVTTVKYSVSFNGNLLEPFSPS  388

Query  1599  RGIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGE  1778
             RG+RQGDPLSP LF+   + LS ++ Q V+ G+ + +K+ R+ P +SHL F DD + F  
Sbjct  389   RGLRQGDPLSPYLFLFVADGLSTILSQDVQAGRLEELKVCRRAPGVSHLLFADDSLLFFR  448

Query  1779  ASLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRY  1958
             A   QASVV++ L  +   +GQ LS  K  +  S +   ++ + I   L +       +Y
Sbjct  449   ACPQQASVVRQALALYQRCTGQLLSSSKCSLLASAHCPTDVLEDIKIVLQVETSTFESKY  508

Query  1959  LGVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLL  2138
             LG+P+  GR+  + +  +  R+  RL  W  + +S   + TLI+SV  AIP Y M    L
Sbjct  509   LGLPTPEGRMSAERFKAIKERLVKRLNSWVEKFMSLGAKDTLIKSVAQAIPTYVMGLFRL  568

Query  2139  PQGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLG  2318
             P        +L RDF WG  +  RK +  +W  +T  K  G LG + L   NQAL  K  
Sbjct  569   PVSTCEAYTKLIRDFWWGDEENKRKIHWTAWDIITRPKGLGGLGFRDLKLFNQALLGKQA  628

Query  2319  WKLMNKEDGLCVKIMEAKVQLPSLPSQACQMYGRVF  2426
             W+L+     LC +I++AK   P+     C++   VF
Sbjct  629   WRLIQFPGSLCARILKAKY-FPN-----CELVDAVF  658


 Score = 80.5 bits (197),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 102/212 (48%), Gaps = 11/212 (5%)
 Frame = +1

Query  481   VSSTWKSDVS---LEANKSNLSK---QLDDWNKHTIGNIFRRK*RVLARISGVQRSLSVY  642
             + S W+ ++    L    S LSK    L +W+ +  G++ +     L  I      LS+ 
Sbjct  12    IKSAWEKELETRDLGEVTSKLSKVMAALREWSINVFGSVTQE----LKEIKAKVEELSIA  67

Query  643   QkldlikldrklrreldeilYQEELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVR  822
               L      R L   +DE+LY+EE++W  RSR  W+  GDRNT+F+H   A R   + + 
Sbjct  68    DPLLHDAEIRMLYARMDELLYREEMMWLQRSRVAWLKEGDRNTKFFHRQAAWRSKKNKIT  127

Query  823   RLKDNFGEWISDGDGILEPFHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFT  1002
             RLK     ++ + + +      F+  L+ +D++    +L DA  P +       +   F+
Sbjct  128   RLKAEDSRFVENKEEMEHMAREFFQTLYLKDNSVDPRELIDALTPRVDDGMNAGLCKPFS  187

Query  1003  VKDLE-AVFEMAQFKAPSSDGFQTSFYQNSWA  1095
               ++  A+F++   KAP  DGF   F+Q +WA
Sbjct  188   DDEIAYALFQIGPLKAPGPDGFPARFFQRNWA  219



>ref|XP_010058631.1| PREDICTED: uncharacterized protein LOC104446483 [Eucalyptus grandis]
Length=1755

 Score =   238 bits (607),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 149/427 (35%), Positives = 226/427 (53%), Gaps = 9/427 (2%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             V  S++    DFFSTG L    N T++ L+P  PN  +VN FR I  CN  YK +TK + 
Sbjct  1023  VGPSVLLAIRDFFSTGQLLREINSTILTLIPKTPNASMVNDFRPIACCNTVYKCITKLLA  1082

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
              RL S +  +I   Q++FV GR+I++N+++ QE+      +       +IK+D  KAYD 
Sbjct  1083  NRLASILPSIISVSQSAFVKGRRISDNIMLAQELFAHFHHEP-YFPKNIIKVDFSKAYDS  1141

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             + W FI  +LQ  GF   +I  IM+C+ T + +I+ +  L  +F   RGIRQGDP+SP +
Sbjct  1142  VDWKFIELSLQAFGFPSIFIDRIMTCIRTPKFSIALNGDLHGFFPSGRGIRQGDPISPYI  1201

Query  1638  FVLYVERLSHLIEQSVKNGQWKGM---KITRKGPCISHLFFVDDLVFFGEASLHQASVVK  1808
             F L +E  + +I        ++     K T+    +SHLFF DD++ F EA++   S + 
Sbjct  1202  FTLVMEVFTGIINARTSKPGFRFFWRCKPTK----LSHLFFADDVLLFSEANMPSLSHLM  1257

Query  1809  KCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRL  1988
               +N F + SG   +  KS IF S      ++  + ++ G  + +    YLGVP I  RL
Sbjct  1258  DGVNTFAAWSGLIPNLNKSEIFISGGPE-SLKSTMVNASGFNLGSLPFWYLGVPIISSRL  1316

Query  1989  KQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLER  2168
              ++    L+  I  R+  W NR LS  GR  LI+SVL +I  Y     +LP  VL+R+E+
Sbjct  1317  GKEDCVSLVDAIMKRVQSWTNRFLSTAGRLQLIKSVLHSIQVYWSSVFILPSAVLNRIEQ  1376

Query  2169  LSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGL  2348
             + R FLW           +SW++V   K +G LGI+ L   N A   K  W L + ++ L
Sbjct  1377  IFRQFLWRGPNLGSGGARVSWEQVCLPKAEGGLGIRSLRVSNIAAMTKHLWLLFSDKESL  1436

Query  2349  CVKIMEA  2369
               K + +
Sbjct  1437  WTKWIHS  1443


 Score = 75.1 bits (183),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 79/312 (25%), Positives = 135/312 (43%), Gaps = 24/312 (8%)
 Frame = +1

Query  220   FQDWIFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWKIR---------SPD  372
             F D + + GL DL + G  +TW    S PN +  ++DR L N  W            +P 
Sbjct  712   FGDCLIQAGLDDLHFVGNRFTW-SASSGPNRRQRKIDRVLTNAAWNTAFSYSEANFLAPG  770

Query  373   VEVLHLPMVNSYHTLGESRR-FRFNAAW*THPNYQE*VSSTWKSDVS------LEANKSN  531
             V   H PMV        SR+ F+F   W +HPN+ E V   W+  +S      L +   +
Sbjct  771   VSD-HSPMVVRILPTPISRKPFKFFNYWMSHPNFFELVRQIWELRMSGTPMFVLYSKLRS  829

Query  532   LSKQLDDWNKHTIGNIFRRK*RVLARISGVQRSLSV-YQkldlikldrklrreldeilYQ  708
             L ++L   NK    +I  R       +   Q ++ +      L   ++       ++  +
Sbjct  830   LKRRLKLLNKEAYSDISARTSEARRLLLEAQNAIQLDPHNQALADAEKNHLHIFSDLRLK  889

Query  709   EELLWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHA  888
             EE  +  +SR  W+  GD NT+F+H +       + V  + D     I+D   +   F  
Sbjct  890   EESFYRQKSRIRWLKEGDLNTKFFHHSVKRGHLRNRVLSISDG-SNVITDEAEVQRLFVD  948

Query  889   FYMDLFSEDSTTQL---EDLNDAFFPPLHTSQWLAINAHFTVKDLEA-VFEMAQFKAPSS  1056
              + +L S  + + +   E++       L  +   AI+  FT +++++ +F +A  KAP  
Sbjct  949   HFQNLLSASTPSAIPSVEEIRANLASTLDDNHIQAISQPFTDEEIKSTLFSLASGKAPGP  1008

Query  1057  DGFQTSFYQNSW  1092
             DGF   F++ SW
Sbjct  1009  DGFNVDFFKRSW  1020



>ref|XP_008393387.1| PREDICTED: uncharacterized protein LOC103455579 [Malus domestica]
Length=876

 Score =   278 bits (712),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 143/427 (33%), Positives = 243/427 (57%), Gaps = 1/427 (0%)
 Frame = +3

Query  1095  TVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAM  1274
             TV   ++     FF +G +  G N T I L+P + NP  +  FR I LCNV YK+++K +
Sbjct  23    TVGAVVLGMVKSFFVSGRMLEGVNHTNIVLIPKVKNPRNMGHFRPISLCNVVYKIISKVL  82

Query  1275  TLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKG-GLMVIKIDLEKAY  1451
             T RLK  +  +I P Q++FV GRQI++N+LV  E+L+ ++     G   M +K+D+ KAY
Sbjct  83    TNRLKRVLPKVISPNQSAFVAGRQISDNILVVHELLHFMQHGKEDGVDYMAMKLDMAKAY  142

Query  1452  DRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSP  1631
             DR+ W+F+ + L + GF   + + +M+CV T    +  +   + +    RGI+QGD LSP
Sbjct  143   DRVEWAFLNAMLLQLGFDDMFCQWVMACVKTVSYXVVVNGETTGYIKPRRGIQQGDXLSP  202

Query  1632  LLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASVVKK  1811
              LF++  E  + L+  + + G+ +GM +T +   +SH+FF DD V F  A+  +A  +K 
Sbjct  203   FLFLICAEGFTSLLHNAEEMGRLRGMSVTEEADPLSHVFFADDSVLFCRATEGEAHTIKG  262

Query  1812  CLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLK  1991
              L ++   SGQ ++  KS + FS   S  +++ +S  LGI      G+YLG+ +  G  K
Sbjct  263   LLQQYAVGSGQFINLDKSSVHFSMGCSKALKEQLSQILGIKHQEGFGKYLGIQADFGASK  322

Query  1992  QDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERL  2171
             +  + ++ +R+  R+ GW  + LS  G+  LI+SV +A+P YTM    LP  +   +E++
Sbjct  323   KKVFEEVRNRLDERINGWAEQFLSMAGKEVLIKSVAAALPIYTMSCFQLPIHLAKEIEQV  382

Query  2172  SRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLC  2351
                F W   +  +  + ++W KV + K  G LG + +   N A+ AK+GW+L++    + 
Sbjct  383   IARFWWRDQRTKKGIHWMTWNKVAKKKVYGGLGFREIIDFNLAMLAKVGWRLISNPGSIL  442

Query  2352  VKIMEAK  2372
              ++++AK
Sbjct  443   ARVLQAK  449



>ref|XP_007031312.1| Uncharacterized protein TCM_016762 [Theobroma cacao]
 gb|EOY02238.1| Uncharacterized protein TCM_016762 [Theobroma cacao]
Length=2214

 Score =   224 bits (571),  Expect(3) = 5e-75, Method: Compositional matrix adjust.
 Identities = 141/433 (33%), Positives = 230/433 (53%), Gaps = 5/433 (1%)
 Frame = +3

Query  1098  VKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLTKAMT  1277
             +K  L +   DFF    LP G   T + L+P   N    ++FR I LC V  K++TK + 
Sbjct  1313  IKQDLFEAVLDFFKGSPLPRGITSTTLVLLPKTQNVSQWSEFRPISLCTVLNKIVTKLLA  1372

Query  1278  LRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLMVIKIDLEKAYDR  1457
              RL   +  +I   Q+ FV GR I++N+L+ QE+++ + ++S +GG +V+K+D+ KAYDR
Sbjct  1373  NRLSKILPSIISENQSGFVNGRLISDNILLAQELVDKINARS-RGGNVVLKLDMAKAYDR  1431

Query  1458  LSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDPLSPLL  1637
             L+W F+   +++ GF+  WI  I +C+S    ++  +  L  +F  ERG+RQGD +SP L
Sbjct  1432  LNWEFLYLMMEQFGFNALWINMIKACISNCWFSLLINGSLVGYFKSERGLRQGDSISPSL  1491

Query  1638  FVLYVERLSHLIEQSVKNGQWKGMK-ITRKGPCISHLFFVDDLVFFGEASLHQASVVKKC  1814
             F+L  E LS  + Q     ++  +  ++     +SHL F DD+V F          +   
Sbjct  1492  FILAAEYLSRGLNQLF--SRYNSLHYLSGCSMSVSHLAFADDIVIFTNGCHSALQKILVF  1549

Query  1815  LNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHGRLKQ  1994
             L E+  +SGQ++++ KS    +    +  +Q I+   G         YLG P   G  K 
Sbjct  1550  LQEYEQVSGQQVNHQKSCFITANGCPLSRRQIIAQVTGFQHKTLPVTYLGAPLHKGPKKV  1609

Query  1995  DSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRLERLS  2174
               +  L+S+I+ R++GW+N+ LS   R TL++SVLS++P Y +Q    P  V+ ++ERL 
Sbjct  1610  FLFDSLISKIRDRISGWENKILSPGSRITLLRSVLSSLPMYLLQVLKPPAIVIEKIERLF  1669

Query  2175  RDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKEDGLCV  2354
               FLWG S   ++ +  +W K+     +G L I+ L  +  A   KL W+     D L  
Sbjct  1670  NSFLWGDSNEGKRMHWAAWNKINFPCSEGGLDIRNLKDVFDAFTLKLWWRFYTC-DSLWT  1728

Query  2355  KIMEAKVQLPSLP  2393
               ++ K  L  +P
Sbjct  1729  LFLKTKYCLGRIP  1741


 Score = 87.4 bits (215),  Expect(3) = 5e-75, Method: Compositional matrix adjust.
 Identities = 82/312 (26%), Positives = 136/312 (44%), Gaps = 38/312 (12%)
 Frame = +1

Query  232   IFREGLIDLGYSGPAYTWMQGLSSPNFKGARLDRALCNIEWK--IRSPDVEVL------H  387
             +F  GL+D G+ G ++TW       N    RLDR + N EW     S  V+ L      H
Sbjct  1012  LFDCGLLDAGFEGNSFTWTN-----NRMFQRLDRVVYNQEWAEFFSSTRVQHLNRDGSDH  1066

Query  388   LPMVNSYHTLGE--SRRFRFNAAW*THPNYQE*VSSTWKSDVSLEA------NKSNLSKQ  543
              P++ S     +     FRF  AW  H ++   V  +W + +  E        +  L + 
Sbjct  1067  CPLLISCSNTNQRGPATFRFLHAWTKHHDFISFVEKSWNTPIHAEGLNAFWTKQQRLKRD  1126

Query  544   LDDWNKHTIGNIFRRK*RVLARISGVQRSLSVYQkldlikldrklrreldeilYQ--EEL  717
             L  WNKH  G+IF  K   LA +   QR L+  Q       +   +           EEL
Sbjct  1127  LKWWNKHIFGDIF--KILRLAEVEAEQRELNFQQNPSAANRELMHKAYAKLNRQLSIEEL  1184

Query  718   LWF*RSREEWIVSGDRNTRFYHAATAVRKSASTVRRLKDNFGEWISDGDGILEPFHAFYM  897
              W  +S  +W+V G+RNT+F+H     ++  + + R++D  G  + +   I      F+ 
Sbjct  1185  FWQQKSGVKWLVEGERNTKFFHMRMRKKRMRNHIFRIQDQEGNVLEEPHLIQNSGVEFFQ  1244

Query  898   DLFSEDSTTQLEDLNDAFFPPLHTSQWLA------INAHFTVKDL-EAVFEMAQFKAPSS  1056
             +L       + E  + + F P  T + ++      + A  +++++ EAVF + +      
Sbjct  1245  NLL------KAEQCDISRFDPSITPRIISTTDNEFLCATPSLQEVKEAVFNINKDSVAGP  1298

Query  1057  DGFQTSFYQNSW  1092
             DGF + FYQ+ W
Sbjct  1299  DGFSSLFYQHCW  1310


 Score = 22.3 bits (46),  Expect(3) = 5e-75, Method: Compositional matrix adjust.
 Identities = 12/45 (27%), Positives = 25/45 (56%), Gaps = 3/45 (7%)
 Frame = +2

Query  2405  SNVWKGILKSAPILLKGSK-KLVKNDRSTLFWLDSWIGKQATLLS  2536
             S++WK I     + ++ ++ K+ + +    FW D W+G Q  ++S
Sbjct  1751  SSIWKRITGGRDVTIQNTRWKIGRGE--LFFWHDCWMGDQPLVIS  1793



>ref|XP_008802031.1| PREDICTED: putative ribonuclease H protein At1g65750 [Phoenix 
dactylifera]
Length=923

 Score =   279 bits (713),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 151/437 (35%), Positives = 239/437 (55%), Gaps = 0/437 (0%)
 Frame = +3

Query  1062  FPNQLLPKFMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLC  1241
             FP     ++   V   +      +F+T  +      T I L+P   +      FR I LC
Sbjct  43    FPPLFFRRYWLIVGQDVTAAIQQYFTTAMMSADWQRTFITLIPKRRDASEPGHFRPISLC  102

Query  1242  NVSYKMLTKAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGLM  1421
                YK  TK + +R++  +  LI P Q +F+ GR I++N+++ QE +  L     +  LM
Sbjct  103   TTMYKATTKILAIRMRGILPRLISPEQGAFIGGRSISDNIMIAQEFMFDLERAPMRRSLM  162

Query  1422  VIKIDLEKAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLER  1601
              +K+D+E+AYDR+ W F+  +LQ  GF   WIR IM CV +   AI  +   S++F+   
Sbjct  163   GVKLDMERAYDRIRWEFVHQSLQGFGFPEGWIRWIMGCVRSPSFAILVNGTPSRYFVSVG  222

Query  1602  GIRQGDPLSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEA  1781
             G+RQG PLSPLLF++  + LS  + QSV   +    +    GP ISHL F DD +    A
Sbjct  223   GLRQGCPLSPLLFIICADALSRALRQSVVTQELGAYRPVVVGPSISHLLFADDCLLLARA  282

Query  1782  SLHQASVVKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYL  1961
             +   A V+ + L ++C++SGQR+++ KS   FS +T  E++ +IS  LG+     + RYL
Sbjct  283   TCRDARVLGRILLDYCAMSGQRVNFSKSAACFSPSTRQEVRHSISEILGVGEHGGVMRYL  342

Query  1962  GVPSIHGRLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLP  2141
             GVP    RL+    + L + ++ RL GW+  +LS  GR TL +SVLS+IP Y +  + +P
Sbjct  343   GVPLSGRRLRGSDCSFLEATVRQRLEGWQMHSLSMMGRVTLARSVLSSIPIYLVSHAFIP  402

Query  2142  QGVLSRLERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGW  2321
               VL  +E+L R+F+WG   G    +L++W+ V +    G LG+Q L    +AL A+   
Sbjct  403   VSVLRSIEQLVRNFIWGRQDGRGGIHLLAWEVVCQPTRDGGLGVQSLLVRREALLARHVA  462

Query  2322  KLMNKEDGLCVKIMEAK  2372
             + + + D +   ++ AK
Sbjct  463   RYVLEPDCMWSSLLRAK  479



>ref|XP_008366302.1| PREDICTED: uncharacterized protein LOC103429949 [Malus domestica]
Length=946

 Score =   273 bits (699),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 150/430 (35%), Positives = 230/430 (53%), Gaps = 1/430 (0%)
 Frame = +3

Query  1086  FMGTVKDSLIKFASDFFSTGHLPNGCNDTVICLVPMIPNP*LVNQFRSIGLCNVSYKMLT  1265
             F   +KD +             P   N T + L+P + +P  V+QFR I LCN SYK+L 
Sbjct  88    FWEQLKDDVNSLIKSLMHESANPCTLNATHVVLIPKVSHPESVSQFRPISLCNYSYKVLA  147

Query  1266  KAMTLRLKSAMRMLIGPFQTSFVLGRQITNNVLVYQEVLNSLRSKSGKGGL-MVIKIDLE  1442
             K +  RLK  +  +I P   +FV GR I +NV +  E+   L+ +  +    M IK+D++
Sbjct  148   KVLANRLKGVLSRIISPSXNAFVAGRMIHDNVGIAHELFXFLKGRKARNKFXMGIKLDMQ  207

Query  1443  KAYDRLSWSFIRSTLQKAGFSPDWIRNIMSCVSTSRLAISFDSRLSKWFMLERGIRQGDP  1622
             KAYDR+ W F+ + + + GF  +W   IM CVS+ + A+  + +  + F   RG+RQGD 
Sbjct  208   KAYDRVEWDFLDAIMARMGFCSEWRHLIMRCVSSVQFAVLINGQPGQQFTPSRGLRQGDX  267

Query  1623  LSPLLFVLYVERLSHLIEQSVKNGQWKGMKITRKGPCISHLFFVDDLVFFGEASLHQASV  1802
             LSP  F++    +S L++++V +    G+KI   GP ISH+FF DD + F +A       
Sbjct  268   LSPYXFLMVGXVISSLLQEAVDSHLLDGVKIGVSGPVISHMFFADDTLLFLKADTKNCRN  327

Query  1803  VKKCLNEFCSLSGQRLSYMKS*IFFSKNTSVEIQQAISSSLGIPIVNDLGRYLGVPSIHG  1982
             +   L  +C  SGQ+++  KS ++F  N S+++   + + LGIP V + G Y GVP I G
Sbjct  328   LVDILGXYCEASGQQVNLQKSSVYFGANVSMQVSNELVNVLGIPAVANPGTYXGVPXIWG  387

Query  1983  RLKQDSYADLMSRIQARLTGWKNRTLSFDGRSTLIQSVLSAIPCYTMQSSLLPQGVLSRL  2162
             R K+   A +  +I  +L GWK  TLS  G+  LI++V+ AIP Y M     P  V   L
Sbjct  388   RSKKRGLAYIKGKILGKLQGWKQCTLSRAGKEVLIKAVVQAIPXYXMHIFKFPAIVXQEL  447

Query  2163  ERLSRDFLWGSSKGNRKCNLISWKKVTESKDQGRLGIQRLD*MNQALFAKLGWKLMNKED  2342
             + L   F WGS    RK + +S   +   K  G LG +     N AL AK  W+L+   +
Sbjct  448   DALVAGFWWGSLGDRRKTHWVSKAVLGLPKMMGGLGFRNFGEFNDALLAKQCWRLITDPN  507

Query  2343  GLCVKIMEAK  2372
              L  ++++A+
Sbjct  508   SLWARVLKAR  517


 Score = 38.9 bits (89),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 1/88 (1%)
 Frame = +1

Query  832   DNFGEWISDGDGILEPFHAFYMDLFSEDSTTQLEDLNDAFFPPLHTSQWLAINAHFTVKD  1011
             D  G+W+     + E     ++ LF          + D     +  +   A+ A  + ++
Sbjct  2     DGDGQWVEHPRRVRELVEDHFISLFQSGGPRNWGSILDCLHQDVSEAMNQALIAPVSEQE  61

Query  1012  L-EAVFEMAQFKAPSSDGFQTSFYQNSW  1092
             + EA   M   KAP  DGFQ  FYQ+ W
Sbjct  62    VQEAALHMGSLKAPGPDGFQGIFYQSFW  89



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 12774255069212