BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24921_g3_i1 len=2453 path=[4242:0-174 4417:175-207 9090:208-444
9325:445-941 9821:942-949 1363:950-1098 9976:1099-1161 88:1162-1185
10062:1186-1219 146:1220-1506 10377:1507-1528 1670:1529-1638
10507:1639-1660 804:1661-1714 10582:1715-1732 10600:1733-1758
10625:1759-1771 1486:1772-2061 710:2062-2104 6342:2105-2145
14021:2146-2452]

Length=2453
                                                                      Score     E

ref|XP_009615073.1|  PREDICTED: oligopeptide transporter 4-like        1212   0.0     
ref|XP_006364982.1|  PREDICTED: oligopeptide transporter 4-like        1207   0.0     
ref|XP_004238028.1|  PREDICTED: oligopeptide transporter 4-like        1204   0.0     
ref|XP_011074283.1|  PREDICTED: oligopeptide transporter 4-like        1165   0.0     
ref|XP_006472404.1|  PREDICTED: oligopeptide transporter 4-like        1157   0.0     
gb|KHG09371.1|  Oligopeptide transporter 4 -like protein               1149   0.0     
ref|XP_007042780.1|  Oligopeptide transporter 4                        1145   0.0     
ref|XP_010104574.1|  Oligopeptide transporter 4                        1144   0.0     
ref|XP_004289821.1|  PREDICTED: oligopeptide transporter 4-like        1144   0.0     
ref|XP_006351838.1|  PREDICTED: oligopeptide transporter 4-like        1142   0.0     
ref|XP_010254620.1|  PREDICTED: oligopeptide transporter 4-like        1142   0.0     
ref|XP_002306519.1|  hypothetical protein POPTR_0005s19410g            1142   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011003045.1|  PREDICTED: oligopeptide transporter 4             1141   0.0     
ref|XP_004231372.1|  PREDICTED: oligopeptide transporter 4             1141   0.0     
ref|XP_002263530.1|  PREDICTED: oligopeptide transporter 4             1141   0.0     Vitis vinifera
ref|XP_002313213.2|  hypothetical protein POPTR_0009s08290g            1140   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006433763.1|  hypothetical protein CICLE_v10003230mg            1139   0.0     
ref|XP_009368318.1|  PREDICTED: oligopeptide transporter 4             1136   0.0     
ref|XP_003593303.1|  Oligopeptide transporter                          1134   0.0     
ref|XP_010030911.1|  PREDICTED: oligopeptide transporter 4-like        1134   0.0     
ref|XP_002527347.1|  Oligopeptide transporter, putative                1132   0.0     Ricinus communis
ref|XP_008237085.1|  PREDICTED: oligopeptide transporter 4-like        1130   0.0     
gb|KCW56911.1|  hypothetical protein EUGRSUZ_I02587                    1130   0.0     
ref|XP_009790410.1|  PREDICTED: oligopeptide transporter 4             1130   0.0     
gb|KCW56912.1|  hypothetical protein EUGRSUZ_I02589                    1130   0.0     
ref|XP_010029956.1|  PREDICTED: oligopeptide transporter 4-like        1129   0.0     
ref|XP_002283680.1|  PREDICTED: oligopeptide transporter 4             1127   0.0     Vitis vinifera
ref|XP_009612437.1|  PREDICTED: oligopeptide transporter 4             1127   0.0     
ref|XP_010112260.1|  Oligopeptide transporter 4                        1127   0.0     
ref|XP_007018306.1|  Oligopeptide transporter 4                        1126   0.0     
ref|XP_007200086.1|  hypothetical protein PRUPE_ppa021086mg            1125   0.0     
ref|XP_006394156.1|  hypothetical protein EUTSA_v10003716mg            1125   0.0     
ref|XP_010065749.1|  PREDICTED: oligopeptide transporter 4-like        1124   0.0     
emb|CDP19592.1|  unnamed protein product                               1124   0.0     
ref|XP_011015796.1|  PREDICTED: oligopeptide transporter 4-like        1123   0.0     
ref|XP_010064240.1|  PREDICTED: oligopeptide transporter 4-like        1123   0.0     
gb|KHG27446.1|  Oligopeptide transporter 4 -like protein               1120   0.0     
ref|XP_010065750.1|  PREDICTED: oligopeptide transporter 4-like        1119   0.0     
gb|KCW63396.1|  hypothetical protein EUGRSUZ_G01042                    1119   0.0     
ref|XP_002283674.1|  PREDICTED: oligopeptide transporter 4-like        1118   0.0     Vitis vinifera
ref|XP_010444374.1|  PREDICTED: oligopeptide transporter 4-like        1116   0.0     
gb|KCW66677.1|  hypothetical protein EUGRSUZ_F00450                    1116   0.0     
ref|XP_010520694.1|  PREDICTED: oligopeptide transporter 4             1115   0.0     
ref|XP_010484229.1|  PREDICTED: oligopeptide transporter 4             1115   0.0     
ref|XP_002518328.1|  Oligopeptide transporter, putative                1114   0.0     Ricinus communis
emb|CDY31321.1|  BnaA02g34200D                                         1113   0.0     
ref|XP_010461766.1|  PREDICTED: oligopeptide transporter 4-like        1113   0.0     
ref|XP_002866614.1|  hypothetical protein ARALYDRAFT_496649            1113   0.0     
ref|XP_010064243.1|  PREDICTED: oligopeptide transporter 4-like        1113   0.0     
ref|XP_006486776.1|  PREDICTED: oligopeptide transporter 4-like        1112   0.0     
emb|CDY46800.1|  BnaC02g43080D                                         1112   0.0     
gb|AAM64614.1|  Isp4-like protein                                      1112   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130453.1|  PREDICTED: oligopeptide transporter 4             1111   0.0     
ref|XP_006280078.1|  hypothetical protein CARUB_v10025959mg            1111   0.0     
ref|XP_011087976.1|  PREDICTED: oligopeptide transporter 4             1110   0.0     
ref|XP_008466652.1|  PREDICTED: oligopeptide transporter 4-like        1109   0.0     
ref|NP_201246.1|  oligopeptide transporter 4                           1109   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010029951.1|  PREDICTED: oligopeptide transporter 4-like        1108   0.0     
gb|KFK28135.1|  hypothetical protein AALP_AA8G476800                   1107   0.0     
emb|CBI19304.3|  unnamed protein product                               1107   0.0     
ref|XP_006422648.1|  hypothetical protein CICLE_v10027887mg            1103   0.0     
emb|CAN81605.1|  hypothetical protein VITISV_025060                    1103   0.0     Vitis vinifera
ref|XP_007148333.1|  hypothetical protein PHAVU_006G200000g            1103   0.0     
ref|XP_004136414.1|  PREDICTED: oligopeptide transporter 4-like        1102   0.0     
ref|XP_004164894.1|  PREDICTED: oligopeptide transporter 4-like        1102   0.0     
ref|XP_004147543.1|  PREDICTED: oligopeptide transporter 4-like        1101   0.0     
ref|XP_008803571.1|  PREDICTED: oligopeptide transporter 4-like i...   1100   0.0     
ref|XP_010691453.1|  PREDICTED: oligopeptide transporter 4             1099   0.0     
ref|XP_003528403.1|  PREDICTED: oligopeptide transporter 4-like        1098   0.0     
ref|XP_010244695.1|  PREDICTED: oligopeptide transporter 4-like        1096   0.0     
gb|KGN53886.1|  hypothetical protein Csa_4G179700                      1094   0.0     
ref|XP_004485624.1|  PREDICTED: oligopeptide transporter 4-like        1092   0.0     
ref|XP_008800083.1|  PREDICTED: oligopeptide transporter 4-like        1092   0.0     
ref|XP_008454451.1|  PREDICTED: oligopeptide transporter 4             1090   0.0     
ref|XP_010933427.1|  PREDICTED: oligopeptide transporter 4-like        1088   0.0     
ref|XP_003545740.1|  PREDICTED: oligopeptide transporter 4             1087   0.0     
ref|XP_007159179.1|  hypothetical protein PHAVU_002G215700g            1085   0.0     
ref|XP_002283691.1|  PREDICTED: oligopeptide transporter 2             1077   0.0     Vitis vinifera
ref|XP_010030910.1|  PREDICTED: oligopeptide transporter 4-like        1077   0.0     
emb|CBI35438.3|  unnamed protein product                               1077   0.0     
ref|XP_003547106.1|  PREDICTED: oligopeptide transporter 4-like        1076   0.0     
emb|CBI19303.3|  unnamed protein product                               1071   0.0     
ref|XP_006856596.1|  hypothetical protein AMTR_s00046p00213370         1071   0.0     
ref|XP_003608353.1|  Oligopeptide transporter                          1071   0.0     
ref|XP_009398499.1|  PREDICTED: oligopeptide transporter 4-like        1061   0.0     
ref|XP_004136415.1|  PREDICTED: oligopeptide transporter 2-like        1057   0.0     
emb|CBI19305.3|  unnamed protein product                               1056   0.0     
ref|XP_008466130.1|  PREDICTED: oligopeptide transporter 2             1054   0.0     
ref|XP_006433764.1|  hypothetical protein CICLE_v10003491mg            1048   0.0     
ref|XP_011078507.1|  PREDICTED: oligopeptide transporter 4-like        1047   0.0     
ref|XP_009413226.1|  PREDICTED: oligopeptide transporter 4-like        1047   0.0     
ref|XP_006472993.1|  PREDICTED: oligopeptide transporter 2-like        1046   0.0     
gb|KDP41518.1|  hypothetical protein JCGZ_15925                        1045   0.0     
ref|XP_007148334.1|  hypothetical protein PHAVU_006G200100g            1045   0.0     
ref|XP_004953568.1|  PREDICTED: oligopeptide transporter 4-like i...   1041   0.0     
ref|XP_009366376.1|  PREDICTED: oligopeptide transporter 2-like        1039   0.0     
gb|AES90550.2|  oligopeptide transporter OPT family protein            1037   0.0     
ref|XP_004953566.1|  PREDICTED: oligopeptide transporter 4-like        1035   0.0     
ref|NP_172464.1|  oligopeptide transporter 2                           1030   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_007018304.1|  Oligopeptide transporter 2                        1028   0.0     
gb|ABE65610.1|  oligopeptide transporter OPT family protein            1027   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_003570148.1|  PREDICTED: oligopeptide transporter 4-like        1026   0.0     
ref|XP_002892535.1|  ATOPT2                                            1026   0.0     
ref|XP_010104576.1|  Oligopeptide transporter 2                        1025   0.0     
ref|XP_010553673.1|  PREDICTED: oligopeptide transporter 2             1024   0.0     
ref|XP_007225210.1|  hypothetical protein PRUPE_ppa002011mg            1024   0.0     
ref|XP_008219191.1|  PREDICTED: oligopeptide transporter 2-like        1024   0.0     
dbj|BAJ90957.1|  predicted protein                                     1024   0.0     
gb|EAY75055.1|  hypothetical protein OsI_02950                         1023   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_008338986.1|  PREDICTED: oligopeptide transporter 2-like        1023   0.0     
ref|XP_006417516.1|  hypothetical protein EUTSA_v10009349mg            1021   0.0     
ref|XP_004953567.1|  PREDICTED: oligopeptide transporter 4-like i...   1021   0.0     
ref|XP_010475851.1|  PREDICTED: oligopeptide transporter 2-like        1021   0.0     
dbj|BAB89477.1|  isp4 protein-like                                     1020   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_006422647.1|  hypothetical protein CICLE_v10027887mg            1017   0.0     
ref|XP_002452706.1|  hypothetical protein SORBIDRAFT_04g031070         1016   0.0     Sorghum bicolor [broomcorn]
ref|XP_010501399.1|  PREDICTED: oligopeptide transporter 2             1015   0.0     
ref|XP_010244696.1|  PREDICTED: oligopeptide transporter 4-like        1015   0.0     
ref|XP_003522744.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...   1014   0.0     
ref|XP_008677393.1|  PREDICTED: oligopeptide transporter 4 isofor...   1014   0.0     
ref|XP_004972025.1|  PREDICTED: oligopeptide transporter 4-like        1013   0.0     
ref|XP_002452707.1|  hypothetical protein SORBIDRAFT_04g031080         1012   0.0     Sorghum bicolor [broomcorn]
ref|XP_006304646.1|  hypothetical protein CARUB_v10011782mg            1009   0.0     
ref|XP_010458316.1|  PREDICTED: oligopeptide transporter 2-like        1008   0.0     
ref|XP_008646108.1|  PREDICTED: oligopeptide transporter 4-like        1007   0.0     
ref|XP_011016978.1|  PREDICTED: oligopeptide transporter 2             1007   0.0     
ref|XP_008378664.1|  PREDICTED: oligopeptide transporter 2-like        1004   0.0     
gb|EEE57620.1|  hypothetical protein OsJ_08019                         1004   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|EEC73829.1|  hypothetical protein OsI_08562                         1001   0.0     Oryza sativa Indica Group [Indian rice]
gb|EYU21027.1|  hypothetical protein MIMGU_mgv1a026700mg               1001   0.0     
dbj|BAD08158.1|  putative sexual differentiation process protein ...   1000   0.0     Oryza sativa Japonica Group [Japonica rice]
emb|CDY69955.1|  BnaCnng66090D                                          998   0.0     
ref|XP_002301110.1|  oligopeptide transporter OPT family protein        998   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009118291.1|  PREDICTED: oligopeptide transporter 2              996   0.0     
ref|XP_010671041.1|  PREDICTED: oligopeptide transporter 2              994   0.0     
emb|CDY22616.1|  BnaC08g42500D                                          994   0.0     
ref|XP_003581597.1|  PREDICTED: oligopeptide transporter 4-like         994   0.0     
gb|KHN33580.1|  Oligopeptide transporter 4                              990   0.0     
ref|XP_007137663.1|  hypothetical protein PHAVU_009G145300g             990   0.0     
ref|XP_004288878.1|  PREDICTED: oligopeptide transporter 2-like         982   0.0     
ref|XP_002447030.1|  hypothetical protein SORBIDRAFT_06g027230          979   0.0     Sorghum bicolor [broomcorn]
ref|XP_006652734.1|  PREDICTED: oligopeptide transporter 4-like         976   0.0     
ref|XP_004288877.1|  PREDICTED: oligopeptide transporter 2-like         974   0.0     
ref|XP_003603705.1|  Oligopeptide transporter                           974   0.0     
ref|XP_007224505.1|  hypothetical protein PRUPE_ppa022679mg             972   0.0     
ref|XP_009366375.1|  PREDICTED: oligopeptide transporter 2-like         970   0.0     
ref|XP_004976663.1|  PREDICTED: oligopeptide transporter 4-like         968   0.0     
ref|XP_009615074.1|  PREDICTED: oligopeptide transporter 4-like         967   0.0     
ref|XP_009775420.1|  PREDICTED: oligopeptide transporter 2-like         966   0.0     
ref|XP_004238545.1|  PREDICTED: oligopeptide transporter 4-like         966   0.0     
emb|CDP19590.1|  unnamed protein product                                964   0.0     
ref|NP_001152089.1|  oligopeptide transporter 4                         964   0.0     Zea mays [maize]
emb|CDP00949.1|  unnamed protein product                                957   0.0     
ref|XP_008663549.1|  PREDICTED: oligopeptide transporter 4-like         957   0.0     
ref|XP_009795358.1|  PREDICTED: oligopeptide transporter 2-like         957   0.0     
ref|XP_009616769.1|  PREDICTED: oligopeptide transporter 2-like         953   0.0     
ref|XP_008219210.1|  PREDICTED: oligopeptide transporter 2-like         953   0.0     
ref|XP_006364985.1|  PREDICTED: oligopeptide transporter 2-like i...    948   0.0     
ref|XP_008339039.1|  PREDICTED: oligopeptide transporter 2-like         946   0.0     
ref|XP_002963418.1|  hypothetical protein SELMODRAFT_166204             946   0.0     
ref|XP_009619170.1|  PREDICTED: oligopeptide transporter 2-like         945   0.0     
ref|XP_006364984.1|  PREDICTED: oligopeptide transporter 2-like i...    945   0.0     
gb|EMT01286.1|  Oligopeptide transporter 4                              945   0.0     
ref|XP_002971556.1|  hypothetical protein SELMODRAFT_172313             944   0.0     
gb|AAB60748.1|  Similar to S. pombe ISP4 (gb|D83992)                    943   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KHN08229.1|  Oligopeptide transporter 4                              942   0.0     
ref|XP_009780017.1|  PREDICTED: oligopeptide transporter 4-like         941   0.0     
gb|EMS68344.1|  Oligopeptide transporter 4                              940   0.0     
ref|XP_006364990.1|  PREDICTED: oligopeptide transporter 4-like         940   0.0     
emb|CAH67988.1|  OSIGBa0142I02-OSIGBa0101B20.31                         937   0.0     Oryza sativa [red rice]
emb|CDP19589.1|  unnamed protein product                                932   0.0     
ref|XP_010320236.1|  PREDICTED: oligopeptide transporter 2-like         932   0.0     
ref|XP_002960906.1|  hypothetical protein SELMODRAFT_229868             929   0.0     
ref|XP_002967106.1|  hypothetical protein SELMODRAFT_87413              928   0.0     
ref|NP_001053729.2|  Os04g0594800                                       924   0.0     Oryza sativa Japonica Group [Japonica rice]
emb|CAE04152.1|  OSJNBa0009P12.37                                       924   0.0     Oryza sativa [red rice]
gb|KHN33579.1|  Oligopeptide transporter 4                              923   0.0     
gb|EAZ26400.1|  hypothetical protein OsJ_10283                          923   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_004252726.1|  PREDICTED: oligopeptide transporter 2-like         923   0.0     
emb|CDP19591.1|  unnamed protein product                                907   0.0     
ref|XP_010267482.1|  PREDICTED: oligopeptide transporter 7-like         890   0.0     
gb|KEH36459.1|  oligopeptide transporter OPT family protein             883   0.0     
gb|EYU18387.1|  hypothetical protein MIMGU_mgv1a0036351mg               880   0.0     
ref|XP_006851884.1|  hypothetical protein AMTR_s00041p00121000          880   0.0     
ref|XP_008806363.1|  PREDICTED: oligopeptide transporter 7-like         879   0.0     
ref|XP_002272972.2|  PREDICTED: oligopeptide transporter 7              877   0.0     Vitis vinifera
ref|XP_008239235.1|  PREDICTED: oligopeptide transporter 7-like         875   0.0     
ref|XP_002518892.1|  Oligopeptide transporter, putative                 874   0.0     Ricinus communis
ref|XP_010053083.1|  PREDICTED: oligopeptide transporter 7              874   0.0     
gb|EEC79904.1|  hypothetical protein OsI_21444                          873   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_007039426.1|  Oligopeptide transporter 7 isoform 1               871   0.0     
ref|XP_010676880.1|  PREDICTED: oligopeptide transporter 7-like         871   0.0     
gb|KDP25233.1|  hypothetical protein JCGZ_20389                         871   0.0     
ref|XP_002437735.1|  hypothetical protein SORBIDRAFT_10g001530          870   0.0     Sorghum bicolor [broomcorn]
ref|XP_008239237.1|  PREDICTED: oligopeptide transporter 7              869   0.0     
ref|NP_001130398.1|  uncharacterized protein LOC100191494               868   0.0     Zea mays [maize]
ref|XP_002303684.2|  hypothetical protein POPTR_0003s14540g             868   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_003601453.1|  Oligopeptide transporter                           868   0.0     
ref|XP_010934487.1|  PREDICTED: oligopeptide transporter 7              867   0.0     
dbj|BAD67732.1|  putative sexual differentiation process protein ...    867   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_011022429.1|  PREDICTED: oligopeptide transporter 7-like         867   0.0     
ref|XP_010436760.1|  PREDICTED: oligopeptide transporter 7-like         867   0.0     
ref|XP_007210345.1|  hypothetical protein PRUPE_ppa001827mg             866   0.0     
gb|KHG17686.1|  Oligopeptide transporter 7                              865   0.0     
gb|AES71704.2|  oligopeptide transporter OPT family protein             865   0.0     
gb|KHG17687.1|  Oligopeptide transporter 7                              864   0.0     
ref|XP_006397011.1|  hypothetical protein EUTSA_v10028453mg             864   0.0     
ref|XP_004964383.1|  PREDICTED: oligopeptide transporter 7-like i...    864   0.0     
ref|XP_008390299.1|  PREDICTED: oligopeptide transporter 7 isofor...    863   0.0     
ref|XP_008806360.1|  PREDICTED: oligopeptide transporter 7-like         863   0.0     
ref|XP_003555686.1|  PREDICTED: oligopeptide transporter 7              863   0.0     
ref|XP_004245468.1|  PREDICTED: oligopeptide transporter 7-like         862   0.0     
ref|XP_008437437.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    861   0.0     
emb|CDP12213.1|  unnamed protein product                                860   0.0     
ref|XP_010422002.1|  PREDICTED: oligopeptide transporter 7              859   0.0     
ref|XP_002971950.1|  hypothetical protein SELMODRAFT_148240             859   0.0     
ref|XP_006476310.1|  PREDICTED: oligopeptide transporter 7-like i...    859   0.0     
ref|XP_006476309.1|  PREDICTED: oligopeptide transporter 7-like i...    858   0.0     
ref|XP_003564333.1|  PREDICTED: oligopeptide transporter 7-like         858   0.0     
gb|EMS45133.1|  Oligopeptide transporter 4                              857   0.0     
ref|XP_004502063.1|  PREDICTED: oligopeptide transporter 7-like         857   0.0     
ref|XP_004143945.1|  PREDICTED: oligopeptide transporter 7-like         857   0.0     
ref|XP_004309550.1|  PREDICTED: oligopeptide transporter 7-like         856   0.0     
ref|XP_009358688.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    856   0.0     
ref|XP_006289826.1|  hypothetical protein CARUB_v10003431mg             857   0.0     
ref|XP_007145948.1|  hypothetical protein PHAVU_006G000100g             856   0.0     
ref|XP_006439250.1|  hypothetical protein CICLE_v10018971mg             856   0.0     
ref|XP_004163578.1|  PREDICTED: oligopeptide transporter 7-like         858   0.0     
ref|XP_002317799.2|  hypothetical protein POPTR_0012s02660g             855   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009407958.1|  PREDICTED: oligopeptide transporter 7-like         855   0.0     
ref|XP_006439249.1|  hypothetical protein CICLE_v10018971mg             855   0.0     
ref|XP_006343795.1|  PREDICTED: oligopeptide transporter 7-like         855   0.0     
dbj|BAJ85948.1|  predicted protein                                      855   0.0     
ref|XP_011043664.1|  PREDICTED: oligopeptide transporter 9-like         853   0.0     
ref|XP_009108224.1|  PREDICTED: oligopeptide transporter 7              855   0.0     
ref|XP_009412736.1|  PREDICTED: oligopeptide transporter 7-like         855   0.0     
ref|XP_009608843.1|  PREDICTED: oligopeptide transporter 7-like         854   0.0     
ref|XP_010455470.1|  PREDICTED: oligopeptide transporter 7-like         854   0.0     
emb|CDX86844.1|  BnaA09g22340D                                          853   0.0     
ref|XP_009359568.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    853   0.0     
ref|XP_010252553.1|  PREDICTED: oligopeptide transporter 7-like         851   0.0     
ref|XP_002874647.1|  ATOPT7                                             851   0.0     
gb|KFK31865.1|  hypothetical protein AALP_AA6G168500                    851   0.0     
ref|XP_011070370.1|  PREDICTED: oligopeptide transporter 7              850   0.0     
gb|KDO81278.1|  hypothetical protein CISIN_1g0461252mg                  840   0.0     
ref|XP_010267481.1|  PREDICTED: oligopeptide transporter 7-like         847   0.0     
ref|XP_004964382.1|  PREDICTED: oligopeptide transporter 7-like i...    850   0.0     
ref|XP_009765351.1|  PREDICTED: oligopeptide transporter 7-like         848   0.0     
gb|EPS60258.1|  hypothetical protein M569_14546                         845   0.0     
gb|EMT07894.1|  Oligopeptide transporter 7                              846   0.0     
ref|XP_006655730.1|  PREDICTED: oligopeptide transporter 7-like         846   0.0     
ref|XP_001767301.1|  predicted protein                                  842   0.0     
ref|XP_008790539.1|  PREDICTED: oligopeptide transporter 7-like         844   0.0     
ref|XP_010649021.1|  PREDICTED: oligopeptide transporter 7-like         843   0.0     
ref|XP_010676881.1|  PREDICTED: oligopeptide transporter 7              843   0.0     
ref|NP_001056665.1|  Os06g0127700                                       842   0.0     Oryza sativa Japonica Group [Japonica rice]
emb|CAN61122.1|  hypothetical protein VITISV_038682                     835   0.0     Vitis vinifera
ref|XP_010934151.1|  PREDICTED: oligopeptide transporter 7-like         841   0.0     
ref|XP_009391956.1|  PREDICTED: oligopeptide transporter 7-like         841   0.0     
ref|XP_002967597.1|  hypothetical protein SELMODRAFT_88962              841   0.0     
ref|XP_002981747.1|  hypothetical protein SELMODRAFT_179057             840   0.0     
emb|CBI34570.3|  unnamed protein product                                835   0.0     
ref|XP_006851891.1|  hypothetical protein AMTR_s00041p00133990          839   0.0     
ref|XP_002436389.1|  hypothetical protein SORBIDRAFT_10g001670          837   0.0     Sorghum bicolor [broomcorn]
ref|XP_002977317.1|  hypothetical protein SELMODRAFT_232939             834   0.0     
ref|XP_010538850.1|  PREDICTED: oligopeptide transporter 7              836   0.0     
gb|KCW77331.1|  hypothetical protein EUGRSUZ_D01692                     833   0.0     
ref|XP_003557106.2|  PREDICTED: oligopeptide transporter 7-like i...    834   0.0     
ref|NP_192815.1|  oligopeptide transporter 7                            835   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010228050.1|  PREDICTED: oligopeptide transporter 7-like i...    833   0.0     
gb|EMS64171.1|  Oligopeptide transporter 4                              829   0.0     
gb|KDP46770.1|  hypothetical protein JCGZ_06558                         833   0.0     
ref|NP_001056651.1|  Os06g0125500                                       832   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010246854.1|  PREDICTED: oligopeptide transporter 7-like         831   0.0     
gb|EMS45172.1|  Oligopeptide transporter 7                              837   0.0     
ref|XP_006655737.1|  PREDICTED: oligopeptide transporter 7-like         830   0.0     
ref|XP_004160804.1|  PREDICTED: oligopeptide transporter 6-like         826   0.0     
ref|XP_002529653.1|  Oligopeptide transporter, putative                 827   0.0     Ricinus communis
ref|XP_008445079.1|  PREDICTED: oligopeptide transporter 6-like         826   0.0     
gb|KHG27803.1|  Oligopeptide transporter 7 -like protein                826   0.0     
gb|EPS62495.1|  hypothetical protein M569_12295                         825   0.0     
ref|XP_004138770.1|  PREDICTED: oligopeptide transporter 6-like         830   0.0     
ref|XP_009591882.1|  PREDICTED: oligopeptide transporter 7-like         824   0.0     
ref|XP_008445076.1|  PREDICTED: oligopeptide transporter 6-like         823   0.0     
ref|XP_011078837.1|  PREDICTED: oligopeptide transporter 7-like i...    822   0.0     
ref|XP_011078828.1|  PREDICTED: oligopeptide transporter 7-like i...    822   0.0     
ref|XP_004502694.1|  PREDICTED: oligopeptide transporter 6-like         822   0.0     
ref|XP_006441174.1|  hypothetical protein CICLE_v10019012mg             821   0.0     
ref|XP_008648099.1|  PREDICTED: uncharacterized protein LOC100383...    822   0.0     
ref|XP_006491962.1|  PREDICTED: oligopeptide transporter 9-like         820   0.0     
ref|XP_009795933.1|  PREDICTED: oligopeptide transporter 7-like i...    819   0.0     
ref|XP_006376657.1|  hypothetical protein POPTR_0012s02650g             818   0.0     
ref|XP_006380596.1|  hypothetical protein POPTR_0007s09650g             815   0.0     
ref|XP_011008821.1|  PREDICTED: oligopeptide transporter 7-like         815   0.0     
ref|XP_010109222.1|  Oligopeptide transporter 6                         814   0.0     
ref|XP_006343361.1|  PREDICTED: oligopeptide transporter 7-like         814   0.0     
ref|XP_009128701.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    813   0.0     
ref|XP_010270227.1|  PREDICTED: oligopeptide transporter 3              812   0.0     
ref|XP_004160803.1|  PREDICTED: oligopeptide transporter 6-like         811   0.0     
ref|XP_010317692.1|  PREDICTED: oligopeptide transporter 7-like         811   0.0     
ref|XP_007220230.1|  hypothetical protein PRUPE_ppa002014mg             810   0.0     
ref|XP_010034698.1|  PREDICTED: oligopeptide transporter 7-like         810   0.0     
gb|KGN48927.1|  hypothetical protein Csa_6G506530                       810   0.0     
ref|XP_010048814.1|  PREDICTED: oligopeptide transporter 6              809   0.0     
ref|XP_008234693.1|  PREDICTED: oligopeptide transporter 6-like         808   0.0     
ref|XP_004138881.1|  PREDICTED: oligopeptide transporter 6-like         809   0.0     
ref|XP_011075935.1|  PREDICTED: oligopeptide transporter 6              808   0.0     
ref|XP_007039132.1|  Oligopeptide transporter 1 isoform 1               808   0.0     
ref|XP_004135024.1|  PREDICTED: oligopeptide transporter 7-like         812   0.0     
gb|EYU19483.1|  hypothetical protein MIMGU_mgv1a023929mg                806   0.0     
gb|EPS59040.1|  hypothetical protein M569_15770                         800   0.0     
emb|CDP01884.1|  unnamed protein product                                808   0.0     
ref|XP_007156168.1|  hypothetical protein PHAVU_003G263900g             808   0.0     
ref|XP_011043662.1|  PREDICTED: oligopeptide transporter 9-like         806   0.0     
ref|XP_004169608.1|  PREDICTED: oligopeptide transporter 7-like         810   0.0     
gb|EYU30413.1|  hypothetical protein MIMGU_mgv1a002159mg                805   0.0     
ref|XP_008464311.1|  PREDICTED: oligopeptide transporter 3              806   0.0     
ref|XP_007046673.1|  Oligopeptide transporter 7 isoform 1               806   0.0     
ref|XP_006425445.1|  hypothetical protein CICLE_v10024968mg             805   0.0     
ref|XP_008440830.1|  PREDICTED: oligopeptide transporter 7-like         805   0.0     
ref|XP_009361323.1|  PREDICTED: oligopeptide transporter 6-like         803   0.0     
ref|XP_007026362.1|  Oligopeptide transporter isoform 1                 803   0.0     
ref|XP_002275134.2|  PREDICTED: oligopeptide transporter 6-like         803   0.0     
ref|XP_008376782.1|  PREDICTED: oligopeptide transporter 6              803   0.0     
ref|XP_010040072.1|  PREDICTED: oligopeptide transporter 7-like         804   0.0     
ref|XP_002273768.2|  PREDICTED: oligopeptide transporter 3              803   0.0     
ref|XP_006856263.1|  hypothetical protein AMTR_s00047p00062520          802   0.0     
ref|XP_011095913.1|  PREDICTED: oligopeptide transporter 3              802   0.0     
ref|XP_006352325.1|  PREDICTED: oligopeptide transporter 3-like         802   0.0     
ref|XP_003519862.1|  PREDICTED: oligopeptide transporter 7-like         801   0.0     
ref|XP_004139520.1|  PREDICTED: oligopeptide transporter 3-like         801   0.0     
emb|CBI18634.3|  unnamed protein product                                801   0.0     
gb|KDP42149.1|  hypothetical protein JCGZ_03016                         801   0.0     
ref|XP_009590288.1|  PREDICTED: oligopeptide transporter 3              800   0.0     
ref|XP_009773684.1|  PREDICTED: oligopeptide transporter 7-like i...    800   0.0     
ref|XP_008218454.1|  PREDICTED: oligopeptide transporter 1-like         799   0.0     
ref|XP_011040169.1|  PREDICTED: oligopeptide transporter 3              798   0.0     
ref|XP_009143920.1|  PREDICTED: oligopeptide transporter 6              798   0.0     
ref|XP_004250295.1|  PREDICTED: oligopeptide transporter 3              799   0.0     
ref|XP_007204095.1|  hypothetical protein PRUPE_ppa002122mg             796   0.0     
emb|CDY19030.1|  BnaC01g20380D                                          796   0.0     
ref|XP_007156167.1|  hypothetical protein PHAVU_003G263800g             797   0.0     
ref|XP_010096486.1|  Oligopeptide transporter 1                         796   0.0     
ref|XP_010039442.1|  PREDICTED: oligopeptide transporter 3-like         795   0.0     
gb|KDP35505.1|  hypothetical protein JCGZ_08943                         795   0.0     
ref|XP_004287803.1|  PREDICTED: oligopeptide transporter 7-like         795   0.0     
ref|XP_007136469.1|  hypothetical protein PHAVU_009G047800g             794   0.0     
ref|XP_009379386.1|  PREDICTED: oligopeptide transporter 7-like         793   0.0     
ref|XP_008780991.1|  PREDICTED: oligopeptide transporter 3-like         793   0.0     
ref|XP_008394097.1|  PREDICTED: oligopeptide transporter 7-like         793   0.0     
ref|XP_008241834.1|  PREDICTED: oligopeptide transporter 7-like         793   0.0     
ref|XP_009119900.1|  PREDICTED: oligopeptide transporter 9              793   0.0     
emb|CDY35662.1|  BnaC09g29840D                                          792   0.0     
gb|KHG20373.1|  Oligopeptide transporter 3 -like protein                792   0.0     
ref|XP_011002374.1|  PREDICTED: oligopeptide transporter 3-like         792   0.0     
ref|NP_194503.1|  oligopeptide transporter                              791   0.0     
ref|XP_010096485.1|  Oligopeptide transporter 1                         791   0.0     
ref|XP_010907563.1|  PREDICTED: oligopeptide transporter 3-like         790   0.0     
ref|XP_010482752.1|  PREDICTED: oligopeptide transporter 9              790   0.0     
ref|XP_009374520.1|  PREDICTED: oligopeptide transporter 3              790   0.0     
ref|XP_002867483.1|  ATOPT6                                             790   0.0     
ref|XP_007156166.1|  hypothetical protein PHAVU_003G263700g             790   0.0     
ref|XP_004507597.1|  PREDICTED: oligopeptide transporter 3-like         790   0.0     
ref|XP_006414361.1|  hypothetical protein EUTSA_v10024512mg             789   0.0     
ref|XP_002267184.1|  PREDICTED: oligopeptide transporter 1-like         790   0.0     
ref|XP_010537060.1|  PREDICTED: oligopeptide transporter 6-like         789   0.0     
ref|XP_004309115.1|  PREDICTED: oligopeptide transporter 6-like         788   0.0     
emb|CDP04526.1|  unnamed protein product                                790   0.0     
ref|XP_008345787.1|  PREDICTED: oligopeptide transporter 3-like         789   0.0     
gb|EYU27660.1|  hypothetical protein MIMGU_mgv1a001879mg                789   0.0     
gb|KFK26970.1|  hypothetical protein AALP_AA8G317000                    788   0.0     
ref|XP_009380132.1|  PREDICTED: oligopeptide transporter 3-like         788   0.0     
ref|XP_009773627.1|  PREDICTED: oligopeptide transporter 3              788   0.0     
ref|XP_002515831.1|  Oligopeptide transporter, putative                 787   0.0     
ref|XP_004295186.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    787   0.0     
ref|XP_004511249.1|  PREDICTED: oligopeptide transporter 7-like         786   0.0     
ref|XP_009773685.1|  PREDICTED: oligopeptide transporter 7-like i...    786   0.0     
ref|XP_002308764.1|  OLIGOPEPTIDE TRANSPORTER family protein            787   0.0     
ref|XP_009801973.1|  PREDICTED: oligopeptide transporter 6-like         786   0.0     
ref|XP_009127158.1|  PREDICTED: oligopeptide transporter 8              786   0.0     
gb|KEH32683.1|  oligopeptide transporter OPT family protein             786   0.0     
ref|XP_009601745.1|  PREDICTED: oligopeptide transporter 7-like         786   0.0     
gb|AAK96781.1|  Unknown protein                                         786   0.0     
sp|O23482.3|OPT3_ARATH  RecName: Full=Oligopeptide transporter 3;...    786   0.0     
emb|CDY28832.1|  BnaA02g10240D                                          786   0.0     
ref|XP_002864247.1|  ATOPT9                                             786   0.0     
ref|XP_010449801.1|  PREDICTED: oligopeptide transporter 3              785   0.0     
gb|KFK29177.1|  hypothetical protein AALP_AA7G099400                    786   0.0     
ref|XP_006285678.1|  hypothetical protein CARUB_v10007142mg             785   0.0     
emb|CDY47076.1|  BnaA03g12220D                                          785   0.0     
gb|KDP35526.1|  hypothetical protein JCGZ_08964                         785   0.0     
ref|XP_010671377.1|  PREDICTED: oligopeptide transporter 6              785   0.0     
ref|NP_001062118.1|  Os08g0492000                                       785   0.0     
ref|XP_002868139.1|  hypothetical protein ARALYDRAFT_355122             784   0.0     
ref|XP_006283198.1|  hypothetical protein CARUB_v10004230mg             784   0.0     
ref|XP_008366195.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    785   0.0     
ref|XP_003549274.1|  PREDICTED: oligopeptide transporter 3-like         784   0.0     
gb|KFK26550.1|  hypothetical protein AALP_AA8G263100                    784   0.0     
ref|XP_008384590.1|  PREDICTED: oligopeptide transporter 1-like         784   0.0     
ref|XP_003522539.1|  PREDICTED: oligopeptide transporter 9-like         784   0.0     
ref|XP_009124517.1|  PREDICTED: oligopeptide transporter 3              784   0.0     
ref|XP_010520948.1|  PREDICTED: oligopeptide transporter 6              784   0.0     
ref|XP_010445886.1|  PREDICTED: oligopeptide transporter 8              783   0.0     
ref|XP_003527991.1|  PREDICTED: oligopeptide transporter 9-like         783   0.0     
ref|XP_003529676.1|  PREDICTED: oligopeptide transporter 3-like         783   0.0     
emb|CDY42539.1|  BnaC08g10640D                                          783   0.0     
gb|EMS65129.1|  Oligopeptide transporter 7                              785   0.0     
ref|XP_008785648.1|  PREDICTED: oligopeptide transporter 3-like         783   0.0     
ref|XP_010644607.1|  PREDICTED: oligopeptide transporter 1-like         783   0.0     
emb|CDY38751.1|  BnaC03g14980D                                          783   0.0     
ref|XP_010440168.1|  PREDICTED: oligopeptide transporter 3-like         782   0.0     
ref|XP_002991411.1|  hypothetical protein SELMODRAFT_269808             782   0.0     
ref|XP_006660244.1|  PREDICTED: oligopeptide transporter 5-like         783   0.0     
ref|NP_567493.5|  oligopeptide transporter                              781   0.0     
ref|XP_006474841.1|  PREDICTED: oligopeptide transporter 1-like         782   0.0     
ref|NP_200164.1|  oligopeptide transporter 8                            781   0.0     
emb|CDX96230.1|  BnaC02g14210D                                          781   0.0     
ref|XP_003628537.1|  Oligopeptide transporter                           781   0.0     
ref|XP_010438561.1|  PREDICTED: oligopeptide transporter 6              781   0.0     
gb|ADW09325.1|  oligopeptide transporter 3                              781   0.0     
ref|XP_010442919.1|  PREDICTED: oligopeptide transporter 8-like         781   0.0     
ref|XP_006401694.1|  hypothetical protein EUTSA_v10015543mg             780   0.0     
ref|XP_008224626.1|  PREDICTED: oligopeptide transporter 3              780   0.0     
ref|XP_002864248.1|  predicted protein                                  780   0.0     
gb|KFK29294.1|  hypothetical protein AALP_AA7G114600                    780   0.0     
ref|XP_007207290.1|  hypothetical protein PRUPE_ppa014997mg             781   0.0     
ref|XP_006401695.1|  hypothetical protein EUTSA_v10016096mg             780   0.0     
ref|XP_010448085.1|  PREDICTED: oligopeptide transporter 6              779   0.0     
ref|XP_008218466.1|  PREDICTED: oligopeptide transporter 1-like         780   0.0     
ref|XP_004235114.1|  PREDICTED: oligopeptide transporter 6              779   0.0     
ref|XP_007211357.1|  hypothetical protein PRUPE_ppa001984mg             779   0.0     
ref|XP_006350626.1|  PREDICTED: oligopeptide transporter 7-like         778   0.0     
ref|XP_006281882.1|  hypothetical protein CARUB_v10028080mg             778   0.0     
ref|XP_010113336.1|  Oligopeptide transporter 7                         790   0.0     
ref|XP_006467278.1|  PREDICTED: oligopeptide transporter 3-like         778   0.0     
ref|XP_007154044.1|  hypothetical protein PHAVU_003G086500g             777   0.0     
dbj|BAJ95761.1|  predicted protein                                      774   0.0     
ref|XP_006413036.1|  hypothetical protein EUTSA_v10024519mg             776   0.0     
ref|XP_006449924.1|  hypothetical protein CICLE_v10014396mg             777   0.0     
gb|KDO78542.1|  hypothetical protein CISIN_1g004659mg                   776   0.0     
ref|XP_008803573.1|  PREDICTED: oligopeptide transporter 4-like i...    771   0.0     
ref|XP_008803572.1|  PREDICTED: oligopeptide transporter 4-like i...    771   0.0     
ref|XP_009367241.1|  PREDICTED: oligopeptide transporter 1-like         776   0.0     
ref|XP_010433323.1|  PREDICTED: oligopeptide transporter 6-like         776   0.0     
ref|XP_002463867.1|  hypothetical protein SORBIDRAFT_01g007880          776   0.0     
ref|XP_009404107.1|  PREDICTED: oligopeptide transporter 3-like         776   0.0     
ref|XP_009132467.1|  PREDICTED: oligopeptide transporter 8-like         775   0.0     
ref|XP_009334674.1|  PREDICTED: oligopeptide transporter 1-like         775   0.0     
ref|XP_004295330.1|  PREDICTED: oligopeptide transporter 3-like         774   0.0     
gb|ABF70152.1|  oligopeptide transporter OPT family protein             775   0.0     
ref|NP_200163.1|  oligopeptide transporter 9                            774   0.0     
ref|XP_002993852.1|  hypothetical protein SELMODRAFT_137672             773   0.0     
ref|XP_006857743.1|  hypothetical protein AMTR_s00061p00190940          774   0.0     
emb|CBI39770.3|  unnamed protein product                                774   0.0     
gb|KDO59179.1|  hypothetical protein CISIN_1g004845mg                   773   0.0     
ref|XP_008219410.1|  PREDICTED: oligopeptide transporter 1-like         774   0.0     
ref|XP_002323113.2|  hypothetical protein POPTR_0016s00650g             773   0.0     
ref|XP_009397220.1|  PREDICTED: oligopeptide transporter 3-like         773   0.0     
emb|CDY55351.1|  BnaAnng13860D                                          772   0.0     
ref|XP_006340746.1|  PREDICTED: oligopeptide transporter 7-like         773   0.0     
ref|XP_010057794.1|  PREDICTED: oligopeptide transporter 3-like         773   0.0     
ref|XP_009132469.1|  PREDICTED: oligopeptide transporter 9-like         773   0.0     
gb|ACL82964.1|  glutathione transporter                                 772   0.0     
emb|CBI23049.3|  unnamed protein product                                770   0.0     
ref|XP_006474839.1|  PREDICTED: oligopeptide transporter 1-like         773   0.0     
ref|XP_010542186.1|  PREDICTED: oligopeptide transporter 3              770   0.0     
ref|XP_009777242.1|  PREDICTED: oligopeptide transporter 1-like         770   0.0     
ref|XP_010686627.1|  PREDICTED: oligopeptide transporter 3              770   0.0     
gb|AET00810.2|  oligopeptide transporter OPT family protein             770   0.0     
ref|XP_011069784.1|  PREDICTED: oligopeptide transporter 5-like         770   0.0     
ref|XP_010064977.1|  PREDICTED: oligopeptide transporter 1-like         769   0.0     
ref|XP_006281558.1|  hypothetical protein CARUB_v10027665mg             768   0.0     
ref|XP_010436532.1|  PREDICTED: oligopeptide transporter 3              768   0.0     
ref|XP_010092336.1|  Oligopeptide transporter 1                         769   0.0     
ref|XP_009367290.1|  PREDICTED: oligopeptide transporter 1-like         769   0.0     
ref|XP_006452635.1|  hypothetical protein CICLE_v10007550mg             768   0.0     
gb|ADW66457.1|  oligopeptide transporter                                768   0.0     
ref|XP_006452637.1|  hypothetical protein CICLE_v10007550mg             767   0.0     
ref|XP_008665425.1|  PREDICTED: oligopeptide transporter 3              767   0.0     
ref|XP_011040149.1|  PREDICTED: oligopeptide transporter 1-like i...    768   0.0     
ref|XP_010545870.1|  PREDICTED: oligopeptide transporter 1-like         768   0.0     
ref|XP_009142514.1|  PREDICTED: oligopeptide transporter 5              767   0.0     
ref|XP_009379497.1|  PREDICTED: oligopeptide transporter 1-like         766   0.0     
ref|XP_010536754.1|  PREDICTED: oligopeptide transporter 5-like         766   0.0     
ref|XP_009600998.1|  PREDICTED: oligopeptide transporter 1-like         765   0.0     
ref|XP_002445962.1|  hypothetical protein SORBIDRAFT_07g028740          766   0.0     
ref|XP_010087657.1|  Oligopeptide transporter 3                         764   0.0     
ref|XP_009349149.1|  PREDICTED: oligopeptide transporter 1-like         765   0.0     
ref|XP_011040150.1|  PREDICTED: oligopeptide transporter 1-like i...    765   0.0     
emb|CDX94308.1|  BnaC01g18760D                                          765   0.0     
ref|XP_010939248.1|  PREDICTED: oligopeptide transporter 3-like         764   0.0     
ref|XP_003617851.1|  Oligopeptide transporter OPT family                764   0.0     
ref|XP_009773686.1|  PREDICTED: oligopeptide transporter 7-like i...    762   0.0     
ref|XP_003617856.1|  Oligopeptide transporter OPT family                764   0.0     
ref|XP_004491523.1|  PREDICTED: oligopeptide transporter 1-like         764   0.0     
gb|AAQ91200.1|  putative glutathione transporter                        762   0.0     
ref|XP_009126974.1|  PREDICTED: oligopeptide transporter 1              763   0.0     
emb|CDY06549.1|  BnaC02g12730D                                          763   0.0     
dbj|BAJ85522.1|  predicted protein                                      759   0.0     
ref|NP_001051290.1|  Os03g0751100                                       763   0.0     



>ref|XP_009615073.1| PREDICTED: oligopeptide transporter 4-like [Nicotiana tomentosiformis]
Length=753

 Score =  1212 bits (3136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/753 (81%), Positives = 674/753 (90%), Gaps = 6/753 (1%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             MGTVEIEAP  K   EDVN++E+S IEEVRLTV NTDDPTLPVWTFRMW+LG++SC+LLS
Sbjct  1     MGTVEIEAPITKQEEEDVNEDELSSIEEVRLTVPNTDDPTLPVWTFRMWILGLLSCILLS  60

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLNQFFSYR+EPLIIT ITVQVATLPIGRFMAA LP  KFRI GFGS +FSLNPGPFNMK
Sbjct  61    FLNQFFSYRKEPLIITQITVQVATLPIGRFMAAVLPTTKFRILGFGSKEFSLNPGPFNMK  120

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLITIFANAG AFGNGSAYAVGIVNII AFY R ISF A WLLIITTQVLGYGWAGLL
Sbjct  121   EHVLITIFANAGSAFGNGSAYAVGIVNIIKAFYGRSISFGASWLLIITTQVLGYGWAGLL  180

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrr------MSRAKFFVISLCCSF  776
             +KYVVEPAHMWWPSTLVQISLFR LHEKE+E+D            MSRAKFFVI+L CSF
Sbjct  181   RKYVVEPAHMWWPSTLVQISLFRALHEKEDEDDNEIVNGKGNKRPMSRAKFFVIALVCSF  240

Query  777   CWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLV  956
              WY FPGY FQ L+SISWVCW +P SVTA Q+GSGLNGLG+GA TLDW+T+ASFL SPL+
Sbjct  241   SWYLFPGYFFQALSSISWVCWAYPNSVTAQQIGSGLNGLGVGAFTLDWATVASFLFSPLI  300

Query  957   CPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQ  1136
             CPFFAI NVFVGYA+IMY+V+PISYWG NVYNAK FPLYSSDLFTAQGQEY+IS IVNKQ
Sbjct  301   CPFFAIANVFVGYALIMYVVIPISYWGFNVYNAKNFPLYSSDLFTAQGQEYNISLIVNKQ  360

Query  1137  FELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDI  1316
             F LD  EY KQGRI LS FF+L+YGFGFATIAST+THVALFYGREIY RY+AS++GK+D+
Sbjct  361   FNLDLAEYEKQGRINLSLFFTLTYGFGFATIASTLTHVALFYGREIYQRYQASSEGKVDV  420

Query  1317  HTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPIS  1496
             HT+LM+ YKDIPSWWFY+LL VTI VSLALCIFL +++QMPYWGL+ AA LAF FTLPIS
Sbjct  421   HTRLMRRYKDIPSWWFYLLLFVTILVSLALCIFLKNQIQMPYWGLLLAAVLAFTFTLPIS  480

Query  1497  IITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKI  1676
             IITATTNQTPGLNIITEYIMG++YPG PIANVCFKTYG+MSMTQAI+FLSDFKLGHYMKI
Sbjct  481   IITATTNQTPGLNIITEYIMGVLYPGSPIANVCFKTYGFMSMTQAISFLSDFKLGHYMKI  540

Query  1677  PPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIW  1856
             PPRSMFLVQF+GT+IAGT+N+SVAWWLL SI+NICHQDK SNSPWTCP D VFFDASVIW
Sbjct  541   PPRSMFLVQFLGTIIAGTVNLSVAWWLLDSIDNICHQDKFSNSPWTCPGDHVFFDASVIW  600

Query  1857  GLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSM  2036
             GLV PKRIF   GNY+ALNWFFLGG++GPV+VWLLH+ FP Q+WIPLINLPVLLGAT  M
Sbjct  601   GLVSPKRIFGHLGNYSALNWFFLGGMIGPVVVWLLHKLFPKQTWIPLINLPVLLGATAWM  660

Query  2037  PPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLED  2216
             PPAT+LNY+SWILVGT+FNFFVFRYRKKWWQRYNYILSA LDAGVAFMAVLLYF+VG+E+
Sbjct  661   PPATALNYNSWILVGTVFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFSVGMEN  720

Query  2217  RTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             R+I+WWG  D EHCDLA CPTAKGI+VDGCP F
Sbjct  721   RSINWWGNNDPEHCDLAYCPTAKGISVDGCPTF  753



>ref|XP_006364982.1| PREDICTED: oligopeptide transporter 4-like [Solanum tuberosum]
Length=755

 Score =  1207 bits (3123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 608/755 (81%), Positives = 677/755 (90%), Gaps = 8/755 (1%)
 Frame = +3

Query  75    MGTVEIEAPALKLAG--EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVL  248
             MGT+E+EAP  KL    E++N++E+SPIEEVRLTV NTDDPTLPVWTFRMW+LGV SCVL
Sbjct  1     MGTMEVEAPITKLQQKEEEINEDELSPIEEVRLTVPNTDDPTLPVWTFRMWILGVFSCVL  60

Query  249   LSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFN  428
             LSFLNQFFSYR+EPLIIT ITVQVATLPIGRFMAA LP  KFRI GFGS +FSLNPGPFN
Sbjct  61    LSFLNQFFSYRKEPLIITQITVQVATLPIGRFMAAVLPTTKFRILGFGSREFSLNPGPFN  120

Query  429   MKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAG  608
             MKEHVLITIFANAGFAFGNGSAYAVGIVNII AFY R ISF A WLLIITTQVLGYGWAG
Sbjct  121   MKEHVLITIFANAGFAFGNGSAYAVGIVNIIKAFYHRNISFVASWLLIITTQVLGYGWAG  180

Query  609   LLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrr------MSRAKFFVISLCC  770
             LL+KYVVEPAHMWWPSTLVQISLFR LHEKE+++D            MSRAKFFVI+L C
Sbjct  181   LLRKYVVEPAHMWWPSTLVQISLFRALHEKEDDDDNEIVNANGNKRPMSRAKFFVIALVC  240

Query  771   SFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSP  950
             SF WY FPGY+FQTL+SISWVCW +PKSVTA Q+GSGLNGLG+GA TLDW+T+ASFL SP
Sbjct  241   SFSWYIFPGYLFQTLSSISWVCWAYPKSVTAQQIGSGLNGLGIGAFTLDWATVASFLFSP  300

Query  951   LVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVN  1130
             L+ PFFAI NVFVGYA+I+Y+V+PISYWG NVYNAK FPLYSSDLFTAQGQ Y+IS IVN
Sbjct  301   LIYPFFAIANVFVGYALILYVVIPISYWGFNVYNAKKFPLYSSDLFTAQGQVYNISLIVN  360

Query  1131  KQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKM  1310
              QF+LDE EY KQGRI LS FF+L+YGFGFATIAST++HV LFYGREIY R+RAS+ GK+
Sbjct  361   NQFKLDEAEYDKQGRINLSLFFTLTYGFGFATIASTLSHVGLFYGREIYQRFRASSVGKV  420

Query  1311  DIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLP  1490
             D+HT+LM+ YKDIPSWWFY+LL++T  VSLALCIFL  +VQ+P+WGL+ AA LAF+FTLP
Sbjct  421   DVHTRLMRRYKDIPSWWFYLLLLMTTLVSLALCIFLKSQVQLPFWGLLLAAGLAFIFTLP  480

Query  1491  ISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYM  1670
             ISIITATTNQTPGLNIITEYIMG IYPG+PIANVCFKTYGYMSMTQAI+FLSDFKLGHYM
Sbjct  481   ISIITATTNQTPGLNIITEYIMGTIYPGRPIANVCFKTYGYMSMTQAISFLSDFKLGHYM  540

Query  1671  KIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASV  1850
             KIPPRSMFLVQF+GT+IAGT+N++VAWWLL SI+NICHQDK SNSPWTCP D VFFDASV
Sbjct  541   KIPPRSMFLVQFVGTIIAGTVNLTVAWWLLGSIDNICHQDKFSNSPWTCPGDHVFFDASV  600

Query  1851  IWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATG  2030
             IWGLV PKRIF   GNY+ALNWFFLGG+LGPV+VWLLH+ FP Q+WIPLINLPVLLGAT 
Sbjct  601   IWGLVSPKRIFGHLGNYSALNWFFLGGLLGPVLVWLLHKSFPKQTWIPLINLPVLLGATA  660

Query  2031  SMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGL  2210
              MPPAT+LNY+SWILVGTIFNFFVFRYRKKWWQRYNYILSA LDAGVAFMAVLLYFTVG+
Sbjct  661   FMPPATALNYNSWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTVGM  720

Query  2211  EDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             EDR+I+WWG +D EHCDLA+CPTAKGI ++GCP F
Sbjct  721   EDRSINWWGNSDPEHCDLATCPTAKGITINGCPTF  755



>ref|XP_004238028.1| PREDICTED: oligopeptide transporter 4-like [Solanum lycopersicum]
Length=755

 Score =  1204 bits (3114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/755 (81%), Positives = 679/755 (90%), Gaps = 8/755 (1%)
 Frame = +3

Query  75    MGTVEIEAPALKLAG--EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVL  248
             MGT+EIEAP  KL    E++N++E+SPIEEVRLTV NTDDPTLPVWTFRMW+LGV SCVL
Sbjct  1     MGTMEIEAPITKLQQKEEEINEDELSPIEEVRLTVPNTDDPTLPVWTFRMWILGVFSCVL  60

Query  249   LSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFN  428
             LSFLNQFFSYR+EPLIIT ITVQVATLPIGRFMAA LP  KFRI GFGS +FSLNPGPFN
Sbjct  61    LSFLNQFFSYRKEPLIITQITVQVATLPIGRFMAAVLPTTKFRILGFGSREFSLNPGPFN  120

Query  429   MKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAG  608
             MKEHVLITIFANAGFAFGNGSAYAVGIVNII AFYRR ISF A WLLIITTQVLGYGWAG
Sbjct  121   MKEHVLITIFANAGFAFGNGSAYAVGIVNIIKAFYRRNISFAASWLLIITTQVLGYGWAG  180

Query  609   LLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrr------MSRAKFFVISLCC  770
             LL+KYVVEPAHMWWPSTLVQISLFR LHE+E+++D            MSRAKFFVI+L C
Sbjct  181   LLRKYVVEPAHMWWPSTLVQISLFRALHEQEDDDDNETVNANGNKRPMSRAKFFVIALVC  240

Query  771   SFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSP  950
             SF WY FPGY+FQ L+SISWVCW +PKSVTA Q+GSGLNGLG+GA TLDW+T+ASFL SP
Sbjct  241   SFSWYIFPGYLFQALSSISWVCWAYPKSVTAQQIGSGLNGLGVGAFTLDWATVASFLFSP  300

Query  951   LVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVN  1130
             L+ PFFAI NVFVGYA+I+Y+V+PISYWG NVYNAK FPLYSSDLFTAQGQEY+IS IVN
Sbjct  301   LIYPFFAIANVFVGYALILYVVIPISYWGFNVYNAKKFPLYSSDLFTAQGQEYNISLIVN  360

Query  1131  KQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKM  1310
              QF+LD+ EY KQGRI LS FF+L+YGFGFATIAST+THV LFYGREIY R+RAS+ GK+
Sbjct  361   NQFKLDQAEYDKQGRINLSLFFTLTYGFGFATIASTLTHVGLFYGREIYQRFRASSVGKV  420

Query  1311  DIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLP  1490
             D+HT+LM+ YKDIPSWWFY+LL+ T  VSLALC+FL  +VQ+PYWGL+ AAALAF+FTLP
Sbjct  421   DVHTRLMRRYKDIPSWWFYLLLLGTTLVSLALCVFLKSQVQLPYWGLLLAAALAFIFTLP  480

Query  1491  ISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYM  1670
             ISIITATTNQTPGLNIITEYIMG IYPG+PIANVCFKTYGYMSMTQAI+FLSDFKLGHYM
Sbjct  481   ISIITATTNQTPGLNIITEYIMGTIYPGRPIANVCFKTYGYMSMTQAISFLSDFKLGHYM  540

Query  1671  KIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASV  1850
             KIPPRSMFLVQF+GT+IAGT+N++VAWWLL SI+NICHQDK SNSPWTCP D VFFDASV
Sbjct  541   KIPPRSMFLVQFVGTIIAGTVNLTVAWWLLDSIDNICHQDKFSNSPWTCPGDHVFFDASV  600

Query  1851  IWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATG  2030
             IWGLV PKRIF   GNY+ALNWFFLGG+LGPV+VWLLH+ FP Q+WIPLINLPVLLGAT 
Sbjct  601   IWGLVSPKRIFGHLGNYSALNWFFLGGLLGPVLVWLLHKSFPKQTWIPLINLPVLLGATA  660

Query  2031  SMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGL  2210
              MPPAT+LNY+SWILVGTIFNFFVFRYRKKWWQRYNYILSA LDAGVAFMAVLLYFTVG+
Sbjct  661   MMPPATALNYNSWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTVGM  720

Query  2211  EDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             EDR+I+WWG TD EHCDLA+CPTAKGI++DGCP F
Sbjct  721   EDRSINWWGNTDPEHCDLATCPTAKGISIDGCPTF  755



>ref|XP_011074283.1| PREDICTED: oligopeptide transporter 4-like [Sesamum indicum]
Length=762

 Score =  1165 bits (3015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/762 (79%), Positives = 671/762 (88%), Gaps = 15/762 (2%)
 Frame = +3

Query  75    MGTVEIEAP------ALKLAGE-DVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGV  233
             MG +E+EAP       +   G+ D +++E+SPIEEVRLTV  TDDP+LPVWTFRMWVLG+
Sbjct  1     MGAMEVEAPFDPQPPKVSENGDGDADEDEISPIEEVRLTVPVTDDPSLPVWTFRMWVLGL  60

Query  234   VSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKF--RIPGFGSGQFS  407
             +SCVLLSFLNQFF+YRREPLIIT ITV VA+LPIGRFMAA LP  K+  R+PG G  +FS
Sbjct  61    LSCVLLSFLNQFFTYRREPLIITQITVLVASLPIGRFMAAVLPTTKWTVRVPGLGIREFS  120

Query  408   LNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQV  587
             LNPGPFN+KEHVLI+IFANAG AFGNG AYAV IV+IIIAFYRRKISF AGWLLIITTQV
Sbjct  121   LNPGPFNIKEHVLISIFANAGSAFGNGPAYAVMIVDIIIAFYRRKISFLAGWLLIITTQV  180

Query  588   LGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeed------gggrrrMSRAKF  749
             LGYGWAGLL+KYVVEPAHMWWPSTLVQISLFRTLHEK+ E           +R+MSR+KF
Sbjct  181   LGYGWAGLLRKYVVEPAHMWWPSTLVQISLFRTLHEKDNEGAIENGDGSSKKRQMSRSKF  240

Query  750   FVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTI  929
             F+I+L CSF WY FPGY+FQ+L SISWVCWVFP SVTAHQ+GSGLNGLG+GALTLDW+ +
Sbjct  241   FLIALTCSFLWYLFPGYLFQSLQSISWVCWVFPHSVTAHQIGSGLNGLGIGALTLDWAAV  300

Query  930   ASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEY  1109
             ASFL SPL+ PFFAI NVFVGY IIMY+V+PISYWGLNVYNAK FP+YS+DLFTA GQEY
Sbjct  301   ASFLFSPLISPFFAIANVFVGYFIIMYIVIPISYWGLNVYNAKNFPIYSADLFTANGQEY  360

Query  1110  DISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYR  1289
             +ISAIV+ QFELD ++Y KQGRI+LSTFFSL+YGFGFATIAST+THVALFYGREIYDRY+
Sbjct  361   NISAIVSPQFELDREQYQKQGRIHLSTFFSLTYGFGFATIASTVTHVALFYGREIYDRYK  420

Query  1290  ASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAAL  1469
             AS+K K DIHTKLMKNYKDIPSWWFYVLL VT+ VSL LCIFL  E+QMP+W L+ AA L
Sbjct  421   ASSKAKRDIHTKLMKNYKDIPSWWFYVLLAVTMVVSLVLCIFLKKEIQMPFWALLLAAVL  480

Query  1470  AFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSD  1649
             AF+FTLPISIITATTNQTPGLNIITEY+MGIIYPG+PIANVCFK YGYMSMTQAIAFLSD
Sbjct  481   AFLFTLPISIITATTNQTPGLNIITEYLMGIIYPGRPIANVCFKVYGYMSMTQAIAFLSD  540

Query  1650  FKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDR  1829
             FKLGHYMKIPPRSMFLVQF+GT++AGT+NMSVAWWLLH++++ICH DK SNSPWTCP+D 
Sbjct  541   FKLGHYMKIPPRSMFLVQFLGTMVAGTVNMSVAWWLLHTVDDICHPDKFSNSPWTCPNDH  600

Query  1830  VFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLP  2009
             VFFDASVIWGLV P RIF SEGNY+ALNWFFL G+LGPV+VW  HR FP  SWIPLINLP
Sbjct  601   VFFDASVIWGLVSPIRIFGSEGNYSALNWFFLAGLLGPVLVWGCHRAFPKHSWIPLINLP  660

Query  2010  VLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVL  2189
             VL GAT  MPPAT+LNY+SWI VGT+FNFFVFRYRKKWWQRYNYILSA LDAGVAFMAVL
Sbjct  661   VLFGATAYMPPATALNYNSWIFVGTVFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVL  720

Query  2190  LYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             LYF VGLE+R ISWWG  D EHCDLA+CPTAKGI VD CPV+
Sbjct  721   LYFVVGLENRNISWWGNNDPEHCDLATCPTAKGIVVDNCPVY  762



>ref|XP_006472404.1| PREDICTED: oligopeptide transporter 4-like [Citrus sinensis]
Length=755

 Score =  1157 bits (2993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/756 (78%), Positives = 662/756 (88%), Gaps = 11/756 (1%)
 Frame = +3

Query  75    MGTVEIEAP---ALKLAGED--VNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVS  239
             MGTVE E P    L +A ED  + +EE+SPIE+VRLTV  TDD +LPVWTFRMW LG+ S
Sbjct  1     MGTVETEGPPSKELTVATEDPAIEEEEMSPIEQVRLTVPTTDDASLPVWTFRMWFLGLFS  60

Query  240   CVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPG  419
             C LLSFLNQFFSYR+EPLIIT ITVQVATLPIGRFMA  L  AKFRIPGFGS +FSLNPG
Sbjct  61    CALLSFLNQFFSYRQEPLIITQITVQVATLPIGRFMATLLSQAKFRIPGFGSREFSLNPG  120

Query  420   PFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYG  599
             PFNMKEHVLITIFANAG AFG+GSAYAVGIVNII AFY + ISF++ W+LIITTQVLGYG
Sbjct  121   PFNMKEHVLITIFANAGSAFGSGSAYAVGIVNIIKAFYVKNISFYSAWILIITTQVLGYG  180

Query  600   WAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFC  779
             WAGLL+KYVVEPAHMWWPSTLVQISLFRTLHE E+   G     +SR KFF+I+L CSFC
Sbjct  181   WAGLLRKYVVEPAHMWWPSTLVQISLFRTLHETEDNVGGKRH--LSRVKFFMIALVCSFC  238

Query  780   WYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVC  959
             W+ FPGY FQ+L SISWVCW FP SV AHQ+GSGLNGLG+GALTLDW+ +ASFL SPL+C
Sbjct  239   WHLFPGYFFQSLQSISWVCWAFPNSVAAHQIGSGLNGLGVGALTLDWTAVASFLFSPLIC  298

Query  960   PFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQF  1139
             PFFAI NVFVGYA I+Y+V+P++YWGLN+YNAK FP++SS L+TAQG EY+I+ IVN +F
Sbjct  299   PFFAIANVFVGYAFIIYVVIPVAYWGLNLYNAKTFPIFSSHLYTAQGPEYNITLIVNDKF  358

Query  1140  ELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIH  1319
             ELD   Y + GRI++STFF+L+YGFGFATIA+T+THVALFYGREI DRYRAS++GK D+H
Sbjct  359   ELDLASYKQHGRIHMSTFFALTYGFGFATIAATLTHVALFYGREILDRYRASSEGKQDVH  418

Query  1320  TKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISI  1499
             T+LMKNYKDIPSWWF VLLV TIAVSLALCIFL  EVQMP+WGLIFAA LAF+FTLP+SI
Sbjct  419   TRLMKNYKDIPSWWFQVLLVGTIAVSLALCIFLKKEVQMPWWGLIFAAGLAFIFTLPVSI  478

Query  1500  ITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIP  1679
             ITATTNQTPGLNIITEYIMG+I PG+PIANVCFKTYGYMSM QAI+FLSDFKLGHYMKIP
Sbjct  479   ITATTNQTPGLNIITEYIMGVILPGEPIANVCFKTYGYMSMAQAISFLSDFKLGHYMKIP  538

Query  1680  PRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIW  1856
             PRSMFLVQFIGT+IAGTIN+ VAWWLL+S+E+IC    L  NSPWTCP+DRVFFDASVIW
Sbjct  539   PRSMFLVQFIGTIIAGTINLIVAWWLLNSVEHICQPGLLPKNSPWTCPNDRVFFDASVIW  598

Query  1857  GLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSM  2036
             GLVGP+RIF S+GNY ALNWFFLGG+LGP  VWLLH+KFP+QSWIPLINLPVLLGAT  M
Sbjct  599   GLVGPRRIFGSQGNYGALNWFFLGGLLGPCAVWLLHKKFPNQSWIPLINLPVLLGATAYM  658

Query  2037  PPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLED  2216
             PPAT+LNY++WILVGTIFNFFVFRYRKKWWQRYNYILSA LDAG AFM VLLY ++GLE 
Sbjct  659   PPATALNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGTAFMTVLLYVSLGLEG  718

Query  2217  RTISWWGTT---DLEHCDLASCPTAKGIAVDGCPVF  2315
               + WWG+    D EHCDLA+CPTAKG+AVDGCPVF
Sbjct  719   VNLHWWGSNPDIDPEHCDLATCPTAKGVAVDGCPVF  754



>gb|KHG09371.1| Oligopeptide transporter 4 -like protein [Gossypium arboreum]
Length=753

 Score =  1149 bits (2972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/757 (77%), Positives = 657/757 (87%), Gaps = 19/757 (3%)
 Frame = +3

Query  84    VEIEAP-------------ALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWV  224
             +EI+AP             A      DV D+E+SPIE+VRLTVTNTDDPTLPVWTFRMW 
Sbjct  1     MEIQAPHPITKSSDPEKHDATSGGNHDVEDDEISPIEQVRLTVTNTDDPTLPVWTFRMWF  60

Query  225   LGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQF  404
             LG+ SC LLSFLNQFFSYR EPLIIT ITVQV+TLPIG FMA+ LP  +F IPGFGS +F
Sbjct  61    LGLFSCALLSFLNQFFSYRTEPLIITQITVQVSTLPIGHFMASVLPKTQFGIPGFGSKRF  120

Query  405   SLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQ  584
             SLNPGPFNMKEHVLI IFANAG AFGNGSAYAVGIVNII AFY R ISF AGWLLIITTQ
Sbjct  121   SLNPGPFNMKEHVLICIFANAGSAFGNGSAYAVGIVNIIKAFYGRNISFLAGWLLIITTQ  180

Query  585   VLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISL  764
             VLGYGWAGLL+KYVVEPAHMWWPSTLVQ+SLFR LHEK+++ D      M+RAKFF+I L
Sbjct  181   VLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFRALHEKDDKNDRR----MTRAKFFLIIL  236

Query  765   CCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLS  944
              CSF WY  PGY+F TL SISW+CW+F KSVTA Q+GSGL GLGLGA TLDWS +ASFL 
Sbjct  237   ICSFVWYLVPGYLFTTLTSISWICWIFSKSVTAQQIGSGLKGLGLGAFTLDWSAVASFLF  296

Query  945   SPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAI  1124
             SPL+ PFFAI NVFVGY +I+Y+ +P++YWGL++YNA  FP++SS LFTAQGQ+Y+I+AI
Sbjct  297   SPLISPFFAIANVFVGYVLIIYIAIPVAYWGLDLYNASRFPIFSSHLFTAQGQKYNITAI  356

Query  1125  VNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKG  1304
             VN +FE+D  +Y +QGRI LS FF+L+YGFGFATIAST+THVALFYGREIYDRYRAS  G
Sbjct  357   VNDKFEIDLAKYEEQGRINLSMFFALTYGFGFATIASTMTHVALFYGREIYDRYRASHTG  416

Query  1305  KMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFT  1484
             K DIHT+LM+ YKDIPSWWFY LL  T  VSL LCIFLND+VQMP+WGL+FA A+AF+FT
Sbjct  417   KEDIHTRLMRKYKDIPSWWFYALLAATFVVSLVLCIFLNDQVQMPWWGLLFAGAMAFIFT  476

Query  1485  LPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGH  1664
             LPISIITATTNQTPGLNIITEY+MG+IYPG+PIANVCFKTYGYMSM QA++FL+DFKLGH
Sbjct  477   LPISIITATTNQTPGLNIITEYVMGLIYPGRPIANVCFKTYGYMSMAQAVSFLNDFKLGH  536

Query  1665  YMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFD  1841
             YMKIPPRSMFLVQFIGT++AGTIN++VAWWLL+SIENIC  D L +NSPWTCP DRVFFD
Sbjct  537   YMKIPPRSMFLVQFIGTILAGTINIAVAWWLLNSIENICQDDLLPANSPWTCPGDRVFFD  596

Query  1842  ASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLG  2021
             ASVIWGLVGPKRIF S GNY A+NWFFLGG LGPVIVWLLH+ FP QSWIPLINLPVLLG
Sbjct  597   ASVIWGLVGPKRIFGSLGNYPAMNWFFLGGALGPVIVWLLHKTFPKQSWIPLINLPVLLG  656

Query  2022  ATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFT  2201
             ATG MPPAT LNY++WILVGTIFNFFVFRYRKKWWQRYNYILSA LDAGVAFMA+LLYF+
Sbjct  657   ATGMMPPATPLNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAILLYFS  716

Query  2202  VGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             VG+E+R+++WWG T+ EHC+LA+CPTAKGI VDGCPV
Sbjct  717   VGMENRSVTWWG-TEGEHCELATCPTAKGIMVDGCPV  752



>ref|XP_007042780.1| Oligopeptide transporter 4 [Theobroma cacao]
 gb|EOX98611.1| Oligopeptide transporter 4 [Theobroma cacao]
Length=941

 Score =  1145 bits (2963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/765 (75%), Positives = 660/765 (86%), Gaps = 23/765 (3%)
 Frame = +3

Query  63    YFFK----MGTVEIEAPALKLA----------GEDVNDEEVSPIEEVRLTVTNTDDPTLP  200
             Y+FK    M ++EI+AP               GE+ +DEE+SPIE+VRLTV NTDDPTLP
Sbjct  184   YYFKIAACMSSMEIQAPHPGTKPSDPEKHVANGENYDDEEISPIEQVRLTVANTDDPTLP  243

Query  201   VWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRI  380
             VWTFRMW LG++SC LLSFLNQFFSYR EPLIIT ITVQVATLP+G FMA+ALP  +F+I
Sbjct  244   VWTFRMWFLGILSCALLSFLNQFFSYRTEPLIITQITVQVATLPVGHFMASALPKTQFKI  303

Query  381   PGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAG  560
             PGFGS  FSLNPG FNMKEHVLI IFANAG AFGNGSAYAVGIVNII AFY R ISF A 
Sbjct  304   PGFGSKMFSLNPGSFNMKEHVLICIFANAGSAFGNGSAYAVGIVNIIKAFYGRSISFLAS  363

Query  561   WLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSR  740
             WLLIITTQVLGYGWAGLL+KYVVEPAHMWWP+TLVQ+SLFR LHEK++         M+R
Sbjct  364   WLLIITTQVLGYGWAGLLRKYVVEPAHMWWPNTLVQVSLFRALHEKDDRR-------MTR  416

Query  741   AKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDW  920
             AKFF+I L CSF WY  PGY+F TL SISWVCW+FPKSVTA Q+GSGL GLGLGA+TLDW
Sbjct  417   AKFFLIVLICSFSWYLVPGYLFTTLTSISWVCWIFPKSVTAQQIGSGLKGLGLGAVTLDW  476

Query  921   STIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQG  1100
             S +ASFL SPL+ PFFAI NVF GY +I+Y+ +P++YWGL++YNA  FP++SS LFTA+G
Sbjct  477   SAVASFLFSPLISPFFAIANVFAGYVLIIYIAIPVAYWGLDLYNASRFPIFSSHLFTAKG  536

Query  1101  QEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYD  1280
             Q+Y+I+AIVN +FE+D  +Y + GRI LS  F+ +YGFGFATIAST+THVALFYGREIYD
Sbjct  537   QKYNITAIVNDKFEIDLAKYEELGRINLSMLFAFTYGFGFATIASTLTHVALFYGREIYD  596

Query  1281  RYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFA  1460
             RYRAS  GK DIHT+LMKNYKDIPSWWFY+LL  T  VSL LCIFL D+VQMP+WGL+FA
Sbjct  597   RYRASYTGKEDIHTRLMKNYKDIPSWWFYILLTATFVVSLVLCIFLKDQVQMPWWGLLFA  656

Query  1461  AALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAF  1640
              A+AF+FTLPISIITATTNQTPGLNIITEY+MG+IYPG+PIANVCFKTYGYMSM QA++F
Sbjct  657   GAMAFVFTLPISIITATTNQTPGLNIITEYVMGLIYPGRPIANVCFKTYGYMSMAQAVSF  716

Query  1641  LSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTC  1817
             L+DFKLGHYMKIPPRSMFLVQFIGT++AGTIN++VAWWLL+SIENICH D L ++SPWTC
Sbjct  717   LNDFKLGHYMKIPPRSMFLVQFIGTVLAGTINLAVAWWLLNSIENICHDDLLPADSPWTC  776

Query  1818  PSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPL  1997
             P DRVFFDASVIWGLVGPKRIF S GNY A+NWFF+GG +GPVIVWLLH+ FP QSWIPL
Sbjct  777   PGDRVFFDASVIWGLVGPKRIFGSLGNYRAMNWFFVGGAVGPVIVWLLHKTFPKQSWIPL  836

Query  1998  INLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAF  2177
             INLPVLLGATG MPPAT LNY++WI+VGTIFNFF+FRYRK WWQRYNYILSA LDAGVAF
Sbjct  837   INLPVLLGATGMMPPATPLNYNAWIIVGTIFNFFIFRYRKHWWQRYNYILSAALDAGVAF  896

Query  2178  MAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             MA+LLYF+VG+E+R+++WWGT   EHC+LA+CPTAKGIAV+GCPV
Sbjct  897   MAILLYFSVGMENRSLTWWGTGG-EHCELATCPTAKGIAVEGCPV  940


 Score =   245 bits (625),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 152/184 (83%), Gaps = 8/184 (4%)
 Frame = +3

Query  75   MGTVEIEAPALK--------LAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLG  230
            M ++E++AP           + G + +D+E+SPIEEVRLTVTNTDDPTLPVWTFRMW LG
Sbjct  1    MCSLEVQAPIPTTLDPEKSVINGANSDDDELSPIEEVRLTVTNTDDPTLPVWTFRMWFLG  60

Query  231  VVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSL  410
            ++SC LLSFLNQFFSYR EPLIIT ITVQVATLPIGRFMAA LP A+F++PG GS +FSL
Sbjct  61   LLSCALLSFLNQFFSYRTEPLIITQITVQVATLPIGRFMAAVLPRAQFKLPGLGSRKFSL  120

Query  411  NPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVL  590
            NPGPFNMKEHVLI+IFANAG AFG+GSAYAVGIV II AFY R ISF AGWLLIITTQV+
Sbjct  121  NPGPFNMKEHVLISIFANAGSAFGSGSAYAVGIVTIIKAFYARSISFLAGWLLIITTQVI  180

Query  591  GYGW  602
               +
Sbjct  181  NRAY  184



>ref|XP_010104574.1| Oligopeptide transporter 4 [Morus notabilis]
 gb|EXC01175.1| Oligopeptide transporter 4 [Morus notabilis]
Length=754

 Score =  1144 bits (2959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/733 (78%), Positives = 663/733 (90%), Gaps = 7/733 (1%)
 Frame = +3

Query  126   VNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITS  305
             V+++E+SP+EEVRLTV NTDD +LPVWTFRMW LG++SC LLSFLNQFFSYR+EPL++T 
Sbjct  26    VDEDELSPVEEVRLTVPNTDDKSLPVWTFRMWFLGLLSCALLSFLNQFFSYRKEPLVVTQ  85

Query  306   ITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgn  485
             ITV VATLP+GRFMAA LP  KFR+PG  S +FSLNPGPFN+KEHVLI+IFANAG AFGN
Sbjct  86    ITVLVATLPVGRFMAAVLPETKFRVPGLKSREFSLNPGPFNVKEHVLISIFANAGSAFGN  145

Query  486   gSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLV  665
             GSAYAV IV+II AFY RKISF +GW+LIITTQVLGYGWAGLL+KYVVEPAHMWWPSTLV
Sbjct  146   GSAYAVMIVDIIKAFYGRKISFLSGWILIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLV  205

Query  666   QISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVF  845
             QISLFRTLHEKEEE+    RR +SRAKFFVI+L CSFCWY FPGY+FQTL SISW+CW F
Sbjct  206   QISLFRTLHEKEEEDKDNKRR-ISRAKFFVIALICSFCWYVFPGYLFQTLQSISWICWAF  264

Query  846   PKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPI  1025
             P SVTAHQ+GSGLNGLGLGALTLDWST+ASFL SPLVCPFFAI NVFVGY +I+YLV+PI
Sbjct  265   PDSVTAHQIGSGLNGLGLGALTLDWSTVASFLFSPLVCPFFAIANVFVGYVLIIYLVIPI  324

Query  1026  SYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLS  1205
             SYWGLNV++AK FP++SSDLFT  GQ Y++S IVNK+FELD ++Y +QGR++LSTFF+L+
Sbjct  325   SYWGLNVFDAKTFPIFSSDLFTGSGQLYNVSLIVNKKFELDLEQYKQQGRVHLSTFFALT  384

Query  1206  YGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVT  1385
             YGFGFATIA+T+THVALF+GREIY+RY+AS +GK DIHT+LMK YKDIPSWWF++LL VT
Sbjct  385   YGFGFATIAATLTHVALFHGREIYERYKASFRGKEDIHTRLMKKYKDIPSWWFHLLLAVT  444

Query  1386  IAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGII  1565
             I VSLALCIFL  E+QMP+WGL+FAAALAF+FTLP+SIITATTNQTPGLNIITEYIMG+I
Sbjct  445   ITVSLALCIFLKKEIQMPWWGLLFAAALAFIFTLPVSIITATTNQTPGLNIITEYIMGVI  504

Query  1566  YPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSV  1745
              PG+PIANVCFKTYGYMSM+QAI+FL+DFKLGHYMKIPPRSMFLVQFIGT++AGTIN+SV
Sbjct  505   LPGRPIANVCFKTYGYMSMSQAISFLADFKLGHYMKIPPRSMFLVQFIGTMLAGTINISV  564

Query  1746  AWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             AWWLLH+++NICH     N+ W+CPSD VFFDASVIWGLVGP+RIF S G Y +LNWFFL
Sbjct  565   AWWLLHTVDNICHD---GNNTWSCPSDNVFFDASVIWGLVGPRRIFGSRGEYPSLNWFFL  621

Query  1926  GGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVF  2105
             GG+LGP++VWLLHR FP+Q WIPL+NLPVLLGAT +MPPAT LNY+SWI VGT+FNFFVF
Sbjct  622   GGVLGPLLVWLLHRLFPNQQWIPLVNLPVLLGATANMPPATPLNYTSWIAVGTVFNFFVF  681

Query  2106  RYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGT---TDLEHCDLASCP  2276
             RYRK+WWQRYNY+LSA LD GVAFMAVLLYF++G+E++++ WWG+    D EHC LA+CP
Sbjct  682   RYRKRWWQRYNYVLSAALDGGVAFMAVLLYFSLGVENKSLHWWGSYPDRDTEHCALATCP  741

Query  2277  TAKGIAVDGCPVF  2315
             TAKGI+VDGCP+F
Sbjct  742   TAKGISVDGCPIF  754



>ref|XP_004289821.1| PREDICTED: oligopeptide transporter 4-like [Fragaria vesca subsp. 
vesca]
Length=740

 Score =  1144 bits (2958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/748 (77%), Positives = 661/748 (88%), Gaps = 9/748 (1%)
 Frame = +3

Query  75    MGTV-EIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLL  251
             MGTV E+EAP  K+  ED +D++VSP+E+VRLTVTN DDPTLPVWTFRMW LG++SC LL
Sbjct  1     MGTVVELEAPKPKI--ED-DDDDVSPVEQVRLTVTNEDDPTLPVWTFRMWFLGLLSCALL  57

Query  252   SFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNM  431
             SFLNQFFSYR EPLIIT ITVQVATLPIG FMA  LP  KFRIPG GS + SLNPGPFN+
Sbjct  58    SFLNQFFSYRTEPLIITQITVQVATLPIGHFMARILPTTKFRIPGLGSTEVSLNPGPFNI  117

Query  432   KEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGL  611
             KEHVLITIFANAG AFG+GSAYAVGIVNII  FY RKI+F A WLLIITTQVLGYGWAGL
Sbjct  118   KEHVLITIFANAGSAFGSGSAYAVGIVNIIKKFYFRKITFLASWLLIITTQVLGYGWAGL  177

Query  612   LKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFF  791
             L+KYVVEPAHMWWPSTLVQ+SLFR LHEKEE+ D      +SRAKFF+I+L CSF WY F
Sbjct  178   LRKYVVEPAHMWWPSTLVQVSLFRALHEKEEKGDQR----ISRAKFFLIALVCSFTWYAF  233

Query  792   PGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFA  971
             PGY+F TL SISWVCW+F KSVTA Q+GSG+ GLG+GA+TLDWS +ASFL SPL+CPFFA
Sbjct  234   PGYLFTTLTSISWVCWIFSKSVTAQQIGSGMRGLGVGAITLDWSAVASFLFSPLICPFFA  293

Query  972   IVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDE  1151
             I NVF GYA+I+Y+V+PI+YWGL+ Y+A+ FP++SS LFTA+GQ YDI AIVN +F+LD 
Sbjct  294   IANVFAGYAMIVYIVIPIAYWGLDSYDAQKFPIFSSHLFTAEGQRYDIPAIVNDEFQLDI  353

Query  1152  DEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLM  1331
              +Y +QGRI+LSTFF+L+YGFGFATIAST+THV LFYGREI DRYRAS +GK DIHT+LM
Sbjct  354   AKYKEQGRIHLSTFFALTYGFGFATIASTLTHVGLFYGREIVDRYRASYQGKDDIHTRLM  413

Query  1332  KNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITAT  1511
             + YKDIPSWWFY+LL VT+AVSLALCIFLND+VQMP+WGL+FA+A+AF FTLPISIITAT
Sbjct  414   RKYKDIPSWWFYLLLAVTLAVSLALCIFLNDQVQMPWWGLLFASAIAFTFTLPISIITAT  473

Query  1512  TNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSM  1691
             TNQTPGLNIITEYIMGII PG PIANVCFKTYGYMSM QA++FL+DFKLGHYMKIPPRSM
Sbjct  474   TNQTPGLNIITEYIMGIILPGHPIANVCFKTYGYMSMAQAVSFLNDFKLGHYMKIPPRSM  533

Query  1692  FLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGP  1871
             FLVQFIGT++AGT+N+ VA WLLHSI+ IC  D  S+SPWTCP DRVFFDASVIWGL GP
Sbjct  534   FLVQFIGTVLAGTVNLVVAEWLLHSIKTICVDDPNSDSPWTCPGDRVFFDASVIWGLAGP  593

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATS  2051
             KRIF S+GNY+A+NWFFLGG++GPVIVWLLH+ FP Q+WI LINLPVLLGAT  MPPAT+
Sbjct  594   KRIFGSQGNYSAMNWFFLGGLIGPVIVWLLHKAFPKQTWIRLINLPVLLGATAYMPPATA  653

Query  2052  LNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISW  2231
             LNY+SWI+VGTIFNFFVFRYRK+WWQRYNY+LSA LDAGVAFMAV++Y +VG+E+ T++W
Sbjct  654   LNYNSWIVVGTIFNFFVFRYRKQWWQRYNYVLSAALDAGVAFMAVVIYLSVGVENTTLTW  713

Query  2232  WGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             WGT   EHCDLA CPTAKGI VDGCPVF
Sbjct  714   WGTNG-EHCDLAGCPTAKGIVVDGCPVF  740



>ref|XP_006351838.1| PREDICTED: oligopeptide transporter 4-like [Solanum tuberosum]
Length=738

 Score =  1142 bits (2955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/746 (76%), Positives = 660/746 (88%), Gaps = 11/746 (1%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             MGT + ++ A  +  +  ND+++SPIEEVRLTVTNTDDPTLPVWTFRMW LG+ SC LLS
Sbjct  1     MGTYQPDSLAGAINSD--NDDDISPIEEVRLTVTNTDDPTLPVWTFRMWFLGLFSCCLLS  58

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLNQFFSYR EPL+IT ITVQVATLPIG F+A  LP  KFR+PGFG   FSLNPGPFNMK
Sbjct  59    FLNQFFSYRTEPLVITQITVQVATLPIGHFLATILPKTKFRLPGFGPRLFSLNPGPFNMK  118

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI+IFANAG AFGNGSAYAVGIV II AFYRR ISF AGW+LIITTQVLGYGWAGLL
Sbjct  119   EHVLISIFANAGSAFGNGSAYAVGIVTIIKAFYRRNISFLAGWILIITTQVLGYGWAGLL  178

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             +KYVVEPAHMWWP TLVQ+SLFR LHEK++         MSRAKFF+I+L CSFCWY  P
Sbjct  179   RKYVVEPAHMWWPGTLVQVSLFRALHEKDDRR-------MSRAKFFLIALICSFCWYLVP  231

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
             GY+F TL SISW+CW F KSVTA Q+GSG+ GLG+GA+TLDWS +ASFL SPL+CPFFAI
Sbjct  232   GYLFSTLTSISWICWAFSKSVTAQQIGSGMRGLGVGAITLDWSAVASFLFSPLICPFFAI  291

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
             VN+F GY +I+Y+V+PI+YWG ++Y A  FP++SS LFT+QGQ+YDISAIVN +FELD  
Sbjct  292   VNIFAGYMLIIYMVIPIAYWGFDLYGASKFPIFSSHLFTSQGQKYDISAIVNDKFELDIG  351

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
             +Y +QGRI++S FF+L+YGFGFATIAST+THVALFYGREIY+R+RAS KGK DIHT+LM+
Sbjct  352   KYEEQGRIHISMFFALTYGFGFATIASTLTHVALFYGREIYERFRASYKGKEDIHTRLMR  411

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
              YKDIPSWWF  LL+VT+AVSL LCIFLN++VQMP+WGL+FA+A+AF+FTLPISIITATT
Sbjct  412   KYKDIPSWWFNALLLVTLAVSLILCIFLNNQVQMPWWGLLFASAIAFIFTLPISIITATT  471

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQTPGLNIITEY+MGII PG+PIANVCFK YGYMSM+QA++FLSDFKLGHYMKIPPRSMF
Sbjct  472   NQTPGLNIITEYVMGIILPGRPIANVCFKVYGYMSMSQAVSFLSDFKLGHYMKIPPRSMF  531

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGP  1871
             LVQF+GT+I+GTIN+SVAWWLL+SIENIC  D L  NSPWTCP DRVFFDASVIWGLVGP
Sbjct  532   LVQFLGTIISGTINISVAWWLLNSIENICQDDLLPPNSPWTCPGDRVFFDASVIWGLVGP  591

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATS  2051
             KRIF + GNY+++NWFFLGG +GPVIVWLLH+ FP+QSWIPLINLPVLLGATG+MPPAT 
Sbjct  592   KRIFGTLGNYSSMNWFFLGGAIGPVIVWLLHKMFPTQSWIPLINLPVLLGATGAMPPATP  651

Query  2052  LNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISW  2231
             LNY++W++VGTIFNFF+FRYRK+WWQRYNYILSA LDAGVAFMAVLLYF++G+E++ ++W
Sbjct  652   LNYNAWVIVGTIFNFFIFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLGMENKGVTW  711

Query  2232  WGTTDLEHCDLASCPTAKGIAVDGCP  2309
             WGT   EHC LA+CPTAKGIAVDGCP
Sbjct  712   WGTNG-EHCKLATCPTAKGIAVDGCP  736



>ref|XP_010254620.1| PREDICTED: oligopeptide transporter 4-like [Nelumbo nucifera]
Length=738

 Score =  1142 bits (2954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/748 (76%), Positives = 655/748 (88%), Gaps = 11/748 (1%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             MGTV+ E P  +   E V+++E+SPIE+VRLTVTNTDDPTLPVWTFRMW LG++SC LLS
Sbjct  1     MGTVQTELP--ESPKEIVDEDELSPIEQVRLTVTNTDDPTLPVWTFRMWFLGLISCALLS  58

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLNQFF+YR EPLIIT ITVQVATLPIGRFMA+ LP  KFR+PGFGS +FSLNPGPFNMK
Sbjct  59    FLNQFFAYRTEPLIITQITVQVATLPIGRFMASVLPRTKFRLPGFGSTEFSLNPGPFNMK  118

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI+IFANAG AFG+G AYAVGIVNII AFYR+ ISF AGW+L+ITTQVLGYGWAGLL
Sbjct  119   EHVLISIFANAGSAFGSGYAYAVGIVNIIKAFYRKNISFLAGWILVITTQVLGYGWAGLL  178

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             +KYVVEPAHMWWPSTLVQ+SLFR LHEK+EE        MSR KFF+I+L CSF WY  P
Sbjct  179   RKYVVEPAHMWWPSTLVQVSLFRALHEKDEER-------MSRGKFFLIALICSFSWYAIP  231

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
             GY+F TL SISWVCW F KSVTA QLGSG+ GLGLGALTLDWS +ASFL SPL+ PFFAI
Sbjct  232   GYLFPTLTSISWVCWAFSKSVTAQQLGSGMKGLGLGALTLDWSAVASFLFSPLISPFFAI  291

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
              NVFVGY ++MY+ +PI+YWGL++Y AK FP++SS LFT QG +Y+I+AIVN +FELD  
Sbjct  292   ANVFVGYVMVMYVAIPIAYWGLDLYKAKTFPIFSSHLFTVQGGKYNITAIVNDKFELDIP  351

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
              Y +QGRIYLSTFF+L+YGFGFATIAST+THV  FYGREIY+R+RAS KGK+DIHT+LM 
Sbjct  352   NYEEQGRIYLSTFFALTYGFGFATIASTLTHVGFFYGREIYERFRASYKGKVDIHTRLMS  411

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
              YK+IP WWF++LLVVT+AVS  LCIFL D+VQMP+WGL+FAAALAF+FTLPIS+ITATT
Sbjct  412   KYKNIPEWWFHLLLVVTVAVSFVLCIFLKDQVQMPWWGLLFAAALAFIFTLPISVITATT  471

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQTPGLNIITEY+MGIIYPG+PIANVCFKTYGYMSM QA++FLSDFKLGHYMKIPPRSMF
Sbjct  472   NQTPGLNIITEYVMGIIYPGRPIANVCFKTYGYMSMAQAVSFLSDFKLGHYMKIPPRSMF  531

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGP  1871
             +VQ IGT+IAGTIN+ VAWWLL SIENIC  D L  NSPWTCP DRVFFDASVIWGLVGP
Sbjct  532   IVQLIGTIIAGTINLGVAWWLLDSIENICQDDLLPPNSPWTCPGDRVFFDASVIWGLVGP  591

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATS  2051
             KRIF + GNY ALNWFFLGG LGPV+VWLLH+ FP QSWIPLINLPVLLGAT  MPPAT+
Sbjct  592   KRIFGTLGNYGALNWFFLGGALGPVLVWLLHKAFPKQSWIPLINLPVLLGATAMMPPATA  651

Query  2052  LNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISW  2231
             LNY++WI+VGTIFNFFVFRYRK+WWQRYNYILSA LDAGVAFM VL+YF++ +E+R ++W
Sbjct  652   LNYNAWIIVGTIFNFFVFRYRKQWWQRYNYILSAALDAGVAFMGVLIYFSLTMENRDLNW  711

Query  2232  WGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             WG TD EHC LA+CPTAKG+ V+GCP +
Sbjct  712   WG-TDGEHCPLATCPTAKGVVVEGCPAY  738



>ref|XP_002306519.1| hypothetical protein POPTR_0005s19410g [Populus trichocarpa]
 gb|EEE93515.1| hypothetical protein POPTR_0005s19410g [Populus trichocarpa]
Length=747

 Score =  1142 bits (2953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/753 (77%), Positives = 663/753 (88%), Gaps = 12/753 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             MGTVE+EAP  K    D+++EE+SPIE+VRLTV NTDDP+LPVWTFRMW LG++SC LLS
Sbjct  1     MGTVEVEAPPSK--DLDIDEEELSPIEQVRLTVPNTDDPSLPVWTFRMWFLGILSCCLLS  58

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLNQFF+YR EPLIIT ITVQVATLPIGRF+A  LP  KF I GFGS +FS NPGPFNMK
Sbjct  59    FLNQFFAYRTEPLIITQITVQVATLPIGRFLATVLPKTKFNILGFGSREFSFNPGPFNMK  118

Query  435   EHVLITIfanagfafgngSAYAVGIVNIII--AFYRRKISFFAGWLLIITTQVLGYGWAG  608
             EHVLI+IFANAG AFG+GSAYAVGIVNII   AFY R ISFF+ W+LIITTQVLGYGWAG
Sbjct  119   EHVLISIFANAGSAFGSGSAYAVGIVNIIKSKAFYGRNISFFSAWVLIITTQVLGYGWAG  178

Query  609   LLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYF  788
             LL+KYVVEPAHMWWPSTLVQISLFRTLHEKE++ +      +SR KFFVI++ CSF WY 
Sbjct  179   LLRKYVVEPAHMWWPSTLVQISLFRTLHEKEDKNEHR----ISRVKFFVIAMTCSFLWYL  234

Query  789   FPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFF  968
              PGY+FQTL SI+W+C+ FP SVTA Q+GSG+ GLG+GALTLDWST+AS+L SPL+ PFF
Sbjct  235   LPGYLFQTLQSIAWICYAFPHSVTAQQIGSGMRGLGIGALTLDWSTVASYLYSPLLTPFF  294

Query  969   AIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELD  1148
             AIVNVFVGYA+IMY+V+PISYWGLNVY+AK FP++SS LF A+G  Y+I+ +VN +FELD
Sbjct  295   AIVNVFVGYALIMYVVIPISYWGLNVYDAKTFPIFSSHLFDARGASYNITEVVNDKFELD  354

Query  1149  EDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKL  1328
               +Y K GR++LSTFF+L+YGFGFATIA+T++HVALFYGREIYDRYRAS KGK DIHT+L
Sbjct  355   LAQYDKHGRVHLSTFFALTYGFGFATIAATLSHVALFYGREIYDRYRASYKGKEDIHTRL  414

Query  1329  MKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITA  1508
             MKNYKDIPSWWF+ LL +T+ V+L LCIFL  EVQMP+WGL+FAAALAF+F+LPISIITA
Sbjct  415   MKNYKDIPSWWFHGLLAMTLLVALFLCIFLKKEVQMPFWGLLFAAALAFIFSLPISIITA  474

Query  1509  TTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRS  1688
             TTNQTPGLNIITEY MGIIYPG+PIANVCFKTYGYMSM QAI+FLSDFKLGHYMKIPPRS
Sbjct  475   TTNQTPGLNIITEYAMGIIYPGRPIANVCFKTYGYMSMAQAISFLSDFKLGHYMKIPPRS  534

Query  1689  MFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLV  1865
             MFLVQFIGT+IAGTIN+ VAWWLL+S+E+IC  + L +NSPWTCPSDRVFFDASVIWGLV
Sbjct  535   MFLVQFIGTIIAGTINLGVAWWLLNSVEHICQDNLLAANSPWTCPSDRVFFDASVIWGLV  594

Query  1866  GPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPA  2045
             GP+RIF S G Y ALNWFFLGG+LGP IVWLLH+ FP QSWIPLINLPVLLGAT SMPPA
Sbjct  595   GPRRIFGSLGEYAALNWFFLGGLLGPFIVWLLHKAFPGQSWIPLINLPVLLGATASMPPA  654

Query  2046  TSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTI  2225
             T++NY+SWILVGTIFNFF+FRYRK WWQRYNY+LSA LDAGVAFMAVL+Y TVGLE++ +
Sbjct  655   TAINYNSWILVGTIFNFFIFRYRKAWWQRYNYVLSAALDAGVAFMAVLIYVTVGLENKNL  714

Query  2226  SWWGTT-DL--EHCDLASCPTAKGIAVDGCPVF  2315
              WWG+  D+  EHC LA+CPTAKGI+VDGCP F
Sbjct  715   YWWGSDPDVFPEHCSLATCPTAKGISVDGCPTF  747



>ref|XP_011003045.1| PREDICTED: oligopeptide transporter 4 [Populus euphratica]
Length=749

 Score =  1141 bits (2952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/755 (75%), Positives = 657/755 (87%), Gaps = 16/755 (2%)
 Frame = +3

Query  75    MGTVEIEAPAL--------KLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLG  230
             MG++EI+ P          K   + V D++VSPIEEVRLTV NTDDPTLP+WTFRMW LG
Sbjct  1     MGSLEIQTPYTSSRLTDLEKPIADAVEDDDVSPIEEVRLTVANTDDPTLPIWTFRMWFLG  60

Query  231   VVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSL  410
             ++SC LL+FLNQFFSYR EPLII+ ITVQVA+LPIGR MAA LP  KF+IPGFGS  FSL
Sbjct  61    LISCSLLAFLNQFFSYRTEPLIISQITVQVASLPIGRSMAAVLPKTKFKIPGFGSRTFSL  120

Query  411   NPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVL  590
             NPGPFN+KEHVLI+IFANAG AFG+GSAYAVGIV II AFY R+ISF AGWLLI TTQVL
Sbjct  121   NPGPFNIKEHVLISIFANAGSAFGSGSAYAVGIVTIIKAFYGRRISFLAGWLLITTTQVL  180

Query  591   GYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCC  770
             GYGWAGLL+KYVVEPAHMWWP TLVQ+SLFR LHEK++         M+RAKFFVI+L C
Sbjct  181   GYGWAGLLRKYVVEPAHMWWPGTLVQVSLFRALHEKDDGHR------MTRAKFFVIALAC  234

Query  771   SFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSP  950
             SF WY FPGY+F TL+SISWVCWVFPKSVTA QLGSG+ GLGLGA+TLDWS +ASFL SP
Sbjct  235   SFVWYLFPGYLFTTLSSISWVCWVFPKSVTAQQLGSGMRGLGLGAITLDWSVVASFLFSP  294

Query  951   LVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVN  1130
             L+ PFFAI NV VGY  I+Y+ MP+SYWGL++Y+A+ FP++SS LFTA+G +Y+I+AIVN
Sbjct  295   LISPFFAIANVLVGYVFIIYVAMPLSYWGLDLYSARKFPIFSSHLFTAEGHKYNITAIVN  354

Query  1131  KQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKM  1310
              +F+LD   Y +QGRI+LS FF+L+YGFGFATIA+T+THVA FYGREI  +YRAS KGK 
Sbjct  355   NKFQLDLPNYEQQGRIHLSMFFALTYGFGFATIAATLTHVAFFYGREILQKYRASYKGKE  414

Query  1311  DIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLP  1490
             DIHTKLMK YKDIPSWWFY+LL VT+ V+LALCIFLND++QMP+WGLIFA+A+AF+FTLP
Sbjct  415   DIHTKLMKRYKDIPSWWFYLLLGVTLIVALALCIFLNDQIQMPWWGLIFASAMAFVFTLP  474

Query  1491  ISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYM  1670
             ISIITATTNQTPGLNIITEY+MG+I PG+PIANVCFKTYGYMSM QA++FLSDFKLGHYM
Sbjct  475   ISIITATTNQTPGLNIITEYVMGVILPGRPIANVCFKTYGYMSMAQAVSFLSDFKLGHYM  534

Query  1671  KIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLS-NSPWTCPSDRVFFDAS  1847
             KIPPRSMFLVQFIGT++AGTIN++VAWWLL+SIENIC  D L  NSPWTCP DRVFFDAS
Sbjct  535   KIPPRSMFLVQFIGTVLAGTINLAVAWWLLNSIENICQDDLLPVNSPWTCPGDRVFFDAS  594

Query  1848  VIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGAT  2027
             VIWGLVGPKRIF + GNY A+NWFFLGG LGPVI+WLLH+ FP QSWIPLINLPVLLGAT
Sbjct  595   VIWGLVGPKRIFGTLGNYQAMNWFFLGGALGPVIIWLLHKSFPKQSWIPLINLPVLLGAT  654

Query  2028  GSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVG  2207
               MPPAT +NY++WI+VGTIFNFF+FRY+K WWQRYNY+LSA LDAGVAFMAVLLYF+VG
Sbjct  655   AMMPPATPVNYNAWIIVGTIFNFFIFRYKKTWWQRYNYVLSAALDAGVAFMAVLLYFSVG  714

Query  2208  LEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             +EDR+++WWGT   EHC+LA+CPTAKGI VDGCPV
Sbjct  715   IEDRSLNWWGTNG-EHCELATCPTAKGIMVDGCPV  748



>ref|XP_004231372.1| PREDICTED: oligopeptide transporter 4 [Solanum lycopersicum]
Length=735

 Score =  1141 bits (2951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/746 (76%), Positives = 661/746 (89%), Gaps = 14/746 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             MGT + E+    LAG  +N ++VSPIEEVRLTVTNTDDPTLPVWTFRMW LG+ SC LLS
Sbjct  1     MGTYQPES----LAGA-MNSDDVSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLFSCCLLS  55

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLNQFFSYR EPL+IT ITVQVATLPIG F+A  LPA KFR+PGFG   FSLNPGPFNMK
Sbjct  56    FLNQFFSYRTEPLVITQITVQVATLPIGHFLATILPATKFRLPGFGPRLFSLNPGPFNMK  115

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI+IFANAG AFGNGSAYAVGIV II AFYRR ISF AGW+LIITTQVLGYGWAGLL
Sbjct  116   EHVLISIFANAGSAFGNGSAYAVGIVTIIKAFYRRNISFLAGWILIITTQVLGYGWAGLL  175

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             +KYVVEPAHMWWP+TLVQ+SLFR LHEK++          SRAKFF+I+L CSFCWY  P
Sbjct  176   RKYVVEPAHMWWPATLVQVSLFRALHEKDDRRP-------SRAKFFLIALICSFCWYLVP  228

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
             GY+F TL SISW+CW F KSVTA Q+GSG+ GLGLGA+TLDWS +ASFL SPL+CPFFAI
Sbjct  229   GYLFSTLTSISWICWAFSKSVTAQQIGSGMRGLGLGAVTLDWSAVASFLFSPLICPFFAI  288

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
             VN+F GY +I+Y+V+PI+YWG ++Y A  FP++SS LFT+QGQ+YDISAIVN +FELD  
Sbjct  289   VNIFAGYMLIIYMVIPIAYWGFDLYGASKFPIFSSHLFTSQGQKYDISAIVNDKFELDIG  348

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
             +Y +QGRI+LS FF+L+YGFGFATIAST+THVALFYGREIY+R+RAS KGK DIHT+LM+
Sbjct  349   KYEEQGRIHLSMFFALTYGFGFATIASTLTHVALFYGREIYERFRASYKGKEDIHTRLMR  408

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
              YKDIPSWWF  LL+VT+A+SL LCIFLN++VQMP+WGL+FA+A+AF+FTLPISIITATT
Sbjct  409   KYKDIPSWWFNALLLVTLAISLILCIFLNNQVQMPWWGLLFASAIAFIFTLPISIITATT  468

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQTPGLNIITEY+MGII PG+PIANVCFK YGYMSM+QA++FLSDFKLGHYMKIPPRSMF
Sbjct  469   NQTPGLNIITEYVMGIILPGRPIANVCFKVYGYMSMSQAVSFLSDFKLGHYMKIPPRSMF  528

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGP  1871
             LVQF+GT+I+GTIN+SVAWWLL+SIENIC  D L  +SPWTCP DRVFFDASVIWGLVGP
Sbjct  529   LVQFLGTIISGTINISVAWWLLNSIENICQDDLLPPDSPWTCPGDRVFFDASVIWGLVGP  588

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATS  2051
             KRIF + GNY+++NWFFLGG +GPVIVWLLH+ FP+QSWIPLINLPVLLGATG+MPPAT 
Sbjct  589   KRIFGTLGNYSSMNWFFLGGAIGPVIVWLLHKMFPTQSWIPLINLPVLLGATGAMPPATP  648

Query  2052  LNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISW  2231
             LNY++W++VGTIFNFF+FRYRK+WWQRYNYILSA LDAGVAFMAVLLYF++G+E++ ++W
Sbjct  649   LNYNAWVIVGTIFNFFIFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLGMENKGVTW  708

Query  2232  WGTTDLEHCDLASCPTAKGIAVDGCP  2309
             WGT   EHC LA+CPTAKGIAVDGCP
Sbjct  709   WGTNG-EHCKLATCPTAKGIAVDGCP  733



>ref|XP_002263530.1| PREDICTED: oligopeptide transporter 4 [Vitis vinifera]
Length=744

 Score =  1141 bits (2951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/751 (76%), Positives = 658/751 (88%), Gaps = 13/751 (2%)
 Frame = +3

Query  75    MGTVEIEAP----ALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSC  242
             MGT+E + P       ++  D +++E+SPIEEVRLTVTNTDDP+LPVWTFRMW +G+ SC
Sbjct  1     MGTLEAQTPYSTAERSISATDGDEDELSPIEEVRLTVTNTDDPSLPVWTFRMWFMGLFSC  60

Query  243   VLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGP  422
              LLSFL+QFF+YR EPLIIT ITVQVATLPIG FMAA LP  +FRIPGFGS  FSLNPGP
Sbjct  61    ALLSFLDQFFAYRTEPLIITQITVQVATLPIGHFMAAVLPTTRFRIPGFGSRSFSLNPGP  120

Query  423   FNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGW  602
             FNMKEHVLI+IFANAG AFG+GSAYAVGIV II AFY+RKISF +GWLLIITTQVLGYGW
Sbjct  121   FNMKEHVLISIFANAGSAFGSGSAYAVGIVTIIKAFYQRKISFLSGWLLIITTQVLGYGW  180

Query  603   AGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCW  782
             AGLL+KYVVEPAHMWWPS+LVQ+SLFR LHEKEE+        M+RAKFFVI+L CSF W
Sbjct  181   AGLLRKYVVEPAHMWWPSSLVQVSLFRALHEKEEQR-------MTRAKFFVIALICSFSW  233

Query  783   YFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCP  962
             Y  PGY+F TL SISWVCW FPKSVTA QLGSG+ GLGLGALTLDW+ +ASFL SPLV P
Sbjct  234   YLIPGYLFSTLTSISWVCWAFPKSVTAQQLGSGMRGLGLGALTLDWTVVASFLFSPLVSP  293

Query  963   FFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFE  1142
             FFAI+N+FVGY +++Y V+P++YWG ++YNA  FP++SS LFT+QGQ YDI AIVN +FE
Sbjct  294   FFAILNIFVGYVLLVYAVIPLAYWGFDMYNAHRFPIFSSHLFTSQGQLYDIGAIVNDKFE  353

Query  1143  LDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHT  1322
             ++  +Y +QGRI LS FF+LSYGFGFATIAST+THVALFYG EI  RYRAS KGK DIHT
Sbjct  354   INRQKYEEQGRINLSIFFALSYGFGFATIASTLTHVALFYGSEICQRYRASYKGKEDIHT  413

Query  1323  KLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISII  1502
             +LM+ Y DIPSWWFY+LLVVTIAVSLALCIFLNDEVQMP+WGLIFAAA+AF+FTLPISII
Sbjct  414   RLMRRYADIPSWWFYLLLVVTIAVSLALCIFLNDEVQMPWWGLIFAAAMAFIFTLPISII  473

Query  1503  TATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPP  1682
             TATTNQTPGLNIITEY+MG+I PG+PIANVCFKTYGYMSM QA++FL+DFKLGHYMKIPP
Sbjct  474   TATTNQTPGLNIITEYVMGVILPGRPIANVCFKTYGYMSMAQAVSFLNDFKLGHYMKIPP  533

Query  1683  RSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWG  1859
             RSMFLVQFIGT++AGTIN++VAWWLL +I+NIC  + L  +SPWTCP DRVFFDASVIWG
Sbjct  534   RSMFLVQFIGTILAGTINIAVAWWLLTTIKNICQDELLPPDSPWTCPGDRVFFDASVIWG  593

Query  1860  LVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMP  2039
             LVGPKRIF S GNY ++NWFFLGG LGPV+VW+ H+ FP QSWIPLINLPVLLGAT  MP
Sbjct  594   LVGPKRIFGSLGNYPSMNWFFLGGALGPVVVWVFHKAFPKQSWIPLINLPVLLGATSMMP  653

Query  2040  PATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDR  2219
             PATSLNY+SWILVGTIFNFFVFRYRK+WWQRYNYILSA +DAGVAFMAVLLYF++G+E++
Sbjct  654   PATSLNYNSWILVGTIFNFFVFRYRKQWWQRYNYILSAAMDAGVAFMAVLLYFSLGIEEK  713

Query  2220  TISWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
              ++WWG TD EHC LA+CPTAKGI VDGCPV
Sbjct  714   GLTWWG-TDGEHCKLATCPTAKGIVVDGCPV  743



>ref|XP_002313213.2| hypothetical protein POPTR_0009s08290g [Populus trichocarpa]
 gb|EEE87168.2| hypothetical protein POPTR_0009s08290g [Populus trichocarpa]
Length=752

 Score =  1140 bits (2948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/756 (75%), Positives = 657/756 (87%), Gaps = 16/756 (2%)
 Frame = +3

Query  75    MGTVEIEAPAL--------KLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLG  230
             MG++EI+ P          K   + V D++VSPIEEVRLTV NTDDPTLPVWTFRMW LG
Sbjct  1     MGSLEIQTPHTSSRLTDLEKPIADAVEDDDVSPIEEVRLTVANTDDPTLPVWTFRMWFLG  60

Query  231   VVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSL  410
             ++SC LL+FLNQFFSYR EPLII+ ITVQ+A+LPIGR MAA LP  KF+IPGFGS  FSL
Sbjct  61    LISCSLLAFLNQFFSYRTEPLIISQITVQIASLPIGRSMAAVLPKTKFKIPGFGSRTFSL  120

Query  411   NPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVL  590
             NPGPFN+KEHVLI+IFANAG AFG+GSAYAVGIV II AFY R ISF AGWLLI TTQVL
Sbjct  121   NPGPFNIKEHVLISIFANAGSAFGSGSAYAVGIVTIIKAFYGRSISFLAGWLLITTTQVL  180

Query  591   GYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCC  770
             GYGWAGLL+KYVVEPAHMWWP TLVQ+SLFR LHEK++         M+RAKFFVI+L C
Sbjct  181   GYGWAGLLRKYVVEPAHMWWPGTLVQVSLFRALHEKDDGHR------MTRAKFFVIALAC  234

Query  771   SFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSP  950
             SF WY FPGY+F TL+SISWVCWVFPKSVTA QLGSG+ GLGLGA+TLDWS +ASFL SP
Sbjct  235   SFVWYLFPGYLFTTLSSISWVCWVFPKSVTAQQLGSGMRGLGLGAITLDWSVVASFLFSP  294

Query  951   LVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVN  1130
             L+ PFFAI NV VGY  I+Y+ MP++YWGL++Y+A+ FP++SS LFTA+G +Y+I+AIVN
Sbjct  295   LISPFFAIANVLVGYVFIIYVAMPLAYWGLDLYSARKFPIFSSHLFTAEGHKYNITAIVN  354

Query  1131  KQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKM  1310
              +F+LD   Y +QGRI+LS FF+L+YGFGFATIA+T+THVA FYGREI  +YRAS KG+ 
Sbjct  355   NKFQLDIPNYEQQGRIHLSMFFALTYGFGFATIAATLTHVAFFYGREILQKYRASYKGRE  414

Query  1311  DIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLP  1490
             DIHT+LMK YKDIPSWWFY+LL VT+ V+LALCIFLND+VQMP+WGLIFA+A+AF+FTLP
Sbjct  415   DIHTRLMKRYKDIPSWWFYLLLGVTLIVALALCIFLNDQVQMPWWGLIFASAMAFVFTLP  474

Query  1491  ISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYM  1670
             ISIITATTNQTPGLNIITEY+MGII PG+PIANVCFKTYGYMSM QA++FL+DFKLGHYM
Sbjct  475   ISIITATTNQTPGLNIITEYVMGIILPGRPIANVCFKTYGYMSMAQAVSFLNDFKLGHYM  534

Query  1671  KIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDAS  1847
             KIPPRSMFLVQFIGT++AGTIN++VAWWLL+SIENIC  D L +NSPWTCP DRVFFDAS
Sbjct  535   KIPPRSMFLVQFIGTILAGTINLAVAWWLLNSIENICQDDLLPANSPWTCPGDRVFFDAS  594

Query  1848  VIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGAT  2027
             VIWGLVGPKRIF + GNY A+NWFFLGG LGPVIVWLLH+ FP QSWIPLINLPVLLGAT
Sbjct  595   VIWGLVGPKRIFGTLGNYQAMNWFFLGGALGPVIVWLLHKSFPKQSWIPLINLPVLLGAT  654

Query  2028  GSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVG  2207
               MPPAT +NY++WI+VGTIFNFF+FRY+K WWQRYNY+LSA LDAGVAFMAVLLYF+VG
Sbjct  655   AMMPPATPVNYNAWIIVGTIFNFFIFRYKKTWWQRYNYVLSAALDAGVAFMAVLLYFSVG  714

Query  2208  LEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             +EDRT++WWGT   EHC+LA+CPTAKGI VDGCP F
Sbjct  715   IEDRTLNWWGTNG-EHCELATCPTAKGIMVDGCPDF  749



>ref|XP_006433763.1| hypothetical protein CICLE_v10003230mg [Citrus clementina]
 gb|ESR47003.1| hypothetical protein CICLE_v10003230mg [Citrus clementina]
Length=728

 Score =  1139 bits (2946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/729 (79%), Positives = 647/729 (89%), Gaps = 6/729 (1%)
 Frame = +3

Query  141   VSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQV  320
             +SPIE+VRLTV  TDD +LPVWTFRMW LG+ SC LLSFLNQFFSYR+EPLIIT ITVQV
Sbjct  1     MSPIEQVRLTVPTTDDASLPVWTFRMWFLGLFSCALLSFLNQFFSYRQEPLIITQITVQV  60

Query  321   ATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYA  500
             ATLPIGRFMA  LP AKFRIPGFGS +FSLNPGPFNMKEHVLITIFANAG AFG+GSAYA
Sbjct  61    ATLPIGRFMATLLPQAKFRIPGFGSREFSLNPGPFNMKEHVLITIFANAGSAFGSGSAYA  120

Query  501   VGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLF  680
             VGIVNII AFY + ISF++ W+LIITTQVLGYGWAGLL+KYVVEPAHMWWPSTLVQISLF
Sbjct  121   VGIVNIIKAFYVKNISFYSAWILIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQISLF  180

Query  681   RTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVT  860
             RTLHE E+   G     +SR KFFVI+L CSFCW+ FPGY FQ+L SISWVCW FP SV 
Sbjct  181   RTLHETEDNVGGKRH--LSRVKFFVIALVCSFCWHLFPGYFFQSLQSISWVCWAFPNSVA  238

Query  861   AHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGL  1040
             AHQ+GSGLNGLG+GALTLDW+ +ASFL SPL+CPFFAI NVFVGYA I+Y+V+P++YWGL
Sbjct  239   AHQIGSGLNGLGVGALTLDWTAVASFLFSPLICPFFAIANVFVGYAFIIYVVIPVAYWGL  298

Query  1041  NVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGF  1220
             N+YNAK FP++SS L+TAQG EY+I+ IVN +FELD   Y + GRI++STFF+L+YGFGF
Sbjct  299   NLYNAKTFPIFSSHLYTAQGPEYNITLIVNDKFELDLASYKQHGRIHMSTFFALTYGFGF  358

Query  1221  ATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSL  1400
             ATIA+T+THVALFYGREI DRYRAS++GK D+HT+LMKNYKDIPSWWF VLLV TIAVSL
Sbjct  359   ATIAATLTHVALFYGREILDRYRASSEGKQDVHTRLMKNYKDIPSWWFQVLLVGTIAVSL  418

Query  1401  ALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKP  1580
             ALCIFL  EVQMP+WGLIFA+ LAF+FTLP+SIITATTNQTPGLNIITEYIMG+I PG+P
Sbjct  419   ALCIFLKKEVQMPWWGLIFASGLAFIFTLPVSIITATTNQTPGLNIITEYIMGVILPGEP  478

Query  1581  IANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLL  1760
             IANVCFKTYGYMSM QAI+FLSDFKLGHYMKIPPRSMFLVQFIGT+IAGTIN+ VAWWLL
Sbjct  479   IANVCFKTYGYMSMAQAISFLSDFKLGHYMKIPPRSMFLVQFIGTIIAGTINLIVAWWLL  538

Query  1761  HSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
             +S+E+IC    L  NSPWTCP+DRVFFDASVIWGLVGP+RIF S+GNY ALNWFF+GG+L
Sbjct  539   NSVEHICQPGLLPKNSPWTCPNDRVFFDASVIWGLVGPRRIFGSQGNYGALNWFFVGGLL  598

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
             GP  VWLLH+KFP+QSWIPLINLPVLLGAT  MPPAT+LNY++WILVGTIFNFFVFRYRK
Sbjct  599   GPCAVWLLHKKFPNQSWIPLINLPVLLGATAYMPPATALNYNAWILVGTIFNFFVFRYRK  658

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTT---DLEHCDLASCPTAKG  2288
             KWWQRYNYILSA LDAG AFM VLLY ++GLE   + WWG+    D EHCDLA+CPTAKG
Sbjct  659   KWWQRYNYILSAALDAGTAFMTVLLYVSLGLEGVNLHWWGSNPDIDPEHCDLATCPTAKG  718

Query  2289  IAVDGCPVF  2315
             +AVDGCPVF
Sbjct  719   VAVDGCPVF  727



>ref|XP_009368318.1| PREDICTED: oligopeptide transporter 4 [Pyrus x bretschneideri]
Length=750

 Score =  1136 bits (2939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/757 (75%), Positives = 655/757 (87%), Gaps = 19/757 (3%)
 Frame = +3

Query  75    MGTVEIEAPALKLA-----------GEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMW  221
             M T+EIE P    +             D  D++VSPIE+VRLTVTNTDDPTLPVWTFRMW
Sbjct  1     MSTLEIEQPYPNTSFATTPKPTHSLEPDTEDDDVSPIEQVRLTVTNTDDPTLPVWTFRMW  60

Query  222   VLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQ  401
              LG+VSC LLSFLNQFFSYR EPLIIT ITVQV+TLPIG FMA  LP   F IPGFGS  
Sbjct  61    FLGLVSCALLSFLNQFFSYRTEPLIITQITVQVSTLPIGYFMAKVLPTKTFHIPGFGSRT  120

Query  402   FSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITT  581
             FSLNPGPFN+KEHVLITIFANAG AFG GSAYAVGIVNII AFY RKIS  A WLLIITT
Sbjct  121   FSLNPGPFNIKEHVLITIFANAGSAFGAGSAYAVGIVNIIKAFYHRKISLLASWLLIITT  180

Query  582   QVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVIS  761
             QVLGYGWAGLL+KYVVEPAHMWWP+TLVQ+SLFR LHEK+E+        MSRAKFF+I+
Sbjct  181   QVLGYGWAGLLRKYVVEPAHMWWPNTLVQVSLFRALHEKDEQR-------MSRAKFFLIT  233

Query  762   LCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFL  941
             L CSF WY FPGY+F TL +ISWVCW+F KSVTA Q+GSG+ GLG+GALTLDWS +ASFL
Sbjct  234   LVCSFTWYAFPGYLFTTLTNISWVCWLFSKSVTAQQIGSGMRGLGVGALTLDWSAVASFL  293

Query  942   SSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISA  1121
              SPL+CPFF IVNVF GYA+I+YLV+P++YWGL+ Y+A+ FP++SS LFTA+GQ+Y+I+A
Sbjct  294   FSPLICPFFVIVNVFAGYALILYLVIPMAYWGLDSYSAQKFPIFSSHLFTAEGQDYNITA  353

Query  1122  IVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTK  1301
             IVN +F+LD  +Y +QGRI+LS FF+L+YGFGFATIAST+THVALFYGREI DRYRAS K
Sbjct  354   IVNDKFQLDISKYEEQGRIHLSMFFALTYGFGFATIASTLTHVALFYGREILDRYRASYK  413

Query  1302  GKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMF  1481
             GK DIHT+LM+ YKDIPSWWFY+LL++T+AVSL LCI LNDEVQMP+WGL+FA A+AF F
Sbjct  414   GKEDIHTRLMRRYKDIPSWWFYMLLIITVAVSLVLCIVLNDEVQMPWWGLLFAGAMAFTF  473

Query  1482  TLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLG  1661
             TLPISIITATTNQTPGLNIITEY+MGII PG+PIANVCFKTYGYMSM QA++FL+DFKLG
Sbjct  474   TLPISIITATTNQTPGLNIITEYVMGIILPGRPIANVCFKTYGYMSMAQAVSFLNDFKLG  533

Query  1662  HYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFD  1841
             HYMKIPPRSMFLVQFIGT++AGT+N++VA WLL+SI+N+C  D  S+SPWTCP+DRVFFD
Sbjct  534   HYMKIPPRSMFLVQFIGTILAGTVNLAVAHWLLNSIKNMCVDDPHSDSPWTCPNDRVFFD  593

Query  1842  ASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLG  2021
             ASVIWGL GPKRIF S GNY A+NWFFLGG +GPVIVW+LH+ +P Q WI LINLPVLLG
Sbjct  594   ASVIWGLAGPKRIFGSLGNYGAMNWFFLGGAVGPVIVWVLHKAYPKQHWIRLINLPVLLG  653

Query  2022  ATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFT  2201
             ATG MPPAT+LNY+SWI+VGTIFNFFVFRYRK WWQRYNYILSA +DAGVAFMAVLLY +
Sbjct  654   ATGLMPPATALNYNSWIIVGTIFNFFVFRYRKNWWQRYNYILSAAMDAGVAFMAVLLYLS  713

Query  2202  VGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             VG+E+++++WWGT   EHCDLA+CPTAKGIAVD CPV
Sbjct  714   VGMENKSLTWWGTNG-EHCDLATCPTAKGIAVDSCPV  749



>ref|XP_003593303.1| Oligopeptide transporter [Medicago truncatula]
 gb|ABN05713.1| Peptidase aspartic, active site; Oligopeptide transporter OPT 
superfamily [Medicago truncatula]
 gb|AES63554.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=729

 Score =  1134 bits (2934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/719 (80%), Positives = 638/719 (89%), Gaps = 8/719 (1%)
 Frame = +3

Query  159   VRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIG  338
             VRLTVTNTDDPT PVWTFRMW LG++SC LLSFLNQFF+YR EPLIIT ITVQVATLPIG
Sbjct  17    VRLTVTNTDDPTQPVWTFRMWFLGLISCSLLSFLNQFFAYRTEPLIITLITVQVATLPIG  76

Query  339   RFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNI  518
              FMAA LP  KFRIPGFG+ + SLNPGPFNMKEHVLITIFANAG AFG+GS YAVGIVNI
Sbjct  77    HFMAAILPTTKFRIPGFGTKKLSLNPGPFNMKEHVLITIFANAGSAFGSGSPYAVGIVNI  136

Query  519   IIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHek  698
             I AFY R ISF A WLLIITTQVLGYGWAGLL+KYVVEPAHMWWPSTLVQ+SLFR LHEK
Sbjct  137   IKAFYGRSISFHAAWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFRALHEK  196

Query  699   eeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgs  878
             +++        +SRAKFF I+L CSF WY  PGY+F TL SISWVCWVF KSVTA QLGS
Sbjct  197   DDDHR------ISRAKFFFIALVCSFSWYVIPGYLFTTLTSISWVCWVFTKSVTAQQLGS  250

Query  879   glnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAK  1058
             G+ GLG+GA+TLDW+ +ASFL SPL+ PFFAIVNVFVGY +I+Y V+PI+YWGLN YNAK
Sbjct  251   GMKGLGIGAITLDWTAVASFLFSPLISPFFAIVNVFVGYVLIIYAVVPIAYWGLNAYNAK  310

Query  1059  IFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIAST  1238
              FPL+SS LFTAQGQ+Y+ISAIVN +FELDE +YA+QGRI+LS FFSL+YGFGFATIAST
Sbjct  311   TFPLFSSHLFTAQGQKYNISAIVNDKFELDEAKYAEQGRIHLSVFFSLTYGFGFATIAST  370

Query  1239  ITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFL  1418
             +THVA FYGREI +RYRAS+KGK DIHTKLMK YKDIPSWWFY LLVVT+AVSL LCIFL
Sbjct  371   LTHVACFYGREIMERYRASSKGKEDIHTKLMKRYKDIPSWWFYALLVVTLAVSLVLCIFL  430

Query  1419  NDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCF  1598
             ND++QMP+WGL+FA ALAF FTLPISIITATTNQTPGLNIITEY+ G+IYPG+PIANVCF
Sbjct  431   NDQIQMPWWGLLFAGALAFAFTLPISIITATTNQTPGLNIITEYVFGLIYPGRPIANVCF  490

Query  1599  KTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENI  1778
             KTYGY+SM QA++FLSDFKLGHYMKIPPRSMFLVQFIGT++AGTIN+ VAWWLL+S+ENI
Sbjct  491   KTYGYISMAQAVSFLSDFKLGHYMKIPPRSMFLVQFIGTMLAGTINIGVAWWLLNSVENI  550

Query  1779  CHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVW  1955
             CH D L   SPWTCP DRVFFDASVIWGLVGPKRIF S+GNY+A+NWFF+GG +GP+IVW
Sbjct  551   CHDDLLPEGSPWTCPGDRVFFDASVIWGLVGPKRIFGSKGNYSAMNWFFIGGAIGPIIVW  610

Query  1956  LLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRY  2135
             LLH+ FP QSWI LINLPVLLGAT  MPPAT LNY+SWI VGTIFNFFVFRYRKKWWQRY
Sbjct  611   LLHKAFPRQSWIALINLPVLLGATAMMPPATPLNYNSWIFVGTIFNFFVFRYRKKWWQRY  670

Query  2136  NYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             NY+LSA LD GVAFM VLLYF++ LE+R+ISWWG T+ EHC LASCPTAKGIAVDGCPV
Sbjct  671   NYVLSAALDTGVAFMTVLLYFSLSLENRSISWWG-TEGEHCPLASCPTAKGIAVDGCPV  728



>ref|XP_010030911.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=739

 Score =  1134 bits (2933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/750 (75%), Positives = 652/750 (87%), Gaps = 16/750 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGE---DVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCV  245
             MGT+E++ P      E    VN++++SPIEEVRLTVTNTDDPTLPVWTFRMW LG++SC 
Sbjct  1     MGTLELQPPPTTRPSELDDAVNEDDLSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLLSCA  60

Query  246   LLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPF  425
             LLSF+NQF ++R EPLI+T ITV VATLPIGRFMAAALP AKFRIPGFGS  FSLNPGPF
Sbjct  61    LLSFINQFMAFRTEPLIVTQITVLVATLPIGRFMAAALPKAKFRIPGFGSQLFSLNPGPF  120

Query  426   NMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWA  605
             N+KEHVLI+IFANAG      +AY +GIV II AFY R ISFFAGWLLIITTQVLGYGWA
Sbjct  121   NLKEHVLISIFANAGSG----TAYGIGIVTIIKAFYHRSISFFAGWLLIITTQVLGYGWA  176

Query  606   GLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWY  785
             GLL+KYVVEPAHMWWPS LVQ+S FR LHE++E+        MSRAKFFVI+L CSF WY
Sbjct  177   GLLRKYVVEPAHMWWPSALVQVSFFRALHERDEQR-------MSRAKFFVIALICSFSWY  229

Query  786   FFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPF  965
               PGY+F TL ++SWVCWVF  SVTA Q+GSG+ GLGLGALTLDW+T+ASFLSSPLVCPF
Sbjct  230   VVPGYLFSTLTNVSWVCWVFSNSVTAQQIGSGMRGLGLGALTLDWTTVASFLSSPLVCPF  289

Query  966   FAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFEL  1145
             FAIVN+FVGYA+I+Y+VMPI+YWG N+Y A  FP++SS LFTAQG+ YDI+AIVN +FEL
Sbjct  290   FAIVNIFVGYALIIYVVMPIAYWGFNLYGANRFPIFSSHLFTAQGERYDITAIVNDKFEL  349

Query  1146  DEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTK  1325
             D  +Y +QGRI+LS FF+L YGFGFATIASTITHV  FYGREIY+RYR S KGK D+H+K
Sbjct  350   DIPKYEEQGRIHLSMFFALFYGFGFATIASTITHVTFFYGREIYERYRDSHKGKADVHSK  409

Query  1326  LMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIIT  1505
             LM+ YKDIPSWWF++LL+V++  SLALCIFLND+VQMP+WGL+F + LAF+FTLPISIIT
Sbjct  410   LMRRYKDIPSWWFHLLLIVSLVGSLALCIFLNDQVQMPWWGLLFGSTLAFVFTLPISIIT  469

Query  1506  ATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPR  1685
             ATTNQTPGLNIITEYIMGII PG+PIANVCFKTYGY+SM QA+ FL+DFKLGHYMKIPPR
Sbjct  470   ATTNQTPGLNIITEYIMGIILPGRPIANVCFKTYGYISMAQAVFFLNDFKLGHYMKIPPR  529

Query  1686  SMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGL  1862
             SMFLVQFIGT++AGTIN++VAWWLL+S+ NIC  D L  +SPWTCP DRVFFDASVIWGL
Sbjct  530   SMFLVQFIGTILAGTINIAVAWWLLNSVTNICQDDLLPPDSPWTCPGDRVFFDASVIWGL  589

Query  1863  VGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPP  2042
             VGP+RIF + GNY A+NWFFLGG +GP+IVWLLH+ FP QSWIPLINLPVLLGATG MPP
Sbjct  590   VGPRRIFGTLGNYQAMNWFFLGGAIGPIIVWLLHKAFPKQSWIPLINLPVLLGATGMMPP  649

Query  2043  ATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRT  2222
             AT LNY++W+LVGTIFNFFVFRYRK+WWQRYNY+LSA LDAG AFMAVLLYF+VG+E+++
Sbjct  650   ATPLNYNAWVLVGTIFNFFVFRYRKQWWQRYNYVLSAALDAGTAFMAVLLYFSVGMENKS  709

Query  2223  ISWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             I+WWGT   EHC+LA+CPTAKGI VDGCP+
Sbjct  710   ITWWGTNG-EHCELAACPTAKGIEVDGCPI  738



>ref|XP_002527347.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF35019.1| Oligopeptide transporter, putative [Ricinus communis]
Length=744

 Score =  1132 bits (2929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/752 (76%), Positives = 655/752 (87%), Gaps = 13/752 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             MG+VEIEAP  K   ED    E+SPIEEVRLTV+NTDDP+LPVWTFRMW LG+VSC LLS
Sbjct  1     MGSVEIEAPPTKKLEED----EISPIEEVRLTVSNTDDPSLPVWTFRMWFLGLVSCCLLS  56

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLNQFFSYR EPL+IT ITVQVATLPIGR MAA LP  KFRIPGFG  +FSLNPGPFN+K
Sbjct  57    FLNQFFSYRTEPLVITQITVQVATLPIGRVMAAVLPQTKFRIPGFGGREFSLNPGPFNVK  116

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI+IFANAG AFGNGSAYA+ IVNII A Y R ISF A W+LIITTQ LGYGWAGLL
Sbjct  117   EHVLISIFANAGSAFGNGSAYAIEIVNIIKAIYGRSISFLASWVLIITTQALGYGWAGLL  176

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             +KYVVEPAHMWWP TLVQISLFRTLHEKEE E+G     MSR KFFVI+L CSF WY  P
Sbjct  177   RKYVVEPAHMWWPGTLVQISLFRTLHEKEETENGNR---MSRVKFFVIALTCSFLWYLVP  233

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
             GY+FQT+ S++W+CW FPKSVTA Q+GSG+ GLG+GA TLDWSTIASFL SPL+ PFFAI
Sbjct  234   GYLFQTVQSVAWICWAFPKSVTAQQIGSGMGGLGVGAFTLDWSTIASFLLSPLLTPFFAI  293

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
             VNVF+GY +I+Y++ PI+YWGLN+YNAK +P+ SS LF AQG  Y+ SAI+N +FELD  
Sbjct  294   VNVFIGYVLILYVLTPITYWGLNLYNAKTYPIISSHLFDAQGARYNFSAIINDKFELDMA  353

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
             +Y K GR+++STFF++SYG GFATIA+T+THVALFYGREIYDRY+AS +GK D+HT+LMK
Sbjct  354   QYQKLGRVHMSTFFAVSYGLGFATIAATLTHVALFYGREIYDRYKASYEGKEDVHTRLMK  413

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
             +Y+DIP+WWFYVLL VT   SLALCIF+ND+VQ+P+WGLI AAALAF+FTLPISIITATT
Sbjct  414   SYRDIPTWWFYVLLAVTFVASLALCIFMNDQVQLPWWGLILAAALAFIFTLPISIITATT  473

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQTPGLNIITEYIMG+IYPG+PIANVCFKTYGYMSM+QA++FLSDFKLGHYMKIPPRSMF
Sbjct  474   NQTPGLNIITEYIMGLIYPGRPIANVCFKTYGYMSMSQAVSFLSDFKLGHYMKIPPRSMF  533

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVG  1868
             LVQFIGT+IAGTIN+ VAWWLL SI+ IC QD+L  SNSPWTCP  RVFFDASVIWGLVG
Sbjct  534   LVQFIGTIIAGTINLGVAWWLLDSIDYIC-QDQLLPSNSPWTCPGSRVFFDASVIWGLVG  592

Query  1869  PKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPAT  2048
             PKRIF S G Y+ALNWFFLGG+LGPV+VWL H+KFP+Q+WIPLINLPVL GAT  MPPAT
Sbjct  593   PKRIFGSLGEYSALNWFFLGGLLGPVVVWLFHKKFPNQTWIPLINLPVLFGATAIMPPAT  652

Query  2049  SLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTIS  2228
             ++N++SWILVGTIFNFF+FRYRK WWQRYNY+LSA LDAGVAFMAVL+YFT+GLE+  + 
Sbjct  653   AVNFNSWILVGTIFNFFIFRYRKNWWQRYNYVLSAALDAGVAFMAVLIYFTLGLENVNMH  712

Query  2229  WWGTT---DLEHCDLASCPTAKGIAVDGCPVF  2315
             WWG+    D EHC LASCPTAKGI  DGCP+F
Sbjct  713   WWGSDPNIDPEHCPLASCPTAKGIISDGCPIF  744



>ref|XP_008237085.1| PREDICTED: oligopeptide transporter 4-like [Prunus mume]
Length=747

 Score =  1130 bits (2924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/754 (75%), Positives = 653/754 (87%), Gaps = 16/754 (2%)
 Frame = +3

Query  75    MGTVEIEAP--------ALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLG  230
             MG++E E P          K    D  D++VSPIE+VRLTVTNTDDPTLPVWTFRMW LG
Sbjct  1     MGSLEPEPPNSDTTFATTPKPLYSDAEDDDVSPIEQVRLTVTNTDDPTLPVWTFRMWFLG  60

Query  231   VVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSL  410
             ++SC LLSFLNQFFSYR EPLIIT ITVQV+ LPIG FMA  LP  KF IPGFGS  FSL
Sbjct  61    LLSCALLSFLNQFFSYRTEPLIITQITVQVSALPIGHFMAKVLPTNKFHIPGFGSRSFSL  120

Query  411   NPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVL  590
             NPGPFN+KEHVL+TIFANAG AFG GSAYAVGIV II  FY RKIS  A WLLIITTQVL
Sbjct  121   NPGPFNIKEHVLVTIFANAGSAFGVGSAYAVGIVTIIKVFYGRKISLLASWLLIITTQVL  180

Query  591   GYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCC  770
             GYGWAGLL+KYVVEPAHMWWP+TLVQ+SLFR LHEK+E+        MSRAKFF+I+L C
Sbjct  181   GYGWAGLLRKYVVEPAHMWWPNTLVQVSLFRALHEKDEQR-------MSRAKFFLIALVC  233

Query  771   SFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSP  950
             SF WY FPGY+F TL +ISWVCW+F KSVTA Q+GSG+ GLG+GALTLDWS +ASFL SP
Sbjct  234   SFTWYAFPGYLFTTLTNISWVCWLFSKSVTAQQIGSGMRGLGVGALTLDWSAVASFLFSP  293

Query  951   LVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVN  1130
             L+ PFF IVNVF GYA+I+Y  +PI+YWGL++Y A+ FP++SS LFTAQGQ+Y+I+AIVN
Sbjct  294   LISPFFVIVNVFAGYALILYFAIPIAYWGLDLYTAQRFPIFSSHLFTAQGQDYNITAIVN  353

Query  1131  KQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKM  1310
              +FELD  +Y +QGRI+LSTFF+L+YGFGFATIAST+THVALFYGREI DRYRAS KGK 
Sbjct  354   DKFELDIPKYEEQGRIHLSTFFALTYGFGFATIASTLTHVALFYGREILDRYRASYKGKE  413

Query  1311  DIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLP  1490
             DIHT+LM+ YKDIPSWWFY+LL++T+AVSL LC  LND+VQMP+WGL+FAAA+AF+FTLP
Sbjct  414   DIHTRLMRRYKDIPSWWFYMLLIITVAVSLVLCTVLNDQVQMPWWGLLFAAAMAFVFTLP  473

Query  1491  ISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYM  1670
             ISIITATTNQTPGLNIITEYIMGII PG+PIANVCFKTYGYMSM QA++FL+DFKLGHYM
Sbjct  474   ISIITATTNQTPGLNIITEYIMGIILPGRPIANVCFKTYGYMSMAQAVSFLNDFKLGHYM  533

Query  1671  KIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASV  1850
             KIPPRSMFLVQFIGT++AGT+N++VA+WLL+SI NIC  D  S+SPWTCPSDRVFFDASV
Sbjct  534   KIPPRSMFLVQFIGTILAGTVNLAVAYWLLNSITNICVDDPQSDSPWTCPSDRVFFDASV  593

Query  1851  IWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATG  2030
             IWGL GPKRIF + G Y A+NWFFLGG +GPVIVW+LH+ +P Q+WI LINLPVLLGATG
Sbjct  594   IWGLAGPKRIFGTLGIYGAMNWFFLGGAVGPVIVWVLHKAYPKQNWIRLINLPVLLGATG  653

Query  2031  SMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGL  2210
             SMPPAT+LNY+SWI+VGTIFNFFVFRYRKKWWQRYNY+LSA LDAG+AFMAVLLY +VG+
Sbjct  654   SMPPATALNYNSWIIVGTIFNFFVFRYRKKWWQRYNYVLSAALDAGLAFMAVLLYLSVGM  713

Query  2211  EDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             E+ +++WWGT   EHCDLA+CPTAKGI VDGCPV
Sbjct  714   ENISVAWWGTNG-EHCDLATCPTAKGIVVDGCPV  746



>gb|KCW56911.1| hypothetical protein EUGRSUZ_I02587 [Eucalyptus grandis]
Length=739

 Score =  1130 bits (2924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/750 (75%), Positives = 650/750 (87%), Gaps = 16/750 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGE---DVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCV  245
             MGT+E++ P      E    VN++++SPIEEVRLTVTNTDDPTLPVWTFRMW LG++SC 
Sbjct  1     MGTLELQPPPTTRPSELDDAVNEDDLSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLLSCA  60

Query  246   LLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPF  425
             LLSF+NQF ++R EPLI+T ITV VATLPIGRFMAAALP AKFRIPGFGS  FSLNPGPF
Sbjct  61    LLSFINQFMAFRTEPLIVTQITVLVATLPIGRFMAAALPKAKFRIPGFGSQLFSLNPGPF  120

Query  426   NMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWA  605
             N+KEHVLI+IFANAG      +AY +GIV II AFY R ISFFAGWLLIITTQVLGYGWA
Sbjct  121   NLKEHVLISIFANAGSG----TAYGIGIVTIIKAFYHRSISFFAGWLLIITTQVLGYGWA  176

Query  606   GLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWY  785
             GLL+KYVVEPAHMWWPS LVQ+S FR LHE++E+        MSRAKFFVI+L CSF WY
Sbjct  177   GLLRKYVVEPAHMWWPSALVQVSFFRALHERDEQR-------MSRAKFFVIALICSFSWY  229

Query  786   FFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPF  965
               PGY+F TL ++SWVCWVF  SVTA Q+GSG+ GLGLGALTLDW+T+ASFLSSPLVCPF
Sbjct  230   VVPGYLFSTLTNVSWVCWVFSNSVTAQQIGSGMRGLGLGALTLDWTTVASFLSSPLVCPF  289

Query  966   FAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFEL  1145
             FAIVN+FVGYA+I+Y+VMPI+YWG N+Y A  FP++SS LFTAQG+ YDI+AIVN +FEL
Sbjct  290   FAIVNIFVGYALIIYVVMPIAYWGFNLYGANRFPIFSSHLFTAQGERYDITAIVNDKFEL  349

Query  1146  DEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTK  1325
             D  +Y +QGRI+LS FF+L YGFGFATIASTITHV  FYGREIY+RYR S KGK D+H+K
Sbjct  350   DIPKYEEQGRIHLSMFFALFYGFGFATIASTITHVTFFYGREIYERYRDSHKGKADVHSK  409

Query  1326  LMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIIT  1505
             LM+ YKDIPSWWF++LL+V++  SLALCIFLND+VQMP+WGL+F + LAF+FTLPISIIT
Sbjct  410   LMRRYKDIPSWWFHLLLIVSLVGSLALCIFLNDQVQMPWWGLLFGSTLAFVFTLPISIIT  469

Query  1506  ATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPR  1685
             ATTNQTPGLNIITEYIMGII PG+PIANVCFKTYGY+SM QA+ FL+DFKLGHYMKIPPR
Sbjct  470   ATTNQTPGLNIITEYIMGIILPGRPIANVCFKTYGYISMAQAVFFLNDFKLGHYMKIPPR  529

Query  1686  SMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGL  1862
             SMFLVQFIGT++AGTIN++VAWWLL+S+ NIC  D L  +SPWTCP DRVFFDASVIWGL
Sbjct  530   SMFLVQFIGTILAGTINIAVAWWLLNSVTNICQDDLLPPDSPWTCPGDRVFFDASVIWGL  589

Query  1863  VGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPP  2042
             VGP+RIF + GNY A+NWFFLGG +GP+IVWLLH+ FP QSWIPLINLPVLLGATG MP 
Sbjct  590   VGPRRIFGTLGNYQAMNWFFLGGAIGPIIVWLLHKTFPKQSWIPLINLPVLLGATGMMPA  649

Query  2043  ATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRT  2222
             AT LNYS+WILVGTIFNFF+FRYRK+WWQRYNY+LSA LDAGVAFMAVLLYF V +E+++
Sbjct  650   ATPLNYSAWILVGTIFNFFIFRYRKQWWQRYNYVLSAALDAGVAFMAVLLYFAVNIENKS  709

Query  2223  ISWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             ++WWGT   EHC+LA+CPTAKGI VDGCPV
Sbjct  710   LTWWGTNG-EHCELAACPTAKGIEVDGCPV  738



>ref|XP_009790410.1| PREDICTED: oligopeptide transporter 4 [Nicotiana sylvestris]
Length=738

 Score =  1130 bits (2923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/746 (77%), Positives = 658/746 (88%), Gaps = 11/746 (1%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             MGT   E+P       D +DE  SPIEEVRLTVTNTDDPTLPVWTFRMW LG+ SC LLS
Sbjct  1     MGTYRPESPPYPAGAADDDDE--SPIEEVRLTVTNTDDPTLPVWTFRMWFLGLFSCCLLS  58

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLNQFFSYR EPL+IT ITVQVATLPIG F+A  LP  KFR+PGFGS  FSLNPGPFNMK
Sbjct  59    FLNQFFSYRTEPLVITQITVQVATLPIGHFLATVLPTTKFRLPGFGSRSFSLNPGPFNMK  118

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI+IFANAG AFGNGSAYAVGIV II AFY R ISF AGWLLIITTQVLGYGWAGLL
Sbjct  119   EHVLISIFANAGSAFGNGSAYAVGIVTIIKAFYHRNISFLAGWLLIITTQVLGYGWAGLL  178

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             +KYVVEPAHMWWPSTLVQ+SLFR LHEK++         MSRAKFF+I+L CSFCWY  P
Sbjct  179   RKYVVEPAHMWWPSTLVQVSLFRALHEKDDRR-------MSRAKFFLIALVCSFCWYLVP  231

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
             GY+F TL SISW+CW F KSVTA Q+GSG+ GLGLGA+TLDWS +ASFL SPL+CPFFAI
Sbjct  232   GYLFSTLTSISWICWAFSKSVTAQQIGSGMRGLGLGAITLDWSAVASFLFSPLICPFFAI  291

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
             VNVF GY +I+Y+V+PI+YWG ++Y A+ FP++SS LFTAQGQ+YDISAIVN +FELD  
Sbjct  292   VNVFAGYMLIIYMVIPIAYWGFDLYGARKFPIFSSHLFTAQGQKYDISAIVNDKFELDIG  351

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
             +Y +QGRI++S FF+L+YGFGFATIAST+THVALFYGREIY+R+RAS KGK DIHT+LM+
Sbjct  352   KYEEQGRIHISMFFALTYGFGFATIASTLTHVALFYGREIYERFRASYKGKEDIHTRLMR  411

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
              YKDIPSWWF  LL+VT+ VSL LCIFLN++VQMP+WGL+FA+A+AF+FTLPISIITATT
Sbjct  412   KYKDIPSWWFNALLLVTLTVSLILCIFLNNQVQMPWWGLLFASAIAFIFTLPISIITATT  471

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQTPGLNIITEY+MGII PG+PIANVCFK YGYMSM+QA++FLSDFKLGHYMKIPPRSMF
Sbjct  472   NQTPGLNIITEYVMGIILPGRPIANVCFKVYGYMSMSQAVSFLSDFKLGHYMKIPPRSMF  531

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGP  1871
             LVQF+GT+I+GTIN+SVAWWLL+SIENIC  D L  +SPWTCP DRVFFDASVIWGLVGP
Sbjct  532   LVQFLGTIISGTINISVAWWLLNSIENICQDDLLPPDSPWTCPGDRVFFDASVIWGLVGP  591

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATS  2051
             KRIF S GNY+++NWFFLGG +GPVIVWLLH+ FP++SWIPLINLPVLLGATG+MPPAT 
Sbjct  592   KRIFGSLGNYSSMNWFFLGGAVGPVIVWLLHKVFPTKSWIPLINLPVLLGATGAMPPATP  651

Query  2052  LNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISW  2231
             LNY++W++VGTIFNFF+FRYRK+WWQRYNYILSA LDAGVAFMAVLLYF++G+E++ ++W
Sbjct  652   LNYNAWVIVGTIFNFFIFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLGMENKGLTW  711

Query  2232  WGTTDLEHCDLASCPTAKGIAVDGCP  2309
             WGT   EHC+LA+CPTAKGIAVDGCP
Sbjct  712   WGTNG-EHCELATCPTAKGIAVDGCP  736



>gb|KCW56912.1| hypothetical protein EUGRSUZ_I02589 [Eucalyptus grandis]
Length=770

 Score =  1130 bits (2922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/750 (75%), Positives = 656/750 (87%), Gaps = 12/750 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGE---DVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCV  245
             MGT+E++ P      E    V+++++SPIEEVRLTVTNTDDPTLPVWTFRMW LG++SC 
Sbjct  28    MGTLELQPPPTARPSELDDAVDEDDLSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLLSCA  87

Query  246   LLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPF  425
             LLSF+NQFF+YR EPLI+T I+V VATLPIGRFMA ALP AKFRIPGFGS  FSLNPGPF
Sbjct  88    LLSFINQFFAYRTEPLIVTQISVLVATLPIGRFMATALPRAKFRIPGFGSQLFSLNPGPF  147

Query  426   NMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWA  605
             N+KEHVLI+IFANAG AFG+G  Y +GIV II AFY R ISFFAGWLLIITTQVLGYGWA
Sbjct  148   NLKEHVLISIFANAGTAFGSGWPYGIGIVTIIKAFYHRSISFFAGWLLIITTQVLGYGWA  207

Query  606   GLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWY  785
             GLL+KYVVEPAHMWWP+TL Q+SLFR LHE++E+        MSRAKFFVI+L CSF WY
Sbjct  208   GLLRKYVVEPAHMWWPATLGQVSLFRALHERDEQR-------MSRAKFFVIALICSFSWY  260

Query  786   FFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPF  965
               PGY+F TL ++SWVCWVF  SVTA Q+GSG+ GLGLGALTLDW+ +ASFLSSPLVCPF
Sbjct  261   VVPGYLFSTLTNVSWVCWVFSNSVTAQQIGSGMRGLGLGALTLDWTAVASFLSSPLVCPF  320

Query  966   FAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFEL  1145
             FAIVN+FVGYA+I+Y+V+PI+YWG N+Y A  FP++SS LFTA+G+ YDI+AIVN +FEL
Sbjct  321   FAIVNIFVGYALIIYVVLPIAYWGFNLYGANRFPIFSSHLFTAKGERYDITAIVNDKFEL  380

Query  1146  DEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTK  1325
             D  +Y +QGRI+LS FF+L+YGFGFATIAST+THVA FYGREIY+RYR S KGK DIHTK
Sbjct  381   DIPKYEEQGRIHLSVFFALTYGFGFATIASTVTHVAFFYGREIYERYRDSHKGKADIHTK  440

Query  1326  LMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIIT  1505
             LM+ YKDIPSWWF++LL+V++ VSLALCIFLND+VQMP+WG++F +ALAF+FTLPISIIT
Sbjct  441   LMRRYKDIPSWWFHLLLIVSLVVSLALCIFLNDQVQMPWWGILFGSALAFVFTLPISIIT  500

Query  1506  ATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPR  1685
             ATTNQTPGLNIITEYIMGII PG+PIANVCFKTYGY+SM QA++FL+DFKLGHYMKIPPR
Sbjct  501   ATTNQTPGLNIITEYIMGIILPGRPIANVCFKTYGYISMAQAVSFLNDFKLGHYMKIPPR  560

Query  1686  SMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGL  1862
             SMFLVQFIGT++AGTIN++VAWWLL+S+ NIC  D L  +SPWTCP DRVFFDASVIWGL
Sbjct  561   SMFLVQFIGTILAGTINIAVAWWLLNSVTNICQDDLLPPDSPWTCPDDRVFFDASVIWGL  620

Query  1863  VGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPP  2042
             VGP+RIF + GNY A+NWFFLGG +GP+IVWLLH+ FP QSWIPLINLPVLLGATG MP 
Sbjct  621   VGPRRIFGTLGNYQAMNWFFLGGAIGPIIVWLLHKTFPKQSWIPLINLPVLLGATGMMPA  680

Query  2043  ATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRT  2222
             AT LNY++WILVGTIFNFF+FRYRK+WWQRYNY+LSA LDAG AFMAVLLYF V +E+++
Sbjct  681   ATPLNYNAWILVGTIFNFFIFRYRKQWWQRYNYVLSAALDAGAAFMAVLLYFAVNIENKS  740

Query  2223  ISWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             I+WWGT   EHC+LA+CPTAKGI  DGCPV
Sbjct  741   ITWWGTNG-EHCELAACPTAKGIEGDGCPV  769



>ref|XP_010029956.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=743

 Score =  1129 bits (2919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/750 (75%), Positives = 656/750 (87%), Gaps = 12/750 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGE---DVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCV  245
             MGT+E++ P      E    V+++++SPIEEVRLTVTNTDDPTLPVWTFRMW LG++SC 
Sbjct  1     MGTLELQPPPTARPSELDDAVDEDDLSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLLSCA  60

Query  246   LLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPF  425
             LLSF+NQFF+YR EPLI+T I+V VATLPIGRFMA ALP AKFRIPGFGS  FSLNPGPF
Sbjct  61    LLSFINQFFAYRTEPLIVTQISVLVATLPIGRFMATALPRAKFRIPGFGSQLFSLNPGPF  120

Query  426   NMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWA  605
             N+KEHVLI+IFANAG AFG+G  Y +GIV II AFY R ISFFAGWLLIITTQVLGYGWA
Sbjct  121   NLKEHVLISIFANAGTAFGSGWPYGIGIVTIIKAFYHRSISFFAGWLLIITTQVLGYGWA  180

Query  606   GLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWY  785
             GLL+KYVVEPAHMWWP+TL Q+SLFR LHE++E+        MSRAKFFVI+L CSF WY
Sbjct  181   GLLRKYVVEPAHMWWPATLGQVSLFRALHERDEQR-------MSRAKFFVIALICSFSWY  233

Query  786   FFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPF  965
               PGY+F TL ++SWVCWVF  SVTA Q+GSG+ GLGLGALTLDW+ +ASFLSSPLVCPF
Sbjct  234   VVPGYLFSTLTNVSWVCWVFSNSVTAQQIGSGMRGLGLGALTLDWTAVASFLSSPLVCPF  293

Query  966   FAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFEL  1145
             FAIVN+FVGYA+I+Y+V+PI+YWG N+Y A  FP++SS LFTA+G+ YDI+AIVN +FEL
Sbjct  294   FAIVNIFVGYALIIYVVLPIAYWGFNLYGANRFPIFSSHLFTAKGERYDITAIVNDKFEL  353

Query  1146  DEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTK  1325
             D  +Y +QGRI+LS FF+L+YGFGFATIAST+THVA FYGREIY+RYR S KGK DIHTK
Sbjct  354   DIPKYEEQGRIHLSVFFALTYGFGFATIASTVTHVAFFYGREIYERYRDSHKGKADIHTK  413

Query  1326  LMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIIT  1505
             LM+ YKDIPSWWF++LL+V++ VSLALCIFLND+VQMP+WG++F +ALAF+FTLPISIIT
Sbjct  414   LMRRYKDIPSWWFHLLLIVSLVVSLALCIFLNDQVQMPWWGILFGSALAFVFTLPISIIT  473

Query  1506  ATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPR  1685
             ATTNQTPGLNIITEYIMGII PG+PIANVCFKTYGY+SM QA++FL+DFKLGHYMKIPPR
Sbjct  474   ATTNQTPGLNIITEYIMGIILPGRPIANVCFKTYGYISMAQAVSFLNDFKLGHYMKIPPR  533

Query  1686  SMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGL  1862
             SMFLVQFIGT++AGTIN++VAWWLL+S+ NIC  D L  +SPWTCP DRVFFDASVIWGL
Sbjct  534   SMFLVQFIGTILAGTINIAVAWWLLNSVTNICQDDLLPPDSPWTCPDDRVFFDASVIWGL  593

Query  1863  VGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPP  2042
             VGP+RIF + GNY A+NWFFLGG +GP+IVWLLH+ FP QSWIPLINLPVLLGATG MP 
Sbjct  594   VGPRRIFGTLGNYQAMNWFFLGGAIGPIIVWLLHKTFPKQSWIPLINLPVLLGATGMMPA  653

Query  2043  ATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRT  2222
             AT LNY++WILVGTIFNFF+FRYRK+WWQRYNY+LSA LDAG AFMAVLLYF V +E+++
Sbjct  654   ATPLNYNAWILVGTIFNFFIFRYRKQWWQRYNYVLSAALDAGAAFMAVLLYFAVNIENKS  713

Query  2223  ISWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             I+WWGT   EHC+LA+CPTAKGI  DGCPV
Sbjct  714   ITWWGTNG-EHCELAACPTAKGIEGDGCPV  742



>ref|XP_002283680.1| PREDICTED: oligopeptide transporter 4 [Vitis vinifera]
Length=757

 Score =  1127 bits (2916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/757 (76%), Positives = 649/757 (86%), Gaps = 10/757 (1%)
 Frame = +3

Query  75    MGTVEIEAPALKL-AGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLL  251
             MGTVEIEAP +K    EDV ++E+SPIEEVRLTV N DDP+LPVWTFRMW LG++SC LL
Sbjct  1     MGTVEIEAPIIKTRTDEDVKEDELSPIEEVRLTVPNDDDPSLPVWTFRMWFLGLISCALL  60

Query  252   SFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFR--IPGFGSGQFSLNPGPF  425
             SFLNQFFSYR+EPL+I+ ITVQVATLPIGRFMA+ LP  KF   IP FG  + SLNPGPF
Sbjct  61    SFLNQFFSYRKEPLVISQITVQVATLPIGRFMASVLPDIKFHVHIPFFGKKELSLNPGPF  120

Query  426   NMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWA  605
             NMKEHVLI+IFANAG AFG GSAYAVGIV II AFY+R IS+ AGW+LIITTQVLGYGWA
Sbjct  121   NMKEHVLISIFANAGSAFGGGSAYAVGIVTIIKAFYKRNISYLAGWILIITTQVLGYGWA  180

Query  606   GLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrM---SRAKFFVISLCCSF  776
             GLL+KYVVEPAHMWWPSTLVQISLFRTLH KE E D          SR+KFF+I++ CSF
Sbjct  181   GLLRKYVVEPAHMWWPSTLVQISLFRTLHGKENEVDEQETEVQQRTSRSKFFLIAMLCSF  240

Query  777   CWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLV  956
              WY  PGY+FQ+L SI+WVCW FP SVTAHQ+GSG  GLG GALTLDW+ +ASFL SPLV
Sbjct  241   LWYMVPGYLFQSLQSIAWVCWAFPNSVTAHQIGSGFRGLGFGALTLDWTVVASFLFSPLV  300

Query  957   CPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQ  1136
             CPFFAIVNVF+GY +I+Y+VMPISYWGLNVYNA+ FP++SS LFTAQGQ Y+I+AIVN +
Sbjct  301   CPFFAIVNVFIGYVLIIYIVMPISYWGLNVYNARTFPIFSSHLFTAQGQSYNITAIVNDK  360

Query  1137  FELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDI  1316
             FE+D  +Y  QGR+ LS FF+L+YGFGFATIAST++HV LFYGREIY R+RAS   K+DI
Sbjct  361   FEIDLAQYDIQGRLNLSLFFALAYGFGFATIASTLSHVGLFYGREIYTRFRASQDEKVDI  420

Query  1317  HTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPIS  1496
             HTKLMK Y+DIPSWWF++LL  ++ VSLALCIFL DEVQMP+WGLIFAA LAF+FTLPIS
Sbjct  421   HTKLMKKYEDIPSWWFHLLLTGSVLVSLALCIFLKDEVQMPWWGLIFAAGLAFVFTLPIS  480

Query  1497  IITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKI  1676
             IITATTNQTPGLNIITEYIMG+I PGKPIANVCFKTYGY+SM QAI+FL DFKLGHYMKI
Sbjct  481   IITATTNQTPGLNIITEYIMGVILPGKPIANVCFKTYGYISMVQAISFLGDFKLGHYMKI  540

Query  1677  PPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVI  1853
             PPRSMFLVQ IGTLIAG++N+ VA WLL SI+NIC ++ L  NSPWTCP  RVFFDASVI
Sbjct  541   PPRSMFLVQLIGTLIAGSVNLFVAMWLLDSIDNICQEELLPENSPWTCPGQRVFFDASVI  600

Query  1854  WGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGS  2033
             WGLV P+RIF + GNY ALNWFFLGG+LGPV VW+LH  FPSQSWIPL+NLPVL+GAT S
Sbjct  601   WGLVAPQRIFGTLGNYGALNWFFLGGLLGPVAVWILHILFPSQSWIPLVNLPVLIGATAS  660

Query  2034  MPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLE  2213
             MPPAT +NY++WILVGTIFNFFVFRYRKKWWQRYNYILSA LDAGVAFMAVL+YFTVG+E
Sbjct  661   MPPATPVNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLIYFTVGIE  720

Query  2214  DRTISWWGTT---DLEHCDLASCPTAKGIAVDGCPVF  2315
             ++ + WWG     D EHC LASCPTAKG+ VDGCP F
Sbjct  721   EKNLYWWGANPDIDPEHCPLASCPTAKGVIVDGCPRF  757



>ref|XP_009612437.1| PREDICTED: oligopeptide transporter 4 [Nicotiana tomentosiformis]
Length=737

 Score =  1127 bits (2915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/746 (77%), Positives = 658/746 (88%), Gaps = 12/746 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             MGT   E+P        V D++ SPIEEVRLTVTNTDDPTLPVWTFRMW LG+ SC LLS
Sbjct  1     MGTYRPESPPYP---AGVADDDESPIEEVRLTVTNTDDPTLPVWTFRMWFLGLFSCCLLS  57

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLNQFFSYR EPL+IT ITVQVATLPIG F+A  LP  KFR+PGFGS  FSLNPGPFNMK
Sbjct  58    FLNQFFSYRTEPLVITQITVQVATLPIGHFLATVLPTTKFRLPGFGSRLFSLNPGPFNMK  117

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI+IFANAG AFGNGSAYAVGIV II AFY R ISF AGWLLIITTQVLGYGWAGLL
Sbjct  118   EHVLISIFANAGSAFGNGSAYAVGIVTIIKAFYHRNISFLAGWLLIITTQVLGYGWAGLL  177

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             +KYVVEPAHMWWPSTLVQ+SLFR LHEK++         MSRAKFF+I+L CSFCWY  P
Sbjct  178   RKYVVEPAHMWWPSTLVQVSLFRALHEKDDRR-------MSRAKFFLIALVCSFCWYLVP  230

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
             GY+F TL SISW+CW F KSVTA Q+GSG+ GLGLGA+TLDWS +ASFL SPL+CPFFAI
Sbjct  231   GYLFSTLTSISWICWAFSKSVTAQQIGSGMRGLGLGAITLDWSAVASFLFSPLICPFFAI  290

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
             VNVF GY +I+Y+V+PI+YWG ++Y AK FP++SS LFTAQGQ+YDISAIVN +FELD  
Sbjct  291   VNVFAGYMLIIYMVIPIAYWGFDLYGAKKFPIFSSHLFTAQGQKYDISAIVNDKFELDIG  350

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
             +Y +QGRI++S FF+L+YGFGFATIAST+THVALFYGREIY+R+RAS KGK DIHT+LM+
Sbjct  351   KYEEQGRIHISMFFALTYGFGFATIASTLTHVALFYGREIYERFRASYKGKEDIHTRLMR  410

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
              YKDIPSWWF  LL+VT+ VSL LCIFLN++VQMP+WGL+FA+A+AF+FTLPISIITATT
Sbjct  411   KYKDIPSWWFNALLLVTLTVSLILCIFLNNQVQMPWWGLLFASAIAFIFTLPISIITATT  470

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQTPGLNIITEY+MGII PG+PIANVCFK YGYMSM+QA++FLSDFKLGHYMKIPPRSMF
Sbjct  471   NQTPGLNIITEYVMGIILPGRPIANVCFKVYGYMSMSQAVSFLSDFKLGHYMKIPPRSMF  530

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGP  1871
             LVQF+GT+I+GTIN+SVAWWLL+SIENIC  D L  +SPWTCP DRVFFDASVIWGLVGP
Sbjct  531   LVQFLGTIISGTINISVAWWLLNSIENICQDDLLPPDSPWTCPGDRVFFDASVIWGLVGP  590

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATS  2051
             KRIF S GNY+++NWFFLGG +GPVIVWLLH+ FP++SWIPLINLPVLLGATG+MPPAT 
Sbjct  591   KRIFGSLGNYSSMNWFFLGGAVGPVIVWLLHKVFPTKSWIPLINLPVLLGATGAMPPATP  650

Query  2052  LNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISW  2231
             LNY++W++VGTIFNFF+FRYRK+WWQRYNYILSA LDAGVAFMAVLLYF++G+E++ ++W
Sbjct  651   LNYNAWVIVGTIFNFFIFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLGMENKGLTW  710

Query  2232  WGTTDLEHCDLASCPTAKGIAVDGCP  2309
             WGT   EHC+LA+CPTAKGIAVDGCP
Sbjct  711   WGTNG-EHCELATCPTAKGIAVDGCP  735



>ref|XP_010112260.1| Oligopeptide transporter 4 [Morus notabilis]
 gb|EXC33016.1| Oligopeptide transporter 4 [Morus notabilis]
Length=742

 Score =  1127 bits (2915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/749 (76%), Positives = 665/749 (89%), Gaps = 11/749 (1%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGE--DVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVL  248
             M T+E++ P  K      D++++E+SPIEEVRLTVTNTDDPTLPVWTFRMW LG++SC L
Sbjct  1     METIEMQPPRQKPDPTVPDMDEDELSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLLSCGL  60

Query  249   LSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFN  428
             LSFLNQFF+YR +PL+IT ITVQVATLPIG FMA  LP  +FR+PGFG  +FS+NPGPFN
Sbjct  61    LSFLNQFFAYRTQPLVITQITVQVATLPIGHFMARTLPKTRFRLPGFGERRFSVNPGPFN  120

Query  429   MKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAG  608
             +KEHVLI+IFANAG AFG+GSAYAVGIV II AFYRR ISF+A W+LIITTQVLGYGWAG
Sbjct  121   IKEHVLISIFANAGSAFGSGSAYAVGIVTIIKAFYRRSISFWASWILIITTQVLGYGWAG  180

Query  609   LLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYF  788
             LL+KYVVEPAHMWWPSTLVQ+SLFR LHEK+E+        MS+AKFF+I+L CSF WY 
Sbjct  181   LLRKYVVEPAHMWWPSTLVQVSLFRALHEKDEQR-------MSQAKFFLIALICSFSWYV  233

Query  789   FPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFF  968
             FPGY+F TL +ISW+CWVF KSVTA Q+GSG+ GLGLG+ TLDWS +ASFL SPL+ PFF
Sbjct  234   FPGYLFSTLTNISWICWVFSKSVTAQQIGSGMRGLGLGSFTLDWSAVASFLFSPLISPFF  293

Query  969   AIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELD  1148
             AIVNVF+GY +++Y+ +PI+YWG+++Y A  FP++SS LFTA+GQ YDI+AIVN +FELD
Sbjct  294   AIVNVFLGYVLLIYVAIPIAYWGVDLYGASKFPIFSSHLFTAKGQTYDITAIVNDKFELD  353

Query  1149  EDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKL  1328
              ++YA+QGRI+LSTFF+LSYGFGFATIA+T+THVA+FYGREIY RYRAS KGK DIHT L
Sbjct  354   IEKYAEQGRIHLSTFFALSYGFGFATIAATLTHVAVFYGREIYQRYRASHKGKEDIHTTL  413

Query  1329  MKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITA  1508
             M+ YKDIPSWWFY+LL VT+AVSLALCIFLND+VQMP+WGL+FA A+AF FTLPISIITA
Sbjct  414   MRRYKDIPSWWFYLLLAVTLAVSLALCIFLNDQVQMPWWGLLFAGAMAFSFTLPISIITA  473

Query  1509  TTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRS  1688
             TTNQTPGLNIITEY+MGII PG+PIANVCFKTYGYMSM QA++FLSDFKLGHYMKIPPRS
Sbjct  474   TTNQTPGLNIITEYVMGIILPGRPIANVCFKTYGYMSMAQAVSFLSDFKLGHYMKIPPRS  533

Query  1689  MFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLV  1865
             MF+VQF+GT++AGTIN++VAWWLL ++ENIC  + L +NSPWTCP DRVFFDASVIWGLV
Sbjct  534   MFIVQFLGTILAGTINLAVAWWLLTTVENICQDNLLPTNSPWTCPGDRVFFDASVIWGLV  593

Query  1866  GPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPA  2045
             GPKRIF S+GNY A+NWFFLGG +GPVI+WLLH+ FP Q+WIPLINLPVLLGAT  MPPA
Sbjct  594   GPKRIFGSQGNYAAMNWFFLGGAVGPVIIWLLHKAFPKQTWIPLINLPVLLGATAMMPPA  653

Query  2046  TSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTI  2225
             TSLN++SWI+VGTIFNFFVFRYRK+WWQRYNYILSA LDAGVAFMAVLLYF+VGLED+++
Sbjct  654   TSLNFNSWIIVGTIFNFFVFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSVGLEDKSL  713

Query  2226  SWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             +WWG TD EHC+LA+CPTAKGI  DGCP+
Sbjct  714   TWWG-TDGEHCELATCPTAKGIIKDGCPL  741



>ref|XP_007018306.1| Oligopeptide transporter 4 [Theobroma cacao]
 gb|EOY15531.1| Oligopeptide transporter 4 [Theobroma cacao]
Length=752

 Score =  1126 bits (2912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/755 (77%), Positives = 664/755 (88%), Gaps = 11/755 (1%)
 Frame = +3

Query  75    MGTVEIEA-PALK---LAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSC  242
             MGTVE++A P L    +   ++++ E+SPIEEVRLTV NTD+P+LPVWTFRMW LG+ SC
Sbjct  1     MGTVELDASPKLDEKPIVEPEIDESELSPIEEVRLTVPNTDEPSLPVWTFRMWFLGLSSC  60

Query  243   VLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGP  422
             +LLSFLNQFF YR EPL+IT ITVQVATLPIGRFMA+ LP  KF IPGFGS QFSLNPGP
Sbjct  61    LLLSFLNQFFGYRSEPLVITQITVQVATLPIGRFMASVLPTTKFPIPGFGSRQFSLNPGP  120

Query  423   FNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGW  602
             FNMKEHVLITIFANAG AFG G+ YAVGIV II AFY R ISF A WLLIITTQV+GYGW
Sbjct  121   FNMKEHVLITIFANAGSAFGGGTVYAVGIVTIIKAFYGRSISFLASWLLIITTQVMGYGW  180

Query  603   AGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCW  782
             AGLL+KYVVEPAHMWWPSTLVQISLFRTLHEKEE +       +SRAKFFVI+L CSFCW
Sbjct  181   AGLLRKYVVEPAHMWWPSTLVQISLFRTLHEKEENDGKRR---ISRAKFFVIALVCSFCW  237

Query  783   YFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCP  962
             Y  PGY+F TL SIS VC  FP SVTAHQ+GSGL+GLG+GA TLDW+T+ASFL SPLV P
Sbjct  238   YIVPGYLFNTLQSISLVCLAFPHSVTAHQIGSGLSGLGIGAFTLDWTTVASFLFSPLVSP  297

Query  963   FFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFE  1142
             FFAIVNVF+GYA+I+Y VMPISYWG+N+YNAK FP++S+DLFT+QGQ Y+I+ IVN++FE
Sbjct  298   FFAIVNVFIGYALIIYFVMPISYWGMNLYNAKTFPIFSADLFTSQGQLYNITQIVNEKFE  357

Query  1143  LDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHT  1322
             LD  EY K GRI+LSTFF+L+YGFGFATIAST++HVALFYGREIY RYRAS+K K DIHT
Sbjct  358   LDLPEYEKLGRIHLSTFFALTYGFGFATIASTVSHVALFYGREIYSRYRASSKEKADIHT  417

Query  1323  KLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISII  1502
             +LM+NY+DIPSWWFY+LL+ +I V LALCIFLN +VQMP+WGL+FAAALAF+FTLPISII
Sbjct  418   RLMRNYRDIPSWWFYLLLLGSIVVGLALCIFLNKDVQMPWWGLLFAAALAFVFTLPISII  477

Query  1503  TATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPP  1682
             TATTNQTPGLNIITEYIMG I PG+PI NVCFKTYGY+SM QA+AFLSDFKLGHYMKIPP
Sbjct  478   TATTNQTPGLNIITEYIMGAILPGEPITNVCFKTYGYISMAQAVAFLSDFKLGHYMKIPP  537

Query  1683  RSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWG  1859
             RSMFLVQFIGT++AGT+N+ VAWWLL S+++ICH+D L  NSPWTCP DRVFFDASVIWG
Sbjct  538   RSMFLVQFIGTVLAGTVNLGVAWWLLTSVDSICHKDLLPKNSPWTCPGDRVFFDASVIWG  597

Query  1860  LVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMP  2039
             LVGPKRIF S G Y+ LNWFFLGG+LGPV+VWLLH+ FPSQSWIPLINLPVLLGATG+MP
Sbjct  598   LVGPKRIFGSLGQYSTLNWFFLGGLLGPVVVWLLHKAFPSQSWIPLINLPVLLGATGNMP  657

Query  2040  PATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDR  2219
             PA+ LNY+SWILVGTIFNFFVFRY+K+WWQRYNYILSA LDAGVAFM VLLYF +GLE++
Sbjct  658   PASPLNYTSWILVGTIFNFFVFRYQKQWWQRYNYILSAALDAGVAFMTVLLYFALGLENK  717

Query  2220  TISWWGTTD---LEHCDLASCPTAKGIAVDGCPVF  2315
             +++WWG++     EHCDLA CPTAKGI+VDGCP F
Sbjct  718   SLNWWGSSPDYIPEHCDLAGCPTAKGISVDGCPTF  752



>ref|XP_007200086.1| hypothetical protein PRUPE_ppa021086mg [Prunus persica]
 gb|EMJ01285.1| hypothetical protein PRUPE_ppa021086mg [Prunus persica]
Length=743

 Score =  1125 bits (2911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/750 (76%), Positives = 655/750 (87%), Gaps = 12/750 (2%)
 Frame = +3

Query  75    MGTVEIEAP----ALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSC  242
             MG++E+E P      K    D  D++VSPIE+VRLTVTNTDDPTLPVWTFRMW LG++SC
Sbjct  1     MGSLELEPPNSNTTPKPLDSDAEDDDVSPIEQVRLTVTNTDDPTLPVWTFRMWFLGLLSC  60

Query  243   VLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGP  422
              LLSFLNQFFSYR EPLIIT ITVQV+TLPIG FMA  LP  KF IPGFGS  FSLNPGP
Sbjct  61    ALLSFLNQFFSYRTEPLIITQITVQVSTLPIGNFMAKVLPTNKFHIPGFGSRSFSLNPGP  120

Query  423   FNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGW  602
             FN+KEHVLITIFANAG AFG GSAYAVGIVNII AFYRRKIS  A WLLIITTQVLGYGW
Sbjct  121   FNIKEHVLITIFANAGSAFGLGSAYAVGIVNIIKAFYRRKISLLASWLLIITTQVLGYGW  180

Query  603   AGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCW  782
             AGLL+KYVVEPAHMWWP+TLVQ+SLFR LHEK+E+        MSRAKFF+I+L CSF W
Sbjct  181   AGLLRKYVVEPAHMWWPNTLVQVSLFRALHEKDEQR-------MSRAKFFLIALVCSFTW  233

Query  783   YFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCP  962
             Y FPGY+F TL +ISWVCW+F KSVTA Q+GSG+ GLG+GALTLDWS +ASFL SPL+ P
Sbjct  234   YAFPGYLFTTLTNISWVCWLFSKSVTAQQIGSGMRGLGVGALTLDWSAVASFLFSPLISP  293

Query  963   FFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFE  1142
             FF IVNVF GYA+I+Y  +PI+YWGL++Y A+ FP++SS LFTAQGQ+Y+I+AIVN+ FE
Sbjct  294   FFVIVNVFAGYALILYFAIPIAYWGLDLYTAQRFPIFSSHLFTAQGQDYNITAIVNENFE  353

Query  1143  LDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHT  1322
             LD  +Y +QGRI+LSTFF+LSYGFGFATIAST+THVALFYGREI DRYRAS KGK DIHT
Sbjct  354   LDIPKYKEQGRIHLSTFFALSYGFGFATIASTLTHVALFYGREILDRYRASYKGKEDIHT  413

Query  1323  KLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISII  1502
             +LM+ YKDIPSWWFY LL++T+AVSL LCIFLND+VQMP+WGL+FAAA+AF FTLPISII
Sbjct  414   RLMRRYKDIPSWWFYTLLIITVAVSLVLCIFLNDQVQMPWWGLLFAAAMAFAFTLPISII  473

Query  1503  TATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPP  1682
             TATTNQTPGLNIITEYIMGII PG+PIANVCFKTYGYMSM QA++FL+DFKLGHYMKIPP
Sbjct  474   TATTNQTPGLNIITEYIMGIILPGRPIANVCFKTYGYMSMAQAVSFLNDFKLGHYMKIPP  533

Query  1683  RSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGL  1862
             RSMFLVQFIGT++AGT+N++VA WLL+SI NIC  D  S+SPWTCP DRVFFDASVIWGL
Sbjct  534   RSMFLVQFIGTILAGTVNLAVAHWLLNSITNICVDDPHSDSPWTCPGDRVFFDASVIWGL  593

Query  1863  VGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPP  2042
              GPKRIF + G Y A+NWFFLGG +GPVIVW+LH+ +P Q+WI LINLPVLLGAT SMPP
Sbjct  594   AGPKRIFGTLGIYGAINWFFLGGAVGPVIVWVLHKAYPKQNWIRLINLPVLLGATASMPP  653

Query  2043  ATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRT  2222
             AT+LNY+SWI+VGTIFNFFVFRYRKKWWQRYNY+LSA LDAG+AFMAVLLY +VG+E+++
Sbjct  654   ATALNYNSWIIVGTIFNFFVFRYRKKWWQRYNYVLSAALDAGLAFMAVLLYLSVGMENKS  713

Query  2223  ISWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             ++WWGT   EHC LA+CPTAKGI VDGCPV
Sbjct  714   VAWWGTNG-EHCTLATCPTAKGIVVDGCPV  742



>ref|XP_006394156.1| hypothetical protein EUTSA_v10003716mg [Eutrema salsugineum]
 gb|ESQ31442.1| hypothetical protein EUTSA_v10003716mg [Eutrema salsugineum]
Length=729

 Score =  1125 bits (2910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/733 (76%), Positives = 643/733 (88%), Gaps = 9/733 (1%)
 Frame = +3

Query  117   GEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLI  296
              ++++D+E SPIEEVRLTVTNTDDPTLPVWTFRMW LG++SC LLSFLNQFFSYR EPL+
Sbjct  4     ADELSDDETSPIEEVRLTVTNTDDPTLPVWTFRMWFLGIISCSLLSFLNQFFSYRTEPLV  63

Query  297   ITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfa  476
             IT ITVQVATLPIG F+A  LP  +F +PG GS +FSLNPGPFNMKEHVLI+IFANAG A
Sbjct  64    ITQITVQVATLPIGHFLAKVLPKTRFGLPGLGSTRFSLNPGPFNMKEHVLISIFANAGSA  123

Query  477   fgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPS  656
             FG+GSAYAVGIV II AFYRR ISF AGWLLIITTQVLGYGWAGLL+KYVVEPAHMWWPS
Sbjct  124   FGSGSAYAVGIVTIIKAFYRRNISFVAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPS  183

Query  657   TLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVC  836
             TLVQ+SLFR LHEK+E+        M+RAKFFVI+L CSF WY  PGY+F TL SISW+C
Sbjct  184   TLVQVSLFRALHEKDEQR-------MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWIC  236

Query  837   WVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLV  1016
             W FP+SVTA Q+GSG+ GLGLGA TLDW+ +ASFL SPL+ PFFAI NVF+GY +++YLV
Sbjct  237   WAFPRSVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFIGYVLLIYLV  296

Query  1017  MPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFF  1196
             +P++YWG + Y+AK FP++SS LFT+ GQ+YDI AIVN +FELD  +Y +QGRI LS FF
Sbjct  297   LPLAYWGFDSYHAKRFPIFSSHLFTSVGQKYDIPAIVNNKFELDVAKYEQQGRINLSMFF  356

Query  1197  SLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLL  1376
             +LSYG GFATIAST+THVALFYGREI +R+R S KGK DIHT+LMK YKDIPSWWFY +L
Sbjct  357   ALSYGLGFATIASTLTHVALFYGREISERFRVSYKGKEDIHTRLMKRYKDIPSWWFYSML  416

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
               T+ VSLALC+FLNDEVQMP+WGL+FA+A+AF+FTLPISIITATTNQTPGLNIITEY M
Sbjct  417   ASTLLVSLALCVFLNDEVQMPWWGLVFASAMAFIFTLPISIITATTNQTPGLNIITEYAM  476

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             GIIYPG+PIANVCFK YGYMSM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGTIN
Sbjct  477   GIIYPGRPIANVCFKVYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTIN  536

Query  1737  MSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALN  1913
             ++VAWW L+SI+NIC ++ L  NSPWTCP DRVFFDASVIWGLVGPKRIF S+GNY A+N
Sbjct  537   ITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYAAMN  596

Query  1914  WFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFN  2093
             WFFLGG +GPVIVWL H+ FP +SWIPL+NLPVLLGAT  MPPAT++NY+SWILVGTIFN
Sbjct  597   WFFLGGAIGPVIVWLCHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGTIFN  656

Query  2094  FFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASC  2273
              FVFRYRK WWQRYNY+LSA +DAGVAFMAVLLYF+VG+E++T+ WWGT   EHCDLA+C
Sbjct  657   LFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEEKTLDWWGTRG-EHCDLATC  715

Query  2274  PTAKGIAVDGCPV  2312
             PTA+G+ VDGCPV
Sbjct  716   PTARGVIVDGCPV  728



>ref|XP_010065749.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=756

 Score =  1124 bits (2908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 558/736 (76%), Positives = 646/736 (88%), Gaps = 11/736 (1%)
 Frame = +3

Query  111   LAGEDVNDEE--VSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRR  284
             +A  DV+D E  +SPIE+VRL VTNTDDPTLPVWTFRMW LGV+SC LLSFLNQFF+YR 
Sbjct  27    VAPNDVDDAEDDLSPIEQVRLIVTNTDDPTLPVWTFRMWFLGVLSCALLSFLNQFFAYRT  86

Query  285   EPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfan  464
             EPL+IT ITVQVATLPIGRFMAA LP A+FRIPG     FSLNPGPFNMKEHVLI+IFAN
Sbjct  87    EPLVITQITVQVATLPIGRFMAAVLPTAEFRIPGLRRRTFSLNPGPFNMKEHVLISIFAN  146

Query  465   agfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHM  644
             AG AFG+G AYAVGIVNII AFY R ISFFAGWLLIITTQVLGYGWAGLL+KY VEPAHM
Sbjct  147   AGSAFGSGPAYAVGIVNIIKAFYLRSISFFAGWLLIITTQVLGYGWAGLLRKYAVEPAHM  206

Query  645   WWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASI  824
             WWPSTLVQ+SLFR LHEK+++        MSRAKFF+I+L CSF WY  PGY+F TL +I
Sbjct  207   WWPSTLVQVSLFRALHEKDDQR-------MSRAKFFIIALICSFSWYVVPGYLFSTLTNI  259

Query  825   SWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAII  1004
             SW+CW+F KSVTA Q+GSG+ GLGLGALTLDW+ +ASFL SPL+CPFFAI+N+F GYA++
Sbjct  260   SWICWIFSKSVTAQQIGSGMKGLGLGALTLDWTVVASFLFSPLICPFFAIMNIFAGYALV  319

Query  1005  MYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYL  1184
             +Y+ +P++YWG N+Y A  FP++SS+LFT QGQ Y+I+AIVN  FELD  +Y  QGRI+L
Sbjct  320   VYVAIPLAYWGFNLYGADRFPIFSSNLFTKQGQAYNITAIVNSNFELDLAKYEDQGRIHL  379

Query  1185  STFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWF  1364
             ST F+ +YGFGFATIAST+THV  FYGREIY+RYRAS KGK DIHT+LM+ YKDIPSWWF
Sbjct  380   STLFAFTYGFGFATIASTLTHVGFFYGREIYERYRASYKGKEDIHTRLMRRYKDIPSWWF  439

Query  1365  YVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIIT  1544
             Y+LLV+T+AVSLALCIFLN +VQMP+WGL+FA+ LAF+FTLPISIITATTNQTPGLNIIT
Sbjct  440   YLLLVLTVAVSLALCIFLNKQVQMPWWGLLFASTLAFIFTLPISIITATTNQTPGLNIIT  499

Query  1545  EYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIA  1724
             EYIMG+IYPG PIANVCFKTYGYMSM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT+IA
Sbjct  500   EYIMGVIYPGHPIANVCFKTYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTIIA  559

Query  1725  GTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNY  1901
             GT+NM+VAWWLL+SI NIC  + L  +SPWTCP+DRVFFDASVIWGL GPKRIF  +GNY
Sbjct  560   GTVNMAVAWWLLNSITNICQIELLPPDSPWTCPNDRVFFDASVIWGLAGPKRIFGVQGNY  619

Query  1902  NALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVG  2081
              A+NWFFLGG +GP +VWLLH+ FP +SWIPLINLPVLLGATG+MPPAT LNY++W+LVG
Sbjct  620   QAMNWFFLGGAVGPFLVWLLHKAFPDKSWIPLINLPVLLGATGNMPPATPLNYNAWVLVG  679

Query  2082  TIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCD  2261
             TIFNFFVFRYRKKWWQRYNY+LSA +DAGVAFM VLLYF +G+E++ ++WWGT   EHCD
Sbjct  680   TIFNFFVFRYRKKWWQRYNYVLSAAMDAGVAFMGVLLYFCLGMENKGLNWWGTGG-EHCD  738

Query  2262  LASCPTAKGIAVDGCP  2309
             LASCPTAKGI++DGCP
Sbjct  739   LASCPTAKGISMDGCP  754



>emb|CDP19592.1| unnamed protein product [Coffea canephora]
Length=707

 Score =  1124 bits (2908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/706 (80%), Positives = 637/706 (90%), Gaps = 6/706 (1%)
 Frame = +3

Query  216   MWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGS  395
             MWVLG++SC+LLSFLNQFFSYRREPLIIT ITV VATLPIGRFMAAALP  +F++PGFGS
Sbjct  1     MWVLGIISCMLLSFLNQFFSYRREPLIITQITVVVATLPIGRFMAAALPTTQFQLPGFGS  60

Query  396   GQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLII  575
             G+FSLNPGPFNMKEHVLI+IFANAG AFGNG AYAVGIV+IIIAFYRRKISFFA WLLII
Sbjct  61    GKFSLNPGPFNMKEHVLISIFANAGTAFGNGPAYAVGIVDIIIAFYRRKISFFAAWLLII  120

Query  576   TTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeee------edgggrrrMS  737
             TTQVLGYGWAGLL+KYVVEPAHMWWPS LVQISLFR LHEKE+       E  G +R+ S
Sbjct  121   TTQVLGYGWAGLLRKYVVEPAHMWWPSNLVQISLFRALHEKEDADGNENGESNGNKRQTS  180

Query  738   RAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlD  917
             R KFFV++L CSF WY  PG++FQ L+SISWVCW +P SVTA QLGSGLNGLGLGA TLD
Sbjct  181   RTKFFVLALVCSFIWYLVPGFLFQALSSISWVCWAYPNSVTAQQLGSGLNGLGLGAFTLD  240

Query  918   WSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQ  1097
             WST+ASFL SPL+ PFFAI NVFVGY ++MY V+PISYWGLNVYNAK FP++SSDLFTAQ
Sbjct  241   WSTVASFLFSPLISPFFAIANVFVGYVLVMYFVIPISYWGLNVYNAKNFPIFSSDLFTAQ  300

Query  1098  GQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIY  1277
             GQEY+IS IVN++FELD+ +Y +QGRI LSTFF+L+YGFGFATIAST+THVALFYGREIY
Sbjct  301   GQEYNISTIVNRKFELDKVQYEQQGRINLSTFFALTYGFGFATIASTLTHVALFYGREIY  360

Query  1278  DRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIF  1457
             DRYRAS+  K DIHT+LM+ YKDIP+ WF VLL  T+ VSLALCIFL  EVQMPYWGL+ 
Sbjct  361   DRYRASSNAKPDIHTRLMRKYKDIPNMWFIVLLSATLIVSLALCIFLKKEVQMPYWGLLL  420

Query  1458  AAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIA  1637
             AAA++F+FTLP+SIITATTNQTPGLNIITEY+MG+IYPGKPIANV FKTYGYMS TQAI+
Sbjct  421   AAAVSFLFTLPVSIITATTNQTPGLNIITEYLMGVIYPGKPIANVAFKTYGYMSTTQAIS  480

Query  1638  FLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTC  1817
             FLSDFKLGHYMKIPPRSMFLVQF+GT+IAGT+N+ VAWWLLH++++ICHQD+ SNSPWTC
Sbjct  481   FLSDFKLGHYMKIPPRSMFLVQFLGTIIAGTVNLGVAWWLLHTVKDICHQDRTSNSPWTC  540

Query  1818  PSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPL  1997
             P DRVFFDASVIWGLVGPKRIF   GNY+ALNWFFLGG+LGP+ +WLLH++FP Q+WIPL
Sbjct  541   PGDRVFFDASVIWGLVGPKRIFGPHGNYSALNWFFLGGLLGPLAIWLLHKQFPKQTWIPL  600

Query  1998  INLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAF  2177
             INLPV+LGAT  MPPAT+LNY+SWILVGTIFNFFVFRYRKKWWQRYNYILSA LDAGVAF
Sbjct  601   INLPVILGATAYMPPATALNYNSWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAF  660

Query  2178  MAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             MAVLL+FTVG+E+R+ISWWG  + EHCDLA+CPTAKGI+VDGCP F
Sbjct  661   MAVLLHFTVGMENRSISWWGNNNPEHCDLATCPTAKGISVDGCPTF  706



>ref|XP_011015796.1| PREDICTED: oligopeptide transporter 4-like [Populus euphratica]
Length=747

 Score =  1123 bits (2906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/753 (76%), Positives = 665/753 (88%), Gaps = 12/753 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             MGTVE+EAP  K    D+++EE+SPIE+VRLTV NTDDP+LPVWTFRMW LG++SC LLS
Sbjct  1     MGTVELEAPPSK--DLDIDEEELSPIEQVRLTVPNTDDPSLPVWTFRMWFLGILSCCLLS  58

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLNQFF+YR EPLIIT ITVQVATLPIGRF+A  LP  KF IPG GS +FS NPGPFNMK
Sbjct  59    FLNQFFAYRTEPLIITQITVQVATLPIGRFLATVLPETKFNIPGLGSREFSFNPGPFNMK  118

Query  435   EHVLITIfanagfafgngSAYAVGIVNIII--AFYRRKISFFAGWLLIITTQVLGYGWAG  608
             EHVLI+IFANAG AFG+GSAYAVGIVNII   AFY R ISFF+ W+LIITTQVLGYGWAG
Sbjct  119   EHVLISIFANAGSAFGSGSAYAVGIVNIIKSKAFYGRNISFFSAWVLIITTQVLGYGWAG  178

Query  609   LLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYF  788
             LL+KYVVEPAHMWWPSTLVQISLFRTLHEKE++ +      +SR KFFVI++ CSF WY 
Sbjct  179   LLRKYVVEPAHMWWPSTLVQISLFRTLHEKEDKNEHR----ISRVKFFVIAMTCSFLWYL  234

Query  789   FPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFF  968
              PGY+FQTL SI+W+C+ FP SVTA Q+GSG+ GLG+GALTLDWST+AS+L SPL+ PFF
Sbjct  235   LPGYLFQTLQSIAWICYAFPHSVTAQQIGSGMRGLGIGALTLDWSTVASYLYSPLLTPFF  294

Query  969   AIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELD  1148
             AIVNVFVGYA+IMY+V+PISYWGLNVYNAK FP++SS LF A+G  Y+I+ +VN +FELD
Sbjct  295   AIVNVFVGYALIMYVVIPISYWGLNVYNAKTFPIFSSHLFDARGATYNITEVVNDKFELD  354

Query  1149  EDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKL  1328
               +Y K GR++LSTFF+L+YGFGFATIA+T++HVALFYGREIYDRYRAS+KGK DIHT+L
Sbjct  355   LAQYDKHGRVHLSTFFALTYGFGFATIAATLSHVALFYGREIYDRYRASSKGKEDIHTRL  414

Query  1329  MKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITA  1508
             MKNYKDIPS WF+ LL +T+ V+L LCIFL  EVQMP+WGL+FAAALAF+F+LPISIITA
Sbjct  415   MKNYKDIPSRWFHGLLAMTLLVALFLCIFLKKEVQMPFWGLLFAAALAFIFSLPISIITA  474

Query  1509  TTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRS  1688
             TTNQTPGLNIITEY+MGIIYPG+PIANVCFKTYGYMSM QAI+FLSDFKLGHYMKIPPRS
Sbjct  475   TTNQTPGLNIITEYVMGIIYPGRPIANVCFKTYGYMSMAQAISFLSDFKLGHYMKIPPRS  534

Query  1689  MFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLV  1865
             MFLVQFIGT+IAGTIN+ VAWWLL+S+E+IC  + L +NSPWTCPSDRVFFDASVIWGLV
Sbjct  535   MFLVQFIGTIIAGTINLGVAWWLLNSVEHICQDNLLPANSPWTCPSDRVFFDASVIWGLV  594

Query  1866  GPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPA  2045
             GP+RIF S+G Y ALNWFFLGG+LGP IVWLLH+ FP QSWIPLINLPVLLGAT +MPPA
Sbjct  595   GPRRIFGSQGEYAALNWFFLGGLLGPFIVWLLHKAFPGQSWIPLINLPVLLGATAAMPPA  654

Query  2046  TSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTI  2225
             T++NY+SWILVGTIFNFF+FRYRK WWQRYNY+LSA LDAGVAFMAVL+Y TVGLE++ +
Sbjct  655   TAINYNSWILVGTIFNFFIFRYRKDWWQRYNYVLSAALDAGVAFMAVLIYVTVGLENKNL  714

Query  2226  SWWGTT-DL--EHCDLASCPTAKGIAVDGCPVF  2315
              WWG+  D+  EHC LA+CPTAKGI+VDGCP F
Sbjct  715   YWWGSDPDVFPEHCSLATCPTAKGISVDGCPTF  747



>ref|XP_010064240.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=748

 Score =  1123 bits (2906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/734 (78%), Positives = 651/734 (89%), Gaps = 5/734 (1%)
 Frame = +3

Query  126   VNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITS  305
             V++ E+SP+EEVRLTV NTDDP LPVWTFRMW LG++SC LLSFLNQFFSYRREPLIIT 
Sbjct  16    VDESELSPVEEVRLTVPNTDDPNLPVWTFRMWTLGLISCALLSFLNQFFSYRREPLIITQ  75

Query  306   ITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgn  485
             ITVQVATLP+GR MA+ LP AKF +PG    +FSLNPGPFNMKEHVLI+IFANAG AFGN
Sbjct  76    ITVQVATLPLGRLMASILPTAKFHLPGLSGSEFSLNPGPFNMKEHVLISIFANAGSAFGN  135

Query  486   gSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLV  665
             GSAYAVGIVNII AFY R ISF A W+LIITTQVLGYGWAGLL+KYVVEP  MWWPSTLV
Sbjct  136   GSAYAVGIVNIIKAFYDRSISFGASWILIITTQVLGYGWAGLLRKYVVEPGQMWWPSTLV  195

Query  666   QISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVF  845
             QISLFRTLHEKE EED      +SR KFFV+++  SF WY  PG++FQ+L+SISWVCW F
Sbjct  196   QISLFRTLHEKETEEDKAQYS-VSRVKFFVMAMVFSFMWYLVPGFLFQSLSSISWVCWAF  254

Query  846   PKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPI  1025
             P SVTA Q+GSGLNGLG+GALTLDWST+ASFL SPL+CPFFAIVNVFVG+A+IMY+V+PI
Sbjct  255   PNSVTAQQIGSGLNGLGVGALTLDWSTVASFLFSPLICPFFAIVNVFVGFAVIMYVVIPI  314

Query  1026  SYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLS  1205
             +YW LN YNAK FP++SSDLFTAQGQEY+I+ IVNK FELD+ EY++ G+I++S FF+L+
Sbjct  315   AYWRLNAYNAKTFPIFSSDLFTAQGQEYNITLIVNKNFELDKAEYSQLGKIHMSMFFALT  374

Query  1206  YGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVT  1385
             YGFGFATIAST+THVALFYGREIYDR+RAS+KGK DIHTKLM+NYKDIP WWFYVLLV+T
Sbjct  375   YGFGFATIASTLTHVALFYGREIYDRFRASSKGKEDIHTKLMRNYKDIPQWWFYVLLVMT  434

Query  1386  IAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGII  1565
             I VSL LC  L  +VQMP+WGL+FA ALAF+FTLPISIITATTNQTPGLNIITEYIMG+I
Sbjct  435   IIVSLILCTVLKKDVQMPWWGLLFAVALAFIFTLPISIITATTNQTPGLNIITEYIMGVI  494

Query  1566  YPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSV  1745
              PG PIANVCFKTYGYMSMTQAI+FLSDFKLGHYMKIPPRSMFLVQFIGT++AGT+N+ V
Sbjct  495   LPGHPIANVCFKTYGYMSMTQAISFLSDFKLGHYMKIPPRSMFLVQFIGTIVAGTVNLGV  554

Query  1746  AWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFF  1922
             AWWLL SI NICH++ L  NSPWTCPSDRVFFDASVIWGLVGPKRIF SEG Y ALNWFF
Sbjct  555   AWWLLDSITNICHKNVLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGSEGVYKALNWFF  614

Query  1923  LGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFV  2102
             LGG+LGPV VWLLH+ F  QSWIPLINLPVLLGAT +MPPAT+LNY+SWI+VGTIFNFF+
Sbjct  615   LGGLLGPVAVWLLHKSFRKQSWIPLINLPVLLGATAAMPPATALNYNSWIVVGTIFNFFI  674

Query  2103  FRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTT---DLEHCDLASC  2273
             FRYRK+WWQRYNYILSA LDAGVAFMAV++YF  G+EDR + WWG+    D EHC LA+C
Sbjct  675   FRYRKRWWQRYNYILSAALDAGVAFMAVVIYFAFGIEDRNLHWWGSNPDVDPEHCGLATC  734

Query  2274  PTAKGIAVDGCPVF  2315
             PTAKGI++DGCPVF
Sbjct  735   PTAKGISIDGCPVF  748



>gb|KHG27446.1| Oligopeptide transporter 4 -like protein [Gossypium arboreum]
Length=755

 Score =  1120 bits (2897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/757 (76%), Positives = 663/757 (88%), Gaps = 12/757 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDE------EVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVV  236
             MGT+EIEA   KLA E V +E      EVSPIE+VRLTV NTDDP+LPVWTFRMW LG+ 
Sbjct  1     MGTMEIEATVPKLAEEVVKEEGEMDEIEVSPIEQVRLTVPNTDDPSLPVWTFRMWFLGLF  60

Query  237   SCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNP  416
             SC LLSFLNQFF YR EPL+IT ITVQVATLPIGRFMA+ALPA KFRIPGFGS +FSLNP
Sbjct  61    SCALLSFLNQFFGYRTEPLVITQITVQVATLPIGRFMASALPATKFRIPGFGSKEFSLNP  120

Query  417   GPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGY  596
             GPFNMKEHVLITIFANAG  FGNG+ YAV IV II AFY R ISFF+ WLLI+TTQV+GY
Sbjct  121   GPFNMKEHVLITIFANAGSGFGNGTVYAVSIVTIIKAFYGRSISFFSSWLLIMTTQVMGY  180

Query  597   GWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSF  776
             GWAG+L+KYVVEPAHMWWPSTLVQISLF TLHEKEE +DG     ++R KFFVI+L  SF
Sbjct  181   GWAGILRKYVVEPAHMWWPSTLVQISLFTTLHEKEENKDGKRP--IARVKFFVIALVSSF  238

Query  777   CWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLV  956
             CWY FPGY+FQTL SIS  C VFP SVTAHQ+GSG+NGLG+GA TLDW+T+ASFL SPLV
Sbjct  239   CWYVFPGYLFQTLQSISLACLVFPHSVTAHQIGSGMNGLGIGAFTLDWTTVASFLFSPLV  298

Query  957   CPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQ  1136
              PFFAIVNVF+GYA+I+YLVMP+SYWGLN++NAK FP+YSSDLFTAQGQEY++S IVNK+
Sbjct  299   SPFFAIVNVFIGYALIIYLVMPVSYWGLNLFNAKTFPIYSSDLFTAQGQEYNVSLIVNKK  358

Query  1137  FELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDI  1316
             FE+D  EY K GR+++STFF+++YGFGFATIA+TITHVALFYGREIY RY+AS++ K D+
Sbjct  359   FEIDFPEYEKLGRVHMSTFFAITYGFGFATIAATITHVALFYGREIYSRYQASSREKPDV  418

Query  1317  HTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPIS  1496
             HT+LM+NYKDIPSWWFY+LL V+I + L LCIF   +VQMP+WGL+FAAALAF FTLPIS
Sbjct  419   HTRLMRNYKDIPSWWFYLLLAVSILLGLVLCIFFKKDVQMPWWGLLFAAALAFFFTLPIS  478

Query  1497  IITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKI  1676
             IITATTNQTPGLNIITEYIMG I PG+PI NVCFKTYGY+SM QA+AFLSDFKLGHYMKI
Sbjct  479   IITATTNQTPGLNIITEYIMGAILPGQPITNVCFKTYGYISMAQAVAFLSDFKLGHYMKI  538

Query  1677  PPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVI  1853
             PPRSMFLVQFIGT++AGTIN+ V WWLL S+ENICH++ L +NSPWTCP D+VFFDASVI
Sbjct  539   PPRSMFLVQFIGTMLAGTINLGVGWWLLSSVENICHKNLLPANSPWTCPGDKVFFDASVI  598

Query  1854  WGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGS  2033
             WGLVGPKRIF S G Y+ LNWFFLGG+LGPV+VWLLH+ FPSQ+WIPLINLPVLLGATG+
Sbjct  599   WGLVGPKRIFGSLGEYSTLNWFFLGGLLGPVVVWLLHKAFPSQAWIPLINLPVLLGATGN  658

Query  2034  MPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLE  2213
             MPPAT LNY+SWI+VGTIFNFFVFRYRK+WWQRYNYILSA LDAG AFM VL+Y  +G+E
Sbjct  659   MPPATPLNYTSWIIVGTIFNFFVFRYRKRWWQRYNYILSAALDAGTAFMTVLIYVALGVE  718

Query  2214  DRTISWWGTT-DL--EHCDLASCPTAKGIAVDGCPVF  2315
              +++ WWG + D+  EHCDLA+CPTAKGI V+GCP+F
Sbjct  719   SKSLHWWGASPDVVPEHCDLATCPTAKGILVEGCPIF  755



>ref|XP_010065750.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW63397.1| hypothetical protein EUGRSUZ_G01043 [Eucalyptus grandis]
Length=752

 Score =  1119 bits (2895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/760 (75%), Positives = 651/760 (86%), Gaps = 23/760 (3%)
 Frame = +3

Query  75    MGTVEIEA----------PALKLAGEDVNDEE--VSPIEEVRLTVTNTDDPTLPVWTFRM  218
             MG++E EA               A  DV+D E  +SPIEEVRLTVTNTDDPTLPVWTFRM
Sbjct  1     MGSLEPEALPSATATVANSKKPAAPNDVDDAEDDLSPIEEVRLTVTNTDDPTLPVWTFRM  60

Query  219   WVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSG  398
             W LGV+SC LLSFLNQFF+YR EPL+IT ITVQVATLPIGRFMAA LP AKFRIPG G  
Sbjct  61    WFLGVLSCALLSFLNQFFAYRTEPLVITQITVQVATLPIGRFMAAVLPTAKFRIPGLGPR  120

Query  399   QFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIIT  578
              FSLNPGPFNMKEHVLI+IFANAG AFG+GSAYAV IVNII AFY R ISFFAGWLLIIT
Sbjct  121   TFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVSIVNIIKAFYVRSISFFAGWLLIIT  180

Query  579   TQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVI  758
             TQVLGYGWAGLL+KYVVEPAHMWWPSTLVQ+SLFR LHEK+++        MSRAKFFVI
Sbjct  181   TQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFRALHEKDDQR-------MSRAKFFVI  233

Query  759   SLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASF  938
             +L CSF WY  PGY+F TL SISWVCW+F KSVTA Q+GSG+ GLGLGA TLDW+ +ASF
Sbjct  234   ALTCSFSWYVVPGYLFPTLTSISWVCWIFSKSVTAQQIGSGMKGLGLGATTLDWTVVASF  293

Query  939   LSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDIS  1118
             L SPL+CPFFAI+N+FVGYA+++Y+ +P++YWG N Y A  FP++SS LFT QGQ Y+I+
Sbjct  294   LFSPLICPFFAIMNIFVGYALVVYVAIPLAYWGFNWYGADRFPIFSSHLFTKQGQTYNIT  353

Query  1119  AIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRAST  1298
             AIVN  FELD  +Y +QGRIY+S FF+L+    FATIAST++HV  FYG EIY RYRAS 
Sbjct  354   AIVNSNFELDVAKYEEQGRIYMSMFFALTIRVWFATIASTLSHVGFFYGSEIYTRYRASY  413

Query  1299  KGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFM  1478
             KGK D+HT+LM+ Y+DIPSWWFY+LL +T+AVSLALCIFLN +VQ+P+WGL+FA+ALAF+
Sbjct  414   KGKEDVHTRLMRRYEDIPSWWFYLLLALTVAVSLALCIFLNKQVQLPWWGLLFASALAFI  473

Query  1479  FTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKL  1658
             FTLPISIITATTNQTPGLNIITEYIMG+IYPG PIANVCFKTYGYMSM QA++FL+DFKL
Sbjct  474   FTLPISIITATTNQTPGLNIITEYIMGLIYPGHPIANVCFKTYGYMSMAQAVSFLNDFKL  533

Query  1659  GHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL--SNSPWTCPSDRV  1832
             GHYMKIPPRSMFLVQFIGT+IAGTINM+VAWWLL+SI NIC QD+L   +SPWTCP DRV
Sbjct  534   GHYMKIPPRSMFLVQFIGTIIAGTINMAVAWWLLNSITNIC-QDQLLPPDSPWTCPGDRV  592

Query  1833  FFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPV  2012
             FFDASVIWGLVGPKRIF  +GNY A+NWFFLGG +GP +VWLLH+ FP +SWIPLINLPV
Sbjct  593   FFDASVIWGLVGPKRIFGVQGNYPAMNWFFLGGAVGPFLVWLLHKAFPDKSWIPLINLPV  652

Query  2013  LLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLL  2192
             LLGATG+MPPAT LNY++W+LVGTIFNFFVFRYRKKWWQRYNY+LSA +DAGVAFM VLL
Sbjct  653   LLGATGNMPPATPLNYNAWVLVGTIFNFFVFRYRKKWWQRYNYVLSAAMDAGVAFMGVLL  712

Query  2193  YFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             YF +G+E+R ++WWGT   EHCDLASCPTAKGI+ DGCP+
Sbjct  713   YFCLGMENRGLNWWGTGG-EHCDLASCPTAKGISADGCPM  751



>gb|KCW63396.1| hypothetical protein EUGRSUZ_G01042, partial [Eucalyptus grandis]
Length=720

 Score =  1119 bits (2895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/726 (76%), Positives = 641/726 (88%), Gaps = 9/726 (1%)
 Frame = +3

Query  135   EEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITV  314
             +++SPIE+VRL VTNTDDPTLPVWTFRMW LGV+SC LLSFLNQFF+YR EPL+IT ITV
Sbjct  1     DDLSPIEQVRLIVTNTDDPTLPVWTFRMWFLGVLSCALLSFLNQFFAYRTEPLVITQITV  60

Query  315   QVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSA  494
             QVATLPIGRFMAA LP A+FRIPG     FSLNPGPFNMKEHVLI+IFANAG AFG+G A
Sbjct  61    QVATLPIGRFMAAVLPTAEFRIPGLRRRTFSLNPGPFNMKEHVLISIFANAGSAFGSGPA  120

Query  495   YAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQIS  674
             YAVGIVNII AFY R ISFFAGWLLIITTQVLGYGWAGLL+KY VEPAHMWWPSTLVQ+S
Sbjct  121   YAVGIVNIIKAFYLRSISFFAGWLLIITTQVLGYGWAGLLRKYAVEPAHMWWPSTLVQVS  180

Query  675   LFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKS  854
             LFR LHEK+++        MSRAKFF+I+L CSF WY  PGY+F TL +ISW+CW+F KS
Sbjct  181   LFRALHEKDDQR-------MSRAKFFIIALICSFSWYVVPGYLFSTLTNISWICWIFSKS  233

Query  855   VTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYW  1034
             VTA Q+GSG+ GLGLGALTLDW+ +ASFL SPL+CPFFAI+N+F GYA+++Y+ +P++YW
Sbjct  234   VTAQQIGSGMKGLGLGALTLDWTVVASFLFSPLICPFFAIMNIFAGYALVVYVAIPLAYW  293

Query  1035  GLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGF  1214
             G N+Y A  FP++SS+LFT QGQ Y+I+AIVN  FELD  +Y  QGRI+LST F+ +YGF
Sbjct  294   GFNLYGADRFPIFSSNLFTKQGQAYNITAIVNSNFELDLAKYEDQGRIHLSTLFAFTYGF  353

Query  1215  GFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAV  1394
             GFATIAST+THV  FYGREIY+RYRAS KGK DIHT+LM+ YKDIPSWWFY+LLV+T+AV
Sbjct  354   GFATIASTLTHVGFFYGREIYERYRASYKGKEDIHTRLMRRYKDIPSWWFYLLLVLTVAV  413

Query  1395  SLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPG  1574
             SLALCIFLN +VQMP+WGL+FA+ LAF+FTLPISIITATTNQTPGLNIITEYIMG+IYPG
Sbjct  414   SLALCIFLNKQVQMPWWGLLFASTLAFIFTLPISIITATTNQTPGLNIITEYIMGVIYPG  473

Query  1575  KPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWW  1754
              PIANVCFKTYGYMSM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT+IAGT+NM+VAWW
Sbjct  474   HPIANVCFKTYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTIIAGTVNMAVAWW  533

Query  1755  LLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGG  1931
             LL+SI NIC  + L  +SPWTCP+DRVFFDASVIWGL GPKRIF  +GNY A+NWFFLGG
Sbjct  534   LLNSITNICQIELLPPDSPWTCPNDRVFFDASVIWGLAGPKRIFGVQGNYQAMNWFFLGG  593

Query  1932  ILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRY  2111
              +GP +VWLLH+ FP +SWIPLINLPVLLGATG+MPPAT LNY++W+LVGTIFNFFVFRY
Sbjct  594   AVGPFLVWLLHKAFPDKSWIPLINLPVLLGATGNMPPATPLNYNAWVLVGTIFNFFVFRY  653

Query  2112  RKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGI  2291
             RKKWWQRYNY+LSA +DAGVAFM VLLYF +G+E++ ++WWGT   EHCDLASCPTAKGI
Sbjct  654   RKKWWQRYNYVLSAAMDAGVAFMGVLLYFCLGMENKGLNWWGTGG-EHCDLASCPTAKGI  712

Query  2292  AVDGCP  2309
             ++DGCP
Sbjct  713   SMDGCP  718



>ref|XP_002283674.1| PREDICTED: oligopeptide transporter 4-like [Vitis vinifera]
Length=754

 Score =  1118 bits (2893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/754 (77%), Positives = 657/754 (87%), Gaps = 7/754 (1%)
 Frame = +3

Query  75    MGTVEIEAPALK-LAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLL  251
             MG+VEIEAP +  L   ++N++E SPIEEVRLTV N DD +L VWTFRMW LGV+SC LL
Sbjct  1     MGSVEIEAPRVNTLENGNINEDEESPIEEVRLTVPNDDDSSLSVWTFRMWFLGVLSCTLL  60

Query  252   SFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNM  431
             SFLNQFFSYRREPL+IT ITVQVATLPIGRFMAA LP  KF IPGFG  +FS NPGPFNM
Sbjct  61    SFLNQFFSYRREPLVITQITVQVATLPIGRFMAAVLPETKFHIPGFGKREFSFNPGPFNM  120

Query  432   KEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGL  611
             KEHVLI+IFANAG AFGNGSAYAVGIV II AFY   ISF AGWLLI+TTQVLGYGWAGL
Sbjct  121   KEHVLISIFANAGSAFGNGSAYAVGIVTIIKAFYNSSISFLAGWLLIVTTQVLGYGWAGL  180

Query  612   LKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgg--grrrMSRAKFFVISLCCSFCWY  785
             L+KYVVEPAHMWWP TLVQI+LFRTLHEKE  ++     ++RMSR+KFFVI++  SF WY
Sbjct  181   LRKYVVEPAHMWWPGTLVQIALFRTLHEKENGDNTDGDNKKRMSRSKFFVIAMTGSFLWY  240

Query  786   FFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPF  965
               P + FQ+L SISWVCW FPKS+TA QLGSG +GLG GALTLDWS +ASFL SPL+CPF
Sbjct  241   SVPDFFFQSLQSISWVCWAFPKSITAQQLGSGFSGLGFGALTLDWSVVASFLFSPLICPF  300

Query  966   FAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFEL  1145
             FAIVNVF+GY +I+Y+VMPISYWGLNVYNA+ FP++SS LFTAQGQ Y+ SAIV K  E+
Sbjct  301   FAIVNVFIGYVLIIYIVMPISYWGLNVYNARTFPIFSSHLFTAQGQRYNTSAIVTKNLEI  360

Query  1146  DEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTK  1325
             D  +Y KQGR+ LS+FF+++YGFGFATIA+T+THVALFYGREIY+RYRAS +GK D+HT+
Sbjct  361   DWVQYEKQGRVNLSSFFAITYGFGFATIAATLTHVALFYGREIYNRYRASKEGKEDVHTR  420

Query  1326  LMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIIT  1505
             LMK YKDIPSWWF++LL +TI +SLALCIFL DEVQMP+W LIFAAALAF+FTLP+SIIT
Sbjct  421   LMKKYKDIPSWWFHLLLALTIIISLALCIFLKDEVQMPWWALIFAAALAFIFTLPVSIIT  480

Query  1506  ATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPR  1685
             ATTNQTPGLNIITEYIMGII+PG+PIANVCFKTYGYMSM QAI+FLSDFKLGHYMKIPPR
Sbjct  481   ATTNQTPGLNIITEYIMGIIWPGRPIANVCFKTYGYMSMAQAISFLSDFKLGHYMKIPPR  540

Query  1686  SMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGL  1862
             SMFLVQ IGT++AGT+N+ VA WLL SI+NIC  + L +NSPWTCPSDRVFFDASVIWGL
Sbjct  541   SMFLVQLIGTILAGTVNLGVALWLLDSIDNICQDNLLPANSPWTCPSDRVFFDASVIWGL  600

Query  1863  VGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPP  2042
             VGPKR+F S GNY ALNWFFLGG+LGPV VWLLH+KFP QSWIPLINLPVLLGAT SMPP
Sbjct  601   VGPKRVFGSLGNYGALNWFFLGGLLGPVAVWLLHKKFPKQSWIPLINLPVLLGATASMPP  660

Query  2043  ATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRT  2222
             AT +NY++WIL+GTIFNFFVFRYRKKWWQRYNYILSA LDAGVAFMAVL+Y ++G+E++ 
Sbjct  661   ATPVNYNAWILIGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLIYVSLGIENKN  720

Query  2223  ISWWGTT---DLEHCDLASCPTAKGIAVDGCPVF  2315
             + WWG     D EHC LASCPTAKG+ VDGCPVF
Sbjct  721   LHWWGADPDIDPEHCPLASCPTAKGVIVDGCPVF  754



>ref|XP_010444374.1| PREDICTED: oligopeptide transporter 4-like [Camelina sativa]
Length=729

 Score =  1116 bits (2887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/733 (75%), Positives = 641/733 (87%), Gaps = 9/733 (1%)
 Frame = +3

Query  117   GEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLI  296
              ++ +DE++SPIEEVRLTVTNTDDPTLPVWTFRMW LG++SC LLSFLNQFFSYR EPL+
Sbjct  4     ADEFSDEDISPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLV  63

Query  297   ITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfa  476
             IT ITVQVATLPIG F+A  LP  +F +PG GS +FSLNPGPFNMKEHVLI+IFANAG A
Sbjct  64    ITQITVQVATLPIGHFLAKVLPKTRFGLPGCGSTRFSLNPGPFNMKEHVLISIFANAGSA  123

Query  477   fgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPS  656
             FG+GSAYAVGI+ II AFYRR ISF AGWLLIITTQVLGYGWAGLL+KYVVEPAHMWWPS
Sbjct  124   FGSGSAYAVGIITIIKAFYRRNISFVAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPS  183

Query  657   TLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVC  836
             TLVQ+SLFR LHEK++++       M+RAKFFVI+L CSF WY  PGY+F TL SISWVC
Sbjct  184   TLVQVSLFRALHEKDDQK-------MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWVC  236

Query  837   WVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLV  1016
             W FP+SVTA Q+GSG+ GLGLGA TLDW+ +ASFL SPL+ PFFAI NVF GY +++Y+V
Sbjct  237   WAFPRSVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFFGYVLLIYIV  296

Query  1017  MPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFF  1196
             +PI+YWG + YNA  FP++SS LFT+ G+ YDI AIVN +FELD  +Y +QGRI LS FF
Sbjct  297   LPIAYWGFDSYNATRFPIFSSHLFTSVGKTYDIPAIVNDKFELDLAKYEQQGRINLSMFF  356

Query  1197  SLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLL  1376
             +LSYG GFATIAST+THVALFYGREI +R+R S KGK DIHT+LMK YKDIPSWWFY +L
Sbjct  357   ALSYGLGFATIASTLTHVALFYGREIIERFRVSYKGKEDIHTRLMKRYKDIPSWWFYSML  416

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
              VT+ +SLALC+FLNDEVQMP+WGL+FA+A+AF+FTLPISIITATTNQTPGLNIITEY M
Sbjct  417   AVTLLISLALCVFLNDEVQMPWWGLVFASAMAFIFTLPISIITATTNQTPGLNIITEYAM  476

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             G+IYPG+PIANVCFK YGYMSM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGTIN
Sbjct  477   GLIYPGRPIANVCFKVYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTIN  536

Query  1737  MSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALN  1913
             ++VAWW L+SI+NIC ++ L  NSPWTCP DRVFFDASVIWGLVGPKRIF S+GNY A+N
Sbjct  537   ITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYAAMN  596

Query  1914  WFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFN  2093
             WFFLGG LGPV+VW LH+ FP +SWIPL+NLPVLLGAT  MPPAT++NY+SWILVGTIFN
Sbjct  597   WFFLGGALGPVLVWSLHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGTIFN  656

Query  2094  FFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASC  2273
              FVFRYRK WWQRYNY+LSA +DAGVAFMAVLLYF+VG+E++++ WWGT   EHCDLA C
Sbjct  657   LFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEEKSLDWWGTRG-EHCDLAKC  715

Query  2274  PTAKGIAVDGCPV  2312
             PTA+G+ VDGCPV
Sbjct  716   PTARGVIVDGCPV  728



>gb|KCW66677.1| hypothetical protein EUGRSUZ_F00450 [Eucalyptus grandis]
Length=752

 Score =  1116 bits (2887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/743 (77%), Positives = 654/743 (88%), Gaps = 5/743 (1%)
 Frame = +3

Query  99    PALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSY  278
             P L      V++ E+SP+E+V+LTV NTDDP LPVWTFRMW LG++SC LLSF NQFFSY
Sbjct  11    PNLPPEDPPVDESELSPVEQVQLTVPNTDDPNLPVWTFRMWTLGLLSCALLSFANQFFSY  70

Query  279   RREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIf  458
             R+EPL+IT ITVQVATLP+GR MA+ LP AKF +PG G  +FSLNPGPFN+KEHVLI+IF
Sbjct  71    RKEPLVITQITVQVATLPLGRLMASILPTAKFHLPGLGGREFSLNPGPFNVKEHVLISIF  130

Query  459   anagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPA  638
             ANAG AFGNG AYAVGIVNII AFY R ISF A W+LIITTQVLGYGWAGLL+KYVVEPA
Sbjct  131   ANAGSAFGNGPAYAVGIVNIIKAFYGRDISFGASWILIITTQVLGYGWAGLLRKYVVEPA  190

Query  639   HMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLA  818
             HMWWPSTLVQISLFRTLHE E +ED    R +SRA+FFVI++ CSF WY  PG++FQ+LA
Sbjct  191   HMWWPSTLVQISLFRTLHENETKEDRAQYR-VSRAEFFVIAMVCSFLWYLVPGFLFQSLA  249

Query  819   SISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYA  998
             SISWVCW FP S+TA Q+GSGLNGLG+GALTLDWST+ SFL SPL+ PFFAIVN+FVG+A
Sbjct  250   SISWVCWAFPNSITAQQIGSGLNGLGVGALTLDWSTVVSFLFSPLIYPFFAIVNIFVGFA  309

Query  999   IIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRI  1178
             +IMY+V+PISYWGLN+YNAK FP++SSDLFTAQGQEY+ + IV+K FELD  EYA+ GRI
Sbjct  310   LIMYVVVPISYWGLNMYNAKTFPIFSSDLFTAQGQEYNTTLIVSKNFELDTTEYAQLGRI  369

Query  1179  YLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSW  1358
             ++S FF+LSYGFGFATIAST++HVALFYGREIYDRYRAS+KGK DIHTKLM+NYKDIP W
Sbjct  370   HMSMFFALSYGFGFATIASTLSHVALFYGREIYDRYRASSKGKDDIHTKLMRNYKDIPQW  429

Query  1359  WFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNI  1538
             WFYVLL VTI +SL LC  L  +VQ+P+WG++FAAALAF+FTLPISIITATTNQTPGLNI
Sbjct  430   WFYVLLAVTIIISLILCTVLKKDVQLPWWGVLFAAALAFIFTLPISIITATTNQTPGLNI  489

Query  1539  ITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTL  1718
             ITEY+MG+IYPG PIANVCFKTYGYMSM QAI+FLSDFKLGHYMKIPPRSMFLVQFIGT+
Sbjct  490   ITEYLMGVIYPGHPIANVCFKTYGYMSMAQAISFLSDFKLGHYMKIPPRSMFLVQFIGTI  549

Query  1719  IAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEG  1895
             +AGT+N+ VAWWLL SI NICH++ L  NSPWTCPSDRVFFDASVIWGLVGPKRIF SEG
Sbjct  550   VAGTVNLGVAWWLLDSITNICHKNVLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGSEG  609

Query  1896  NYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWIL  2075
              Y ALNWFFLGG+LGPV VWLLH+ F  QSWIPLINLPVLLGAT +MPPAT+LNY+SWI+
Sbjct  610   VYKALNWFFLGGLLGPVAVWLLHKSFRKQSWIPLINLPVLLGATAAMPPATALNYNSWIV  669

Query  2076  VGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTT---D  2246
             VGTIFNFF+FRYRK+WWQRYNYILSA LDAGVAFMAV++YF  G+EDR + WWG+    D
Sbjct  670   VGTIFNFFIFRYRKRWWQRYNYILSAALDAGVAFMAVVIYFAFGIEDRNLHWWGSNPDVD  729

Query  2247  LEHCDLASCPTAKGIAVDGCPVF  2315
              EHC LA+CPTAKGI++DGCPVF
Sbjct  730   PEHCGLATCPTAKGISIDGCPVF  752



>ref|XP_010520694.1| PREDICTED: oligopeptide transporter 4 [Tarenaya hassleriana]
Length=756

 Score =  1115 bits (2884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 558/761 (73%), Positives = 654/761 (86%), Gaps = 17/761 (2%)
 Frame = +3

Query  57    SLYFFKMGTVEIEAPALKLAGEDV--------NDEEVSPIEEVRLTVTNTDDPTLPVWTF  212
             +L   +  T     P   +AG  V        +D++VSP+E+VRLTVTNTDDPT PVWTF
Sbjct  3     ALELQRTSTAATSDPEKPIAGNSVVSGGEEEEDDDDVSPVEQVRLTVTNTDDPTQPVWTF  62

Query  213   RMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFG  392
             RMW LG++SC LLSFLNQFF+YR EPLIIT ITVQVATLP+G F+A  LP  +F IPGFG
Sbjct  63    RMWFLGLLSCALLSFLNQFFAYRTEPLIITQITVQVATLPMGHFLAKVLPTTRFTIPGFG  122

Query  393   SGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLI  572
             S + +LNPGPFNMKEHVLI+IFANAG AFG+GSA+AV IV II AFYRR ISF A WLLI
Sbjct  123   SNRLTLNPGPFNMKEHVLISIFANAGSAFGSGSAFAVSIVTIIKAFYRRNISFLAAWLLI  182

Query  573   ITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFF  752
             ITTQVLGYGWAGLL+KYVVEPAHMWWPSTLVQ+SLFR LHEK+E+        M+RAKFF
Sbjct  183   ITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFRALHEKDEQR-------MTRAKFF  235

Query  753   VISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIA  932
             VI+L CSF WY  PGY+F TL SISW+CWVFPKSVTA QLGSG+ GLGLGA+TLDW+ +A
Sbjct  236   VIALICSFAWYLVPGYLFSTLTSISWICWVFPKSVTAQQLGSGMRGLGLGAITLDWTAVA  295

Query  933   SFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYD  1112
             SFL SPL+ PFFAI NVF+GYA+I+Y+++P++YWG++ Y+AK FP++SS LFT+ GQ+YD
Sbjct  296   SFLFSPLISPFFAIANVFIGYALILYVIVPVAYWGMDSYHAKRFPIFSSTLFTSDGQKYD  355

Query  1113  ISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRA  1292
             I A+VN+ FELD  +Y +QGRI LS FFSL+YGFGFATIAST+THVA FYGREIY+R+RA
Sbjct  356   IPAMVNENFELDLVKYQQQGRINLSLFFSLTYGFGFATIASTLTHVAFFYGREIYERFRA  415

Query  1293  STKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALA  1472
             S K K D+HT+LM+ YKDIPSWWF+ +L +T+ VSLALCIFLND+VQMP+WGLIFA+A+A
Sbjct  416   SYKSKEDVHTRLMRRYKDIPSWWFHSMLGLTLLVSLALCIFLNDQVQMPWWGLIFASAMA  475

Query  1473  FMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDF  1652
             F+FTLPISIITATTNQTPGLNIITEY MGIIYPG+PIANVCFK YGY SM QA++FL+DF
Sbjct  476   FVFTLPISIITATTNQTPGLNIITEYAMGIIYPGRPIANVCFKIYGYTSMAQAVSFLNDF  535

Query  1653  KLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDR  1829
             KLGHYMKIPPRSMFLVQFIGT++AGT+N+SVAWW L SIENIC +D L  +SPWTCP DR
Sbjct  536   KLGHYMKIPPRSMFLVQFIGTILAGTVNLSVAWWQLSSIENICQEDLLPPDSPWTCPGDR  595

Query  1830  VFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLP  2009
             VFFDASVIWGLVGPKRIF S+GNY A+NWFF+GG LGP+IVW+LH+ FP+QSWIPLINLP
Sbjct  596   VFFDASVIWGLVGPKRIFGSQGNYAAMNWFFVGGALGPIIVWMLHKSFPNQSWIPLINLP  655

Query  2010  VLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVL  2189
             VLLGAT  MPPAT++NY+SWILVGT+FNFFVFRYRK+WWQRYNY+LSA LDAGVAFMAVL
Sbjct  656   VLLGATSMMPPATAVNYNSWILVGTVFNFFVFRYRKQWWQRYNYVLSAALDAGVAFMAVL  715

Query  2190  LYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             LYFT+G+E   +SWWG TD EHC+LA CPTA+GI+VDGCPV
Sbjct  716   LYFTLGMEGIRLSWWG-TDGEHCNLAKCPTAEGISVDGCPV  755



>ref|XP_010484229.1| PREDICTED: oligopeptide transporter 4 [Camelina sativa]
Length=729

 Score =  1115 bits (2884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/733 (75%), Positives = 640/733 (87%), Gaps = 9/733 (1%)
 Frame = +3

Query  117   GEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLI  296
              ++ +DE+ SPIEEVRLTVTNTDDPTLPVWTFRMW LG++SC LLSFLNQFFSYR EPL+
Sbjct  4     ADEFSDEDTSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLV  63

Query  297   ITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfa  476
             IT ITVQVATLPIG F+A  LP  +F +PG GS +FSLNPGPFNMKEHVLI+IFANAG A
Sbjct  64    ITQITVQVATLPIGHFLAKVLPKTRFGLPGCGSTRFSLNPGPFNMKEHVLISIFANAGSA  123

Query  477   fgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPS  656
             FG+GSAYAVGI+ II AFYRR ISF AGWLLIITTQVLGYGWAGLL+KYVVEPAHMWWPS
Sbjct  124   FGSGSAYAVGIITIIKAFYRRDISFVAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPS  183

Query  657   TLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVC  836
             TLVQ+SLFR LHEK++++       M+RAKFFVI+L CSF WY  PGY+F TL SISWVC
Sbjct  184   TLVQVSLFRALHEKDDQK-------MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWVC  236

Query  837   WVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLV  1016
             W FP+SVTA Q+GSG+ GLGLGA TLDW+ +ASFL SPL+ PFFAI NVF GY +++Y+V
Sbjct  237   WAFPRSVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFFGYVLLIYIV  296

Query  1017  MPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFF  1196
             +PI+YWG + YNA  FP++SS LFT+ G+ YDI AIVN +FELD  +Y +QGRI LS FF
Sbjct  297   LPIAYWGFDSYNATRFPIFSSHLFTSVGKTYDIPAIVNDKFELDLAKYEQQGRINLSMFF  356

Query  1197  SLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLL  1376
             +L+YG GFATIAST+THVALFYGREI +R+R S KGK DIHT+LMK YKDIPSWWFY +L
Sbjct  357   ALTYGLGFATIASTLTHVALFYGREIIERFRVSYKGKEDIHTRLMKRYKDIPSWWFYSML  416

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
              VT+ +SLALC+FLNDEVQMP+WGL+FA+A+AF+FTLPISIITATTNQTPGLNIITEY M
Sbjct  417   AVTLLISLALCVFLNDEVQMPWWGLVFASAMAFIFTLPISIITATTNQTPGLNIITEYAM  476

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             G+IYPG+PIANVCFK YGYMSM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGTIN
Sbjct  477   GLIYPGRPIANVCFKVYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTIN  536

Query  1737  MSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALN  1913
             ++VAWW L+SI+NIC ++ L  NSPWTCP DRVFFDASVIWGLVGPKRIF S+GNY A+N
Sbjct  537   ITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYAAMN  596

Query  1914  WFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFN  2093
             WFFLGG LGPVIVW LH+ FP +SWIPL+NLPVLLGAT  MPPAT++NY+SWILVGTIFN
Sbjct  597   WFFLGGALGPVIVWSLHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGTIFN  656

Query  2094  FFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASC  2273
              FVFRYRK WWQRYNY+LSA +DAGVAFMAVLLYF+VG+E++++ WWGT   EHCDLA C
Sbjct  657   LFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEEKSLDWWGTRG-EHCDLAKC  715

Query  2274  PTAKGIAVDGCPV  2312
             PTA+G+ VDGCPV
Sbjct  716   PTARGVIVDGCPV  728



>ref|XP_002518328.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF44088.1| Oligopeptide transporter, putative [Ricinus communis]
Length=754

 Score =  1114 bits (2882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/759 (75%), Positives = 663/759 (87%), Gaps = 22/759 (3%)
 Frame = +3

Query  75    MGTVEIEAP------ALKL-------AGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFR  215
             MG++EI+ P        KL       A +D +D  VSPIEEVRLTV+NTDDPTLPVWTFR
Sbjct  2     MGSLEIQTPYSTTTTDTKLPDPEKPTAADDADD--VSPIEEVRLTVSNTDDPTLPVWTFR  59

Query  216   MWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGS  395
             MW LG++SC LLSFLNQFF+YR EPL+IT ITVQVATLPIG F+A+ LP  KFRI GFGS
Sbjct  60    MWFLGLLSCGLLSFLNQFFAYRTEPLVITQITVQVATLPIGHFLASVLPKTKFRIAGFGS  119

Query  396   GQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLII  575
               FSLNPGPFNMKEHVLI+IFANAG AFG+GSAYAVGIV II AFY+RKISFFA W+LI+
Sbjct  120   KTFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVGIVTIIKAFYQRKISFFASWILIV  179

Query  576   TTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFV  755
             TTQVLGYGWAGLL+KYVVEPAHMWWPSTLVQ+SLFR LHEK+++  G     M+RAKFF+
Sbjct  180   TTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFRALHEKDDKGQG-----MTRAKFFL  234

Query  756   ISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIAS  935
             I+L CSF WY  PGY+F TL SISWVCWVF KSVTA QLGSG+ GLGLGA TLDWS +AS
Sbjct  235   IALVCSFSWYVVPGYLFTTLTSISWVCWVFSKSVTAQQLGSGMRGLGLGAFTLDWSAVAS  294

Query  936   FLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDI  1115
             FL SPL+ PFFAIVNV +GY +I+Y+ +P++YWGL++YNA  FP++SS LFTAQGQ+Y+I
Sbjct  295   FLFSPLISPFFAIVNVAIGYVLILYIAIPVAYWGLDLYNAHRFPIFSSHLFTAQGQKYNI  354

Query  1116  SAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRAS  1295
              AIVN +FELD  +Y +QGRI+LS FF+L+YGFGFATIAST+ HVALFYGREI ++YRAS
Sbjct  355   PAIVNDKFELDLPKYDEQGRIHLSMFFALTYGFGFATIASTLMHVALFYGREILEQYRAS  414

Query  1296  TKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAF  1475
             +KGK DIHT+LMK YKDIP+WWFY+LL V++AVSL LCIFLND+VQMP+W LIFA+A+AF
Sbjct  415   SKGKEDIHTRLMKRYKDIPAWWFYLLLAVSLAVSLLLCIFLNDQVQMPWWALIFASAMAF  474

Query  1476  MFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFK  1655
              FTLPISIITATTNQTPGLNIITEY+MGIIYPG+PIANVCFKTYGY+SM QA++FL+DFK
Sbjct  475   FFTLPISIITATTNQTPGLNIITEYVMGIIYPGRPIANVCFKTYGYISMAQAVSFLNDFK  534

Query  1656  LGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRV  1832
             LGHYMKIPPRSMFLVQFIGT++AGTIN++VAWWLL+SI NIC  D L  NSPWTCP DRV
Sbjct  535   LGHYMKIPPRSMFLVQFIGTMLAGTINLAVAWWLLNSITNICQDDLLPPNSPWTCPGDRV  594

Query  1833  FFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPV  2012
             FFDASVIWGLVGP+RIF S GNY A+NWFFLGG +GP+IVWLLH+ FP +SWIPLINLPV
Sbjct  595   FFDASVIWGLVGPRRIFGSLGNYQAMNWFFLGGAVGPIIVWLLHKSFPRKSWIPLINLPV  654

Query  2013  LLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLL  2192
             LLG+TG MPPAT++NY+SWI+VGTIFNFFVFRYRK+WWQRYNYILSA LDAGVAFMAVLL
Sbjct  655   LLGSTGMMPPATAVNYNSWIIVGTIFNFFVFRYRKQWWQRYNYILSAALDAGVAFMAVLL  714

Query  2193  YFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCP  2309
             YF++G+E+R+++WWG TD EHCDLASCPTAKGI V GCP
Sbjct  715   YFSLGIENRSLTWWG-TDGEHCDLASCPTAKGIDVAGCP  752



>emb|CDY31321.1| BnaA02g34200D [Brassica napus]
Length=729

 Score =  1113 bits (2880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/732 (75%), Positives = 637/732 (87%), Gaps = 9/732 (1%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
             ++  D++VSPIEEVRLTVTNTDD TLPVWTFRMW LG++SC LLSFLNQFFSYR EPL+I
Sbjct  5     DESYDDDVSPIEEVRLTVTNTDDHTLPVWTFRMWFLGLISCALLSFLNQFFSYRTEPLVI  64

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
             T ITVQVATLPIG F+A  LP  +F IPGFGS +FSLNPGPFNMKEHVLI+IFANAG AF
Sbjct  65    TQITVQVATLPIGHFLAKVLPKTQFGIPGFGSTRFSLNPGPFNMKEHVLISIFANAGSAF  124

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
             G+GSAYAVGIV II AFYR+ ISF AGWLLIITTQVLGYGWAGLL+KYVVEPAHMWWPST
Sbjct  125   GSGSAYAVGIVTIIKAFYRKNISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPST  184

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR LHEK+E+        M+RAKFFVI+L CSF WY  PGY+F TL SISW+CW
Sbjct  185   LVQVSLFRALHEKDEQR-------MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWICW  237

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
              FP+SVTA Q+GSG+ GLGLGA TLDW+ +ASFL SPL+ PFFAI NVF+GY +++Y+V+
Sbjct  238   AFPRSVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFIGYVLLIYIVL  297

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             P+SYWG + YNA  FP++SS LFT+ GQ YDI AIVN +FELD  +Y +QGRI LSTFF+
Sbjct  298   PLSYWGFDAYNATRFPIFSSHLFTSVGQTYDIPAIVNDKFELDLAKYEQQGRINLSTFFA  357

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLV  1379
             ++YG GFATIAST+THVALFYGREI +R+R S KGK D+HT+LMK YKDIPSWWFY +L 
Sbjct  358   MTYGLGFATIASTLTHVALFYGREITERFRVSYKGKEDVHTRLMKRYKDIPSWWFYSMLA  417

Query  1380  VTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMG  1559
              T+ +SLALCIFLND+VQMP+WGL+FA+A+AF+FTLPISIITATTNQTPGLNIITEY MG
Sbjct  418   ATLLISLALCIFLNDQVQMPWWGLVFASAMAFVFTLPISIITATTNQTPGLNIITEYAMG  477

Query  1560  IIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINM  1739
             IIYPG+PIANVCFK YGYMSM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGTIN+
Sbjct  478   IIYPGRPIANVCFKVYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTINI  537

Query  1740  SVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNW  1916
             +VAWW L++I NIC ++ L  NSPWTCP DRVFFDASVIWGLVGPKRIF S+GNY A+NW
Sbjct  538   TVAWWQLNTITNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYAAMNW  597

Query  1917  FFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNF  2096
             FFLGG +GPVIVWL H+ FP  SWIPL+NLPVLLGAT  MPPAT++NY+SWILVGTIFN 
Sbjct  598   FFLGGAIGPVIVWLCHKAFPKHSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGTIFNL  657

Query  2097  FVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCP  2276
             FVFRYRK WWQRYNY+LSA +DAGVAFMAVLLYF+VG+ED+++ WWGT   EHCDLA CP
Sbjct  658   FVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEDKSLDWWGTRG-EHCDLARCP  716

Query  2277  TAKGIAVDGCPV  2312
             TA+G+ V GCPV
Sbjct  717   TARGVIVKGCPV  728



>ref|XP_010461766.1| PREDICTED: oligopeptide transporter 4-like [Camelina sativa]
Length=729

 Score =  1113 bits (2879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/733 (75%), Positives = 639/733 (87%), Gaps = 9/733 (1%)
 Frame = +3

Query  117   GEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLI  296
              ++ +DE+ SPIEEVRLTVTNTDDPTLPVWTFRMW LG++SC LLSFLNQFFSYR EPL+
Sbjct  4     ADEFSDEDTSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLV  63

Query  297   ITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfa  476
             IT ITVQVATLPIG F+A  LP  +F +PG GS +FSLNPGPFNMKEHVLI+IFANAG A
Sbjct  64    ITQITVQVATLPIGHFLAKVLPKTRFGLPGCGSTRFSLNPGPFNMKEHVLISIFANAGSA  123

Query  477   fgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPS  656
             FG+GSAYAVGI+ II AFYRR ISF AGWLLIITTQVLGYGWAGLL+KYVVEPAHMWWPS
Sbjct  124   FGSGSAYAVGIITIIKAFYRRNISFVAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPS  183

Query  657   TLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVC  836
             TLVQ+SLFR LHEK++++       M+RAKFFVI+L CSF WY  PGY+F TL SISWVC
Sbjct  184   TLVQVSLFRALHEKDDQK-------MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWVC  236

Query  837   WVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLV  1016
             W FP+SVTA Q+GSG+ GLGLGA TLDW+ +ASFL SPL+ PFFAI N F GY +++Y+V
Sbjct  237   WAFPRSVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANAFFGYVLLIYIV  296

Query  1017  MPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFF  1196
             +PI+YWG + YNA  FP++SS LFT+ G+ YDI AIVN +FELD  +Y +QGRI LS FF
Sbjct  297   LPIAYWGFDSYNATRFPIFSSHLFTSVGKTYDIPAIVNDKFELDLAKYEQQGRINLSMFF  356

Query  1197  SLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLL  1376
             +L+YG GFATIAST+THVALFYGREI +R+R S KGK DIHT+LMK YKDIPSWWFY +L
Sbjct  357   ALTYGLGFATIASTLTHVALFYGREIIERFRVSYKGKEDIHTRLMKRYKDIPSWWFYSML  416

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
              VT+ +SLALC+FLNDEVQMP+WGL+FA+A+AF+FTLPISIITATTNQTPGLNIITEY M
Sbjct  417   AVTLLISLALCVFLNDEVQMPWWGLVFASAMAFIFTLPISIITATTNQTPGLNIITEYAM  476

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             G+IYPG+PIANVCFK YGYMSM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGTIN
Sbjct  477   GLIYPGRPIANVCFKVYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTIN  536

Query  1737  MSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALN  1913
             ++VAWW L+SI+NIC ++ L  NSPWTCP DRVFFDASVIWGLVGPKRIF S+GNY A+N
Sbjct  537   ITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYAAMN  596

Query  1914  WFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFN  2093
             WFFLGG LGPV+VW LH+ FP +SWIPL+NLPVLLGAT  MPPAT++NY+SWILVGTIFN
Sbjct  597   WFFLGGALGPVLVWSLHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGTIFN  656

Query  2094  FFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASC  2273
              FVFRYRK WWQRYNY+LSA +DAGVAFMAVLLYF+VG+E++++ WWGT   EHCDLA C
Sbjct  657   LFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEEKSLDWWGTRG-EHCDLAKC  715

Query  2274  PTAKGIAVDGCPV  2312
             PTA+G+ VDGCPV
Sbjct  716   PTARGVIVDGCPV  728



>ref|XP_002866614.1| hypothetical protein ARALYDRAFT_496649 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42873.1| hypothetical protein ARALYDRAFT_496649 [Arabidopsis lyrata subsp. 
lyrata]
Length=729

 Score =  1113 bits (2879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/733 (75%), Positives = 636/733 (87%), Gaps = 9/733 (1%)
 Frame = +3

Query  117   GEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLI  296
              ++ +DE+ SPIEEVRLTVTNTDDPTLPVWTFRMW LG++SC LLSFLNQFFSYR EPL+
Sbjct  4     ADEFSDEDTSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLV  63

Query  297   ITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfa  476
             IT ITVQVATLPIG F+A  LP  +F +PG GS +FSLNPGPFNMKEHVLI+IFANAG A
Sbjct  64    ITQITVQVATLPIGHFLAKVLPKTRFGLPGCGSARFSLNPGPFNMKEHVLISIFANAGSA  123

Query  477   fgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPS  656
             FG+GSAYAVGI+ II AFY R ISF AGWLLIITTQVLGYGWAGLL+KYVVEPAHMWWPS
Sbjct  124   FGSGSAYAVGIITIIKAFYGRNISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPS  183

Query  657   TLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVC  836
             TLVQ+SLFR LHEK+++        M+RAKFFVI+L CSF WY  PGY+F TL SISWVC
Sbjct  184   TLVQVSLFRALHEKDDQR-------MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWVC  236

Query  837   WVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLV  1016
             W FP+SVTA Q+GSG+ GLGLGA TLDW+ +ASFL SPL+ PFFAI NVFVGY +++YLV
Sbjct  237   WAFPRSVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFVGYVLLIYLV  296

Query  1017  MPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFF  1196
             +P+ YWG + YNA  FP++SS LFT+ G+ YDI AIVN  FELD  +Y +QGRI LS FF
Sbjct  297   LPLGYWGFDSYNATRFPIFSSHLFTSFGKTYDIPAIVNDNFELDLAKYEQQGRINLSMFF  356

Query  1197  SLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLL  1376
             +LSYG GFATIAST+THVALFYGREI +R+R S KGK DIHT+LMK YKDIPSWWFY +L
Sbjct  357   ALSYGLGFATIASTLTHVALFYGREISERFRVSYKGKEDIHTRLMKRYKDIPSWWFYSML  416

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
               T+ +SLALCIFLNDEVQMP+WGL+FA+A+AF+FTLPISIITATTNQTPGLNIITEY M
Sbjct  417   AATLLISLALCIFLNDEVQMPWWGLVFASAMAFVFTLPISIITATTNQTPGLNIITEYAM  476

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             G+IYPG+PIANVCFK YGYMSM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGTIN
Sbjct  477   GLIYPGRPIANVCFKVYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTIN  536

Query  1737  MSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALN  1913
             ++VAWW L+SI+NIC ++ L  NSPWTCP DRVFFDASVIWGLVGPKRIF S+GNY A+N
Sbjct  537   ITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYAAMN  596

Query  1914  WFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFN  2093
             WFFLGG LGPVIVW LH+ FP +SWIPL+NLPVLLGAT  MPPAT++NY+SWILVGTIFN
Sbjct  597   WFFLGGALGPVIVWSLHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGTIFN  656

Query  2094  FFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASC  2273
              FVFRYRK WWQRYNY+LSA +DAGVAFMAVLLYF+VG+E++++ WWGT   EHCDLA C
Sbjct  657   LFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEEKSLDWWGTRG-EHCDLAKC  715

Query  2274  PTAKGIAVDGCPV  2312
             PTA+G+ VDGCPV
Sbjct  716   PTARGVIVDGCPV  728



>ref|XP_010064243.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=752

 Score =  1113 bits (2878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/743 (77%), Positives = 654/743 (88%), Gaps = 5/743 (1%)
 Frame = +3

Query  99    PALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSY  278
             P L      V++ E+SP+E+V+LTV NTDDP LPVWTFRMW LG++SC LLSF NQFFSY
Sbjct  11    PNLPPEDPPVDESELSPVEQVQLTVPNTDDPNLPVWTFRMWTLGLLSCALLSFANQFFSY  70

Query  279   RREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIf  458
             R+EPL+IT ITVQVATLP+GR MA+ LP AKF +PG G  +FSLNPGPFN+KEHVLI+IF
Sbjct  71    RKEPLVITQITVQVATLPLGRLMASILPTAKFHLPGLGGREFSLNPGPFNVKEHVLISIF  130

Query  459   anagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPA  638
             ANAG AFGNG AYAVGIVNII AFY R ISF A W+LIITTQVLGYGWAGLL+KYVVEPA
Sbjct  131   ANAGSAFGNGPAYAVGIVNIIKAFYGRDISFGASWILIITTQVLGYGWAGLLRKYVVEPA  190

Query  639   HMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLA  818
             HMWWPSTLVQISLFRTLHE E +ED    R +SRA+FFVI++ CSF WY  PG++FQ+LA
Sbjct  191   HMWWPSTLVQISLFRTLHENETKEDRAQYR-VSRAEFFVIAMVCSFLWYLVPGFLFQSLA  249

Query  819   SISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYA  998
             SISWVCW FP S+TA Q+GSGLNGLG+GALTLDWST+ SFL SPL+ PFFAIVN+FVG+A
Sbjct  250   SISWVCWAFPNSITAQQIGSGLNGLGVGALTLDWSTVVSFLFSPLIYPFFAIVNIFVGFA  309

Query  999   IIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRI  1178
             +IMY+V+PISYWGLN+YNAK FP++SSDLFTAQGQEY+ + IV+K FELD  EYA+ GRI
Sbjct  310   LIMYVVVPISYWGLNMYNAKTFPIFSSDLFTAQGQEYNTTLIVSKNFELDTTEYAQLGRI  369

Query  1179  YLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSW  1358
             ++S FF+LSYGFGFATIAST++HVALFYGREIYDRYRAS+KGK DIHTKLM+NYKDIP W
Sbjct  370   HMSMFFALSYGFGFATIASTLSHVALFYGREIYDRYRASSKGKDDIHTKLMRNYKDIPQW  429

Query  1359  WFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNI  1538
             WFYVLL VTI +SL LC  L  +VQ+P+WG++FAAALAF+FTLPISIITATTNQTPGLNI
Sbjct  430   WFYVLLAVTIIISLILCTVLKKDVQLPWWGVLFAAALAFIFTLPISIITATTNQTPGLNI  489

Query  1539  ITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTL  1718
             ITEY+MG+IYPG PIANVCFKTYGYMSM QAI+FLSDFKLGHYMKIPPRSMFLVQFIGT+
Sbjct  490   ITEYLMGVIYPGHPIANVCFKTYGYMSMAQAISFLSDFKLGHYMKIPPRSMFLVQFIGTI  549

Query  1719  IAGTINMSVAWWLLHSIENICHQDKLS-NSPWTCPSDRVFFDASVIWGLVGPKRIFDSEG  1895
             IAG+IN+ VAWWLL SI NICH++ L  NSPWTCP+DRVFFDASVIWGLVGP+RIF SEG
Sbjct  550   IAGSINLGVAWWLLDSIPNICHKNVLPLNSPWTCPTDRVFFDASVIWGLVGPRRIFGSEG  609

Query  1896  NYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWIL  2075
              Y ALNWFFLGG+LGPV+VWLLH+ +P QSWIPLINLPVLLGAT +MPPAT+LNYSSWI+
Sbjct  610   VYGALNWFFLGGLLGPVVVWLLHKSYPKQSWIPLINLPVLLGATAAMPPATALNYSSWIV  669

Query  2076  VGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTT---D  2246
             VGTIFNFFVFRYRK+WWQRYNYILSA LDAGVAFMAV++YF   +EDR + WWG+    D
Sbjct  670   VGTIFNFFVFRYRKRWWQRYNYILSAALDAGVAFMAVVIYFAFEIEDRNLHWWGSNPNVD  729

Query  2247  LEHCDLASCPTAKGIAVDGCPVF  2315
              EHC LA+CPTAKGI+VDGC VF
Sbjct  730   PEHCRLATCPTAKGISVDGCLVF  752



>ref|XP_006486776.1| PREDICTED: oligopeptide transporter 4-like [Citrus sinensis]
Length=736

 Score =  1112 bits (2877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 561/731 (77%), Positives = 650/731 (89%), Gaps = 9/731 (1%)
 Frame = +3

Query  123   DVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIIT  302
             D++ +E+SP+EEVRLTV N+DDP+LPVWTFRMW LG++SC LLSFLNQFF+YR EPLIIT
Sbjct  13    DIDGDELSPVEEVRLTVLNSDDPSLPVWTFRMWFLGLLSCALLSFLNQFFAYRTEPLIIT  72

Query  303   SITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafg  482
              ITVQVATLPIGRF+AA LP  +FRIPG GS  FSLN GPFN+KEHVLI+IFANAG AFG
Sbjct  73    QITVQVATLPIGRFLAATLPETRFRIPGCGSRLFSLNSGPFNVKEHVLISIFANAGSAFG  132

Query  483   ngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTL  662
              GS +AV IVNII AFY RKISF A WLLIITTQVLGYGWAGLL+KYVVEPAHMWWPSTL
Sbjct  133   AGSTFAVSIVNIIKAFYHRKISFLASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTL  192

Query  663   VQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWV  842
             VQ+SLFR LHEK+++        MSRAKFFVI+L CSF WY  PGY+  TL+SISWVCW 
Sbjct  193   VQVSLFRALHEKDDQR-------MSRAKFFVIALICSFSWYLVPGYLVPTLSSISWVCWA  245

Query  843   FPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMP  1022
             F KSVTA QLGSG+ GLGLGALTLDWS +ASFL SPL+ PFFAIVNVF GY +I+Y+V+P
Sbjct  246   FSKSVTAQQLGSGMRGLGLGALTLDWSVVASFLFSPLISPFFAIVNVFAGYVLIIYVVIP  305

Query  1023  ISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSL  1202
             I+YWGL++Y+A  FP++SS LFT+QG++YDISAIVN +FELD+D+Y +QGRI+LS FF+L
Sbjct  306   IAYWGLDLYSAHKFPIFSSHLFTSQGKKYDISAIVNDKFELDQDKYQEQGRIHLSMFFAL  365

Query  1203  SYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVV  1382
             +YGFGFATIASTITHV  FYGREIY+R+RAS KGK DIHT+LM+ YKDIP WWFY++LVV
Sbjct  366   TYGFGFATIASTITHVGFFYGREIYERFRASYKGKEDIHTRLMRRYKDIPHWWFYLMLVV  425

Query  1383  TIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGI  1562
             T+ VSL LC FL D+VQMP+WGL+FA A+AF+FTLPISIITATTNQTPGLNIITEY+MGI
Sbjct  426   TLVVSLVLCTFLKDQVQMPWWGLLFAGAMAFVFTLPISIITATTNQTPGLNIITEYVMGI  485

Query  1563  IYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMS  1742
             IYPG+PIANVCFK YGYMSM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGTIN++
Sbjct  486   IYPGRPIANVCFKVYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTVLAGTINLA  545

Query  1743  VAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWF  1919
             VAWWLL+SIENIC  + L  +SPWTCP DRVFFDASVIWGLVGPKRIF S+GNY A+NWF
Sbjct  546   VAWWLLNSIENICQDELLPPDSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYPAMNWF  605

Query  1920  FLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFF  2099
             F+GG LGPV+VWLLH+ FP QSWIPLINLPVLLGATG MPPAT++NY+SWI+VGTIFNFF
Sbjct  606   FVGGALGPVLVWLLHKAFPKQSWIPLINLPVLLGATGMMPPATAVNYNSWIIVGTIFNFF  665

Query  2100  VFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPT  2279
             +FRYRK+WWQRYNYILSA +DAGVAFMAV+LYF+VG+ED+ +SWWG T+ EHCDLA+CPT
Sbjct  666   IFRYRKQWWQRYNYILSAAMDAGVAFMAVILYFSVGMEDKGLSWWG-TEGEHCDLATCPT  724

Query  2280  AKGIAVDGCPV  2312
             AKGI VDGCPV
Sbjct  725   AKGILVDGCPV  735



>emb|CDY46800.1| BnaC02g43080D [Brassica napus]
Length=729

 Score =  1112 bits (2876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/732 (75%), Positives = 637/732 (87%), Gaps = 9/732 (1%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
             ++  D++VSPIEEVRLTVTNTDD TLPVWTFRMW LG++SC LLSFLNQFFSYR EPL+I
Sbjct  5     DESYDDDVSPIEEVRLTVTNTDDHTLPVWTFRMWFLGLISCALLSFLNQFFSYRTEPLVI  64

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
             T ITVQVATLPIG F+A  LP  +F IPGFGS +FSLNPGPFNMKEHVLI+IFANAG AF
Sbjct  65    TQITVQVATLPIGHFLAKVLPKTQFGIPGFGSTRFSLNPGPFNMKEHVLISIFANAGSAF  124

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
             G+GSAYAVGIV II AFYR+ ISF AGWLLIITTQVLGYGWAGLL+KYVVEPAHMWWPST
Sbjct  125   GSGSAYAVGIVTIIKAFYRKNISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPST  184

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR LHEK+E+        M+RAKFFVI+L CSF WY  PGY+F TL SISW+CW
Sbjct  185   LVQVSLFRALHEKDEQR-------MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWICW  237

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
              FP+SVTA Q+GSG+ GLGLGA TLDW+ +ASFL SPL+ PFFAI NVF+GY +++Y+V+
Sbjct  238   AFPRSVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFIGYVLLIYIVL  297

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             P+SYWG + YNA  FP++SS LFT+ GQ YDI AIVN +FELD  +Y +QGRI LSTFF+
Sbjct  298   PLSYWGFDAYNATRFPIFSSHLFTSVGQTYDIPAIVNDKFELDLAKYEQQGRINLSTFFA  357

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLV  1379
             ++YG GFATIAST+THVALFYGREI +R+R S KGK D+HT+LMK YKDIPSWWFY +L 
Sbjct  358   MTYGLGFATIASTLTHVALFYGREITERFRVSYKGKEDVHTRLMKRYKDIPSWWFYSMLG  417

Query  1380  VTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMG  1559
              T+ +SLALC+FLND+VQMP+WGL+FA+A+AF+FTLPISIITATTNQTPGLNIITEY MG
Sbjct  418   ATLLISLALCVFLNDQVQMPWWGLVFASAMAFIFTLPISIITATTNQTPGLNIITEYAMG  477

Query  1560  IIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINM  1739
             IIYPG+PIANVCFK YGYMSM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGTIN+
Sbjct  478   IIYPGRPIANVCFKVYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTINI  537

Query  1740  SVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNW  1916
             +VAWW L++I NIC ++ L  NSPWTCP DRVFFDASVIWGLVGPKRIF S+GNY A+NW
Sbjct  538   TVAWWQLNTITNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYAAMNW  597

Query  1917  FFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNF  2096
             FFLGG +GPVIVWL H+ FP  SWIPL+NLPVLLGAT  MPPAT++NY+SWILVGTIFN 
Sbjct  598   FFLGGAIGPVIVWLCHKAFPKHSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGTIFNL  657

Query  2097  FVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCP  2276
             FVFRYRK WWQRYNY+LSA +DAGVAFMAVLLYF+VG+ED+++ WWGT   EHCDLA CP
Sbjct  658   FVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEDKSLDWWGTRG-EHCDLARCP  716

Query  2277  TAKGIAVDGCPV  2312
             TA+G+ V GCPV
Sbjct  717   TARGVIVKGCPV  728



>gb|AAM64614.1| Isp4-like protein [Arabidopsis thaliana]
Length=729

 Score =  1112 bits (2875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/733 (75%), Positives = 637/733 (87%), Gaps = 9/733 (1%)
 Frame = +3

Query  117   GEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLI  296
              ++ +DE+ SPIEEVRLTVTNTDDPTLPVWTFRMW LG++SC LLSFLNQFFSYR EPL+
Sbjct  4     ADEFSDEDTSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLV  63

Query  297   ITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfa  476
             IT ITVQVATLPIG F+A  LP  +F +PG GS +FSLNPGPFNMKEHVLI+IFANAG A
Sbjct  64    ITQITVQVATLPIGHFLAKVLPKTRFGLPGCGSARFSLNPGPFNMKEHVLISIFANAGSA  123

Query  477   fgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPS  656
             FG+GSAYAVGI+ II AFY R ISF AGWLLIITTQVLGYGWAGLL+KYVVEPAHMWWPS
Sbjct  124   FGSGSAYAVGIITIIKAFYGRSISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPS  183

Query  657   TLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVC  836
             TLVQ+SLFR LHEK+++        M+RAKFFVI+L CSF WY  PGY+F TL SISWVC
Sbjct  184   TLVQVSLFRALHEKDDQR-------MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWVC  236

Query  837   WVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLV  1016
             W FP+SVTA Q+GSG+ GLGLGA TLDW+ +ASFL SPL+ PFFAI NVF+GY +++YLV
Sbjct  237   WAFPRSVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFIGYVLLIYLV  296

Query  1017  MPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFF  1196
             +P++YWG + YNA  FP++SS LFT+ G+ YDI AIVN  FELD  +Y +QGRI LS FF
Sbjct  297   LPLAYWGFDSYNATRFPIFSSHLFTSVGKTYDIPAIVNDNFELDLAKYEQQGRINLSMFF  356

Query  1197  SLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLL  1376
             +L+YG GFATIAST+THVALFYG+EI +R+R S KGK DIHT+LMK YKDIPSWWFY +L
Sbjct  357   ALTYGLGFATIASTLTHVALFYGKEISERFRVSYKGKEDIHTRLMKRYKDIPSWWFYSML  416

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
               T+ +SLALC+FLNDEVQMP+WGL+FA+A+AF+FTLPISIITATTNQTPGLNIITEY M
Sbjct  417   AATLLISLALCVFLNDEVQMPWWGLVFASAMAFVFTLPISIITATTNQTPGLNIITEYAM  476

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             G+IYPG+PIANVCFK YGYMSM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGTIN
Sbjct  477   GLIYPGRPIANVCFKVYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTIN  536

Query  1737  MSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALN  1913
             ++VAWW L+SI+NIC ++ L  NSPWTCP DRVFFDASVIWGLVGPKRIF S+GNY A+N
Sbjct  537   ITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYAAMN  596

Query  1914  WFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFN  2093
             WFFLGG LGPVIVW LH+ FP +SWIPL+NLPVLLGAT  MPPAT++NY+SWILVGTIFN
Sbjct  597   WFFLGGALGPVIVWSLHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGTIFN  656

Query  2094  FFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASC  2273
              FVFRYRK WWQRYNY+LSA +DAGVAFMAVLLYF+VG+E++++ WWGT   EHCDLA C
Sbjct  657   LFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEEKSLDWWGTRG-EHCDLAKC  715

Query  2274  PTAKGIAVDGCPV  2312
             PTA+G+ VDGCPV
Sbjct  716   PTARGVIVDGCPV  728



>ref|XP_009130453.1| PREDICTED: oligopeptide transporter 4 [Brassica rapa]
Length=729

 Score =  1111 bits (2873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/732 (75%), Positives = 638/732 (87%), Gaps = 9/732 (1%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
             ++  D++VSPIEEVRLTVTNTDD TLPVWTFRMW LG++SC LLSFLNQFFSYR EPL+I
Sbjct  5     DESYDDDVSPIEEVRLTVTNTDDHTLPVWTFRMWFLGLISCALLSFLNQFFSYRTEPLVI  64

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
             T ITVQVATLPIG F+A  LP  +F IPGFGS +FSLNPGPFNMKEHVLI+IFANAG AF
Sbjct  65    TQITVQVATLPIGHFLAKVLPKTQFGIPGFGSTRFSLNPGPFNMKEHVLISIFANAGSAF  124

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
             G+GSAYAVGIV II AFYR+ ISF AGWLLIITTQVLGYGWAGLL+KYVVEPAHMWWPST
Sbjct  125   GSGSAYAVGIVTIIKAFYRKNISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPST  184

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR LHEK+E+        M+RAKFFVI+L CSF WY  PGY+F TL SISW+CW
Sbjct  185   LVQVSLFRALHEKDEQR-------MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWICW  237

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
              FP+SVTA Q+GSG+ GLGLGA TLDW+ +ASFL SPL+ PFFAI NVF+GY +++Y+V+
Sbjct  238   AFPRSVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFIGYVLLIYIVL  297

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             P+SYWG + YNA  FP++SS LFT+ GQ Y+I AIVN +FELD  +Y +QGRI LSTFF+
Sbjct  298   PLSYWGFDAYNATRFPIFSSHLFTSVGQTYNIPAIVNDKFELDLAKYEQQGRINLSTFFA  357

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLV  1379
             ++YG GFATIAST+THVALFYGREI +R+R S KGK D+HT+LMK YKDIPSWWFY +L 
Sbjct  358   MTYGLGFATIASTLTHVALFYGREITERFRVSYKGKEDVHTRLMKRYKDIPSWWFYSMLG  417

Query  1380  VTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMG  1559
              T+ +SLALCIFLND+VQMP+WGL+FA+A+AF+FTLPISIITATTNQTPGLNIITEY MG
Sbjct  418   ATLLISLALCIFLNDQVQMPWWGLVFASAMAFVFTLPISIITATTNQTPGLNIITEYAMG  477

Query  1560  IIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINM  1739
             IIYPG+PIANVCFK YGYMSM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGTIN+
Sbjct  478   IIYPGRPIANVCFKVYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTINI  537

Query  1740  SVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNW  1916
             +VAWW L++I NIC ++ L  NSPWTCP DRVFFDASVIWGLVGPKRIF S+GNY A+NW
Sbjct  538   TVAWWQLNTITNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYAAMNW  597

Query  1917  FFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNF  2096
             FFLGG +GPVIVWL H+ FP +SWIPL+NLPVLLGAT  MPPAT++NY+SWILVGTIFN 
Sbjct  598   FFLGGAIGPVIVWLCHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGTIFNL  657

Query  2097  FVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCP  2276
             FVFRYRK WWQRYNY+LSA +DAGVAFMAVLLYF+VG+ED+++ WWGT   EHCDLA CP
Sbjct  658   FVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEDKSLDWWGTQG-EHCDLARCP  716

Query  2277  TAKGIAVDGCPV  2312
             TA+G+ V GCPV
Sbjct  717   TARGVIVKGCPV  728



>ref|XP_006280078.1| hypothetical protein CARUB_v10025959mg [Capsella rubella]
 gb|EOA12976.1| hypothetical protein CARUB_v10025959mg [Capsella rubella]
Length=729

 Score =  1111 bits (2873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/733 (75%), Positives = 636/733 (87%), Gaps = 9/733 (1%)
 Frame = +3

Query  117   GEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLI  296
              ++ +DE+ SPIEEVRLTVTNTDDPTLPVWTFRMW LG++SC LLSFLNQFFSYR EPL+
Sbjct  4     ADEFSDEDTSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLV  63

Query  297   ITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfa  476
             IT ITVQVATLPIG F+A  LP  +F +PG GS +FSLNPGPFNMKEHVLI+IFANAG A
Sbjct  64    ITQITVQVATLPIGHFLAKVLPKTRFGLPGCGSARFSLNPGPFNMKEHVLISIFANAGSA  123

Query  477   fgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPS  656
             FG+GSAYAVGI+ II AFYRR ISF AGWLLIITTQVLGYGWAGLL+KYV+EPAHMWWPS
Sbjct  124   FGSGSAYAVGIITIIKAFYRRNISFIAGWLLIITTQVLGYGWAGLLRKYVIEPAHMWWPS  183

Query  657   TLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVC  836
             TLVQ+SLFR LHEK+++        M+RAKFFVI+L CSF WY  PGY+F TL SISWVC
Sbjct  184   TLVQVSLFRALHEKDDQR-------MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWVC  236

Query  837   WVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLV  1016
             W FP+SVTA Q+GSG+ GLGLGA TLDW+ +ASFL SPL+ PFFAI NVF GY +++Y+V
Sbjct  237   WAFPRSVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFFGYVLLIYIV  296

Query  1017  MPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFF  1196
             +PI YWG + YNA  FP++SS LFT+ G  YDI AIVN  FELD  +Y +QGRI LS FF
Sbjct  297   LPIGYWGFDSYNATRFPIFSSHLFTSVGNTYDIPAIVNDNFELDLVKYEQQGRINLSMFF  356

Query  1197  SLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLL  1376
             +L+YG GFATIA+T+THVALFYGREI +R+R S KGK DIHT+LMK YKDIPSWWFY +L
Sbjct  357   ALTYGLGFATIAATLTHVALFYGREIVERFRVSYKGKEDIHTRLMKRYKDIPSWWFYSML  416

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
              VT+ +SLALC+FLNDEVQMP+WGL+FA+A+AF+FTLPISIITATTNQTPGLNIITEY M
Sbjct  417   AVTLLISLALCVFLNDEVQMPWWGLVFASAMAFIFTLPISIITATTNQTPGLNIITEYAM  476

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             G+IYPG+PIANVCFK YGYMSM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGTIN
Sbjct  477   GLIYPGRPIANVCFKVYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTIN  536

Query  1737  MSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALN  1913
             ++VAWW L+SI+NIC ++ L  NSPWTCP DRVFFDASVIWGLVGPKRIF S+GNY A+N
Sbjct  537   ITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYAAMN  596

Query  1914  WFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFN  2093
             WFFLGG LGPV+VW LH+ FP +SWIPL+NLPVLLGAT  MPPAT++NY+SWILVGTIFN
Sbjct  597   WFFLGGALGPVLVWSLHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGTIFN  656

Query  2094  FFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASC  2273
              FVFRYRK WWQRYNY+LSA +DAGVAFMAVLLYF+VG+E++++ WWGT   EHCDLA C
Sbjct  657   LFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEEKSLDWWGTRG-EHCDLAKC  715

Query  2274  PTAKGIAVDGCPV  2312
             PTA+G+ VDGCPV
Sbjct  716   PTARGVIVDGCPV  728



>ref|XP_011087976.1| PREDICTED: oligopeptide transporter 4 [Sesamum indicum]
Length=744

 Score =  1110 bits (2872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/757 (75%), Positives = 649/757 (86%), Gaps = 23/757 (3%)
 Frame = +3

Query  75    MGTVEI---------EAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVL  227
             MGT+E+          +  L+   + V DE  SPIEEVRLTVTNTDDPTLPVWTFRMW L
Sbjct  1     MGTLELTNITTASSDHSSKLQCPEDFVEDE--SPIEEVRLTVTNTDDPTLPVWTFRMWFL  58

Query  228   GVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFS  407
             G++SC LLSFLNQFF+YR EPL+IT ITVQVATLPIG F+AA LP  KFR   FG   FS
Sbjct  59    GLLSCALLSFLNQFFAYRTEPLLITQITVQVATLPIGHFLAAVLPETKFR---FGGRVFS  115

Query  408   LNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQV  587
             LNPGPFNMKEHVLI+IFANAG AFGNGSAYAVGIV I+ AFYRR ISF AGWLLIITTQV
Sbjct  116   LNPGPFNMKEHVLISIFANAGSAFGNGSAYAVGIVTIVKAFYRRNISFLAGWLLIITTQV  175

Query  588   LGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLC  767
             LGYGWAGLL+KYV+EPAHMWWP TLVQ+SLFR LHEK+++        MSRAKFF+I+L 
Sbjct  176   LGYGWAGLLRKYVIEPAHMWWPGTLVQVSLFRALHEKDDQR-------MSRAKFFLIALI  228

Query  768   CSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSS  947
             CSF WY  PGY+F TL SISWVCW F KSVTA Q+GSGL GLGLGALTLDW+ +ASFL S
Sbjct  229   CSFSWYLVPGYLFPTLTSISWVCWTFSKSVTAQQIGSGLRGLGLGALTLDWTVVASFLLS  288

Query  948   PLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIV  1127
             PL+CPFFAI+NV  GYA+I+YLV+PI+YWG ++Y A+ FP++SS LFTAQGQ+Y+ISAIV
Sbjct  289   PLICPFFAIMNVLAGYALIIYLVLPIAYWGFDLYGARKFPIFSSHLFTAQGQKYNISAIV  348

Query  1128  NKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGK  1307
             N +FELD  +Y +QGRI+LS FF+L+YGFGFATIA+T+THV  FYGREIY R+RAS K K
Sbjct  349   NDKFELDLKKYEEQGRIHLSMFFALTYGFGFATIAATLTHVGCFYGREIYARFRASYKEK  408

Query  1308  MDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTL  1487
              D+HT+LM+ YKDIPSWWFY+LL VT+A SL LCIFLN +VQMP+WGL+FA+A+AF+F L
Sbjct  409   EDVHTRLMRRYKDIPSWWFYILLGVTLAASLILCIFLNKQVQMPWWGLVFASAIAFIFPL  468

Query  1488  PISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHY  1667
             PISIITATTNQTPGLNIITEY+MGIIYPGKPIANVCFKTYGYMSM+QA++FLSDFKLGHY
Sbjct  469   PISIITATTNQTPGLNIITEYVMGIIYPGKPIANVCFKTYGYMSMSQAVSFLSDFKLGHY  528

Query  1668  MKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDA  1844
             MKIPPRSMF+VQF+GT+IAGT+N++VAWWLL SI NIC  D L  +SPWTCP DRVFFDA
Sbjct  529   MKIPPRSMFIVQFLGTIIAGTVNIAVAWWLLTSITNICQDDLLPPDSPWTCPGDRVFFDA  588

Query  1845  SVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGA  2024
             SVIWGLVGPKRIF S GNY+++NWFFLGG LGPV+VWL H+ FP QSWIPLINLPVLLGA
Sbjct  589   SVIWGLVGPKRIFGSLGNYSSMNWFFLGGALGPVLVWLFHKAFPKQSWIPLINLPVLLGA  648

Query  2025  TGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTV  2204
             TG MPPAT LNY++WI++GTIFNFFVFRYRK WWQRYNYILSA LDAGVAFMAV LYF++
Sbjct  649   TGIMPPATPLNYNAWIIIGTIFNFFVFRYRKSWWQRYNYILSAALDAGVAFMAVALYFSL  708

Query  2205  GLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             G+E++ I WWGT+  EHC LA+CPTAKGI VDGCPV+
Sbjct  709   GMENKEIHWWGTSG-EHCKLATCPTAKGIQVDGCPVY  744



>ref|XP_008466652.1| PREDICTED: oligopeptide transporter 4-like [Cucumis melo]
Length=743

 Score =  1109 bits (2869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/749 (73%), Positives = 644/749 (86%), Gaps = 8/749 (1%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             MGT   E P      E +  E++SPIE+VRLTV  TDD T PVWTFRMW LG++SC  +S
Sbjct  1     MGTEVTETPLT--VDELLEKEDISPIEQVRLTVATTDDVTQPVWTFRMWTLGLISCCAMS  58

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             F+NQFFSYR+EPL+IT ITVQV +LPIGRFMAA LP  KFRIPGFGS +FS NPGPFNMK
Sbjct  59    FVNQFFSYRKEPLVITQITVQVVSLPIGRFMAATLPTRKFRIPGFGSKEFSFNPGPFNMK  118

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLITIFANAG AFG+GSAYAVGI+ II  FY R ISFF  WLL+ITTQVLGYGWAGL+
Sbjct  119   EHVLITIFANAGSAFGSGSAYAVGIITIIKVFYWRTISFFTSWLLVITTQVLGYGWAGLM  178

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             +K+VVEPAHMWWP+TLVQISLFRTLHE+EEE +       SR KFF+I L  SF WY FP
Sbjct  179   RKFVVEPAHMWWPNTLVQISLFRTLHEEEEEGEKRT----SRIKFFLIVLTASFTWYIFP  234

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
             GYIFQTL SISWVCW FP SVTAHQLGSG +GLG G+ +LDWST+ASFL SPL+ PFFA+
Sbjct  235   GYIFQTLQSISWVCWAFPHSVTAHQLGSGFSGLGFGSFSLDWSTVASFLGSPLITPFFAV  294

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
             VN+FVGY +++Y+V+P +YWGLNV+NAK FP++SSDLFT+ GQEYDI++IV+  FEL+ D
Sbjct  295   VNIFVGYVVLIYVVIPTAYWGLNVFNAKTFPIFSSDLFTSSGQEYDITSIVDNNFELNTD  354

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
              Y + GR+ LS+FF+++YGFGFA IA+T+THVALF+GREI  ++RAS++GK DIHT+LM+
Sbjct  355   AYGQVGRVNLSSFFAITYGFGFAAIAATLTHVALFHGREIVRKFRASSEGKEDIHTRLMR  414

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
             +YKDIPSWWF+V+L+V IA SLALCIFL  EVQ+P+WGL+FAAALAF+FTLPISIITATT
Sbjct  415   SYKDIPSWWFHVVLLVAIAASLALCIFLKKEVQLPWWGLLFAAALAFIFTLPISIITATT  474

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQTPGLNIITEY+MG+I PG+PIANVCFKTYGY+SM QA++FL+DFKLGHYMKIPPRSMF
Sbjct  475   NQTPGLNIITEYLMGVILPGRPIANVCFKTYGYISMAQAVSFLNDFKLGHYMKIPPRSMF  534

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPK  1874
             LVQ IGT+IAGTIN+SVAWWLL S++ ICHQ   SNSPWTCP DRVFFDASVIWGLVGPK
Sbjct  535   LVQLIGTVIAGTINVSVAWWLLSSVDQICHQSASSNSPWTCPGDRVFFDASVIWGLVGPK  594

Query  1875  RIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSL  2054
             RIF S+GNY ALNWFFL GILGP +V+LLHR FP+QSWIPLINLPVL GAT SMPPA  +
Sbjct  595   RIFGSQGNYPALNWFFLAGILGPSLVYLLHRIFPNQSWIPLINLPVLFGATASMPPAAPI  654

Query  2055  NYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWW  2234
             NY+SWILVGTIFN+F+FRYRKKWWQRYNYILSA LDAGVAFMA+L++FT G+ +  ++WW
Sbjct  655   NYNSWILVGTIFNYFLFRYRKKWWQRYNYILSAALDAGVAFMALLIHFTFGVRNVHMNWW  714

Query  2235  GTT--DLEHCDLASCPTAKGIAVDGCPVF  2315
             G+   D +HC LASCPTAKG+ VDGCPVF
Sbjct  715   GSNPIDTDHCLLASCPTAKGVVVDGCPVF  743



>ref|NP_201246.1| oligopeptide transporter 4 [Arabidopsis thaliana]
 sp|Q9FME8.1|OPT4_ARATH RecName: Full=Oligopeptide transporter 4; Short=AtOPT4 [Arabidopsis 
thaliana]
 dbj|BAB09872.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AAM20694.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AAN15658.1| Isp4-like protein [Arabidopsis thaliana]
 dbj|BAE99084.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AED97890.1| oligopeptide transporter 4 [Arabidopsis thaliana]
Length=729

 Score =  1109 bits (2868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/733 (75%), Positives = 635/733 (87%), Gaps = 9/733 (1%)
 Frame = +3

Query  117   GEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLI  296
              ++ +DE+ SPIEEVRLTVTNTDDPTLPVWTFRMW LG++SC LLSFLNQFFSYR EPL+
Sbjct  4     ADEFSDEDTSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLV  63

Query  297   ITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfa  476
             IT ITVQVATLPIG F+A  LP  +F +PG GS +FSLNPGPFNMKEHVLI+IFANAG A
Sbjct  64    ITQITVQVATLPIGHFLAKVLPKTRFGLPGCGSARFSLNPGPFNMKEHVLISIFANAGSA  123

Query  477   fgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPS  656
             FG+GSAYAVGI+ II AFY R ISF AGWLLIITTQVLGYGWAGLL+KYVVEPAHMWWPS
Sbjct  124   FGSGSAYAVGIITIIKAFYGRSISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPS  183

Query  657   TLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVC  836
             TLVQ+SLFR LHEK+++        M+RAKFFVI+L CSF WY  PGY+F TL SISWVC
Sbjct  184   TLVQVSLFRALHEKDDQR-------MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWVC  236

Query  837   WVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLV  1016
             W FP+SVTA Q+GSG+ GLGLGA TLDW+ +ASFL SPL+ PFFAI NVF+GY +++Y V
Sbjct  237   WAFPRSVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFIGYVLLIYFV  296

Query  1017  MPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFF  1196
             +P++YWG + YNA  FP++SS LFT+ G  YDI AIVN  FELD  +Y +QGRI LS FF
Sbjct  297   LPLAYWGFDSYNATRFPIFSSHLFTSVGNTYDIPAIVNDNFELDLAKYEQQGRINLSMFF  356

Query  1197  SLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLL  1376
             +L+YG GFATIAST+THVALFYG+EI +R+R S KGK DIHT+LMK YKDIPSWWFY +L
Sbjct  357   ALTYGLGFATIASTLTHVALFYGKEISERFRVSYKGKEDIHTRLMKRYKDIPSWWFYSML  416

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
               T+ +SLALC+FLNDEVQMP+WGL+FA+A+AF+FTLPISIITATTNQTPGLNIITEY M
Sbjct  417   AATLLISLALCVFLNDEVQMPWWGLVFASAMAFVFTLPISIITATTNQTPGLNIITEYAM  476

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             G+IYPG+PIANVCFK YGYMSM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGTIN
Sbjct  477   GLIYPGRPIANVCFKVYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTIN  536

Query  1737  MSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALN  1913
             ++VAWW L+SI+NIC ++ L  NSPWTCP DRVFFDASVIWGLVGPKRIF S+GNY A+N
Sbjct  537   ITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYAAMN  596

Query  1914  WFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFN  2093
             WFFLGG LGPVIVW LH+ FP +SWIPL+NLPVLLGAT  MPPAT++NY+SWILVGTIFN
Sbjct  597   WFFLGGALGPVIVWSLHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGTIFN  656

Query  2094  FFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASC  2273
              FVFRYRK WWQRYNY+LSA +DAGVAFMAVLLYF+VG+E++++ WWGT   EHCDLA C
Sbjct  657   LFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEEKSLDWWGTRG-EHCDLAKC  715

Query  2274  PTAKGIAVDGCPV  2312
             PTA+G+ VDGCPV
Sbjct  716   PTARGVIVDGCPV  728



>ref|XP_010029951.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW56909.1| hypothetical protein EUGRSUZ_I02585 [Eucalyptus grandis]
Length=746

 Score =  1108 bits (2865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/730 (76%), Positives = 645/730 (88%), Gaps = 9/730 (1%)
 Frame = +3

Query  126   VNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITS  305
             V+ +++SPIEEVRLTV+N DDP+LPVWTFRMW LG++SC LLSFLNQFF+YR EPL+IT 
Sbjct  24    VDKDDLSPIEEVRLTVSNADDPSLPVWTFRMWFLGLLSCALLSFLNQFFAYRTEPLVITQ  83

Query  306   ITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgn  485
             ITVQVATLPIGRFMAAALP AKF+IPG G   FSLNPGPFNMKEHVLI+IFANAG AFG+
Sbjct  84    ITVQVATLPIGRFMAAALPEAKFQIPGLGPRLFSLNPGPFNMKEHVLISIFANAGSAFGS  143

Query  486   gSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLV  665
             GSAY VGIVNII AFY R ISFFAGWLLIITTQVLGYGWAGLL+KYVVEP+HMWWP TLV
Sbjct  144   GSAYGVGIVNIIKAFYHRGISFFAGWLLIITTQVLGYGWAGLLRKYVVEPSHMWWPGTLV  203

Query  666   QISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVF  845
             Q+SLFR LHE +E+        MSRAKFF+I+L CSF WY  PGY+F TL +ISWVCW F
Sbjct  204   QVSLFRALHETDEQR-------MSRAKFFLIALICSFTWYAVPGYLFSTLTNISWVCWAF  256

Query  846   PKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPI  1025
               SVTA Q+GSG+ GLGLGALTLDW+ +ASFL SPL+CPFFAIVNVFVGYA+I+Y+V+P 
Sbjct  257   SNSVTAQQIGSGMRGLGLGALTLDWTAVASFLFSPLICPFFAIVNVFVGYALIIYVVIPT  316

Query  1026  SYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLS  1205
             +YWG NVY+A  FP++SS LFTAQGQ+Y+I+AIVN +FELD  +Y +QGRI+LS FF+L+
Sbjct  317   AYWGFNVYSANRFPIFSSHLFTAQGQKYNITAIVNDKFELDIPKYEEQGRIHLSMFFALT  376

Query  1206  YGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVT  1385
             YGFGFATIAST+THVA FYGREIY+RYRAS +G  DIHTKLM+ YKDIPSWWF++LLVV 
Sbjct  377   YGFGFATIASTLTHVAFFYGREIYERYRASHEGTADIHTKLMRRYKDIPSWWFHLLLVVN  436

Query  1386  IAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGII  1565
             + VSL LCI +ND+VQMP+WGL+FA+ALAF+FTLPISIITATTNQTPGLNIITEYIMG+I
Sbjct  437   LVVSLLLCIVMNDQVQMPWWGLLFASALAFVFTLPISIITATTNQTPGLNIITEYIMGVI  496

Query  1566  YPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSV  1745
              PG+PIANVCFKTYGY+SM QA++FLSDFKLGHYMKIPPRSMFLVQFIGT++AGTIN++V
Sbjct  497   LPGRPIANVCFKTYGYISMAQAVSFLSDFKLGHYMKIPPRSMFLVQFIGTILAGTINIAV  556

Query  1746  AWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFF  1922
             AWWLL+S+ NIC  D L  +SPWTCP DRVFFDASVIWGLVGP+RIF + GNY  +NWFF
Sbjct  557   AWWLLNSVTNICQDDLLPPDSPWTCPGDRVFFDASVIWGLVGPRRIFGTLGNYRQMNWFF  616

Query  1923  LGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFV  2102
             LGG +GP+IVWLLH+ FP QSWIPLINLPVLLGATG MPPAT LNY++W+L G IFNFF+
Sbjct  617   LGGAIGPIIVWLLHKAFPKQSWIPLINLPVLLGATGMMPPATPLNYNAWVLAGVIFNFFI  676

Query  2103  FRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTA  2282
             FRYRK+WWQRYNY+LSA LDAG AFMAVLLYF+VG+E+R+I+WWGT   EHC+LA+CPTA
Sbjct  677   FRYRKQWWQRYNYVLSAALDAGTAFMAVLLYFSVGMENRSITWWGTNG-EHCELAACPTA  735

Query  2283  KGIAVDGCPV  2312
             KGI VDGCPV
Sbjct  736   KGIEVDGCPV  745



>gb|KFK28135.1| hypothetical protein AALP_AA8G476800 [Arabis alpina]
Length=990

 Score =  1107 bits (2862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/744 (74%), Positives = 641/744 (86%), Gaps = 10/744 (1%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
             ++ +D+E+SPIEEVRLTVTNTDD TLPVWTFRMW LG++SC LLSFLNQFFSYR EPL+I
Sbjct  5     DEFSDDEISPIEEVRLTVTNTDDHTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLVI  64

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
             T ITVQVATLPIG F+A  LP  +F +PG GS +FSLNPGPFNMKEHVLI+IFANAG AF
Sbjct  65    TQITVQVATLPIGHFLAKVLPKNQFGLPGCGSTRFSLNPGPFNMKEHVLISIFANAGSAF  124

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
             G+GSAYAVGIV II AFY R ISF AGWLLIITTQVLGYGWAGLL+KYVVEPAHMWWPST
Sbjct  125   GSGSAYAVGIVTIIKAFYGRNISFVAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPST  184

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR LHEK+E+        M+RAKFFVI+L CSF WY  PGY+F TL SISW+CW
Sbjct  185   LVQVSLFRALHEKDEQR-------MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWICW  237

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
              FPK VTA Q+GSG+ GLGLGA TLDW+ +ASFL SPL+ PFFAI NVF+GY +++Y+V+
Sbjct  238   AFPKLVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFIGYVLLIYMVL  297

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             P++YWG + YNA+ FP++SS LFT+ GQ+YDI AIVN +FELD  +Y +QGRI LS FFS
Sbjct  298   PVAYWGFDSYNAQRFPIFSSHLFTSVGQKYDIPAIVNDKFELDIAKYDQQGRINLSMFFS  357

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLV  1379
             L+YG GFATIAST+THVALFYGREI +R+R S KGK DIHT+LMK YKDIPSWWFY LL 
Sbjct  358   LTYGLGFATIASTLTHVALFYGREITERFRVSYKGKEDIHTRLMKRYKDIPSWWFYSLLA  417

Query  1380  VTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMG  1559
              T+ VSLALC+FL DEVQMP+WGL+FA+A+AF FTLPISIITATTNQTPGLNIITEY MG
Sbjct  418   STLLVSLALCVFLKDEVQMPWWGLVFASAMAFFFTLPISIITATTNQTPGLNIITEYAMG  477

Query  1560  IIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINM  1739
             IIYPG+PIANVCFK YGYMSM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGTIN+
Sbjct  478   IIYPGRPIANVCFKVYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTINI  537

Query  1740  SVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNW  1916
             +VAWW L SI+NIC ++ L  NSPWTCP DRVFFDASVIWGLVGPKRIF S+GNY A+NW
Sbjct  538   TVAWWQLTSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYAAMNW  597

Query  1917  FFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNF  2096
             FFLGG +GPVIVWL H+ FP ++WIPL+NLPVLLGAT  MPPAT++NY+SWILVGTIFN 
Sbjct  598   FFLGGAIGPVIVWLCHKAFPKRTWIPLVNLPVLLGATAMMPPATAVNYNSWILVGTIFNL  657

Query  2097  FVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCP  2276
             FVFRYRK WWQRYNY+LSA LDAGVAFMAVLLYF+VG+E++++ WWGT   EHCDLA CP
Sbjct  658   FVFRYRKSWWQRYNYVLSAALDAGVAFMAVLLYFSVGMEEKSLDWWGTRG-EHCDLARCP  716

Query  2277  TAKGIAVDGCPVF*LLLRICYLTF  2348
             TA+G+ VDGCP+   L  + Y +F
Sbjct  717   TARGVIVDGCPIL-HLANVGYASF  739



>emb|CBI19304.3| unnamed protein product [Vitis vinifera]
Length=749

 Score =  1107 bits (2862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/738 (75%), Positives = 634/738 (86%), Gaps = 13/738 (2%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
             EDV ++E+SPIEEVRLTV N DDP+LPVWTFRMW LG++SC LLSFLNQFFSYR+EPL+I
Sbjct  19    EDVKEDELSPIEEVRLTVPNDDDPSLPVWTFRMWFLGLISCALLSFLNQFFSYRKEPLVI  78

Query  300   TSITVQVATLPIGRFMAAALPAAKFR--IPGFGSGQFSLNPGPFNMKEHVLITIfanagf  473
             + ITVQVATLPIGRFMA+ LP  KF   IP FG  + SLNPGPFNMKEHVLI+IFANAG 
Sbjct  79    SQITVQVATLPIGRFMASVLPDIKFHVHIPFFGKKELSLNPGPFNMKEHVLISIFANAGS  138

Query  474   afgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWP  653
             AFG GSAYAVGIV II AFY+R IS+ AGW+LIITTQVLGYGWAGLL+KYVVEPAHMWWP
Sbjct  139   AFGGGSAYAVGIVTIIKAFYKRNISYLAGWILIITTQVLGYGWAGLLRKYVVEPAHMWWP  198

Query  654   STLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWV  833
             STLVQISLFR    + ++         SR+KFF+I++ CSF WY  PGY+FQ+L SI+WV
Sbjct  199   STLVQISLFRYQETEVQQRT-------SRSKFFLIAMLCSFLWYMVPGYLFQSLQSIAWV  251

Query  834   CWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYL  1013
             CW FP SVTAHQ+GSG  GLG GALTLDW+ +ASFL SPLVCPFFAIVNVF+GY +I+Y+
Sbjct  252   CWAFPNSVTAHQIGSGFRGLGFGALTLDWTVVASFLFSPLVCPFFAIVNVFIGYVLIIYI  311

Query  1014  VMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTF  1193
             VMPISYWGLNVYNA+ FP++SS LFTAQGQ Y+I+AIVN +FE+D  +Y  QGR+ LS F
Sbjct  312   VMPISYWGLNVYNARTFPIFSSHLFTAQGQSYNITAIVNDKFEIDLAQYDIQGRLNLSLF  371

Query  1194  FSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVL  1373
             F+L+YGFGFATIAST++HV LFYGREIY R+RAS   K+DIHTKLMK Y+DIPSWWF++L
Sbjct  372   FALAYGFGFATIASTLSHVGLFYGREIYTRFRASQDEKVDIHTKLMKKYEDIPSWWFHLL  431

Query  1374  LVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYI  1553
             L  ++ VSLALCIFL DEVQMP+WGLIFAA LAF+FTLPISIITATTNQTPGLNIITEYI
Sbjct  432   LTGSVLVSLALCIFLKDEVQMPWWGLIFAAGLAFVFTLPISIITATTNQTPGLNIITEYI  491

Query  1554  MGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTI  1733
             MG+I PGKPIANVCFKTYGY+SM QAI+FL DFKLGHYMKIPPRSMFLVQ IGTLIAG++
Sbjct  492   MGVILPGKPIANVCFKTYGYISMVQAISFLGDFKLGHYMKIPPRSMFLVQLIGTLIAGSV  551

Query  1734  NMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNAL  1910
             N+ VA WLL SI+NIC ++ L  NSPWTCP  RVFFDASVIWGLV P+RIF + GNY AL
Sbjct  552   NLFVAMWLLDSIDNICQEELLPENSPWTCPGQRVFFDASVIWGLVAPQRIFGTLGNYGAL  611

Query  1911  NWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIF  2090
             NWFFLGG+LGPV VW+LH  FPSQSWIPL+NLPVL+GAT SMPPAT +NY++WILVGTIF
Sbjct  612   NWFFLGGLLGPVAVWILHILFPSQSWIPLVNLPVLIGATASMPPATPVNYNAWILVGTIF  671

Query  2091  NFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTT---DLEHCD  2261
             NFFVFRYRKKWWQRYNYILSA LDAGVAFMAVL+YFTVG+E++ + WWG     D EHC 
Sbjct  672   NFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLIYFTVGIEEKNLYWWGANPDIDPEHCP  731

Query  2262  LASCPTAKGIAVDGCPVF  2315
             LASCPTAKG+ VDGCP F
Sbjct  732   LASCPTAKGVIVDGCPRF  749



>ref|XP_006422648.1| hypothetical protein CICLE_v10027887mg [Citrus clementina]
 gb|ESR35888.1| hypothetical protein CICLE_v10027887mg [Citrus clementina]
Length=736

 Score =  1103 bits (2854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/731 (76%), Positives = 647/731 (89%), Gaps = 9/731 (1%)
 Frame = +3

Query  123   DVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIIT  302
             D++ +E+SP+EEVRLTV N+DDP+LPVWTFRMW LG++SC LLSFLNQFF+YR EPLIIT
Sbjct  13    DIDRDELSPVEEVRLTVLNSDDPSLPVWTFRMWFLGLLSCALLSFLNQFFAYRTEPLIIT  72

Query  303   SITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafg  482
              ITVQVATLPIGRF+ A LP  +FRIPG GS  FSLN GPFN+KEHVLI+IFANAG AFG
Sbjct  73    QITVQVATLPIGRFLEATLPETRFRIPGCGSRLFSLNSGPFNVKEHVLISIFANAGSAFG  132

Query  483   ngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTL  662
              GS +AV IVNII AFY RKISF A WLLIITTQVLGYGWAGLL+KYVVEPAHMWWPSTL
Sbjct  133   AGSTFAVSIVNIIKAFYHRKISFLASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTL  192

Query  663   VQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWV  842
             VQ+SLFR LHEK+++        MSRAKFFVI+L CSF WY  PGY+  TL+SISWVCW 
Sbjct  193   VQVSLFRALHEKDDQR-------MSRAKFFVIALICSFSWYLVPGYLVPTLSSISWVCWA  245

Query  843   FPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMP  1022
             F KSVTA QLGSG+ GLGLGALTLDWS +ASFL SPL+ PFFAIVNVF GY +I+Y+V+P
Sbjct  246   FSKSVTAQQLGSGMRGLGLGALTLDWSVVASFLFSPLISPFFAIVNVFAGYVLIIYVVIP  305

Query  1023  ISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSL  1202
             I+YWGL++Y+A  FP++SS LFT++GQ+YDISAIVN +FELD+D+Y +QGRI+LS FF+L
Sbjct  306   IAYWGLDLYSAHKFPIFSSHLFTSEGQKYDISAIVNDKFELDQDKYQEQGRIHLSMFFAL  365

Query  1203  SYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVV  1382
             +YGFGFATIASTITHV  FYGREIY+R+RAS KGK DIHT+LM+ Y+DIP WWFY++LVV
Sbjct  366   TYGFGFATIASTITHVGFFYGREIYERFRASYKGKEDIHTRLMRRYEDIPHWWFYLMLVV  425

Query  1383  TIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGI  1562
             T+ VSL LC FL D+VQMP+WGL+FA A+AF+FTLPISIITATTNQTPGLNIITEY+MGI
Sbjct  426   TLVVSLVLCTFLKDQVQMPWWGLLFAGAMAFVFTLPISIITATTNQTPGLNIITEYVMGI  485

Query  1563  IYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMS  1742
             IYPG+PIANVCFK YGYMS+ QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGTIN++
Sbjct  486   IYPGRPIANVCFKVYGYMSVAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTINLA  545

Query  1743  VAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWF  1919
             VAWWLL+SIENIC  + L  +SPWTCP DRVFFDASVIWGL GPKRIF S+GNY A+NWF
Sbjct  546   VAWWLLNSIENICQDELLPPDSPWTCPGDRVFFDASVIWGLAGPKRIFGSQGNYPAMNWF  605

Query  1920  FLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFF  2099
             F+GG LGPV+VWLLH+ FP QSWI LINLPVLLGATG MPPAT++NY+SWI+VGTIFNFF
Sbjct  606   FVGGALGPVLVWLLHKAFPKQSWIALINLPVLLGATGMMPPATAVNYNSWIIVGTIFNFF  665

Query  2100  VFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPT  2279
             +FRYRK+WWQRYNYILSA +DAGVAFMAV+LYF+VG+ED+ +SWWG T+ EHCDLA+CPT
Sbjct  666   IFRYRKQWWQRYNYILSAAMDAGVAFMAVILYFSVGMEDKGLSWWG-TEGEHCDLATCPT  724

Query  2280  AKGIAVDGCPV  2312
             AKGI +DGCPV
Sbjct  725   AKGILIDGCPV  735



>emb|CAN81605.1| hypothetical protein VITISV_025060 [Vitis vinifera]
Length=739

 Score =  1103 bits (2853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/739 (75%), Positives = 634/739 (86%), Gaps = 10/739 (1%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
             E +N++E SPIEEVRLTV N DD +L VWTFRMW LGV+SC LLSFLNQFFSYRREPL+I
Sbjct  2     EHINEDEESPIEEVRLTVPNDDDSSLSVWTFRMWFLGVLSCTLLSFLNQFFSYRREPLVI  61

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
             T ITVQVATLPIGRFMAA LP  KF IPGFG  +FS NPGPFNMKEHVLI+IFANAG AF
Sbjct  62    TQITVQVATLPIGRFMAAVLPETKFHIPGFGKREFSFNPGPFNMKEHVLISIFANAGSAF  121

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
             GNGSAYAVGIV II AFY   ISF AGWLLI+TTQVLGYGWAGLL+KYVVEPAHMWWPST
Sbjct  122   GNGSAYAVGIVTIIKAFYNSSISFLAGWLLIVTTQVLGYGWAGLLRKYVVEPAHMWWPST  181

Query  660   LVQISLFRTL------HekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLAS  821
             LVQISLFR L                G  R SR+KFF+I++ CSF WY  PGY+FQ+L S
Sbjct  182   LVQISLFRGLVIKAKFAIGSRYLLNQGCNRTSRSKFFLIAMLCSFLWYMVPGYLFQSLQS  241

Query  822   ISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAI  1001
             I+WVCW FP SVTAHQ+GSG  GLG GALTLDW+ +ASFL SPLVCPFFAIVNVF+GY +
Sbjct  242   IAWVCWAFPNSVTAHQIGSGFRGLGFGALTLDWTVVASFLFSPLVCPFFAIVNVFIGYVL  301

Query  1002  IMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIY  1181
             I+Y+VMPISYWGLNVYNA+ FP++SS LFTAQGQ Y+I+AIVN +FE+D  +Y  QGR+ 
Sbjct  302   IIYIVMPISYWGLNVYNARTFPIFSSHLFTAQGQSYNITAIVNDKFEIDLAQYDIQGRLN  361

Query  1182  LSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWW  1361
             LS FF+L+YGFGFATIAST++HV LFYGREIY R+RAS   K+DIHTKLMK Y+DIPSWW
Sbjct  362   LSLFFALAYGFGFATIASTLSHVGLFYGREIYTRFRASQDEKVDIHTKLMKKYEDIPSWW  421

Query  1362  FYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNII  1541
             F++LL  ++ VSLALCIFL DEVQMP+WGLIFAA LAF+FTLPISIITATTNQTPGLNI+
Sbjct  422   FHLLLTGSVLVSLALCIFLKDEVQMPWWGLIFAAGLAFVFTLPISIITATTNQTPGLNIV  481

Query  1542  TEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLI  1721
             TEY+MG+I PG+PIANVCFKTYGY+SM QA++FL+DFKLGHYMKIPPRSMF+VQFIGT+I
Sbjct  482   TEYLMGVILPGRPIANVCFKTYGYISMAQAVSFLNDFKLGHYMKIPPRSMFVVQFIGTII  541

Query  1722  AGTINMSVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEG  1895
             AGT+N++VAWWLL SIENIC QD+L   NSPWTCP DRVF+DASVIWGLVGP+RIF   G
Sbjct  542   AGTVNITVAWWLLTSIENIC-QDQLLPPNSPWTCPGDRVFYDASVIWGLVGPRRIFGDLG  600

Query  1896  NYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWIL  2075
             +Y+ALNWFFL G LGPV+VWLLH+ FP+Q WI L+NLPVLLGATG+MPPAT+LN+++WI 
Sbjct  601   DYSALNWFFLVGALGPVLVWLLHKAFPTQKWISLVNLPVLLGATGAMPPATTLNFNAWIF  660

Query  2076  VGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEH  2255
             VGTIFNFF+FRYRK WWQRYNY+LSA LDAG+AFM VLLYF++ + +R+ISWWG    EH
Sbjct  661   VGTIFNFFIFRYRKNWWQRYNYVLSAALDAGLAFMGVLLYFSLTMANRSISWWGAEG-EH  719

Query  2256  CDLASCPTAKGIAVDGCPV  2312
             C LASCPTAKGI VDGCPV
Sbjct  720   CGLASCPTAKGIVVDGCPV  738



>ref|XP_007148333.1| hypothetical protein PHAVU_006G200000g [Phaseolus vulgaris]
 gb|ESW20327.1| hypothetical protein PHAVU_006G200000g [Phaseolus vulgaris]
Length=738

 Score =  1103 bits (2852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/742 (77%), Positives = 653/742 (88%), Gaps = 9/742 (1%)
 Frame = +3

Query  87    EIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQ  266
              +  P   +  ++ +D++VSPIEEVRLTV NTDDPT PVWTFRMW+LG++SC LLSFLNQ
Sbjct  3     SVSDPEKPVTSQEDDDDDVSPIEEVRLTVANTDDPTRPVWTFRMWLLGLLSCSLLSFLNQ  62

Query  267   FFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVL  446
             FF+YR EPLIIT IT+QVATLPIG FMAA LP  KF +PGFGS  FSLNPGPFNMKEHVL
Sbjct  63    FFAYRTEPLIITQITIQVATLPIGHFMAAVLPETKFTLPGFGSKSFSLNPGPFNMKEHVL  122

Query  447   ITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYV  626
             ITIFANAG AFG+GS YAVGIVNII AFY R ISFFA WLLIITTQVLGYGWAGLL+KYV
Sbjct  123   ITIFANAGSAFGSGSPYAVGIVNIIKAFYGRSISFFASWLLIITTQVLGYGWAGLLRKYV  182

Query  627   VEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIF  806
             VEPAHMWWPSTLVQ+SLFR LHEK+++        +SRAKFF I+L CSF WY  PGY+F
Sbjct  183   VEPAHMWWPSTLVQVSLFRALHEKDDQR-------LSRAKFFFIALLCSFVWYVIPGYLF  235

Query  807   QTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVF  986
              TL +ISWVCW+F KSVTA Q+GSG+ GLG+GALTLDW+ +ASFL SPL+ PFFAIVN+F
Sbjct  236   TTLTNISWVCWIFSKSVTAQQIGSGMRGLGVGALTLDWAAVASFLFSPLISPFFAIVNIF  295

Query  987   VGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAK  1166
             VGYA+I+Y V+PI+YWGLNVYNAK FP++SS LFTAQGQ Y+I AIV+  FEL   EY K
Sbjct  296   VGYALIVYAVIPIAYWGLNVYNAKRFPIFSSHLFTAQGQRYNIPAIVDDHFELSVAEYEK  355

Query  1167  QGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKD  1346
             QGRI+LS FF+L+YGFGFATIAST+THV  FYGREI +RYRAS+KGK DIHTKLMK YKD
Sbjct  356   QGRIHLSVFFALTYGFGFATIASTLTHVFCFYGREIMERYRASSKGKEDIHTKLMKRYKD  415

Query  1347  IPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTP  1526
             IPSWWFY+LLVVT+ VSLALCIFLND+VQMP+WGL+FA ALAF FTLPISIITATTNQTP
Sbjct  416   IPSWWFYLLLVVTLVVSLALCIFLNDQVQMPWWGLLFAGALAFGFTLPISIITATTNQTP  475

Query  1527  GLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQF  1706
             GLNIITEY+ G+IYPG+PIANVCFKTYGY+SM QA++FLSDFKLGHYMKIPPRSMFLVQF
Sbjct  476   GLNIITEYVFGLIYPGRPIANVCFKTYGYISMAQAVSFLSDFKLGHYMKIPPRSMFLVQF  535

Query  1707  IGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIF  1883
             IGT++AGTIN+ VAWWLL+SI+NICH D L ++SPWTCP DRVFFDASVIWGLVGPKRIF
Sbjct  536   IGTMLAGTINIGVAWWLLNSIKNICHDDLLPADSPWTCPGDRVFFDASVIWGLVGPKRIF  595

Query  1884  DSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYS  2063
              S+GNY+A+NWFFLGG LGPVIVWLLH+ FP QSWIPLINLP+LLGATG MPPAT LNY+
Sbjct  596   GSQGNYSAMNWFFLGGALGPVIVWLLHKAFPKQSWIPLINLPILLGATGMMPPATPLNYN  655

Query  2064  SWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTT  2243
             +WILVGTIFNFF+FRYRKKWWQRYNY+LSA LD+GVAFM VLLYFT+GLE+R+++WWG  
Sbjct  656   AWILVGTIFNFFIFRYRKKWWQRYNYVLSAALDSGVAFMTVLLYFTLGLENRSLNWWG-N  714

Query  2244  DLEHCDLASCPTAKGIAVDGCP  2309
             D EHC LA+CPTAKGI VDGCP
Sbjct  715   DGEHCPLAACPTAKGIIVDGCP  736



>ref|XP_004136414.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
 gb|KGN60283.1| hypothetical protein Csa_3G893330 [Cucumis sativus]
Length=743

 Score =  1102 bits (2850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/749 (73%), Positives = 644/749 (86%), Gaps = 8/749 (1%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             MGT   E P      E +  E++SPIEEVRLTV+ TDD + PVWTFRMW LG++SC  +S
Sbjct  1     MGTEVTETPLT--VDELLEKEDISPIEEVRLTVSTTDDVSQPVWTFRMWTLGLISCCAMS  58

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             F+NQFFSYRREPL+IT I+VQVA+LPIGRFMAA LP  KFRIPGFGS +FS NPGPFNMK
Sbjct  59    FVNQFFSYRREPLVITQISVQVASLPIGRFMAATLPTRKFRIPGFGSKEFSFNPGPFNMK  118

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI+IFANAG AFG+GSAYAV IV II  FY R I+FF  WLL+ITTQVLGYGWAGL+
Sbjct  119   EHVLISIFANAGSAFGSGSAYAVAIVTIIKVFYWRSIAFFTSWLLVITTQVLGYGWAGLM  178

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             +KYVVEPAHMWWP+TLVQISLFRTLHE+EEE +      +SR KFF+I L  SF WY FP
Sbjct  179   RKYVVEPAHMWWPNTLVQISLFRTLHEEEEEGERR----ISRIKFFLIVLAASFTWYIFP  234

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
             GYIFQTL SISWVCW FP SVTAHQLGSG +GLG G+ +LDWST+ASFL SPL+ PFFAI
Sbjct  235   GYIFQTLQSISWVCWAFPHSVTAHQLGSGFSGLGFGSFSLDWSTVASFLGSPLITPFFAI  294

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
             VN+FVGY  ++Y+V+PI+YWGLNV+NAK FP++SS LFT+ GQ YDI++IVN  FEL+++
Sbjct  295   VNIFVGYVALIYVVIPIAYWGLNVFNAKTFPIFSSYLFTSSGQVYDITSIVNDNFELNQE  354

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
              YA+ GR+ LS+FF+++YGFGFA IA+T+THVALF+GREI  ++RAS++G+ DIHT+LM+
Sbjct  355   AYAQVGRVNLSSFFAITYGFGFAAIAATLTHVALFHGREIVKKFRASSEGREDIHTRLMR  414

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
             NYKDIP+WWF+++L+  IA SLALCIFL  EVQ+P+WGL+FAAALAF+FTLPISIITATT
Sbjct  415   NYKDIPTWWFHIVLLGAIAASLALCIFLKKEVQLPWWGLLFAAALAFIFTLPISIITATT  474

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQTPGLNIITEY+MG+I PG+PIANVCFKTYGY+SM QA++FL+DFKLGHYMKIPPRSMF
Sbjct  475   NQTPGLNIITEYLMGVILPGRPIANVCFKTYGYISMAQAVSFLNDFKLGHYMKIPPRSMF  534

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPK  1874
             LVQ IGT+IAGTIN+SVAWWLL S++ ICHQ   SNSPWTCP DRVFFDASVIWGLVGPK
Sbjct  535   LVQLIGTVIAGTINVSVAWWLLSSVDQICHQSPSSNSPWTCPGDRVFFDASVIWGLVGPK  594

Query  1875  RIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSL  2054
             RIF S+GNY ALNWFFL G+LGP +V+LLHR FP+QSWIPLINLPVL GAT SMPPAT +
Sbjct  595   RIFGSQGNYPALNWFFLAGLLGPSLVYLLHRIFPNQSWIPLINLPVLFGATASMPPATPI  654

Query  2055  NYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWW  2234
             NY+SWILVGT+FN+F+FRYRKKWWQRYNYILSA LDAGVAFMA+L++F  G+ D  ++WW
Sbjct  655   NYNSWILVGTVFNYFLFRYRKKWWQRYNYILSAALDAGVAFMALLIHFAFGVRDVHMNWW  714

Query  2235  GTT--DLEHCDLASCPTAKGIAVDGCPVF  2315
             G+   D +HC LASCPTAKG+  DGCPVF
Sbjct  715   GSNPIDTDHCLLASCPTAKGVVADGCPVF  743



>ref|XP_004164894.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
Length=743

 Score =  1102 bits (2849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/749 (73%), Positives = 644/749 (86%), Gaps = 8/749 (1%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             MGT   E P      E +  E++SPIEEVRLTV+ TDD + PVWTFRMW LG++SC  +S
Sbjct  1     MGTEVTETPLT--VDELLEKEDISPIEEVRLTVSTTDDVSQPVWTFRMWTLGLISCCAMS  58

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             F+NQFFSYRREPL+IT I+VQVA+LPIGRFMAA LP  KFRIPGFGS +FS NPGPFNMK
Sbjct  59    FVNQFFSYRREPLVITQISVQVASLPIGRFMAATLPTRKFRIPGFGSKEFSFNPGPFNMK  118

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI+IFANAG AFG+GSAYAV IV II  FY R I+FF  WLL+ITTQVLGYGWAGL+
Sbjct  119   EHVLISIFANAGSAFGSGSAYAVAIVTIIKVFYWRSIAFFTSWLLVITTQVLGYGWAGLM  178

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             +KYVVEPAHMWWP+TLVQISLFRTLHE+EEE +      +SR KFF+I L  SF WY FP
Sbjct  179   RKYVVEPAHMWWPNTLVQISLFRTLHEEEEEGERR----ISRIKFFLIVLAASFTWYIFP  234

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
             GYIFQTL SISWVCW FP SVTAHQLGSG +GLG G+ +LDWST+ASFL SPL+ PFFAI
Sbjct  235   GYIFQTLQSISWVCWAFPHSVTAHQLGSGFSGLGFGSFSLDWSTVASFLGSPLITPFFAI  294

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
             VN+FVGY  ++Y+V+PI+YWGLNV+NAK FP++SS LFT+ GQ YDI++IVN  FEL+++
Sbjct  295   VNIFVGYVALVYVVIPIAYWGLNVFNAKTFPIFSSYLFTSSGQVYDITSIVNDNFELNQE  354

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
              YA+ GR+ LS+FF+++YGFGFA IA+T+THVALF+GREI  ++RAS++G+ DIHT+LM+
Sbjct  355   AYAQVGRVNLSSFFAITYGFGFAAIAATLTHVALFHGREIVKKFRASSEGREDIHTRLMR  414

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
             NYKDIP+WWF+++L+  IA SLALCIFL  EVQ+P+WGL+FAAALAF+FTLPISIITATT
Sbjct  415   NYKDIPTWWFHIVLLGAIAASLALCIFLKKEVQLPWWGLLFAAALAFIFTLPISIITATT  474

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQTPGLNIITEY+MG+I PG+PIANVCFKTYGY+SM QA++FL+DFKLGHYMKIPPRSMF
Sbjct  475   NQTPGLNIITEYLMGVILPGRPIANVCFKTYGYISMAQAVSFLNDFKLGHYMKIPPRSMF  534

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPK  1874
             LVQ IGT+IAGTIN+SVAWWLL S++ ICHQ   SNSPWTCP DRVFFDASVIWGLVGPK
Sbjct  535   LVQLIGTVIAGTINVSVAWWLLSSVDQICHQSPSSNSPWTCPGDRVFFDASVIWGLVGPK  594

Query  1875  RIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSL  2054
             RIF S+GNY ALNWFFL G+LGP +V+LLHR FP+QSWIPLINLPVL GAT SMPPAT +
Sbjct  595   RIFGSQGNYPALNWFFLAGLLGPSLVYLLHRIFPNQSWIPLINLPVLFGATASMPPATPI  654

Query  2055  NYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWW  2234
             NY+SWILVGT+FN+F+FRYRKKWWQRYNYILSA LDAGVAFMA+L++F  G+ D  ++WW
Sbjct  655   NYNSWILVGTVFNYFLFRYRKKWWQRYNYILSAALDAGVAFMALLIHFAFGVRDVHMNWW  714

Query  2235  GTT--DLEHCDLASCPTAKGIAVDGCPVF  2315
             G+   D +HC LASCPTAKG+  DGCPVF
Sbjct  715   GSNPIDTDHCLLASCPTAKGVVADGCPVF  743



>ref|XP_004147543.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
 ref|XP_004170983.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
Length=738

 Score =  1101 bits (2847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/743 (75%), Positives = 643/743 (87%), Gaps = 11/743 (1%)
 Frame = +3

Query  93    EAPALKLAGED--VNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQ  266
               P   L+G D   +D+++SPIE+VRLTVTN+DDPTLPVWTFRMW LG++SC LLSFLNQ
Sbjct  3     HQPPPPLSGSDPAADDDDISPIEQVRLTVTNSDDPTLPVWTFRMWTLGLLSCALLSFLNQ  62

Query  267   FFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVL  446
             FF YR EPLIIT ITVQVATLPIG+FMAA LPA++FR+PGFGS +FSLNPGPFNMKEHVL
Sbjct  63    FFYYRTEPLIITQITVQVATLPIGQFMAAVLPASRFRLPGFGSRRFSLNPGPFNMKEHVL  122

Query  447   ITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYV  626
             I+IFANAG AFG GSAYAVGIVNII AFY R ISF A WLLI+TTQVLGYGWAGLL+KYV
Sbjct  123   ISIFANAGTAFGGGSAYAVGIVNIIKAFYGRNISFVAAWLLIVTTQVLGYGWAGLLRKYV  182

Query  627   VEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIF  806
             VEPAHMWWPSTLVQ+SLFR LHEKE+         MSR KFF+I+L CSF WY  PGY+F
Sbjct  183   VEPAHMWWPSTLVQVSLFRALHEKEDCR-------MSRGKFFLIALICSFSWYVIPGYLF  235

Query  807   QTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVF  986
              TL SISWVCW FP SVTA QLGSG+ GLGLGA TLDWS ++SFL SPL+ PFF+IVN+F
Sbjct  236   PTLTSISWVCWAFPNSVTAQQLGSGMKGLGLGAFTLDWSAVSSFLFSPLISPFFSIVNIF  295

Query  987   VGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAK  1166
             VGY +I+Y+ +PI+YWG N+YNA  FP++SS LFTAQGQ Y+I+AIVN +FELD  +Y +
Sbjct  296   VGYTLIIYIAVPIAYWGFNLYNASTFPIFSSKLFTAQGQLYNITAIVNDKFELDLAKYEE  355

Query  1167  QGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKD  1346
              G+I+LS FF+L+YGFGFAT+A+T+THV  FYGREIY+RYRAS KGK DIHTKLMK Y+D
Sbjct  356   HGQIHLSMFFALTYGFGFATVAATLTHVGFFYGREIYERYRASYKGKEDIHTKLMKRYED  415

Query  1347  IPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTP  1526
             IPSWWFY+LLV+T+ VSL LCIFL  +VQ+P+WGLIFAA +AF+FTLPISIITATTNQTP
Sbjct  416   IPSWWFYLLLVLTVLVSLILCIFLKHQVQLPWWGLIFAAVMAFLFTLPISIITATTNQTP  475

Query  1527  GLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQF  1706
             GLNIITEY+MG+IYPG+PIANVCFKTYGYMSM QA++FLSDFKLGHYMKIPP+SMFLVQF
Sbjct  476   GLNIITEYVMGLIYPGRPIANVCFKTYGYMSMAQAVSFLSDFKLGHYMKIPPKSMFLVQF  535

Query  1707  IGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIF  1883
             IGT++AGTIN+ VAWWLL SI NIC  + L  NSPWTCPSDRVFFDASVIWGL+GPKRIF
Sbjct  536   IGTILAGTINLCVAWWLLTSISNICQVELLPPNSPWTCPSDRVFFDASVIWGLIGPKRIF  595

Query  1884  DSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYS  2063
              S G Y  +NWFFLGG +GP++VWLLHR FP QSWIPLINLPVLLGAT  MPPAT +NY+
Sbjct  596   GSHGFYGTMNWFFLGGAIGPILVWLLHRAFPKQSWIPLINLPVLLGATAMMPPATPVNYN  655

Query  2064  SWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTT  2243
             +WIL+GTIFNF +FRYRK+WWQRYNYILSA LD G+AFMAVLLYF+VG+E+R++ WWGT 
Sbjct  656   AWILIGTIFNFVIFRYRKQWWQRYNYILSAALDGGLAFMAVLLYFSVGMEERSVEWWGTA  715

Query  2244  DLEHCDLASCPTAKGIAVDGCPV  2312
               EHCDLA+CPTAKG+ VD CPV
Sbjct  716   G-EHCDLAACPTAKGVVVDSCPV  737



>ref|XP_008803571.1| PREDICTED: oligopeptide transporter 4-like isoform X1 [Phoenix 
dactylifera]
Length=763

 Score =  1100 bits (2846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/737 (74%), Positives = 638/737 (87%), Gaps = 11/737 (1%)
 Frame = +3

Query  108   KLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRRE  287
             K AG D  +EEVSPIE+VRLTV  TD+PTLPVWTFRMW +G++SC L+SFLNQFFSYR E
Sbjct  37    KTAGGD--EEEVSPIEQVRLTVPTTDNPTLPVWTFRMWFIGILSCSLMSFLNQFFSYRTE  94

Query  288   PLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfana  467
             PLIIT I++QVA+LP+G F+A  LPAAKFR+PGFG  QFSLNPGPFNMKEHVLI+IFANA
Sbjct  95    PLIITQISIQVASLPVGHFLARVLPAAKFRLPGFGDRQFSLNPGPFNMKEHVLISIFANA  154

Query  468   gfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMW  647
             G+AFGNG AY VGIVNII AFY+R ISF AGW+LIITTQVLGYGWAGL++KYVVEPAHMW
Sbjct  155   GYAFGNGPAYGVGIVNIIRAFYKRTISFTAGWILIITTQVLGYGWAGLMRKYVVEPAHMW  214

Query  648   WPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASIS  827
             WP+TLVQ+SLFR LHEKE+         M+RAKFFVI+L CSF WY  PGY+F T+ S+S
Sbjct  215   WPTTLVQVSLFRALHEKEDRR-------MTRAKFFVIALACSFAWYAVPGYLFSTVTSMS  267

Query  828   WVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIM  1007
             WVCWVF KSVTA QLGSG++GLGLGA TLDW+ ++SFL SPLVCPFFAI NVF+GYA  +
Sbjct  268   WVCWVFSKSVTAQQLGSGMHGLGLGAFTLDWTVVSSFLFSPLVCPFFAIANVFIGYAFTV  327

Query  1008  YLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLS  1187
             Y++ P++YWGLN+YNA+ FP++SS+LFT+ GQ YDI++IVN +FE+D + Y K GRI LS
Sbjct  328   YIITPVAYWGLNLYNAQTFPIFSSNLFTSTGQPYDITSIVNDKFEIDMEAYEKHGRINLS  387

Query  1188  TFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFY  1367
              FF+++YG GFATIASTITHVALFYGREIYDR+RAS  GK DIHTKLM+ Y+DIP WWF+
Sbjct  388   VFFAVTYGLGFATIASTITHVALFYGREIYDRFRASYNGKPDIHTKLMRKYEDIPGWWFH  447

Query  1368  VLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITE  1547
             +LLV+TI VSL LC  L DE+Q+P+WGL+FA  +AF FTLPISII+ATTNQTPGLNIITE
Sbjct  448   LLLVLTIVVSLILCTVLKDEIQLPWWGLLFACGMAFFFTLPISIISATTNQTPGLNIITE  507

Query  1548  YIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAG  1727
             Y++G+I PGKPIANVCFK YGYMSM+QA++FL+DFKLGHYMKIPPRSMFLVQFIGT+IAG
Sbjct  508   YVIGLILPGKPIANVCFKVYGYMSMSQAVSFLADFKLGHYMKIPPRSMFLVQFIGTIIAG  567

Query  1728  TINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYN  1904
             TIN++VAWWLL SI NIC  D L  NSPWTCPSDRVFFDASVIWGLVGP+RIF   GNY 
Sbjct  568   TINLAVAWWLLGSITNICQSDLLPENSPWTCPSDRVFFDASVIWGLVGPRRIFGPLGNYA  627

Query  1905  ALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGT  2084
             ALNWFF  G LGP+IVW+ HR FPSQ+WIPLINLPVL GAT  MPPAT+LNY++W+ VGT
Sbjct  628   ALNWFFAVGALGPIIVWIFHRLFPSQTWIPLINLPVLFGATAYMPPATALNYTAWVTVGT  687

Query  2085  IFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDL  2264
             +FNFFVFRYRKKWW+RYNYILSA LDAGVAFM VLLYFT+ LE+ +++WWGT   EHCDL
Sbjct  688   VFNFFVFRYRKKWWERYNYILSAALDAGVAFMGVLLYFTLNLENTSLNWWGTGG-EHCDL  746

Query  2265  ASCPTAKGIAVDGCPVF  2315
             A+CPTAKG+ VDGCPVF
Sbjct  747   ATCPTAKGVRVDGCPVF  763



>ref|XP_010691453.1| PREDICTED: oligopeptide transporter 4 [Beta vulgaris subsp. vulgaris]
Length=746

 Score =  1099 bits (2843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/750 (74%), Positives = 650/750 (87%), Gaps = 9/750 (1%)
 Frame = +3

Query  75    MGTVEIE---APALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCV  245
             MG+ E++    P  + +  D++++++SPIEEVRLTVTNTDDPTLPVWTFRMW LG+VSC 
Sbjct  1     MGSFELQPTIQPDPEKSKPDIDEDDISPIEEVRLTVTNTDDPTLPVWTFRMWFLGLVSCG  60

Query  246   LLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPF  425
             +LSFLNQFFSYR EPLIIT ITVQVATLP+G F+A  LP  KFRIPGFG   FSLNPGPF
Sbjct  61    MLSFLNQFFSYRTEPLIITQITVQVATLPLGHFLARILPETKFRIPGFGPRTFSLNPGPF  120

Query  426   NMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWA  605
             N+KEHVLITIFANAG AFGNGSAYAVGIVNII AFY+R ISF A W+LIITTQVLGYGWA
Sbjct  121   NVKEHVLITIFANAGSAFGNGSAYAVGIVNIIKAFYKRNISFLAAWILIITTQVLGYGWA  180

Query  606   GLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWY  785
             GL++KYVVEPAHMWWP+TLVQ+SLFR LHEK+++E+       SRAKFF+I+L CSF WY
Sbjct  181   GLMRKYVVEPAHMWWPNTLVQVSLFRALHEKDDKEEKRT----SRAKFFLIALMCSFLWY  236

Query  786   FFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPF  965
               PGY+F TL SISWVCWVF +SVTA QLGSG+ GLGLGA+TLDWS +ASFL SPL+ PF
Sbjct  237   AVPGYLFSTLTSISWVCWVFSRSVTAQQLGSGMRGLGLGAITLDWSAVASFLLSPLITPF  296

Query  966   FAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFEL  1145
             FAI NV VGY +I+Y+ +PI+YWGL++Y+A+ FP++SS LFTAQGQ Y+ISAIVN +FEL
Sbjct  297   FAIANVCVGYVLIIYIFIPIAYWGLDLYSARKFPIFSSHLFTAQGQIYNISAIVNDKFEL  356

Query  1146  DEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTK  1325
             D  +Y KQG+I++STFF+L+YGFGFATIAST+THV  FYGREIY+R+RAS   K DIHTK
Sbjct  357   DIAQYEKQGQIHMSTFFALTYGFGFATIASTLTHVGFFYGREIYERFRASYTSKDDIHTK  416

Query  1326  LMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIIT  1505
             LMK YKDIP+WWFY+LL +TI +S  L IFL +EVQ+P+W L+FA  +AF+FTLPISIIT
Sbjct  417   LMKKYKDIPAWWFYLLLGLTITISFLLSIFLKEEVQIPWWALLFACGMAFVFTLPISIIT  476

Query  1506  ATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPR  1685
             ATTNQTPGLNIITEYIMG+I PGKPIANVCFK YGYMSM+QA++FLSDFKLGHYMKIPPR
Sbjct  477   ATTNQTPGLNIITEYIMGLILPGKPIANVCFKVYGYMSMSQAVSFLSDFKLGHYMKIPPR  536

Query  1686  SMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGL  1862
             SMFLVQFIGT+ AGTIN++VAWWLL+SI NIC  + L ++SPWTCP DRVFFDASVIWGL
Sbjct  537   SMFLVQFIGTIFAGTINIAVAWWLLNSIHNICEDNLLPADSPWTCPGDRVFFDASVIWGL  596

Query  1863  VGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPP  2042
             VGPKRIF   G Y A+NWFF+GG +GP+IVWL H+ FP +SWIPLINLPVLLGAT  MPP
Sbjct  597   VGPKRIFGDLGTYKAMNWFFIGGAIGPIIVWLFHKAFPKKSWIPLINLPVLLGATAYMPP  656

Query  2043  ATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRT  2222
             AT++NY++WI+VGTIFN FVFRYRK+WWQRYNYILSA LDAGVAFM VLLYF++G+ED++
Sbjct  657   ATTVNYNAWIIVGTIFNLFVFRYRKQWWQRYNYILSAALDAGVAFMGVLLYFSLGVEDKS  716

Query  2223  ISWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             ++WWGT   EHC+LASCPTAKGIAVDGCP+
Sbjct  717   LTWWGTNG-EHCNLASCPTAKGIAVDGCPI  745



>ref|XP_003528403.1| PREDICTED: oligopeptide transporter 4-like [Glycine max]
Length=746

 Score =  1098 bits (2841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/725 (77%), Positives = 639/725 (88%), Gaps = 9/725 (1%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIEEVRLTV NTDDPT PVWTFRMW LG++SC LLSFLNQFFSYR EPL+IT ITVQVA
Sbjct  30    SPIEEVRLTVKNTDDPTQPVWTFRMWFLGLLSCSLLSFLNQFFSYRTEPLVITQITVQVA  89

Query  324   TLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
             TLP+G  MA  LP A FRIPGFG+ +FS NPGPFNMKEHVLITIFANAG AFG+GS YA+
Sbjct  90    TLPLGHLMAVVLPTAMFRIPGFGTKRFSFNPGPFNMKEHVLITIFANAGSAFGSGSPYAL  149

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFR  683
             GIVNI+ A YRRKISF + WLL+ITTQVLGYGWAGLL+KYVVEPAHMWWPSTLVQ+SLFR
Sbjct  150   GIVNIVKALYRRKISFISSWLLVITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFR  209

Query  684   TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTA  863
              LHEK+E          SRAKFF I+L CSF WY  PGY F TL +ISWVCW+F KSVTA
Sbjct  210   ALHEKDERR-------FSRAKFFFIALVCSFSWYVIPGYFFSTLTNISWVCWIFSKSVTA  262

Query  864   HQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLN  1043
              QLGSG+NGLG GALTLDW+ +ASFL SPL+ PFFAIVN+FVGY +++Y+V+PI+YWGLN
Sbjct  263   QQLGSGMNGLGFGALTLDWTAVASFLFSPLISPFFAIVNIFVGYTLVVYVVIPIAYWGLN  322

Query  1044  VYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFA  1223
             VY+A +FP++SS+LFT+QGQEY+ISAIVN++FELD  +Y +QGRI+LS FFSL+YGFGFA
Sbjct  323   VYSAHMFPIFSSNLFTSQGQEYNISAIVNEKFELDIAKYHQQGRIHLSVFFSLTYGFGFA  382

Query  1224  TIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLA  1403
             T+AST+THV  FYGRE+ +RYRAS KGK DIHTKLMK YKDIP+WWFYV++ VT+ VSL 
Sbjct  383   TVASTLTHVVCFYGREVMERYRASAKGKEDIHTKLMKKYKDIPTWWFYVMMGVTLVVSLV  442

Query  1404  LCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPI  1583
             LCIFLN++VQMP+WGLIFA+ALAF+FTLPISIITATTNQTPGLNIITEY+ GIIYPG+PI
Sbjct  443   LCIFLNNQVQMPWWGLIFASALAFIFTLPISIITATTNQTPGLNIITEYLFGIIYPGRPI  502

Query  1584  ANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLH  1763
             ANVCFKTYGY+SM QA++FL DFKLGHYMKIPPRSMFLVQFIGT++AGTIN+ VAWWLL+
Sbjct  503   ANVCFKTYGYISMAQAVSFLGDFKLGHYMKIPPRSMFLVQFIGTMLAGTINICVAWWLLN  562

Query  1764  SIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILG  1940
             SI NICH+D L   SPWTCPSDRVFFDASVIWGLVGP RIF S G+Y ALNWFF GG +G
Sbjct  563   SINNICHKDLLPEGSPWTCPSDRVFFDASVIWGLVGPLRIFGSHGDYQALNWFFFGGAIG  622

Query  1941  PVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKK  2120
             P++VW+LH+ FP QSWIPLINLPVLLGATG MPPAT LNY++WI+VGTIFNFF+FRYRKK
Sbjct  623   PILVWILHKSFPKQSWIPLINLPVLLGATGMMPPATPLNYNAWIIVGTIFNFFIFRYRKK  682

Query  2121  WWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVD  2300
             WWQRYNY+LSA LDAGVAFMAVLLYFT+GLE+ +++WWGT   EHC LA+CPTAKGI VD
Sbjct  683   WWQRYNYVLSAALDAGVAFMAVLLYFTLGLENTSLNWWGTAG-EHCPLATCPTAKGIVVD  741

Query  2301  GCPVF  2315
             GCPV+
Sbjct  742   GCPVY  746



>ref|XP_010244695.1| PREDICTED: oligopeptide transporter 4-like [Nelumbo nucifera]
Length=743

 Score =  1096 bits (2835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/726 (76%), Positives = 640/726 (88%), Gaps = 9/726 (1%)
 Frame = +3

Query  141   VSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQV  320
             +SPIEEVRLTV NTDDP+LPVWTFRMW +G++SC LLSFLNQFF+YR EP+IIT ITVQ+
Sbjct  26    LSPIEEVRLTVANTDDPSLPVWTFRMWFMGLLSCGLLSFLNQFFAYRTEPIIITQITVQI  85

Query  321   ATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYA  500
             ATLPIGRFMA+ LP  KFR+PGFGS +FSLNPGPFNMKEHVLI+IFANAG AFG GSAYA
Sbjct  86    ATLPIGRFMASVLPRTKFRLPGFGSREFSLNPGPFNMKEHVLISIFANAGSAFGGGSAYA  145

Query  501   VGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLF  680
             VGIVNII AFYRR ISFFAGW+L+ITTQVLGYGWAG+L+KYVVEPAHMWWPSTLVQ+SLF
Sbjct  146   VGIVNIIKAFYRRNISFFAGWILVITTQVLGYGWAGILRKYVVEPAHMWWPSTLVQVSLF  205

Query  681   RTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVT  860
             R LHEK+++        MSR KFF+I+L CSFCWY  PGY+F TL+SISW+CW F KSVT
Sbjct  206   RALHEKDDQR-------MSRGKFFLIALICSFCWYTVPGYLFPTLSSISWICWAFSKSVT  258

Query  861   AHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGL  1040
             AHQLGSG++GLG+GALTLDWS ++SFL SPL+ PFFAI NVFVGY ++MY+V+PISYWG+
Sbjct  259   AHQLGSGMDGLGIGALTLDWSVVSSFLFSPLMSPFFAIANVFVGYVVVMYIVIPISYWGV  318

Query  1041  NVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGF  1220
             ++YNAK FP++SS LFT+ GQ Y++SAIVN +FE+D   Y +QGRI+LS FF+L+YGFGF
Sbjct  319   DLYNAKTFPIFSSHLFTSHGQTYNVSAIVNDKFEIDIANYEEQGRIHLSMFFALTYGFGF  378

Query  1221  ATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSL  1400
             ATIA+T+THVALFYGREIY+RYRAS  GK DIHT+LMK Y DIP WWFY++LVVT+ VSL
Sbjct  379   ATIAATLTHVALFYGREIYERYRASYMGKEDIHTRLMKKYSDIPGWWFYLMLVVTLIVSL  438

Query  1401  ALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKP  1580
              LCIFL ++VQMP+WGL+FA+ LAF+FTLPIS ITATTNQTPGLNIITEYIMGII PGKP
Sbjct  439   LLCIFLKNQVQMPWWGLLFASVLAFIFTLPISTITATTNQTPGLNIITEYIMGIILPGKP  498

Query  1581  IANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLL  1760
             IANVCFKTYGY+SM QA++FLSDFKLGHYMKIPP+SMFLVQFIGT++AGTIN++VA WLL
Sbjct  499   IANVCFKTYGYISMAQAVSFLSDFKLGHYMKIPPKSMFLVQFIGTIMAGTINIAVAMWLL  558

Query  1761  HSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
             +SI NIC    L  +SPWTCPSDRVFFDASVIWGLVGPKRIF + GNY ALNWFFLGG L
Sbjct  559   NSIPNICDDQILPPDSPWTCPSDRVFFDASVIWGLVGPKRIFGTLGNYTALNWFFLGGAL  618

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
             GP++VWLLH+ FP Q+WIP INLPVLLGAT  MPPAT++NY+SW+LVGTIFNFF+FRYRK
Sbjct  619   GPLLVWLLHKTFPKQTWIPQINLPVLLGATAMMPPATTVNYTSWVLVGTIFNFFIFRYRK  678

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV  2297
              WWQRYNY+LSA LDAGVAFM VLLYF++ +E + + WWG    EHCDLASCPTAKGI V
Sbjct  679   NWWQRYNYVLSAALDAGVAFMGVLLYFSLNMEGKGLDWWGAGG-EHCDLASCPTAKGIVV  737

Query  2298  DGCPVF  2315
             DGCPVF
Sbjct  738   DGCPVF  743



>gb|KGN53886.1| hypothetical protein Csa_4G179700 [Cucumis sativus]
Length=738

 Score =  1094 bits (2830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/743 (74%), Positives = 641/743 (86%), Gaps = 11/743 (1%)
 Frame = +3

Query  93    EAPALKLAGED--VNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQ  266
               P   L+G D   +D+++SPIE+VRLTVTN+DDPTLPVWTFRMW LG++SC LLSFLNQ
Sbjct  3     HQPPPPLSGSDPAADDDDISPIEQVRLTVTNSDDPTLPVWTFRMWTLGLLSCALLSFLNQ  62

Query  267   FFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVL  446
             FF YR EPLIIT ITVQVATLPIG+FMAA LPA++FR+PGFGS +FSLNPGPFNMKEHVL
Sbjct  63    FFYYRTEPLIITQITVQVATLPIGQFMAAVLPASRFRLPGFGSRRFSLNPGPFNMKEHVL  122

Query  447   ITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYV  626
             I+IFANAG AFG GSAYAVGIVNII AFY R ISF A WLLI+TTQVLGYGWAGLL+KYV
Sbjct  123   ISIFANAGTAFGGGSAYAVGIVNIIKAFYGRNISFVAAWLLIVTTQVLGYGWAGLLRKYV  182

Query  627   VEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIF  806
             VEPAHMWWPSTLVQI ++  LHEKE+         MSR KFF+I+L CSF WY  PGY+F
Sbjct  183   VEPAHMWWPSTLVQIYIYMALHEKEDCR-------MSRGKFFLIALICSFSWYVIPGYLF  235

Query  807   QTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVF  986
              TL SISWVCW FP SVTA QLGSG+ GLGLGA TLDWS ++SFL SPL+ PFF+IVN+F
Sbjct  236   PTLTSISWVCWAFPNSVTAQQLGSGMKGLGLGAFTLDWSAVSSFLFSPLISPFFSIVNIF  295

Query  987   VGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAK  1166
             VGY +I+Y+ +PI+YWG N+YNA  FP++SS LFTAQGQ Y+I+AIVN +FELD  +Y +
Sbjct  296   VGYTLIIYIAVPIAYWGFNLYNASTFPIFSSKLFTAQGQLYNITAIVNDKFELDLAKYEE  355

Query  1167  QGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKD  1346
              G+I+LS FF+L+YGFGFAT+A+T+THV  FYGREIY+RYRAS KGK DIHTKLMK Y+D
Sbjct  356   HGQIHLSMFFALTYGFGFATVAATLTHVGFFYGREIYERYRASYKGKEDIHTKLMKRYED  415

Query  1347  IPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTP  1526
             IPSWWFY+LLV+T+ VSL LCIFL  +VQ+P+WGLIFAA +AF+FTLPISIITATTNQTP
Sbjct  416   IPSWWFYLLLVLTVLVSLILCIFLKHQVQLPWWGLIFAAVMAFLFTLPISIITATTNQTP  475

Query  1527  GLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQF  1706
             GLNIITEY+MG+IYPG+PIANVCFKTYGYMSM QA++FLSDFKLGHYMKIPP+SMFLVQF
Sbjct  476   GLNIITEYVMGLIYPGRPIANVCFKTYGYMSMAQAVSFLSDFKLGHYMKIPPKSMFLVQF  535

Query  1707  IGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIF  1883
             IGT++AGTIN+ VAWWLL SI NIC  + L  NSPWTCPSDRVFFDASVIWGL+GPKRIF
Sbjct  536   IGTILAGTINLCVAWWLLTSISNICQVELLPPNSPWTCPSDRVFFDASVIWGLIGPKRIF  595

Query  1884  DSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYS  2063
              S G Y  +NWFFLGG +GP++VWLLHR FP QSWIPLINLPVLLGAT  MPPAT +NY+
Sbjct  596   GSHGFYGTMNWFFLGGAIGPILVWLLHRAFPKQSWIPLINLPVLLGATAMMPPATPVNYN  655

Query  2064  SWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTT  2243
             +WIL+GTIFNF +FRYRK+WWQRYNYILSA LD G+AFMAVLLYF+VG+E+R++ WWGT 
Sbjct  656   AWILIGTIFNFVIFRYRKQWWQRYNYILSAALDGGLAFMAVLLYFSVGMEERSVEWWGTA  715

Query  2244  DLEHCDLASCPTAKGIAVDGCPV  2312
               EHCDLA+CPTAKG+ VD CPV
Sbjct  716   G-EHCDLAACPTAKGVVVDSCPV  737



>ref|XP_004485624.1| PREDICTED: oligopeptide transporter 4-like [Cicer arietinum]
Length=740

 Score =  1092 bits (2825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/717 (79%), Positives = 626/717 (87%), Gaps = 8/717 (1%)
 Frame = +3

Query  162   RLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGR  341
             RLTVTN DDP+ PVWTFRMW LG++SC LLSFLNQFF+YR EPLIIT I VQV+TLPIG 
Sbjct  29    RLTVTNKDDPSQPVWTFRMWFLGLISCSLLSFLNQFFAYRTEPLIITLIAVQVSTLPIGH  88

Query  342   FMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNII  521
             FMA  LP+ KF IPGFGS  FS NPGPFNMKEHVLITIFANAG AFG+GS YAVGIVNII
Sbjct  89    FMATVLPSTKFGIPGFGSKMFSFNPGPFNMKEHVLITIFANAGSAFGSGSPYAVGIVNII  148

Query  522   IAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHeke  701
              AFY R ISF A WLLIITTQVLGYGWAGLL+KYVVEPAHMWWPSTLVQ+SLFR LHEK+
Sbjct  149   KAFYGRSISFHAAWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFRALHEKD  208

Query  702   eeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsg  881
             +         +SRAKFF I+L CSF WY  PGY F TL SISWVCWVF KSVTA QLGSG
Sbjct  209   DGHR------ISRAKFFFIALVCSFSWYVIPGYFFTTLTSISWVCWVFSKSVTAQQLGSG  262

Query  882   lnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKI  1061
             + GLG+GALTLDWS +ASFL SPL+ PFFAIVNVFVGYAII+Y V PI+YWGL+ YNAK 
Sbjct  263   MKGLGIGALTLDWSAVASFLFSPLISPFFAIVNVFVGYAIIVYAVTPIAYWGLDTYNAKR  322

Query  1062  FPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTI  1241
             FP++SS LFT+QGQ+Y+ISAIVN +FELD  +Y +QGRI+LS FFSL+YGFGFATIAST+
Sbjct  323   FPIFSSHLFTSQGQKYNISAIVNDKFELDFAKYREQGRIHLSVFFSLTYGFGFATIASTL  382

Query  1242  THVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLN  1421
             THV  FYGREI +RYRAS+KGK DIHTKLMK YKDIPSWWFY LLVVT+ VSLALCIFLN
Sbjct  383   THVGCFYGREIVERYRASSKGKEDIHTKLMKRYKDIPSWWFYALLVVTLLVSLALCIFLN  442

Query  1422  DEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFK  1601
             D++QMP+WGL+FA  LAF FTLPISIITATTNQTPGLNIITEY+ G+IYPG+PIANVCFK
Sbjct  443   DQIQMPWWGLLFAGVLAFAFTLPISIITATTNQTPGLNIITEYVFGLIYPGRPIANVCFK  502

Query  1602  TYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENIC  1781
             TYGY+SM QA++FLSDFKLGHYMKIPPRSMFLVQFIGT++AGTIN+ VAWWLL+SIENIC
Sbjct  503   TYGYISMAQAVSFLSDFKLGHYMKIPPRSMFLVQFIGTILAGTINIGVAWWLLNSIENIC  562

Query  1782  HQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWL  1958
             H D L   SPWTCP DRVFFDASVIWGLVGPKRIF S+GNY+A+NWFFLGG +GP+IVWL
Sbjct  563   HDDLLPPGSPWTCPGDRVFFDASVIWGLVGPKRIFGSKGNYSAMNWFFLGGAIGPIIVWL  622

Query  1959  LHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYN  2138
              HR FP QSWIPLINLPVLLGAT  MPPAT LNY++WILVGTIFNFFVFRYRKKWWQRYN
Sbjct  623   FHRAFPKQSWIPLINLPVLLGATAMMPPATPLNYNAWILVGTIFNFFVFRYRKKWWQRYN  682

Query  2139  YILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCP  2309
             Y+LSA LD GVAFM VLLYF++GLE+R+ISWWG  D EHC LASCPTA+GI VDGCP
Sbjct  683   YVLSAALDTGVAFMTVLLYFSLGLENRSISWWG-NDGEHCPLASCPTAEGIVVDGCP  738



>ref|XP_008800083.1| PREDICTED: oligopeptide transporter 4-like [Phoenix dactylifera]
Length=748

 Score =  1092 bits (2824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/747 (72%), Positives = 637/747 (85%), Gaps = 13/747 (2%)
 Frame = +3

Query  78    GTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSF  257
              ++++EA    + G  V DEE SPIE+VRLTV  TDDPTLPVWTFRMW +G++SC L++F
Sbjct  14    ASMDVEA----IPGAGVEDEENSPIEQVRLTVLTTDDPTLPVWTFRMWFIGILSCSLMAF  69

Query  258   LNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKE  437
             LNQFFSYR EPLII  IT+QVA+LP+GRF+A  LPA KFR+PGFG  +FSLNPGPFNMKE
Sbjct  70    LNQFFSYRTEPLIIGQITIQVASLPVGRFLARVLPATKFRLPGFGDRKFSLNPGPFNMKE  129

Query  438   HVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLK  617
             HVLI+IFANAG AFG+GSAYAVGIV+II AFY+R ISF A WLLI+TTQVLGYGWAGLL+
Sbjct  130   HVLISIFANAGCAFGSGSAYAVGIVDIIRAFYKRSISFIASWLLIVTTQVLGYGWAGLLR  189

Query  618   KYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPG  797
             KYVVEPAHMWWP TLVQ+SLFR LHEKE+         MSRAKFFVI+L CSF WY  PG
Sbjct  190   KYVVEPAHMWWPGTLVQVSLFRALHEKEDSR-------MSRAKFFVIALACSFLWYAVPG  242

Query  798   YIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIV  977
             ++F TL SISW+CWVF KSVTA QLGSG+ GLG+GA TLDWS ++SFL SPLV PFFAIV
Sbjct  243   FLFPTLTSISWLCWVFSKSVTAQQLGSGMRGLGIGAFTLDWSAVSSFLFSPLVSPFFAIV  302

Query  978   NVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDE  1157
             NVF GY +I+Y+V P++YWGL++Y+AK FP++SS LFT+ GQ YD+ AIVN +FE+D   
Sbjct  303   NVFFGYVLIVYIVTPVAYWGLDLYHAKTFPIFSSHLFTSAGQNYDVHAIVNNKFEIDVQA  362

Query  1158  YAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKN  1337
             Y KQG+I LS FF+LSYG GFATIA+T+THVA FYGREIYDR+RAS K K DIHTKLM+N
Sbjct  363   YEKQGKISLSIFFALSYGLGFATIAATVTHVAFFYGREIYDRFRASYKKKADIHTKLMRN  422

Query  1338  YKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTN  1517
             Y++IP WWFY LL+VT  +SL LC  L D+VQ+P+WGL+FA A+AF+FTLP SIITATTN
Sbjct  423   YEEIPGWWFYSLLIVTFVISLILCTVLKDQVQLPWWGLLFACAMAFLFTLPTSIITATTN  482

Query  1518  QTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFL  1697
             QTPGLNIITEY+MG+I PGKPI+NVCFK YGYMSM QAI+FL+DFKLGHYMKIPP+SMF+
Sbjct  483   QTPGLNIITEYVMGLIQPGKPISNVCFKVYGYMSMAQAISFLADFKLGHYMKIPPKSMFI  542

Query  1698  VQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPK  1874
             VQF+GT+IAGTIN++VAWWLL S+ENIC+   L +NSPWTCP DRVFFDASVIWGLVGP+
Sbjct  543   VQFVGTIIAGTINLAVAWWLLGSVENICNDQLLPANSPWTCPGDRVFFDASVIWGLVGPR  602

Query  1875  RIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSL  2054
             RIF   GNY ALNWFF+GG LGP+IVW+ H+ FP Q+WIPLINLPVLLGAT +MPPATS+
Sbjct  603   RIFGPLGNYGALNWFFVGGALGPIIVWIFHKIFPGQTWIPLINLPVLLGATAAMPPATSV  662

Query  2055  NYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWW  2234
             NY+SWI+VGT+FNFFV+RYRKKWW+RYNYILSA LDAGVAFM V+LYF + LE+ +I WW
Sbjct  663   NYNSWIVVGTVFNFFVYRYRKKWWERYNYILSAALDAGVAFMGVVLYFALSLENVSIDWW  722

Query  2235  GTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             GT   EHC LA+CPTA+G+ VDGCPVF
Sbjct  723   GTAG-EHCPLATCPTARGVQVDGCPVF  748



>ref|XP_008454451.1| PREDICTED: oligopeptide transporter 4 [Cucumis melo]
Length=738

 Score =  1090 bits (2818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/739 (75%), Positives = 639/739 (86%), Gaps = 9/739 (1%)
 Frame = +3

Query  99    PALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSY  278
             P L       +D+++SPIE+VRLTVTN+DDPTLPVWTFRMW LG++SC LLSFLNQFF Y
Sbjct  7     PPLSANDPAADDDDISPIEQVRLTVTNSDDPTLPVWTFRMWTLGLLSCALLSFLNQFFYY  66

Query  279   RREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIf  458
             R EPLIIT ITVQVATLPIG+FMAA LPA +FR+PGFGS +FSLNPGPFNMKEHVLI+IF
Sbjct  67    RTEPLIITQITVQVATLPIGQFMAAVLPATRFRLPGFGSRRFSLNPGPFNMKEHVLISIF  126

Query  459   anagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPA  638
             ANAG AFG GSAYAVGIVNII AFY R ISF A WLLI+TTQVLGYGWAGLL+KYVVEPA
Sbjct  127   ANAGTAFGGGSAYAVGIVNIIKAFYGRNISFVAAWLLIVTTQVLGYGWAGLLRKYVVEPA  186

Query  639   HMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLA  818
             HMWWPSTLVQ+SLFR LHEKE+         MSR KFF+I+L CSF WY  PGY+F TL 
Sbjct  187   HMWWPSTLVQVSLFRALHEKEDCR-------MSRGKFFLIALICSFSWYVIPGYLFPTLT  239

Query  819   SISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYA  998
             SISWVCW FP SVTA QLGSG+ GLGLGA TLDWS ++SFL SPL+ PFF+IVN+FVGY 
Sbjct  240   SISWVCWAFPNSVTAQQLGSGMKGLGLGAFTLDWSAVSSFLFSPLISPFFSIVNIFVGYT  299

Query  999   IIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRI  1178
             +I+Y+ +PI+YWG N+YNA  FP++SS LFTAQGQ Y+++AIVN +FELD  +Y + G+I
Sbjct  300   LIIYIAVPIAYWGFNLYNASTFPIFSSKLFTAQGQLYNVTAIVNDKFELDLAKYEEHGQI  359

Query  1179  YLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSW  1358
             +LS FF+L+YGFGFAT+A+T+THV  FYGREIY+RYRAS KGK DIHTKLMK Y+DIPSW
Sbjct  360   HLSMFFALTYGFGFATVAATLTHVGFFYGREIYERYRASYKGKEDIHTKLMKRYEDIPSW  419

Query  1359  WFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNI  1538
             WFY+LLV+T+ VSL LCIFL  +VQ+P+WGLIFAA +AF+FTLPISIITATTNQTPGLNI
Sbjct  420   WFYLLLVLTVLVSLILCIFLRHQVQLPWWGLIFAAGMAFLFTLPISIITATTNQTPGLNI  479

Query  1539  ITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTL  1718
             ITEY++G+IYPG+PIANVCFKTYGYMSM QA++FLSDFKLGHYMKIPP+SMFLVQFIGT+
Sbjct  480   ITEYVIGLIYPGRPIANVCFKTYGYMSMAQAVSFLSDFKLGHYMKIPPKSMFLVQFIGTI  539

Query  1719  IAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEG  1895
             +AGTIN+ VAWWLL SI NIC  + L  NSPWTCPSDRVFFDASVIWGL+GPKRIF S G
Sbjct  540   LAGTINLCVAWWLLTSISNICQVELLPPNSPWTCPSDRVFFDASVIWGLIGPKRIFGSHG  599

Query  1896  NYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWIL  2075
              Y  +NWFFLGG +GP++VWLLHR FP QSWIPLINLPVLLGAT  MPPAT +NY++WIL
Sbjct  600   FYGTMNWFFLGGAIGPILVWLLHRAFPKQSWIPLINLPVLLGATAMMPPATPVNYNAWIL  659

Query  2076  VGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEH  2255
             +GTIFNF +FRYRK+WWQRYNYILSA LD G+AFMAVLLYF+VG+E+R++ WWGT   EH
Sbjct  660   IGTIFNFVIFRYRKQWWQRYNYILSAALDGGLAFMAVLLYFSVGMEERSVEWWGTAG-EH  718

Query  2256  CDLASCPTAKGIAVDGCPV  2312
             CDLA+CPTAKG+ VD CPV
Sbjct  719   CDLAACPTAKGVVVDSCPV  737



>ref|XP_010933427.1| PREDICTED: oligopeptide transporter 4-like [Elaeis guineensis]
Length=764

 Score =  1088 bits (2813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/737 (74%), Positives = 629/737 (85%), Gaps = 10/737 (1%)
 Frame = +3

Query  108   KLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRRE  287
             K  G D ++EEVSPIEEVRLTV  TD+P+LPVWTFRMW +G+++C L+SFLNQFFSYR E
Sbjct  37    KTGGGD-DEEEVSPIEEVRLTVPTTDNPSLPVWTFRMWFIGILACSLMSFLNQFFSYRTE  95

Query  288   PLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfana  467
             PLIIT IT+QVA+LP+G F+A  LPAAKFR+PGFG   FS NPGPFNMKEHVLI+IFANA
Sbjct  96    PLIITQITMQVASLPMGHFLARVLPAAKFRLPGFGDRLFSFNPGPFNMKEHVLISIFANA  155

Query  468   gfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMW  647
             G+AFGNG AYAVGIV+II AFY+R ISF + W+LIITTQVLGYGWAGL++KYVVEPAHMW
Sbjct  156   GYAFGNGPAYAVGIVDIIRAFYKRTISFISSWILIITTQVLGYGWAGLMRKYVVEPAHMW  215

Query  648   WPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASIS  827
             WPSTLVQ+SLFR LHEKEE         M+RAKFFVI+L CSF WY  PG++F T+ SIS
Sbjct  216   WPSTLVQVSLFRALHEKEERR-------MTRAKFFVIALACSFAWYAVPGFLFPTITSIS  268

Query  828   WVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIM  1007
             WVCWVF KSVTA QLGSG+ GLGLGA TLDWS ++SFL SPL+CPFFAI N+F+GY  ++
Sbjct  269   WVCWVFSKSVTAQQLGSGMQGLGLGAFTLDWSAVSSFLFSPLICPFFAIANIFIGYVFMV  328

Query  1008  YLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLS  1187
             Y++ PI YWGLN+YNAK FP++SS LFT  GQ YDI+AIVN +FE+D   Y K GRI LS
Sbjct  329   YIITPICYWGLNLYNAKTFPIFSSHLFTPDGQPYDITAIVNDKFEIDMKAYEKHGRINLS  388

Query  1188  TFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFY  1367
              FF++SYG GFATIAST+THVA FYGREIYDR+RAS  GK DIHTKLM+ Y+DIP WWF+
Sbjct  389   VFFAVSYGLGFATIASTVTHVAFFYGREIYDRFRASFHGKPDIHTKLMRKYEDIPGWWFH  448

Query  1368  VLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITE  1547
              +LV+TI VSL LC  L DEVQ+P+WGL+FA  +AF+FTLPISIITATTNQTPGLNIITE
Sbjct  449   SMLVLTIVVSLILCTVLKDEVQLPWWGLLFACGMAFIFTLPISIITATTNQTPGLNIITE  508

Query  1548  YIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAG  1727
             Y+MG+I PGKPIANVCFK YGYMSM QA++FL+DFKLGHYMKIPP+SMFLVQFIGT+IAG
Sbjct  509   YVMGLILPGKPIANVCFKVYGYMSMAQAVSFLADFKLGHYMKIPPKSMFLVQFIGTIIAG  568

Query  1728  TINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYN  1904
             TIN++VAWWLL SIENIC  D L  NSPWTCP DRVFFDASVIWGLVGP+RIF   GNY 
Sbjct  569   TINLAVAWWLLGSIENICQSDLLPENSPWTCPGDRVFFDASVIWGLVGPRRIFGPLGNYG  628

Query  1905  ALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGT  2084
             ALNWFFL G LGP+IVW+ HR FPSQ+WIPLINLPVL GAT +MPPAT++NY++W+ VGT
Sbjct  629   ALNWFFLVGALGPIIVWIFHRLFPSQTWIPLINLPVLFGATANMPPATAVNYTAWVTVGT  688

Query  2085  IFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDL  2264
             +FNFFVFRYRK+WW+RYNYILSA LDAGVAFM V LYF + +E+ +I+WWGT   EHCDL
Sbjct  689   VFNFFVFRYRKRWWERYNYILSAALDAGVAFMGVFLYFALNMENTSINWWGTGG-EHCDL  747

Query  2265  ASCPTAKGIAVDGCPVF  2315
             A+CPTAKG+ VDGCPVF
Sbjct  748   ATCPTAKGVQVDGCPVF  764



>ref|XP_003545740.1| PREDICTED: oligopeptide transporter 4 [Glycine max]
Length=736

 Score =  1087 bits (2812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/738 (77%), Positives = 641/738 (87%), Gaps = 9/738 (1%)
 Frame = +3

Query  99    PALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSY  278
             P  ++  E V D+E+SPIEEVRLTVTNTDDPT PVWTFRMW LG++SC LLSFLNQFF+Y
Sbjct  5     PEKRVTSEVVEDDELSPIEEVRLTVTNTDDPTRPVWTFRMWFLGLLSCSLLSFLNQFFAY  64

Query  279   RREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIf  458
             R EPLIIT ITVQVATLPIG FMAA LP   F IPGFGS  FS NPGPFNMKEHVLITIF
Sbjct  65    RTEPLIITQITVQVATLPIGHFMAAFLPTTTFSIPGFGSKSFSFNPGPFNMKEHVLITIF  124

Query  459   anagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPA  638
             ANAG AFG+GS YAVGIVNII AFY R ISF A WLLIITTQVLGYGWAGLL+KYVVEPA
Sbjct  125   ANAGSAFGSGSPYAVGIVNIIKAFYGRSISFAASWLLIITTQVLGYGWAGLLRKYVVEPA  184

Query  639   HMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLA  818
             HMWWPSTLVQ+SLFR LHEK++         +SRAKFF I+L CSF WY  PGY+F TL 
Sbjct  185   HMWWPSTLVQVSLFRALHEKDDHR-------LSRAKFFFIALVCSFSWYVVPGYLFTTLT  237

Query  819   SISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYA  998
             +ISWVCW+F KSVTA Q+GSG+ GLG+GALTLDW+ +ASFL SPL+ PFFAIVNVFVGYA
Sbjct  238   NISWVCWIFSKSVTAQQIGSGMRGLGVGALTLDWAAVASFLFSPLISPFFAIVNVFVGYA  297

Query  999   IIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRI  1178
             +I+Y+V+P+SYWGLNVYNA  FP++SS LFTAQGQ+Y+I  IV+  FEL+  EY KQGRI
Sbjct  298   LIVYVVIPVSYWGLNVYNANRFPIFSSHLFTAQGQKYNIPKIVDNHFELNVAEYEKQGRI  357

Query  1179  YLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSW  1358
             +LS FF+L+YGFGFATIAST+THV  FYGREI +RYRAS+KGK DIHTKLM+ YKDIPSW
Sbjct  358   HLSVFFALTYGFGFATIASTLTHVVCFYGREIMERYRASSKGKEDIHTKLMRRYKDIPSW  417

Query  1359  WFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNI  1538
             WF+ LL+VT+ VSLALCIFL D+VQMP+WGL+FA  LAF FTLPISIITATTNQTPGLNI
Sbjct  418   WFHSLLLVTLLVSLALCIFLKDQVQMPWWGLLFAGVLAFGFTLPISIITATTNQTPGLNI  477

Query  1539  ITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTL  1718
             ITEY+ G+IYPG+PIANVCFKTYGY+SM QA++FLSDFKLGHYMKIPPRSMFLVQFIGT+
Sbjct  478   ITEYVFGLIYPGRPIANVCFKTYGYISMAQAVSFLSDFKLGHYMKIPPRSMFLVQFIGTM  537

Query  1719  IAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEG  1895
             +AGTIN+ VAWWLL+SI+NICH D L   SPWTCP DRVFFDASVIWGLVGPKRIF S+G
Sbjct  538   LAGTINIGVAWWLLNSIKNICHDDLLPEGSPWTCPGDRVFFDASVIWGLVGPKRIFGSQG  597

Query  1896  NYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWIL  2075
             NY+A+NWFFLGG +GP+IVWLLH+ FP QSWIPLINLPVLLGATG MPPAT LNY++WI 
Sbjct  598   NYSAMNWFFLGGAVGPIIVWLLHKAFPKQSWIPLINLPVLLGATGMMPPATPLNYNAWIF  657

Query  2076  VGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEH  2255
             VGTIFNFF+FRYRKKWWQRYNY+LSA LD+GVAFM VLLYF +GLE+++++WWG  D EH
Sbjct  658   VGTIFNFFIFRYRKKWWQRYNYVLSAALDSGVAFMTVLLYFALGLENKSLNWWG-NDGEH  716

Query  2256  CDLASCPTAKGIAVDGCP  2309
             C LA CPTAKG+ VDGCP
Sbjct  717   CPLAVCPTAKGVIVDGCP  734



>ref|XP_007159179.1| hypothetical protein PHAVU_002G215700g [Phaseolus vulgaris]
 gb|ESW31173.1| hypothetical protein PHAVU_002G215700g [Phaseolus vulgaris]
Length=738

 Score =  1085 bits (2807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/720 (77%), Positives = 630/720 (88%), Gaps = 9/720 (1%)
 Frame = +3

Query  159   VRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIG  338
             VRLTV NTDDP  PVWTFRMW LG++SC LLSFLNQFF+YR EPL+IT ITVQVA LPIG
Sbjct  27    VRLTVRNTDDPNQPVWTFRMWFLGLLSCSLLSFLNQFFAYRTEPLVITQITVQVAMLPIG  86

Query  339   RFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNI  518
               MA  LP   FRIPGFGS +FS NPGPFNMKEHVL+TIFANAG AFGNGS+YAV I+NI
Sbjct  87    HLMAKLLPTTTFRIPGFGSKRFSFNPGPFNMKEHVLVTIFANAGSAFGNGSSYAVSIINI  146

Query  519   IIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHek  698
             + AFY RKISF A WLL+ITTQVLGYGWAGLLKKYVVEPAHMWWPS+LVQ+SLFR +HEK
Sbjct  147   VKAFYGRKISFLASWLLVITTQVLGYGWAGLLKKYVVEPAHMWWPSSLVQVSLFRAMHEK  206

Query  699   eeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgs  878
             ++          SRAKFF I+L CSF WY  PGY F TL +ISWVCW+F KSVTA QLGS
Sbjct  207   DDGG-------FSRAKFFFIALVCSFIWYVVPGYFFSTLTNISWVCWIFSKSVTAQQLGS  259

Query  879   glnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAK  1058
             G+NGLGLGALTLDWS +ASFL SPL+ PFFAIVN+FVGYA+I+Y V+PI+YWG N+YNA 
Sbjct  260   GMNGLGLGALTLDWSAVASFLFSPLISPFFAIVNIFVGYALIVYAVIPIAYWGFNMYNAN  319

Query  1059  IFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIAST  1238
              FP++SSDLFT+ GQEY+ISAIVN+ FELD D+Y +QGRI LS FFSL+YG GFATIAST
Sbjct  320   RFPIFSSDLFTSNGQEYNISAIVNQNFELDLDKYNQQGRINLSVFFSLTYGLGFATIAST  379

Query  1239  ITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFL  1418
             +THVA F+GREI +RYRAS  GK DIHTK+MK YKDIPSWWF+V+L VT+ VSL LCIFL
Sbjct  380   LTHVAFFHGREIMERYRASATGKEDIHTKMMKKYKDIPSWWFHVMLGVTLVVSLMLCIFL  439

Query  1419  NDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCF  1598
             ND+VQMP+WGL+FA+ALAF+FTLP+S+ITATTNQTPGLN+ITEYI GIIYPG+PIANVCF
Sbjct  440   NDQVQMPWWGLVFASALAFVFTLPVSVITATTNQTPGLNVITEYIFGIIYPGRPIANVCF  499

Query  1599  KTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENI  1778
             KT+GY+SM QA++FLSDFKLGHYMKIPPRSMFLVQFIGT++AG+IN  VAWWLL+S+ NI
Sbjct  500   KTFGYISMAQAVSFLSDFKLGHYMKIPPRSMFLVQFIGTMLAGSINTGVAWWLLNSVHNI  559

Query  1779  CHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVW  1955
             CH+D L  +SPWTCPSD VFFDASVIWGLVGP+RIF S GNY ALNWFFLGG +GP++VW
Sbjct  560   CHRDLLPEDSPWTCPSDHVFFDASVIWGLVGPRRIFGSHGNYQALNWFFLGGAIGPILVW  619

Query  1956  LLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRY  2135
             LLH+ FP QSWIPLINLPVLLGATG MPPAT+LNY++WI++GTIFNFFVFRYRKKWWQRY
Sbjct  620   LLHKAFPKQSWIPLINLPVLLGATGMMPPATALNYNAWIIIGTIFNFFVFRYRKKWWQRY  679

Query  2136  NYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             NY+LSA LDAGVAFMAVLLYF VGLE+++ISWWG  D EHC LA+CPTAKGI VDGCPV+
Sbjct  680   NYVLSAALDAGVAFMAVLLYFAVGLENKSISWWG-NDGEHCPLATCPTAKGIVVDGCPVY  738



>ref|XP_002283691.1| PREDICTED: oligopeptide transporter 2 [Vitis vinifera]
Length=740

 Score =  1077 bits (2786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/748 (71%), Positives = 641/748 (86%), Gaps = 11/748 (1%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             M ++EI+      + E++++ E+SPIEEVRLTV  TDDP+LPVWTFRMW LG++SCVLLS
Sbjct  1     MASLEIDGSRRSKSVEEIDEYELSPIEEVRLTVPTTDDPSLPVWTFRMWFLGLISCVLLS  60

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLN FF YR EPL+IT I+VQVATLP+GRFMA  LP  KFR+PGFGS ++SLNPGPFN+K
Sbjct  61    FLNTFFGYRTEPLVITMISVQVATLPVGRFMAKVLPKTKFRVPGFGSREYSLNPGPFNVK  120

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI+IFANAG AFG+G+AYA+ IV+II AFY R+ISF A W+L+ITTQVLGYGWAG+L
Sbjct  121   EHVLISIFANAGAAFGSGTAYAISIVDIIKAFYHREISFSACWILVITTQVLGYGWAGIL  180

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             +K+VV+PA MWWPS+L Q+SLF  LHEK+++        M+RAKFF+I+L CSF WY  P
Sbjct  181   RKFVVDPAEMWWPSSLTQVSLFSALHEKDKKR-------MTRAKFFLIALICSFSWYVVP  233

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
             GY+F TL +ISWVCWVFP S+TA Q+GSG+ GLG+GALTLDWS IASFL SPL+ PFFAI
Sbjct  234   GYLFPTLGTISWVCWVFPNSITAQQIGSGMRGLGIGALTLDWSVIASFLGSPLITPFFAI  293

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
             +NV  GY I MYL+ P++YWGLNVYNAK FP++SS LF AQGQ Y++SAIVN +FE+D +
Sbjct  294   INVLAGYVIFMYLITPVAYWGLNVYNAKNFPIFSSHLFNAQGQRYNVSAIVNNKFEIDME  353

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
              Y KQG I+LS FFS+SYG GFA + ST+THVALF GREIY ++RA+ KGK DIHTKLMK
Sbjct  354   TYQKQGHIHLSIFFSISYGLGFAAVISTLTHVALFNGREIYKQFRATYKGKEDIHTKLMK  413

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
             NYKDIP+ WF+++L +++A+SL LCIF+ DE+QMP+WGLIFAA LA  FTLPISIITATT
Sbjct  414   NYKDIPNTWFHLMLGLSLALSLILCIFMKDEIQMPWWGLIFAAFLALTFTLPISIITATT  473

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQTPGLNI+TEY+MG+I PG+PIANVCFKTYGY+SM QA++FL+DFKLGHYMKIPPRSMF
Sbjct  474   NQTPGLNIVTEYLMGVILPGRPIANVCFKTYGYISMAQAVSFLNDFKLGHYMKIPPRSMF  533

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVG  1868
             +VQFIGT+IAGT+N++VAWWLL SIENIC QD+L   NSPWTCP DRVF+DASVIWGLVG
Sbjct  534   VVQFIGTIIAGTVNITVAWWLLTSIENIC-QDQLLPPNSPWTCPGDRVFYDASVIWGLVG  592

Query  1869  PKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPAT  2048
             P+RIF   G+Y+ALNWFFL G LGPV+VWLLH+ FP+Q WI L+NLPVLLGATG+MPPAT
Sbjct  593   PRRIFGDLGDYSALNWFFLVGALGPVLVWLLHKAFPTQKWISLVNLPVLLGATGAMPPAT  652

Query  2049  SLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTIS  2228
             +LN+++WI VGTIFNFF+FRYRK WWQRYNY+LSA LDAG+AFM VLLYF++ + +R+IS
Sbjct  653   TLNFNAWIFVGTIFNFFIFRYRKNWWQRYNYVLSAALDAGLAFMGVLLYFSLTMANRSIS  712

Query  2229  WWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             WWG  + EHC LASCPTAKGI VDGCPV
Sbjct  713   WWG-AEGEHCGLASCPTAKGIVVDGCPV  739



>ref|XP_010030910.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW56910.1| hypothetical protein EUGRSUZ_I02586 [Eucalyptus grandis]
Length=742

 Score =  1077 bits (2785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/747 (73%), Positives = 635/747 (85%), Gaps = 16/747 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             + T  +  P  +L G  V+++++SPIEEV LTV NTDDPTLPVWTFRMW LG++SC LLS
Sbjct  10    LATAAVAKP-FELDGA-VDEDDLSPIEEVHLTVPNTDDPTLPVWTFRMWFLGLLSCALLS  67

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLNQFFSYR EPL IT ITV VATLPIGRFMAA LP AKFRIPG G   FSLNPGPFNMK
Sbjct  68    FLNQFFSYRTEPLFITQITVVVATLPIGRFMAAMLPEAKFRIPGLGPRLFSLNPGPFNMK  127

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI+IFANA       SAY V IVNII AFY R+ISF AGWLLIITTQVLGYGWAGLL
Sbjct  128   EHVLISIFANAAV-----SAYGVRIVNIIKAFYHRRISFRAGWLLIITTQVLGYGWAGLL  182

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             +KYVVEPAHMWWP+ LVQ+SLFR LHE++E+        MSRAKFF+I+L CSF WY  P
Sbjct  183   RKYVVEPAHMWWPANLVQVSLFRALHERDEKH-------MSRAKFFLIALICSFSWYVVP  235

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
             GY+F T+++ISWVCW F  SVTA Q+GSG+ GLG+GALTLDW+ ++S+L SPL+ P FA 
Sbjct  236   GYLFSTVSNISWVCWAFSNSVTAQQIGSGMKGLGVGALTLDWTVVSSYLGSPLISPLFAT  295

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
             VNVF GY  I+Y+V+P +YWG N+Y+A  FP++SS LFTAQGQ Y I+AIVN +FELD  
Sbjct  296   VNVFAGYTFIVYVVIPTAYWGFNLYSANRFPIFSSQLFTAQGQRYKITAIVNDKFELDIP  355

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
             +Y +QGRI+LS FF+L+YGFGFATIAST+THVA FYGREIY+RYRAS KGK DIHTKLM+
Sbjct  356   KYEEQGRIHLSAFFALTYGFGFATIASTLTHVAFFYGREIYERYRASHKGKADIHTKLMR  415

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
              YKDIPSWWF++LLVV + VSL LCI +ND+VQ+P+WGL+FA+ALAF+FTLPISIITATT
Sbjct  416   RYKDIPSWWFHLLLVVILVVSLLLCILMNDQVQLPWWGLLFASALAFVFTLPISIITATT  475

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQTPGLN+ITEY+MGII PG+PIANVCFKTYGY+SM QA+ FLSDFKLGHYMKIPPRSMF
Sbjct  476   NQTPGLNVITEYLMGIILPGRPIANVCFKTYGYISMFQAVFFLSDFKLGHYMKIPPRSMF  535

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLS-NSPWTCPSDRVFFDASVIWGLVGP  1871
             LVQ IGT++AGT+N++VAWWLL+S+ NIC  D L  +SPWTCPSDRVFFDASVIWGL GP
Sbjct  536   LVQLIGTILAGTVNIAVAWWLLNSVTNICQDDLLPLDSPWTCPSDRVFFDASVIWGLAGP  595

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATS  2051
             +RIF + G+Y  +NWFFLGG +GP+IVWLLH+ FP QSWIPLINLPVLLGAT  MPPAT 
Sbjct  596   RRIFGALGDYREINWFFLGGAIGPIIVWLLHKAFPKQSWIPLINLPVLLGATAMMPPATP  655

Query  2052  LNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISW  2231
             LNY++W+LVGTIFNFFVFRYRK+WWQRYNY+LSA LDAG AFMAVLLYF VG+E+++I+W
Sbjct  656   LNYNAWVLVGTIFNFFVFRYRKQWWQRYNYVLSAALDAGTAFMAVLLYFAVGMENKSITW  715

Query  2232  WGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             WGT   EHC+LA+CPTAKGI VDGCP+
Sbjct  716   WGTNG-EHCELAACPTAKGIEVDGCPI  741



>emb|CBI35438.3| unnamed protein product [Vitis vinifera]
Length=693

 Score =  1077 bits (2785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/700 (78%), Positives = 619/700 (88%), Gaps = 9/700 (1%)
 Frame = +3

Query  216   MWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGS  395
             MW +G+ SC LLSFL+QFF+YR EPLIIT ITVQVATLPIG FMAA LP  +FRIPGFGS
Sbjct  1     MWFMGLFSCALLSFLDQFFAYRTEPLIITQITVQVATLPIGHFMAAVLPTTRFRIPGFGS  60

Query  396   GQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLII  575
               FSLNPGPFNMKEHVLI+IFANAG AFG+GSAYAVGIV II AFY+RKISF +GWLLII
Sbjct  61    RSFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVGIVTIIKAFYQRKISFLSGWLLII  120

Query  576   TTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFV  755
             TTQVLGYGWAGLL+KYVVEPAHMWWPS+LVQ+SLFR LHEKEE+        M+RAKFFV
Sbjct  121   TTQVLGYGWAGLLRKYVVEPAHMWWPSSLVQVSLFRALHEKEEQR-------MTRAKFFV  173

Query  756   ISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIAS  935
             I+L CSF WY  PGY+F TL SISWVCW FPKSVTA QLGSG+ GLGLGALTLDW+ +AS
Sbjct  174   IALICSFSWYLIPGYLFSTLTSISWVCWAFPKSVTAQQLGSGMRGLGLGALTLDWTVVAS  233

Query  936   FLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDI  1115
             FL SPLV PFFAI+N+FVGY +++Y V+P++YWG ++YNA  FP++SS LFT+QGQ YDI
Sbjct  234   FLFSPLVSPFFAILNIFVGYVLLVYAVIPLAYWGFDMYNAHRFPIFSSHLFTSQGQLYDI  293

Query  1116  SAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRAS  1295
              AIVN +FE++  +Y +QGRI LS FF+LSYGFGFATIAST+THVALFYG EI  RYRAS
Sbjct  294   GAIVNDKFEINRQKYEEQGRINLSIFFALSYGFGFATIASTLTHVALFYGSEICQRYRAS  353

Query  1296  TKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAF  1475
              KGK DIHT+LM+ Y DIPSWWFY+LLVVTIAVSLALCIFLNDEVQMP+WGLIFAAA+AF
Sbjct  354   YKGKEDIHTRLMRRYADIPSWWFYLLLVVTIAVSLALCIFLNDEVQMPWWGLIFAAAMAF  413

Query  1476  MFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFK  1655
             +FTLPISIITATTNQTPGLNIITEY+MG+I PG+PIANVCFKTYGYMSM QA++FL+DFK
Sbjct  414   IFTLPISIITATTNQTPGLNIITEYVMGVILPGRPIANVCFKTYGYMSMAQAVSFLNDFK  473

Query  1656  LGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRV  1832
             LGHYMKIPPRSMFLVQFIGT++AGTIN++VAWWLL +I+NIC  + L  +SPWTCP DRV
Sbjct  474   LGHYMKIPPRSMFLVQFIGTILAGTINIAVAWWLLTTIKNICQDELLPPDSPWTCPGDRV  533

Query  1833  FFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPV  2012
             FFDASVIWGLVGPKRIF S GNY ++NWFFLGG LGPV+VW+ H+ FP QSWIPLINLPV
Sbjct  534   FFDASVIWGLVGPKRIFGSLGNYPSMNWFFLGGALGPVVVWVFHKAFPKQSWIPLINLPV  593

Query  2013  LLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLL  2192
             LLGAT  MPPATSLNY+SWILVGTIFNFFVFRYRK+WWQRYNYILSA +DAGVAFMAVLL
Sbjct  594   LLGATSMMPPATSLNYNSWILVGTIFNFFVFRYRKQWWQRYNYILSAAMDAGVAFMAVLL  653

Query  2193  YFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             YF++G+E++ ++WWG TD EHC LA+CPTAKGI VDGCPV
Sbjct  654   YFSLGIEEKGLTWWG-TDGEHCKLATCPTAKGIVVDGCPV  692



>ref|XP_003547106.1| PREDICTED: oligopeptide transporter 4-like [Glycine max]
Length=737

 Score =  1076 bits (2783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/740 (74%), Positives = 632/740 (85%), Gaps = 11/740 (1%)
 Frame = +3

Query  93    EAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFF  272
             E PA     ED  D+EVSPIEEVRL+V+NTDDPT PVWTFRMW LG++SC L+SFLNQFF
Sbjct  6     ENPAASETEED--DDEVSPIEEVRLSVSNTDDPTRPVWTFRMWFLGLLSCSLVSFLNQFF  63

Query  273   SYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLIT  452
             +Y  E +IIT ITVQVATLPIG FMAA LP   F IPGFGS  FS NPGPFNMKEHVLIT
Sbjct  64    AYHTERIIITQITVQVATLPIGHFMAALLPKTTFSIPGFGSKSFSFNPGPFNMKEHVLIT  123

Query  453   IfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVE  632
             IFANAG AFG+GS YAVGIVNII AFY R +SF A WLLI+TTQVLGYGWAGLL +YVV+
Sbjct  124   IFANAGSAFGDGSPYAVGIVNIIKAFYGRSVSFVASWLLIVTTQVLGYGWAGLLVEYVVK  183

Query  633   PAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQT  812
             PAHMWWPSTLVQ +LFR LHEK++         +SR KFF  +   S  WY  PGY+F T
Sbjct  184   PAHMWWPSTLVQAALFRALHEKDDHR-------ISRTKFFFFAQLFSMSWYVVPGYLFTT  236

Query  813   LASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVG  992
             L +ISWVCW+F KSVTA Q+GSG+ GLG+GALTLDW+ + SFL SPL+ PFFAIVNVFVG
Sbjct  237   LTNISWVCWIFSKSVTAQQIGSGMRGLGVGALTLDWAAVTSFLFSPLISPFFAIVNVFVG  296

Query  993   YAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQG  1172
             YA+ +Y+V+P+SYWGLNVYNA  FP++SS LFTAQGQ+Y+I  IV+  FEL+  EY KQG
Sbjct  297   YALTVYVVIPVSYWGLNVYNANRFPIFSSHLFTAQGQKYNIPKIVDNHFELNVAEYEKQG  356

Query  1173  RIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIP  1352
             RI+LS FF+L+YGFGFATIAST+THV  FYGREI +RYRAS+KGK DIHTKLM+ YKDIP
Sbjct  357   RIHLSVFFALTYGFGFATIASTLTHVVCFYGREIMERYRASSKGKEDIHTKLMRRYKDIP  416

Query  1353  SWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGL  1532
             SWWF+ LL+VT+ VSLALCIFL D+VQMP+WGL+FA  LAF FTLPISIITATTNQTPGL
Sbjct  417   SWWFHSLLLVTLLVSLALCIFLKDQVQMPWWGLLFAGVLAFGFTLPISIITATTNQTPGL  476

Query  1533  NIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIG  1712
             NIITEY+ G+IYPG+PIANVCFKTYGY+SM QA++FLSDFKLGHYMKIPPRSMFLVQFIG
Sbjct  477   NIITEYVFGLIYPGRPIANVCFKTYGYISMAQAVSFLSDFKLGHYMKIPPRSMFLVQFIG  536

Query  1713  TLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDS  1889
             T++AGTIN+ VAWWLL+SI+NICH D L   SPWTCP DRVFFDASVIWGLVGPKRIF S
Sbjct  537   TILAGTINIGVAWWLLNSIKNICHDDLLPEGSPWTCPGDRVFFDASVIWGLVGPKRIFGS  596

Query  1890  EGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSW  2069
             +GNY+A+NWFFLGG LGP+IVWLLH+ FP QSWIPLINLPVLLGATG MPPAT LNY++W
Sbjct  597   QGNYSAMNWFFLGGALGPIIVWLLHKAFPKQSWIPLINLPVLLGATGMMPPATPLNYNAW  656

Query  2070  ILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDL  2249
             I VGTIFNFF+FRYRKKWWQRYNY+LSA LD+GVAFM V+LYF++GLE+++++WWG  D 
Sbjct  657   IFVGTIFNFFIFRYRKKWWQRYNYVLSAALDSGVAFMTVMLYFSLGLENKSLNWWG-NDG  715

Query  2250  EHCDLASCPTAKGIAVDGCP  2309
             EHC LA+CPTAKGI VDGCP
Sbjct  716   EHCPLAACPTAKGIIVDGCP  735



>emb|CBI19303.3| unnamed protein product [Vitis vinifera]
Length=859

 Score =  1071 bits (2770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/733 (72%), Positives = 634/733 (86%), Gaps = 11/733 (2%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
             E++++ E+SPIEEVRLTV  TDDP+LPVWTFRMW LG++SCVLLSFLN FF YR EPL+I
Sbjct  135   EEIDEYELSPIEEVRLTVPTTDDPSLPVWTFRMWFLGLISCVLLSFLNTFFGYRTEPLVI  194

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
             T I+VQVATLP+GRFMA  LP  KFR+PGFGS ++SLNPGPFN+KEHVLI+IFANAG AF
Sbjct  195   TMISVQVATLPVGRFMAKVLPKTKFRVPGFGSREYSLNPGPFNVKEHVLISIFANAGAAF  254

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
             G+G+AYA+ IV+II AFY R+ISF A W+L+ITTQVLGYGWAG+L+K+VV+PA MWWPS+
Sbjct  255   GSGTAYAISIVDIIKAFYHREISFSACWILVITTQVLGYGWAGILRKFVVDPAEMWWPSS  314

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             L Q+SLF  LHEK+++        M+RAKFF+I+L CSF WY  PGY+F TL +ISWVCW
Sbjct  315   LTQVSLFSALHEKDKKR-------MTRAKFFLIALICSFSWYVVPGYLFPTLGTISWVCW  367

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
             VFP S+TA Q+GSG+ GLG+GALTLDWS IASFL SPL+ PFFAI+NV  GY I MYL+ 
Sbjct  368   VFPNSITAQQIGSGMRGLGIGALTLDWSVIASFLGSPLITPFFAIINVLAGYVIFMYLIT  427

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             P++YWGLNVYNAK FP++SS LF AQGQ Y++SAIVN +FE+D + Y KQG I+LS FFS
Sbjct  428   PVAYWGLNVYNAKNFPIFSSHLFNAQGQRYNVSAIVNNKFEIDMETYQKQGHIHLSIFFS  487

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLV  1379
             +SYG GFA + ST+THVALF GREIY ++RA+ KGK DIHTKLMKNYKDIP+ WF+++L 
Sbjct  488   ISYGLGFAAVISTLTHVALFNGREIYKQFRATYKGKEDIHTKLMKNYKDIPNTWFHLMLG  547

Query  1380  VTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMG  1559
             +++A+SL LCIF+ DE+QMP+WGLIFAA LA  FTLPISIITATTNQTPGLNI+TEY+MG
Sbjct  548   LSLALSLILCIFMKDEIQMPWWGLIFAAFLALTFTLPISIITATTNQTPGLNIVTEYLMG  607

Query  1560  IIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINM  1739
             +I PG+PIANVCFKTYGY+SM QA++FL+DFKLGHYMKIPPRSMF+VQFIGT+IAGT+N+
Sbjct  608   VILPGRPIANVCFKTYGYISMAQAVSFLNDFKLGHYMKIPPRSMFVVQFIGTIIAGTVNI  667

Query  1740  SVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALN  1913
             +VAWWLL SIENIC QD+L   NSPWTCP DRVF+DASVIWGLVGP+RIF   G+Y+ALN
Sbjct  668   TVAWWLLTSIENIC-QDQLLPPNSPWTCPGDRVFYDASVIWGLVGPRRIFGDLGDYSALN  726

Query  1914  WFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFN  2093
             WFFL G LGPV+VWLLH+ FP+Q WI L+NLPVLLGATG+MPPAT+LN+++WI VGTIFN
Sbjct  727   WFFLVGALGPVLVWLLHKAFPTQKWISLVNLPVLLGATGAMPPATTLNFNAWIFVGTIFN  786

Query  2094  FFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASC  2273
             FF+FRYRK WWQRYNY+LSA LDAG+AFM VLLYF++ + +R+ISWWG  + EHC LASC
Sbjct  787   FFIFRYRKNWWQRYNYVLSAALDAGLAFMGVLLYFSLTMANRSISWWG-AEGEHCGLASC  845

Query  2274  PTAKGIAVDGCPV  2312
             PTAKGI VDGCPV
Sbjct  846   PTAKGIVVDGCPV  858



>ref|XP_006856596.1| hypothetical protein AMTR_s00046p00213370 [Amborella trichopoda]
 gb|ERN18063.1| hypothetical protein AMTR_s00046p00213370 [Amborella trichopoda]
Length=732

 Score =  1071 bits (2769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/741 (73%), Positives = 627/741 (85%), Gaps = 13/741 (2%)
 Frame = +3

Query  93    EAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFF  272
             EA A ++  E   ++E+SPIE+VRLTVT TDDP+LPVWTFRMW LGV+SC  +SFLNQFF
Sbjct  3     EASA-EMTLEREEEDEISPIEQVRLTVTTTDDPSLPVWTFRMWFLGVLSCAAMSFLNQFF  61

Query  273   SYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLIT  452
             +YR EPL+IT I+VQVA+LP G F+AA LP  KFR+   G  ++SLNPGPFNMKEHVLIT
Sbjct  62    AYRTEPLVITQISVQVASLPAGHFLAAVLPKKKFRL---GGSEYSLNPGPFNMKEHVLIT  118

Query  453   IfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVE  632
             IFANAG+AFG+G+ YAVGIVNII AFYRRKISF A WL+IITTQVLGYGWAGLL+KYVVE
Sbjct  119   IFANAGYAFGSGTPYAVGIVNIIKAFYRRKISFIASWLIIITTQVLGYGWAGLLRKYVVE  178

Query  633   PAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQT  812
             PAHMWWPSTLVQ+S+FR LHEK++         +SRAKFFVI+L CSF +Y  PGY+F T
Sbjct  179   PAHMWWPSTLVQVSVFRALHEKDDRR-------LSRAKFFVIALVCSFSYYVLPGYLFST  231

Query  813   LASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVG  992
             L +ISWVCW  PKS+TA QLGSGLNGLGLGA  LDW+ IA+F+ SPL+ PFFAI+N+FVG
Sbjct  232   LTTISWVCWAHPKSITAQQLGSGLNGLGLGAFPLDWAAIAAFMFSPLIYPFFAIMNIFVG  291

Query  993   YAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQG  1172
             Y +I+YL +PI+YWG ++Y AK FP++SSDLFTA GQ Y+I+AIVN QFELDE  YA+QG
Sbjct  292   YVVIVYLAIPIAYWGFDLYGAKKFPIFSSDLFTADGQPYNITAIVNGQFELDETAYAQQG  351

Query  1173  RIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIP  1352
              I+LS FF+L+YGFGFATIASTITHVALFYGREI+ R RAS + K D+HT+LMKNY DIP
Sbjct  352   PIHLSMFFALTYGFGFATIASTITHVALFYGREIWQRSRASIRSKPDMHTRLMKNYADIP  411

Query  1353  SWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGL  1532
              WWFY L+  T+A+SL LCI L  EVQ+P+WG+  A ALAF+FTLPISIITATTNQTPGL
Sbjct  412   QWWFYALMAATVAISLFLCIVLKHEVQLPWWGIFLACALAFLFTLPISIITATTNQTPGL  471

Query  1533  NIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIG  1712
             NIITEYIMG I PGKPIANVCFK YGYMSM+QA++FL+DFKLGHYMKIPPRSMFLVQFIG
Sbjct  472   NIITEYIMGYILPGKPIANVCFKVYGYMSMSQAVSFLADFKLGHYMKIPPRSMFLVQFIG  531

Query  1713  TLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDS  1889
             T+IAGTIN+ VAWWLL SIENIC++  L   SPWTCP DRVFFDASVIWGLVGPKRIF  
Sbjct  532   TVIAGTINLGVAWWLLDSIENICNKAALPKGSPWTCPGDRVFFDASVIWGLVGPKRIFGP  591

Query  1890  EGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSW  2069
              G Y ALNWFFLGG LGPV+VWLLH+ FPSQ+WIPLINLPVLLGAT  MP AT+LNY++W
Sbjct  592   LGAYPALNWFFLGGALGPVLVWLLHKAFPSQTWIPLINLPVLLGATAYMPAATALNYNAW  651

Query  2070  ILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDL  2249
             + VGT+FNFFVFRYRK WWQRYNY+LSAGLDAGVAFM VLLYF++ +E+ + +WWG TD 
Sbjct  652   VAVGTVFNFFVFRYRKSWWQRYNYVLSAGLDAGVAFMGVLLYFSLSMENNSFNWWG-TDG  710

Query  2250  EHCDLASCPTAKGIAVDGCPV  2312
             EHCD A CPTAKG+   GCPV
Sbjct  711   EHCDFAVCPTAKGVIAKGCPV  731



>ref|XP_003608353.1| Oligopeptide transporter [Medicago truncatula]
Length=739

 Score =  1071 bits (2769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/720 (76%), Positives = 619/720 (86%), Gaps = 8/720 (1%)
 Frame = +3

Query  159   VRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIG  338
             VRLTV  TDDPTLPVWTFRMW LG++SC LLSFLNQFF+YR EPLIIT ITVQVATLP+G
Sbjct  27    VRLTVKKTDDPTLPVWTFRMWFLGLLSCALLSFLNQFFAYRTEPLIITQITVQVATLPLG  86

Query  339   RFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNI  518
               MA+ LP+  FRIPGFGS +FS NPGPFNMKEHVLITIFANAG AFG+GS+YAVGIVNI
Sbjct  87    HLMASVLPSKTFRIPGFGSKRFSFNPGPFNMKEHVLITIFANAGAAFGSGSSYAVGIVNI  146

Query  519   IIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHek  698
             I AFY R ISF A WLLIITTQVLGYGWAGLL+KYVVEPAHMWWP TLVQ+SLFRTLH  
Sbjct  147   IKAFYGRNISFLAAWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPGTLVQVSLFRTLH--  204

Query  699   eeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgs  878
                E      + SRAKFF I+L CSF WY  PGY+F TL SISWVCWVF KSVTA Q+GS
Sbjct  205   ---EKDDNPHQFSRAKFFFIALVCSFTWYIVPGYLFTTLTSISWVCWVFSKSVTAQQIGS  261

Query  879   glnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAK  1058
             G+NGLGLGALTLDWS +ASFL SPL+ PFFAIVNVFVGYA+++Y V+PI+YWG NVY A 
Sbjct  262   GMNGLGLGALTLDWSAVASFLFSPLISPFFAIVNVFVGYALLVYAVIPIAYWGFNVYGAN  321

Query  1059  IFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIAST  1238
              F ++SSDL+TAQGQ Y+IS IVN +FE+D  +Y +QGRI+LSTFF+LSYGFGFATIAST
Sbjct  322   RFSIFSSDLYTAQGQPYNISNIVNDKFEIDLAKYHEQGRIHLSTFFALSYGFGFATIAST  381

Query  1239  ITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFL  1418
             +THVA FYGR         T+ K+    KLMKNYKDIPSWWFY+LL VT  VSL +CIFL
Sbjct  382   VTHVACFYGRLWSGIVLRKTEKKI-FTQKLMKNYKDIPSWWFYLLLGVTFVVSLMICIFL  440

Query  1419  NDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCF  1598
             ND++QMP+WGL+ A+ALAF+FTLPISIITATTNQTPGLNIITEYI GIIYPG+PIANVCF
Sbjct  441   NDQIQMPWWGLLIASALAFIFTLPISIITATTNQTPGLNIITEYIFGIIYPGRPIANVCF  500

Query  1599  KTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENI  1778
             KTYGY+SM QA++FLSDFKLGHYMKIPPRSMFLVQFIGT++AGTIN+ VAWWLL S++NI
Sbjct  501   KTYGYISMAQAVSFLSDFKLGHYMKIPPRSMFLVQFIGTVLAGTINIGVAWWLLDSVKNI  560

Query  1779  CHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVW  1955
             C++D L   SPWTCPSDRVFFDASV+WGLVGPKRIF S G Y+ LNWFFLGG +GP++VW
Sbjct  561   CNKDLLPKGSPWTCPSDRVFFDASVVWGLVGPKRIFGSLGEYSTLNWFFLGGAIGPILVW  620

Query  1956  LLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRY  2135
             LLH+ FP QSWIPLINLPVLLGATG MPPAT+LNY+SWI+VGTIFNFF+FRYRKKWWQRY
Sbjct  621   LLHKAFPKQSWIPLINLPVLLGATGMMPPATALNYNSWIIVGTIFNFFIFRYRKKWWQRY  680

Query  2136  NYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             NY+LSA LDAGVAFMAVLLY  +GLE+ +++WWGT   EHC LA+CPTAKGI VDGCPVF
Sbjct  681   NYVLSAALDAGVAFMAVLLYLALGLENVSLNWWGTAG-EHCPLAACPTAKGIVVDGCPVF  739



>ref|XP_009398499.1| PREDICTED: oligopeptide transporter 4-like [Musa acuminata subsp. 
malaccensis]
Length=738

 Score =  1061 bits (2744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/733 (74%), Positives = 626/733 (85%), Gaps = 11/733 (2%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
              ++ ++E+SPIE+VRLTV N+DDP+LPVWTFRMW LG++SC LLSFLNQFF YR +PLII
Sbjct  16    REMEEDELSPIEQVRLTVMNSDDPSLPVWTFRMWSLGLLSCCLLSFLNQFFGYRSQPLII  75

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
             T ITVQVA+LP+G F+A  LP  +FR+PG G+   SLNPGPFNMKEHVLI+IFANAG AF
Sbjct  76    TQITVQVASLPLGHFLARVLPTTRFRLPGLGA--VSLNPGPFNMKEHVLISIFANAGAAF  133

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
             GNGSAYA+GIVNII AFY R ISF A WLLIITTQVLGYGWAGL+++YVVEPAHMWWPST
Sbjct  134   GNGSAYAIGIVNIIKAFYGRSISFIASWLLIITTQVLGYGWAGLMRRYVVEPAHMWWPST  193

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR LHEKE+         MSRAKFFVI+L CSF WY  PGY F T+ +ISWVCW
Sbjct  194   LVQVSLFRALHEKEDRR-------MSRAKFFVIALICSFTWYTVPGYFFPTITNISWVCW  246

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
             VF KSVTA Q+GSGL GLG+GA TLDW+ +ASFL SPL+CPFFAIVNV +GYA++MY+ +
Sbjct  247   VFSKSVTAQQIGSGLQGLGVGAFTLDWAAVASFLFSPLICPFFAIVNVLIGYALLMYVAI  306

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             P++YWG N+YNAK FP++SSDLFTA GQ Y+I+AIVN QFE++   Y +QGRI LS FF+
Sbjct  307   PLAYWGFNLYNAKTFPIFSSDLFTAAGQPYNITAIVNNQFEINMAAYEQQGRINLSMFFA  366

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLV  1379
             LSYGFGF+ I +T+THV  FYGREIY+R+RAS KGK DIHT+LMK Y++IP WWFYVLL 
Sbjct  367   LSYGFGFSAITATLTHVCFFYGREIYERFRASYKGKPDIHTRLMKKYENIPEWWFYVLLA  426

Query  1380  VTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMG  1559
             VT  VSL LCI LND+V +P+WGLIFA  +AF+FTLPISIITATTNQTPGLNIITEYIMG
Sbjct  427   VTFTVSLILCIVLNDQVHLPWWGLIFACGMAFVFTLPISIITATTNQTPGLNIITEYIMG  486

Query  1560  IIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINM  1739
             +I PGKPI+NVCFK YGYMSM QA++FL+DFKLGHYMKIPP+SMFLVQFIGT+IAGTIN+
Sbjct  487   LIQPGKPISNVCFKVYGYMSMAQAVSFLADFKLGHYMKIPPKSMFLVQFIGTIIAGTINL  546

Query  1740  SVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNW  1916
              VAWWLL SIENICH   L  NSPWTCPSDRVFFDASVIWGLVGP+RIF  +GNY +LNW
Sbjct  547   GVAWWLLGSIENICHPGLLPPNSPWTCPSDRVFFDASVIWGLVGPRRIFGPKGNYGSLNW  606

Query  1917  FFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNF  2096
             FFL G LGP+IVWL H+ FP QSWIPLINLPVLLGATG MPPAT LN+S+WI VGT FNF
Sbjct  607   FFLVGALGPIIVWLFHKAFPRQSWIPLINLPVLLGATGMMPPATPLNFSAWIAVGTAFNF  666

Query  2097  FVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCP  2276
             FVFRYRKKWW+RYNYILSA LDAGVAFM VLLYF + +E+++I+WWG  + EHC LASCP
Sbjct  667   FVFRYRKKWWERYNYILSAALDAGVAFMGVLLYFALSMENKSITWWG-AEGEHCPLASCP  725

Query  2277  TAKGIAVDGCPVF  2315
             TAKG+ VDGCP F
Sbjct  726   TAKGVQVDGCPQF  738



>ref|XP_004136415.1| PREDICTED: oligopeptide transporter 2-like [Cucumis sativus]
 ref|XP_004164895.1| PREDICTED: oligopeptide transporter 2-like [Cucumis sativus]
 gb|KGN60282.1| hypothetical protein Csa_3G893320 [Cucumis sativus]
Length=742

 Score =  1057 bits (2733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/746 (71%), Positives = 638/746 (86%), Gaps = 11/746 (1%)
 Frame = +3

Query  84    VEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLN  263
             +E+E  +     + + D+E+SPIE+VRLTV+N DDP++PVWTFRMW LG++SC++LSFLN
Sbjct  6     IELEQDSTTTTQKPIPDDEISPIEQVRLTVSNEDDPSIPVWTFRMWFLGLLSCIILSFLN  65

Query  264   QFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHV  443
              FF YR EPL+I+ I+VQVATLPIGRFMA  LP   FRIPGFG   FSLNPGPFN+KEHV
Sbjct  66    TFFGYRTEPLVISMISVQVATLPIGRFMANVLPTKTFRIPGFGDRNFSLNPGPFNIKEHV  125

Query  444   LITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKY  623
             LI+IFANAG AFGNG+AYA+GIV+I++AFY RKISF  GW+L+ITTQV+GYGWAG+L+KY
Sbjct  126   LISIFANAGSAFGNGAAYAIGIVDIVMAFYHRKISFLTGWILVITTQVMGYGWAGILRKY  185

Query  624   VVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYI  803
             VV+PA MWWPS+LVQ+SLFR +HEK+E         MSR KFF+I+L CSF WY FPGY+
Sbjct  186   VVDPAEMWWPSSLVQVSLFRAMHEKDESR-------MSRGKFFLITLICSFSWYVFPGYL  238

Query  804   FQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNV  983
             F TL++ISWVCW++P+SVTA QLGSG+ GLGLG+ +LDWS +AS+L SPL+ PFFA VNV
Sbjct  239   FPTLSTISWVCWIYPRSVTAQQLGSGMRGLGLGSFSLDWSVVASYLYSPLISPFFATVNV  298

Query  984   FVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYA  1163
              VGY +IMY+++P++YW  NVYNA+ FP++SS L+ A GQ Y++SAIVN +FE+D D Y 
Sbjct  299   AVGYIVIMYIMLPVAYWKANVYNARNFPIFSSHLYDANGQIYNVSAIVNDKFEIDMDAYE  358

Query  1164  KQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYK  1343
             KQGRI LS FFSLSYG GFA I ST++HVALF G+EIY ++RAS  GK DIHTKLMK YK
Sbjct  359   KQGRINLSVFFSLSYGIGFAAIISTLSHVALFNGKEIYQQFRASYSGKEDIHTKLMKKYK  418

Query  1344  DIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQT  1523
             DIPSWWF++LL+++I +SLALCIF+ DE+QMP+WGLIFAA LA  FTLPISIITATTNQ+
Sbjct  419   DIPSWWFHLLLLLSIILSLALCIFMKDEIQMPWWGLIFAAFLALTFTLPISIITATTNQS  478

Query  1524  PGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQ  1703
             PGLNIITEY+MGII PG+PIANVCFKTYGY+SMTQA++FL+DFKLGHYMKIPP SMF+VQ
Sbjct  479   PGLNIITEYLMGIILPGRPIANVCFKTYGYISMTQAVSFLNDFKLGHYMKIPPISMFIVQ  538

Query  1704  FIGTLIAGTINMSVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVGPKR  1877
              IGTLIAGT+NM+VAWWLL SIENIC QD+L   NSPWTCP DRVFFDASVIWGLVGPKR
Sbjct  539   CIGTLIAGTVNMAVAWWLLTSIENIC-QDQLLPPNSPWTCPGDRVFFDASVIWGLVGPKR  597

Query  1878  IFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLN  2057
             IF S GNY ALNWFF+GG +GP++VWLL + FP   WI LINLPVLLG+T  MPPAT++N
Sbjct  598   IFGSLGNYAALNWFFIGGAIGPILVWLLQKTFPKHKWISLINLPVLLGSTAIMPPATAVN  657

Query  2058  YSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWG  2237
             ++ WI+VGTIFNFFVFRYRK+WWQRYNY+LSA LDAG+AFM VLLYFT+ +ED+ ++WWG
Sbjct  658   FNCWIIVGTIFNFFVFRYRKEWWQRYNYVLSAALDAGLAFMGVLLYFTLTMEDKGLTWWG  717

Query  2238  TTDLEHCDLASCPTAKGIAVDGCPVF  2315
              +D EHC+LA+CPTAKGI VDGCPVF
Sbjct  718   -SDGEHCELANCPTAKGIVVDGCPVF  742



>emb|CBI19305.3| unnamed protein product [Vitis vinifera]
Length=700

 Score =  1056 bits (2732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/704 (77%), Positives = 612/704 (87%), Gaps = 8/704 (1%)
 Frame = +3

Query  216   MWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGS  395
             MW LGV+SC LLSFLNQFFSYRREPL+IT ITVQVATLPIGRFMAA LP  KF IPGFG 
Sbjct  1     MWFLGVLSCTLLSFLNQFFSYRREPLVITQITVQVATLPIGRFMAAVLPETKFHIPGFGK  60

Query  396   GQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLII  575
              +FS NPGPFNMKEHVLI+IFANAG AFGNGSAYAVGIV II AFY   ISF AGWLLI+
Sbjct  61    REFSFNPGPFNMKEHVLISIFANAGSAFGNGSAYAVGIVTIIKAFYNSSISFLAGWLLIV  120

Query  576   TTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFV  755
             TTQVLGYGWAGLL+KYVVEPAHMWWP TLVQI+LFR LH    +        MSR+KFFV
Sbjct  121   TTQVLGYGWAGLLRKYVVEPAHMWWPGTLVQIALFRRLHISYGDNKKR----MSRSKFFV  176

Query  756   ISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIAS  935
             I++  SF WY  P + FQ+L SISWVCW FPKS+TA QLGSG +GLG GALTLDWS +AS
Sbjct  177   IAMTGSFLWYSVPDFFFQSLQSISWVCWAFPKSITAQQLGSGFSGLGFGALTLDWSVVAS  236

Query  936   FLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDI  1115
             FL SPL+CPFFAIVNVF+GY +I+Y+VMPISYWGLNVYNA+ FP++SS LFTAQGQ Y+ 
Sbjct  237   FLFSPLICPFFAIVNVFIGYVLIIYIVMPISYWGLNVYNARTFPIFSSHLFTAQGQRYNT  296

Query  1116  SAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRAS  1295
             SAIV K  E+D  +Y KQGR+ LS+FF+++YGFGFATIA+T+THVALFYGREIY+RYRAS
Sbjct  297   SAIVTKNLEIDWVQYEKQGRVNLSSFFAITYGFGFATIAATLTHVALFYGREIYNRYRAS  356

Query  1296  TKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAF  1475
              +GK D+HT+LMK YKDIPSWWF++LL +TI +SLALCIFL DEVQMP+W LIFAAALAF
Sbjct  357   KEGKEDVHTRLMKKYKDIPSWWFHLLLALTIIISLALCIFLKDEVQMPWWALIFAAALAF  416

Query  1476  MFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFK  1655
             +FTLP+SIITATTNQTPGLNIITEYIMGII+PG+PIANVCFKTYGYMSM QAI+FLSDFK
Sbjct  417   IFTLPVSIITATTNQTPGLNIITEYIMGIIWPGRPIANVCFKTYGYMSMAQAISFLSDFK  476

Query  1656  LGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRV  1832
             LGHYMKIPPRSMFLVQ IGT++AGT+N+ VA WLL SI+NIC  + L +NSPWTCPSDRV
Sbjct  477   LGHYMKIPPRSMFLVQLIGTILAGTVNLGVALWLLDSIDNICQDNLLPANSPWTCPSDRV  536

Query  1833  FFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPV  2012
             FFDASVIWGLVGPKR+F S GNY ALNWFFLGG+LGPV VWLLH+KFP QSWIPLINLPV
Sbjct  537   FFDASVIWGLVGPKRVFGSLGNYGALNWFFLGGLLGPVAVWLLHKKFPKQSWIPLINLPV  596

Query  2013  LLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLL  2192
             LLGAT SMPPAT +NY++WIL+GTIFNFFVFRYRKKWWQRYNYILSA LDAGVAFMAVL+
Sbjct  597   LLGATASMPPATPVNYNAWILIGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLI  656

Query  2193  YFTVGLEDRTISWWGTT---DLEHCDLASCPTAKGIAVDGCPVF  2315
             Y ++G+E++ + WWG     D EHC LASCPTAKG+ VDGCPVF
Sbjct  657   YVSLGIENKNLHWWGADPDIDPEHCPLASCPTAKGVIVDGCPVF  700



>ref|XP_008466130.1| PREDICTED: oligopeptide transporter 2 [Cucumis melo]
Length=741

 Score =  1054 bits (2725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/750 (71%), Positives = 641/750 (85%), Gaps = 12/750 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGED-VNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLL  251
             M ++EIE        +  + D+E+SPIE+VRLTV+N DDP++PVWTFRMW LG++SC++L
Sbjct  1     MASLEIELEQDSTTTQKPIPDDEISPIEQVRLTVSNEDDPSIPVWTFRMWFLGLLSCMIL  60

Query  252   SFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNM  431
             SFLN FF YR EPL+I+ I+VQVATLPIGRFMA  LP   FRIPGFG   FSLNPGPFN+
Sbjct  61    SFLNTFFGYRTEPLVISMISVQVATLPIGRFMANVLPTTTFRIPGFGDRNFSLNPGPFNI  120

Query  432   KEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGL  611
             KEHVLI+IFANAG AFGNG+AYA+GIV+I++AFY RKISF AGW+L+ITTQV+GYGWAG+
Sbjct  121   KEHVLISIFANAGSAFGNGAAYAIGIVDIVMAFYHRKISFLAGWILVITTQVMGYGWAGI  180

Query  612   LKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFF  791
             L+KYVV+PA MWWPS+LVQ+SLFR +HEK+E         MSR KFF+I+L CSF WY F
Sbjct  181   LRKYVVDPAEMWWPSSLVQVSLFRAMHEKDESR-------MSRGKFFLITLICSFSWYVF  233

Query  792   PGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFA  971
             PGY+F TL++ISWVCW++P+SVTA QLGSG+ GLGLG+ +LDWS IAS+L SPL+ PFFA
Sbjct  234   PGYLFPTLSTISWVCWIYPRSVTAQQLGSGMRGLGLGSFSLDWSVIASYLYSPLISPFFA  293

Query  972   IVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDE  1151
              VNV VGY +IMY+++PI+YW  NVYNA+ FP++SS L+ A+GQ Y++SAIVN +FE+D 
Sbjct  294   TVNVAVGYIVIMYIMLPIAYWKTNVYNAQNFPIFSSHLYDAKGQIYNVSAIVNDKFEIDM  353

Query  1152  DEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLM  1331
               Y KQGRI LS FFSLSYG GFA I ST++HVALF G+EIY ++RAS  GK DIHTKLM
Sbjct  354   GAYEKQGRINLSVFFSLSYGIGFAAIISTLSHVALFNGKEIYQQFRASYSGKEDIHTKLM  413

Query  1332  KNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITAT  1511
             K YKDIPSWWF++LL+++I +SLALCIF+ DE+QMP+WGLIFAA LA  FTLPISIITAT
Sbjct  414   KKYKDIPSWWFHLLLLLSIILSLALCIFMKDEIQMPWWGLIFAAFLALTFTLPISIITAT  473

Query  1512  TNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSM  1691
             TNQ+PGLNIITEY+MGII PG+PIANVCFKTYGY+SMTQA++FL+DFKLGHYMKIPP SM
Sbjct  474   TNQSPGLNIITEYLMGIILPGRPIANVCFKTYGYISMTQAVSFLNDFKLGHYMKIPPISM  533

Query  1692  FLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLV  1865
             F+VQ IGTLIAGT+NM+VAWWLL SIENIC QD+L   NSPWTCP DRVFFDASVIWGLV
Sbjct  534   FIVQCIGTLIAGTVNMAVAWWLLTSIENIC-QDQLLPPNSPWTCPGDRVFFDASVIWGLV  592

Query  1866  GPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPA  2045
             GPKRIF S GNY ALNWFF+GG +GP++VWLL + FP+  WI LINLPVLLG+T  MPPA
Sbjct  593   GPKRIFGSLGNYAALNWFFVGGAIGPLLVWLLQKAFPNHKWISLINLPVLLGSTAIMPPA  652

Query  2046  TSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTI  2225
             T++N++ WI+VGTIFNFFVFRYRK+WWQRYNY+LSA LDAG+AFM VLLYFT+ +ED+ +
Sbjct  653   TAVNFNCWIIVGTIFNFFVFRYRKEWWQRYNYVLSAALDAGLAFMGVLLYFTLTMEDKGL  712

Query  2226  SWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             +WWG +D EHCDLA+CPTAKGI VDGCPVF
Sbjct  713   TWWG-SDGEHCDLANCPTAKGIVVDGCPVF  741



>ref|XP_006433764.1| hypothetical protein CICLE_v10003491mg [Citrus clementina]
 gb|ESR47004.1| hypothetical protein CICLE_v10003491mg [Citrus clementina]
Length=742

 Score =  1048 bits (2710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/747 (71%), Positives = 635/747 (85%), Gaps = 13/747 (2%)
 Frame = +3

Query  87    EIEAPALKLAGEDVNDE--EVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFL  260
             + EAP  K    +++DE  +VSPIEEVRLTV+N DDPTLPV+TFRMW LGV+SCVLLSFL
Sbjct  5     DAEAPPSKRKDHELDDENDDVSPIEEVRLTVSNEDDPTLPVYTFRMWFLGVISCVLLSFL  64

Query  261   NQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEH  440
             N FF+YR EPL++T I+VQVATLPIGRFMA  LP  KFR+PGFG  +FSLNPGPFN+KEH
Sbjct  65    NTFFAYRTEPLLVTMISVQVATLPIGRFMARLLPEKKFRVPGFGEKEFSLNPGPFNVKEH  124

Query  441   VLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKK  620
             VLI+IFANAG  FG+G+AYA+ IV+II AFYRR ISF A W+L+ITTQVLGYGWAG+L+K
Sbjct  125   VLISIFANAGAGFGSGAAYAISIVDIIKAFYRRNISFLAAWILVITTQVLGYGWAGILRK  184

Query  621   YVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGY  800
             +VV+PA MWWPS+LVQ+SLFR LHEK+          MSR KFF+I L CSF WY FPGY
Sbjct  185   FVVDPAEMWWPSSLVQVSLFRALHEKDNNR-------MSRGKFFLIVLVCSFSWYIFPGY  237

Query  801   IFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVN  980
             +F TL ++SWVCW FP S+TAHQLGSG+ GLGLGA  LDWS IAS+L SPL+ PFFAIVN
Sbjct  238   LFPTLTTVSWVCWAFPSSITAHQLGSGMKGLGLGAFALDWSVIASYLGSPLITPFFAIVN  297

Query  981   VFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEY  1160
             VFVGY I+MY++ PI+YWG N+Y+AK FP++SS LF ++GQ Y+ISAIVN+ FELD   Y
Sbjct  298   VFVGYIIVMYVLTPIAYWGFNLYDAKTFPIFSSHLFNSKGQIYNISAIVNENFELDIPMY  357

Query  1161  AKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNY  1340
              +QG ++LSTFF+++YG GFA I ST+THVALF GREIY++ RAST+GK DIHT+LMK Y
Sbjct  358   ERQGPMHLSTFFAVTYGIGFAAIISTLTHVALFNGREIYEQIRASTRGKQDIHTRLMKKY  417

Query  1341  KDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQ  1520
             KDIP+WWFY++LV ++ +SL LCIF+ DEVQMP+WGL+FAAALA +FTLPISIITATTNQ
Sbjct  418   KDIPNWWFYLMLVGSLILSLVLCIFMKDEVQMPWWGLLFAAALALIFTLPISIITATTNQ  477

Query  1521  TPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLV  1700
             TPGLNIITEYIMG+IYPG+PIANVCFKTYGY+SM+QA++FLSDFKLGHYMKIP R+MF+V
Sbjct  478   TPGLNIITEYIMGVIYPGRPIANVCFKTYGYISMSQAVSFLSDFKLGHYMKIPTRAMFVV  537

Query  1701  QFIGTLIAGTINMSVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVGPK  1874
             QFIGT+IAGT+N+ VAWWLL ++ENIC QD+L   NSPWTCP DRVF+DASVIWGL+GPK
Sbjct  538   QFIGTIIAGTVNLGVAWWLLTTVENIC-QDQLLPPNSPWTCPGDRVFYDASVIWGLIGPK  596

Query  1875  RIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSL  2054
             RIF   G Y+ALNWFFL G LGP +VWLLH+ FP   WI LINLPVLLGAT  MPPAT++
Sbjct  597   RIFGRMGIYSALNWFFLLGTLGPFVVWLLHKAFPKHKWITLINLPVLLGATAQMPPATTV  656

Query  2055  NYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWW  2234
             N++ WI+VGTIFN+F+F+YRK WWQRYNY++SA LDAG+AFM VLLYFT+ +E+R+I WW
Sbjct  657   NFNCWIVVGTIFNYFIFKYRKGWWQRYNYVVSAALDAGLAFMGVLLYFTLTMENRSIDWW  716

Query  2235  GTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             G+   EHCDLASCPT KG+ V+GCPV+
Sbjct  717   GSAG-EHCDLASCPTTKGVVVEGCPVY  742



>ref|XP_011078507.1| PREDICTED: oligopeptide transporter 4-like [Sesamum indicum]
Length=754

 Score =  1047 bits (2708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/741 (70%), Positives = 631/741 (85%), Gaps = 15/741 (2%)
 Frame = +3

Query  93    EAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFF  272
             E PA+       ++EEVSP+E+VRLTV N DDPTLPVWTFRMW LG+ SC+LLSFLN FF
Sbjct  27    EEPAVD------DEEEVSPVEQVRLTVPNEDDPTLPVWTFRMWFLGLFSCMLLSFLNTFF  80

Query  273   SYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLIT  452
             SYR EPLIIT I+VQVATLPIGRFMA  LP  KFR+PGFGS +FSLNPGPFNMKEHVLI+
Sbjct  81    SYRSEPLIITMISVQVATLPIGRFMANVLPTTKFRLPGFGSREFSLNPGPFNMKEHVLIS  140

Query  453   IfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVE  632
             IFANAG AFG GSAYAVGIV+II AFY+R ISF A W+L+ITTQVLGYGWAG+L+KYVVE
Sbjct  141   IFANAGSAFGGGSAYAVGIVDIIKAFYKRNISFLASWILVITTQVLGYGWAGILRKYVVE  200

Query  633   PAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQT  812
             PA MWWPS+LVQ+SLFR LHE++  +        SRA+FF+I+L CSF WY  PGY+F T
Sbjct  201   PAEMWWPSSLVQVSLFRALHERDSGKH-------SRARFFLIALACSFLWYIVPGYLFST  253

Query  813   LASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVG  992
             L+++S +C +FPKSVTA Q+GSG+ GLG+ +LT DWS +ASFL SPL+ PFFAIVNVFVG
Sbjct  254   LSNLSLLCLIFPKSVTAQQIGSGMRGLGIASLTFDWSVVASFLGSPLITPFFAIVNVFVG  313

Query  993   YAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQG  1172
             Y  ++Y+++PI+YWGL+VY+AK FP++SS LFT  GQ Y++SAIVN +FE+D   Y +QG
Sbjct  314   YFAVVYVMIPIAYWGLDVYHAKTFPIFSSHLFTRNGQIYNVSAIVNDKFEIDLPAYEQQG  373

Query  1173  RIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIP  1352
             RI LS FF+LSYG  FA + +T+THV +F GREIY RYRAS KGK DIHT+LMK Y+DIP
Sbjct  374   RINLSIFFALSYGLNFAAVMATLTHVIMFNGREIYQRYRASHKGKPDIHTRLMKKYRDIP  433

Query  1353  SWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGL  1532
             SWWF+ +L++++ VSL LCIF+ D+VQ+P+WGL+F+A LA +FTLPISIITATTNQTPGL
Sbjct  434   SWWFHAMLLLSLVVSLGLCIFMKDQVQLPWWGLLFSAGLALIFTLPISIITATTNQTPGL  493

Query  1533  NIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIG  1712
             N+ITEYI+GIIYPG+PIANVCFKTYGY+SM+QA++FL+DFKLGHYMK+PPRSMF+VQ +G
Sbjct  494   NVITEYIIGIIYPGRPIANVCFKTYGYISMSQAVSFLNDFKLGHYMKVPPRSMFIVQLVG  553

Query  1713  TLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDS  1889
             T++AGTIN+ +AW+LL ++ NIC  + L  NSPW CP+DRVFFDASVIWGLVGPKRIF  
Sbjct  554   TIVAGTINIGIAWYLLTTVNNICQDELLPPNSPWMCPNDRVFFDASVIWGLVGPKRIFGD  613

Query  1890  EGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSW  2069
              GNY+ALNW FLGG + PV VWLLH+ FPS++WI LINLPVLLGAT +MPPAT+LN++SW
Sbjct  614   LGNYSALNWCFLGGAVAPVFVWLLHKAFPSKTWIKLINLPVLLGATAAMPPATTLNFNSW  673

Query  2070  ILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDL  2249
             ILVGTIFN FVFRYRK+WWQRYNY+LSA LDAG+AFM V+LYF +G+E+ +ISWWG+   
Sbjct  674   ILVGTIFNLFVFRYRKRWWQRYNYVLSAALDAGLAFMGVVLYFCLGVENVSISWWGSNG-  732

Query  2250  EHCDLASCPTAKGIAVDGCPV  2312
             E+CDLASCPTAKG+AVDGCPV
Sbjct  733   EYCDLASCPTAKGVAVDGCPV  753



>ref|XP_009413226.1| PREDICTED: oligopeptide transporter 4-like [Musa acuminata subsp. 
malaccensis]
Length=746

 Score =  1047 bits (2708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/725 (72%), Positives = 615/725 (85%), Gaps = 7/725 (1%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIE+VRLTV NTDDPTLPVWTFRMW LG+ S  L+SFLNQFFSYR EPL+IT ITVQVA
Sbjct  28    SPIEQVRLTVRNTDDPTLPVWTFRMWFLGLASVCLMSFLNQFFSYRSEPLVITQITVQVA  87

Query  324   TLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
             +LP+G F+A  LP  +FR+PG G  +FSLNPGPFNMKEHVLI+IFANAG AFGNGSAYAV
Sbjct  88    SLPLGHFLARVLPTWRFRLPGLGQREFSLNPGPFNMKEHVLISIFANAGCAFGNGSAYAV  147

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFR  683
             GIVNII AFY+R +S  AGWLLIITTQVLGYGWAGL+++YVVEPAHMWWPSTLVQ+SLFR
Sbjct  148   GIVNIIRAFYKRSVSLIAGWLLIITTQVLGYGWAGLMRRYVVEPAHMWWPSTLVQVSLFR  207

Query  684   TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTA  863
              LHEKE+         +SRAKFFVI L CSFCWY  PGY F T+ S+SWVCW+F  SVTA
Sbjct  208   ALHEKEDGRIRR----ISRAKFFVIVLICSFCWYTVPGYFFPTITSMSWVCWLFSNSVTA  263

Query  864   HQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLN  1043
              QLGSGLNGL +GA TLDWST+ SFL SPLV PFFAIVNVF+G+ I +Y+ +P++YWGLN
Sbjct  264   QQLGSGLNGLAIGAFTLDWSTVVSFLGSPLVSPFFAIVNVFIGFVIFVYIAIPVAYWGLN  323

Query  1044  VYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFA  1223
              ++AK FP++SS+LF A G++Y+I+AIVN +FE+D   Y KQGRI LS FF+LSYGFGFA
Sbjct  324   SFDAKTFPIFSSELFAATGRKYNITAIVNDRFEIDMAAYEKQGRINLSMFFALSYGFGFA  383

Query  1224  TIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLA  1403
              IA+T THV  FYGREI+DRYRAS KGK DIHT+LM  Y DIP WWFY LL++T+AVS+ 
Sbjct  384   AIAATFTHVMFFYGREIHDRYRASYKGKPDIHTRLMHKYADIPGWWFYSLLLLTVAVSVV  443

Query  1404  LCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPI  1583
             LC  L D+VQ+P WGL FA ALAF+FTLPISIITATTNQTPGLNIITEY+MG++ PGKPI
Sbjct  444   LCTVLKDQVQLPVWGLFFACALAFIFTLPISIITATTNQTPGLNIITEYMMGLLQPGKPI  503

Query  1584  ANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLH  1763
             +NVCFK YGYMSM QA++FL+DFKLGHYMKIPPRSMFLVQ IGT+IAGTIN++VA W+L 
Sbjct  504   SNVCFKVYGYMSMAQAVSFLADFKLGHYMKIPPRSMFLVQLIGTIIAGTINITVAHWMLG  563

Query  1764  SIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILG  1940
             SI+NIC + +L  NSPWTCP DRVFFDASVIWGLVGP+RIF   GNY +LNWFFLGG +G
Sbjct  564   SIDNICDRARLPPNSPWTCPGDRVFFDASVIWGLVGPRRIFGPLGNYGSLNWFFLGGAIG  623

Query  1941  PVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKK  2120
             PV+VW LHR FP++SWIPL+NLPVLLGATG MPPA+ +N+++W++VGT+FN+ V+R RKK
Sbjct  624   PVLVWGLHRAFPARSWIPLVNLPVLLGATGIMPPASPINFTAWVVVGTVFNYAVYRRRKK  683

Query  2121  WWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVD  2300
             WW+R+NYILSA +DAGVAFM VLLYF + +E+ +I WWGT   EHC LA+CPTAKG+ V+
Sbjct  684   WWERFNYILSAAMDAGVAFMGVLLYFALNMENTSIDWWGTD--EHCPLATCPTAKGVQVE  741

Query  2301  GCPVF  2315
             GCPVF
Sbjct  742   GCPVF  746



>ref|XP_006472993.1| PREDICTED: oligopeptide transporter 2-like [Citrus sinensis]
Length=742

 Score =  1046 bits (2705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/747 (70%), Positives = 635/747 (85%), Gaps = 13/747 (2%)
 Frame = +3

Query  87    EIEAPALKLAGEDVNDE--EVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFL  260
             + EAP  K    +++DE  +VSPIEEVRLTV+N DDPTLPV+TFRMW LGV+SCVLLSFL
Sbjct  5     DAEAPPSKRKDHELDDENDDVSPIEEVRLTVSNEDDPTLPVYTFRMWFLGVISCVLLSFL  64

Query  261   NQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEH  440
             N FF+YR EPL++T I+VQVATLPIGRFMA  LP  KFR+PGFG  +FSLNPGPFN+KEH
Sbjct  65    NTFFAYRTEPLLVTMISVQVATLPIGRFMARLLPEKKFRVPGFGEKEFSLNPGPFNVKEH  124

Query  441   VLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKK  620
             VLI+IFANAG  FG+G+AYA+ IV+II AFYRR ISF A W+L+ITTQVLGYGWAG+L+K
Sbjct  125   VLISIFANAGAGFGSGAAYAISIVDIIKAFYRRNISFLAAWILVITTQVLGYGWAGILRK  184

Query  621   YVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGY  800
             +VV+PA MWWPS+LVQ+SLFR LHEK+          MSR KFF+I L CSF WY FPGY
Sbjct  185   FVVDPAEMWWPSSLVQVSLFRALHEKDNSR-------MSRGKFFLIVLVCSFSWYIFPGY  237

Query  801   IFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVN  980
             +F TL ++SWVCW FP S+TAHQLGSG+ GLGLGA  LDWS IAS+L SPL+ PFFAIVN
Sbjct  238   LFPTLTTVSWVCWAFPSSITAHQLGSGMKGLGLGAFALDWSVIASYLGSPLITPFFAIVN  297

Query  981   VFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEY  1160
             VFVGY I+MY++ PI+YWG N+Y+AK FP++SS LF ++GQ Y+ISAIVN+ FELD   Y
Sbjct  298   VFVGYIIVMYVLTPIAYWGFNLYDAKTFPIFSSHLFNSKGQIYNISAIVNENFELDIPMY  357

Query  1161  AKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNY  1340
              +QG ++LSTFF+++YG GFA I ST+THVALF GREIY++ RAST+GK DIHT+LMK Y
Sbjct  358   ERQGPMHLSTFFAVTYGIGFAAIISTLTHVALFNGREIYEQIRASTRGKQDIHTRLMKKY  417

Query  1341  KDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQ  1520
             KDIP+WWFY++LV ++ +SL LCIF+ DEVQMP+WGL+FAAALA +FTLPISIITATTNQ
Sbjct  418   KDIPNWWFYLMLVGSLILSLVLCIFMKDEVQMPWWGLLFAAALALIFTLPISIITATTNQ  477

Query  1521  TPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLV  1700
             TPGLNIITEYIMG+IYPG+PIANVCFKTYGY+SM+QA++FLSDFKLGHYMKIP R+MF+V
Sbjct  478   TPGLNIITEYIMGVIYPGRPIANVCFKTYGYISMSQAVSFLSDFKLGHYMKIPTRAMFVV  537

Query  1701  QFIGTLIAGTINMSVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVGPK  1874
             QFIGT+IAGT+N+ VAWWLL ++ENIC QD+L   NSPWTCP DRVF+DASVIWGL+GPK
Sbjct  538   QFIGTIIAGTVNLGVAWWLLTTVENIC-QDQLLPPNSPWTCPGDRVFYDASVIWGLIGPK  596

Query  1875  RIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSL  2054
             RIF   G Y+ALNWFFL G LGP +VWLL + FP   WI LINLPVLLGAT  MPPAT++
Sbjct  597   RIFGRMGIYSALNWFFLLGTLGPFVVWLLQKAFPKHKWITLINLPVLLGATAQMPPATTV  656

Query  2055  NYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWW  2234
             N++ WI+VGTIFN+F+F+YRK WWQRYNY++SA LDAG+AFM VLLYFT+ +E+R+I+WW
Sbjct  657   NFNCWIVVGTIFNYFIFKYRKGWWQRYNYVVSAALDAGLAFMGVLLYFTLTMENRSINWW  716

Query  2235  GTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             G+   EHCDLASCPT KG+ V+GCPV+
Sbjct  717   GSAG-EHCDLASCPTTKGVVVEGCPVY  742



>gb|KDP41518.1| hypothetical protein JCGZ_15925 [Jatropha curcas]
Length=730

 Score =  1045 bits (2701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/734 (69%), Positives = 622/734 (85%), Gaps = 12/734 (2%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
             E ++D+ VSPIEEVRLTV+N DDPTLPVWTFRMW LG+VSCVLLSFLN FF+YR EPL I
Sbjct  7     ETISDD-VSPIEEVRLTVSNHDDPTLPVWTFRMWFLGIVSCVLLSFLNTFFAYRTEPLTI  65

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
             + I+VQVATLPIGRFMA  LP  KF IPGFG+ +FSLNPGPFN+KEHVLI+IFAN G   
Sbjct  66    SMISVQVATLPIGRFMAKTLPTTKFAIPGFGNKKFSLNPGPFNVKEHVLISIFANVGSNA  125

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
             G+G+AYA+ I++II+AFY RKISF A W+L+ITTQVLGYGWAG+++K+VV+PAHMWWP +
Sbjct  126   GSGAAYAISIIDIIVAFYHRKISFLASWILVITTQVLGYGWAGIMRKFVVDPAHMWWPIS  185

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR +HE++ +        MSR KFF+I+L CSF WY FPGY+FQTL +ISWVCW
Sbjct  186   LVQVSLFRAMHERDNKR-------MSRGKFFLIALICSFSWYLFPGYLFQTLGTISWVCW  238

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
             +FP SVTA Q+GSG+ GLGLGA  +DWS IAS+L SPL+ PFFAIVNV VGY II+Y+++
Sbjct  239   LFPNSVTAQQIGSGMQGLGLGAFAVDWSVIASYLGSPLITPFFAIVNVLVGYIIIVYILV  298

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             P++YWG +VY+AK FP+ SS LF  +GQ Y++SAIVN +FE+D  EY K+G +YLS+FF+
Sbjct  299   PVAYWGFDVYDAKKFPIISSHLFNRRGQLYNVSAIVNDKFEIDLQEYEKEGNLYLSSFFA  358

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLV  1379
             ++YG GFA I ST+ HV LF G+EI  ++RAS  GK DIHT+LMK YK IP+WWFY+ L+
Sbjct  359   ITYGVGFAAIVSTLVHVGLFNGKEIVQQFRASYNGKEDIHTRLMKKYKGIPNWWFYLTLM  418

Query  1380  VTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMG  1559
             +++ +SL +CIF+ +++QMP+WGL+FA ALA +FTLPISIITATTNQ+PGLNIITEY+MG
Sbjct  419   LSLILSLVMCIFMKEQIQMPWWGLLFAVALALIFTLPISIITATTNQSPGLNIITEYLMG  478

Query  1560  IIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINM  1739
             +I PG+PIANVCFKTYGY+SMTQA++FL+DFKLGHYMKIPPRSMFLVQ IGTLI+GT+N 
Sbjct  479   VILPGRPIANVCFKTYGYISMTQAVSFLADFKLGHYMKIPPRSMFLVQCIGTLISGTVNT  538

Query  1740  SVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALN  1913
              VAWWLL S++NIC QD L   +SPWTCPSDRVF+DASVIWGLVGP+RIF   GNY+ALN
Sbjct  539   GVAWWLLTSVKNIC-QDSLLPPDSPWTCPSDRVFYDASVIWGLVGPRRIFGHLGNYSALN  597

Query  1914  WFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFN  2093
             WFFLGG +GPVIVWLLH+ FP Q WIPLINLPVLLGAT  +PPAT++N++ WILVGT FN
Sbjct  598   WFFLGGAIGPVIVWLLHKAFPKQKWIPLINLPVLLGATAILPPATTVNFNCWILVGTTFN  657

Query  2094  FFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASC  2273
             +FVF+Y KKWWQRYNY+LSA LDAG+AFM V+LYFT+ +E + ISWWG  D EHC LASC
Sbjct  658   YFVFKYHKKWWQRYNYVLSAALDAGLAFMGVILYFTLTMEGKFISWWG-NDGEHCPLASC  716

Query  2274  PTAKGIAVDGCPVF  2315
             PTA+GIAVDGC V 
Sbjct  717   PTAEGIAVDGCVVL  730



>ref|XP_007148334.1| hypothetical protein PHAVU_006G200100g [Phaseolus vulgaris]
 gb|ESW20328.1| hypothetical protein PHAVU_006G200100g [Phaseolus vulgaris]
Length=734

 Score =  1045 bits (2701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/731 (73%), Positives = 622/731 (85%), Gaps = 10/731 (1%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
              +V+++EVSPIEEVRLTV+N+DDPT P+WTFR+W LG++ C LLSF+NQ F+YR EPLI+
Sbjct  11    SEVDEDEVSPIEEVRLTVSNSDDPTQPIWTFRVWFLGLLFCCLLSFINQSFAYRTEPLIM  70

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
                ++QVA LP+  FMA  LP  KF IPGFG   FS NPGPFN+KEHVLIT+FANAG AF
Sbjct  71    VQTSIQVAVLPVAHFMAVVLPKTKFTIPGFGPRSFSFNPGPFNVKEHVLITMFANAGSAF  130

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
             G+GS YAVGIVNII AFY R ISFFA WLLI+TTQVLGYGWAGLL+KYVVEP HMWWP +
Sbjct  131   GSGSPYAVGIVNIIKAFYGRGISFFASWLLIVTTQVLGYGWAGLLRKYVVEPPHMWWPGS  190

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ S+FR +HE +           +R KFF  +L CS  WY  PGY+F TL +ISWVCW
Sbjct  191   LVQASVFRAMHETDNN--------RARTKFFFYALLCSMAWYVIPGYLFTTLTNISWVCW  242

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
             +F KSVTA Q+GSG+ GLG+GALTLDW  + SFL SPL+ PFFAIVN+FVGY +I+Y+V 
Sbjct  243   IFSKSVTAQQIGSGMRGLGVGALTLDWVAVTSFLFSPLISPFFAIVNIFVGYTLIVYVVT  302

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             PI+YWGLNVYNAK FP++SS LFT QGQ Y+I AIV+  F+L+  EY KQGRI+LS FF+
Sbjct  303   PIAYWGLNVYNAKRFPIFSSHLFTVQGQRYNIPAIVDDHFKLNVAEYEKQGRIHLSVFFA  362

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLV  1379
             LSYGFGFATIAST+THV  FYGREI +RYRAS     DIHTKLMK YKDIPSWWFY+LLV
Sbjct  363   LSYGFGFATIASTLTHVFCFYGREIMERYRASFNVTEDIHTKLMKRYKDIPSWWFYLLLV  422

Query  1380  VTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMG  1559
             VT+ VSLALCIFL D+VQMP+WGL+FA ALAF FTLP+SIITATTNQTPGLN+I EY+ G
Sbjct  423   VTLVVSLALCIFLKDQVQMPWWGLLFAVALAFGFTLPVSIITATTNQTPGLNVIAEYVFG  482

Query  1560  IIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINM  1739
             +IYPG+PIANVCFKTYGY+SM Q+++FLSDFKLGHYMKIPPRSMFLVQFIGT++AGTIN+
Sbjct  483   LIYPGRPIANVCFKTYGYISMAQSVSFLSDFKLGHYMKIPPRSMFLVQFIGTMLAGTINI  542

Query  1740  SVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNW  1916
              VAWWLL+SI+NICH D L ++SPWTCP DRVFFDASVIWGLVGPKRIF S+GNY+A+NW
Sbjct  543   GVAWWLLNSIKNICHDDLLPADSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYSAMNW  602

Query  1917  FFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNF  2096
             FFLGG LGPVIVWLLH+ FP QSWIPLINLPVLLGATG MPPAT LNY++WILVGTIFNF
Sbjct  603   FFLGGALGPVIVWLLHKAFPKQSWIPLINLPVLLGATGMMPPATPLNYNAWILVGTIFNF  662

Query  2097  FVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCP  2276
             F+FRYRKKWWQRYNY+LSA LD+GVAFM VLLYFT+GLE+R+++WWG  D EHC LA+CP
Sbjct  663   FIFRYRKKWWQRYNYVLSAALDSGVAFMTVLLYFTLGLENRSLNWWG-NDGEHCPLAACP  721

Query  2277  TAKGIAVDGCP  2309
             TAKG+ VDGCP
Sbjct  722   TAKGVIVDGCP  732



>ref|XP_004953568.1| PREDICTED: oligopeptide transporter 4-like isoform X2 [Setaria 
italica]
Length=754

 Score =  1041 bits (2691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/755 (70%), Positives = 621/755 (82%), Gaps = 10/755 (1%)
 Frame = +3

Query  72    KMGTVEIEAPALKLAGEDVND---EEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSC  242
             ++GT E    A K     V D   EE SP+E+VRLTV +TDDP+LPVWTFRMW +G++SC
Sbjct  3     EVGTAERGQAAGKEEEGIVGDGEEEESSPVEQVRLTVPSTDDPSLPVWTFRMWSIGLLSC  62

Query  243   VLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGF-GSGQFSLNPG  419
              L+SFLNQFF YR EPL++T ITVQVA+LP+G FMA  LP  + R P   G G++SLNPG
Sbjct  63    ALMSFLNQFFVYRTEPLVVTQITVQVASLPVGHFMARVLPRTRHRAPKLLGGGEWSLNPG  122

Query  420   PFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYG  599
             PFNMKEHVLI+IFANAGFAFG GSAYAVGI++II AFY R ISFF  WLL+ITTQVLGYG
Sbjct  123   PFNMKEHVLISIFANAGFAFGGGSAYAVGIIDIIRAFYHRHISFFTAWLLVITTQVLGYG  182

Query  600   WAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFC  779
             WAGL++KYVVEPAHMWWPSTLVQ+SLFR LHEK+E   G  +  +SR+KFF+++L CSF 
Sbjct  183   WAGLMRKYVVEPAHMWWPSTLVQVSLFRALHEKDEASKGSRQ--ISRSKFFLVALACSFA  240

Query  780   WYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVC  959
             WY  PGY+F  L SISWVCWVF KSVTA QLGSG+ GLGLGA TLDWST++SFL SPL+ 
Sbjct  241   WYAVPGYLFPALTSISWVCWVFSKSVTAQQLGSGMKGLGLGAFTLDWSTVSSFLFSPLIS  300

Query  960   PFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQF  1139
             PFFA VN+F GY   +YL+MPI+YWG N+YNAK FP++SS LF + G +YDI +IVN QF
Sbjct  301   PFFATVNIFFGYVFFVYLIMPIAYWGFNLYNAKTFPIFSSHLFMSNGTKYDIPSIVNSQF  360

Query  1140  ELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIH  1319
             ELD+D Y ++GR+ LS FF+LSYGF FATIA+TITHV LFYG+EIY R++AS K K DIH
Sbjct  361   ELDKDAYNQRGRVNLSIFFALSYGFSFATIAATITHVGLFYGKEIYRRFKASQKEKPDIH  420

Query  1320  TKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISI  1499
             TKLM+ Y DIP+WWFY L+ +++ VSL LC  L  EVQ+P+WGLIFA  +AF+FTLPISI
Sbjct  421   TKLMEKYDDIPAWWFYSLMALSVVVSLLLCTVLKREVQLPWWGLIFACGMAFIFTLPISI  480

Query  1500  ITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIP  1679
             ITATTNQTPGLN+ITEY MG+I PG PIANVCFK YGYMSM+QA+AFLSDFKLGHYMKIP
Sbjct  481   ITATTNQTPGLNVITEYAMGLIMPGYPIANVCFKVYGYMSMSQAVAFLSDFKLGHYMKIP  540

Query  1680  PRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWG  1859
             P+SMFLVQFIGT++AGT+N+  AWWLL SI++IC       SPWTCPSDRVFFDASVIWG
Sbjct  541   PKSMFLVQFIGTIVAGTVNLGTAWWLLGSIKDICSDSLPPESPWTCPSDRVFFDASVIWG  600

Query  1860  LVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMP  2039
             LVGP+RIF S GNY ALNWFFL G  GPVIV+ LHR +P+Q WIPLINLPVLLGAT SMP
Sbjct  601   LVGPRRIFGSAGNYGALNWFFLIGAAGPVIVYALHRMYPNQRWIPLINLPVLLGATASMP  660

Query  2040  PATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDR  2219
             PAT++NY+SW+L+GTIFNFFVFRY+KKWW RYNYILSA LDAGVAFM V+LYF++ +E++
Sbjct  661   PATAVNYNSWLLIGTIFNFFVFRYQKKWWTRYNYILSAALDAGVAFMGVVLYFSLTMENK  720

Query  2220  TISWWGTTDLEHCDLASCPTAKGIAVDG---CPVF  2315
             TI WWGT   EHC LASCPTAKG+ +     CPVF
Sbjct  721   TIDWWGTAG-EHCPLASCPTAKGMDLGPDSVCPVF  754



>ref|XP_009366376.1| PREDICTED: oligopeptide transporter 2-like [Pyrus x bretschneideri]
Length=734

 Score =  1039 bits (2686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/748 (71%), Positives = 634/748 (85%), Gaps = 21/748 (3%)
 Frame = +3

Query  81    TVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFL  260
             T+EIE PA K    D ND  VSP+EEVRLTV+N DDPTLPVWTFRMW LG+ SC LLSFL
Sbjct  5     TLEIE-PATK---HDEND--VSPVEEVRLTVSNDDDPTLPVWTFRMWTLGLASCALLSFL  58

Query  261   NQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEH  440
             N FFSYR EPLII+ I+VQVATLPIGRFMA ALP  KF+I   GS +FSLNPGPFNMKEH
Sbjct  59    NTFFSYRTEPLIISMISVQVATLPIGRFMARALPKRKFQI---GSKEFSLNPGPFNMKEH  115

Query  441   VLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKK  620
             VLI+IFANAG  FG+G+AYA+ IV+II AFY RKISF A W+L+ITTQVLGYGWAG+L++
Sbjct  116   VLISIFANAGSGFGSGTAYAISIVDIIKAFYHRKISFLASWILVITTQVLGYGWAGILRR  175

Query  621   YVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGY  800
             YVV+PA MWWPS+LVQ+SLFR LHEK+          MSR KFF I+L CSF W+  PGY
Sbjct  176   YVVDPAEMWWPSSLVQVSLFRALHEKDNNR-------MSRGKFFFIALICSFAWFVVPGY  228

Query  801   IFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVN  980
             +F TL++ISWVCW++PKSVTA Q+GSG+ GLG+GA +LDW+ IAS+L SPL+ PFFAIVN
Sbjct  229   LFPTLSTISWVCWIYPKSVTAQQIGSGMGGLGIGAFSLDWTVIASYLYSPLISPFFAIVN  288

Query  981   VFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEY  1160
             V  GY ++MY+++PI+YWG+N+YNAK F ++SS LF A GQ Y++SA+VN +FE+D   Y
Sbjct  289   VAAGYVLVMYMLLPIAYWGVNLYNAKNFAIFSSHLFDASGQIYNVSALVNNKFEIDMPAY  348

Query  1161  AKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYR-ASTKGKMDIHTKLMKN  1337
              +QGRI LS FFSL+YG GFA++ ST+THVALF GREIY +YR AS   K DIHT+LM+ 
Sbjct  349   ERQGRINLSVFFSLTYGIGFASVVSTLTHVALFNGREIYKQYRRASQSVKEDIHTRLMRK  408

Query  1338  YKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTN  1517
             YKDIP+WWF+++L+V++A+SL +CIF+ D+VQMP+WGLIFAA LA +FTLPISII ATTN
Sbjct  409   YKDIPNWWFHLMLLVSLALSLVMCIFMKDQVQMPWWGLIFAAGLALVFTLPISIIPATTN  468

Query  1518  QTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFL  1697
             Q+PGLNIITEYIMG+I PGKPIANVCFKTYGY+SM+QAI+FL+DFKLGHYMKIPP SMF+
Sbjct  469   QSPGLNIITEYIMGLILPGKPIANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPISMFI  528

Query  1698  VQFIGTLIAGTINMSVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVGP  1871
             VQ IGT++AGT+N+ VAWWLL SIENIC QD+L   NSPWTCP DRVFFDASVIWGLVGP
Sbjct  529   VQCIGTIVAGTVNIGVAWWLLSSIENIC-QDQLLPPNSPWTCPGDRVFFDASVIWGLVGP  587

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATS  2051
             KRIF S GNY ALNWFFL G LGP++VWLLH+ FPSQ WI LINLPVLLGAT +MPPAT+
Sbjct  588   KRIFGSLGNYKALNWFFLIGALGPLLVWLLHKAFPSQKWIKLINLPVLLGATAAMPPATT  647

Query  2052  LNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISW  2231
             +N++ WI+VGTIFN+FVFRYRKKWWQRYNY+LSA LDAGVAFM VLLYF++ + +++ISW
Sbjct  648   VNFNCWIVVGTIFNYFVFRYRKKWWQRYNYVLSAALDAGVAFMGVLLYFSLTMNEKSISW  707

Query  2232  WGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             WGT   EHCDLA+CPTAKGI VDGCPV+
Sbjct  708   WGTNG-EHCDLATCPTAKGIVVDGCPVY  734



>gb|AES90550.2| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=718

 Score =  1037 bits (2681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/720 (74%), Positives = 604/720 (84%), Gaps = 29/720 (4%)
 Frame = +3

Query  159   VRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIG  338
             VRLTV  TDDPTLPVWTFRMW LG++SC LLSFLNQFF+YR EPLIIT ITVQVATLP+G
Sbjct  27    VRLTVKKTDDPTLPVWTFRMWFLGLLSCALLSFLNQFFAYRTEPLIITQITVQVATLPLG  86

Query  339   RFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNI  518
               MA+ LP+  FRIPGFGS +FS NPGPFNMKEHVLITIFANAG AFG+GS+YAVGIVNI
Sbjct  87    HLMASVLPSKTFRIPGFGSKRFSFNPGPFNMKEHVLITIFANAGAAFGSGSSYAVGIVNI  146

Query  519   IIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHek  698
             I AFY R ISF A WLLIITTQVLGYGWAGLL+KYVVEPAHMWWP TLVQ+SLFRTLH  
Sbjct  147   IKAFYGRNISFLAAWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPGTLVQVSLFRTLH--  204

Query  699   eeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgs  878
                E      + SRAKFF I+L CSF WY  PGY+F TL SISWVCWVF KSVTA Q+GS
Sbjct  205   ---EKDDNPHQFSRAKFFFIALVCSFTWYIVPGYLFTTLTSISWVCWVFSKSVTAQQIGS  261

Query  879   glnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAK  1058
             G+NGLGLGALTLDWS +ASFL SPL+ PFFAIVNVFVGYA+++Y V+PI+YWG NVY A 
Sbjct  262   GMNGLGLGALTLDWSAVASFLFSPLISPFFAIVNVFVGYALLVYAVIPIAYWGFNVYGAN  321

Query  1059  IFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIAST  1238
              F ++SSDL+TAQGQ Y+IS IVN +FE+D  +Y +QGRI+LSTFF+LSYGFGFATIAST
Sbjct  322   RFSIFSSDLYTAQGQPYNISNIVNDKFEIDLAKYHEQGRIHLSTFFALSYGFGFATIAST  381

Query  1239  ITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFL  1418
             +THVA FYGREI +RYRAS  GK DIHTK  +  +       +  LV             
Sbjct  382   VTHVACFYGREIMERYRASKNGKEDIHTKTDEKLQR------HSFLV-------------  422

Query  1419  NDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCF  1598
                +QMP+WGL+ A+ALAF+FTLPISIITATTNQTPGLNIITEYI GIIYPG+PIANVCF
Sbjct  423   ---IQMPWWGLLIASALAFIFTLPISIITATTNQTPGLNIITEYIFGIIYPGRPIANVCF  479

Query  1599  KTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENI  1778
             KTYGY+SM QA++FLSDFKLGHYMKIPPRSMFLVQFIGT++AGTIN+ VAWWLL S++NI
Sbjct  480   KTYGYISMAQAVSFLSDFKLGHYMKIPPRSMFLVQFIGTVLAGTINIGVAWWLLDSVKNI  539

Query  1779  CHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVW  1955
             C++D L   SPWTCPSDRVFFDASV+WGLVGPKRIF S G Y+ LNWFFLGG +GP++VW
Sbjct  540   CNKDLLPKGSPWTCPSDRVFFDASVVWGLVGPKRIFGSLGEYSTLNWFFLGGAIGPILVW  599

Query  1956  LLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRY  2135
             LLH+ FP QSWIPLINLPVLLGATG MPPAT+LNY+SWI+VGTIFNFF+FRYRKKWWQRY
Sbjct  600   LLHKAFPKQSWIPLINLPVLLGATGMMPPATALNYNSWIIVGTIFNFFIFRYRKKWWQRY  659

Query  2136  NYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             NY+LSA LDAGVAFMAVLLY  +GLE+ +++WWGT   EHC LA+CPTAKGI VDGCPVF
Sbjct  660   NYVLSAALDAGVAFMAVLLYLALGLENVSLNWWGTAG-EHCPLAACPTAKGIVVDGCPVF  718



>ref|XP_004953566.1| PREDICTED: oligopeptide transporter 4-like [Setaria italica]
Length=762

 Score =  1035 bits (2675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/735 (71%), Positives = 612/735 (83%), Gaps = 7/735 (1%)
 Frame = +3

Query  123   DVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIIT  302
             D +DEE SPIE+VRLTV +TDDP+LPVWTFRMW +G++SC L+SFLNQFFSYR EPLI+T
Sbjct  31    DDDDEETSPIEQVRLTVPSTDDPSLPVWTFRMWSIGILSCALMSFLNQFFSYRAEPLIVT  90

Query  303   SITVQVATLPIGRFMAAALPAAKFRIPG-FGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
              ITVQVA+LP+G FMA  LP A+FR P   G G++SLNPGPFNMKEHVLI+IFANAGFAF
Sbjct  91    QITVQVASLPVGHFMARVLPRARFRAPRVLGGGEWSLNPGPFNMKEHVLISIFANAGFAF  150

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
             G G+AYAVGIVNII AFY R ISFF GWLL+ITTQVLGYGWAGL++KYVVEPAHMWWP T
Sbjct  151   GAGNAYAVGIVNIIRAFYHRHISFFTGWLLVITTQVLGYGWAGLMRKYVVEPAHMWWPGT  210

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR LHEKEE   G  +  ++R+KFF ++L CSF WY  PGY+F  L SISWVCW
Sbjct  211   LVQVSLFRALHEKEEFPKGSRQ--ITRSKFFAVALACSFAWYAVPGYLFPLLTSISWVCW  268

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
             VFPKSVTA QLGSG+ GLG+GA TLDW+T++++L SPL+ PFFA VN+F GY + +Y+++
Sbjct  269   VFPKSVTAQQLGSGMLGLGIGAFTLDWATVSAYLFSPLISPFFATVNIFFGYVLFVYVII  328

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             P +YWG N+YNAK FP++S+DLF + G  YDI++IVN QF +++DEY K G++ LS FF+
Sbjct  329   PTAYWGFNLYNAKTFPIFSNDLFVSNGTSYDITSIVNDQFVINKDEYNKLGKVNLSIFFA  388

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLV  1379
             LSYG  FA IA+T THV LFYG+EIY R+RAS K K DIHT+LMK Y DIP WWFY L+ 
Sbjct  389   LSYGLSFAAIAATTTHVGLFYGKEIYQRFRASRKEKPDIHTRLMKKYDDIPGWWFYSLMA  448

Query  1380  VTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMG  1559
             ++I VSL LC  L  EVQ+P+WGLIFA  +AF+FTLPISIITATTNQTPGLN+ITEY MG
Sbjct  449   LSIIVSLLLCTVLKREVQLPWWGLIFACGMAFIFTLPISIITATTNQTPGLNVITEYAMG  508

Query  1560  IIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINM  1739
             +I PG PIANVCFKTYGYMSM+QAIAFLSDFKLGHYMKIPP+SMFLVQF+GT++AGT+N+
Sbjct  509   LIMPGYPIANVCFKTYGYMSMSQAIAFLSDFKLGHYMKIPPKSMFLVQFVGTIVAGTVNI  568

Query  1740  SVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWF  1919
              VAWWLL SIENICH D  S SPWTCP+DRVFFDASVIWGLVGP+ IF   GNY ALNWF
Sbjct  569   GVAWWLLGSIENICHVDPSSGSPWTCPNDRVFFDASVIWGLVGPREIFGRLGNYGALNWF  628

Query  1920  FLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFF  2099
             FL G  GPVIV+ LHR FPSQ WIP+INLPVLLGAT  MPPA+++NY++W+L+GTIFNFF
Sbjct  629   FLIGAAGPVIVYALHRVFPSQRWIPMINLPVLLGATAIMPPASTVNYNAWLLIGTIFNFF  688

Query  2100  VFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPT  2279
             VFRYRK WW RYNYILSA LDAGVAFM V+LYF++ +E + I WWGT   EHC LA CPT
Sbjct  689   VFRYRKGWWVRYNYILSAALDAGVAFMGVVLYFSLTMETKRIQWWGTAG-EHCPLAFCPT  747

Query  2280  AKGIAVDG---CPVF  2315
             AKG+ +     CPVF
Sbjct  748   AKGVDLGPDSVCPVF  762



>ref|NP_172464.1| oligopeptide transporter 2 [Arabidopsis thaliana]
 sp|O04514.2|OPT2_ARATH RecName: Full=Oligopeptide transporter 2; Short=AtOPT2 [Arabidopsis 
thaliana]
 gb|AEE28515.1| oligopeptide transporter 2 [Arabidopsis thaliana]
Length=734

 Score =  1030 bits (2663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/749 (68%), Positives = 626/749 (84%), Gaps = 17/749 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             M  +E+  P  ++  +D +DE  SP+E+VRLTV+N DDP+LPVWTFRMW LG++SC+LLS
Sbjct  1     MAAIELHKP--EINADDDDDE--SPVEQVRLTVSNHDDPSLPVWTFRMWFLGLLSCILLS  56

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLN FF YR +PL+IT I+VQV TLP+G+ MA  LP  K++I   GS +FS NPGPFN+K
Sbjct  57    FLNTFFGYRTQPLMITMISVQVVTLPLGKLMARVLPETKYKI---GSWEFSFNPGPFNVK  113

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI++FANAG  FG+G+AYAVGIV+II+AFY+RKISF A W+L+ITTQ+LGYGWAG++
Sbjct  114   EHVLISMFANAGAGFGSGTAYAVGIVDIIMAFYKRKISFLASWILVITTQILGYGWAGIM  173

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             +K VV+PA MWWP++++Q+SLFR LHEK+          MSR KFFVI+  CSF WY FP
Sbjct  174   RKLVVDPAQMWWPTSVLQVSLFRALHEKDNAR-------MSRGKFFVIAFVCSFAWYIFP  226

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
              Y+F TL+SISWVCW FPKS+TA QLGSG++GLG+GA  LDWS IAS+L SPLV PFFAI
Sbjct  227   AYLFLTLSSISWVCWAFPKSITAQQLGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAI  286

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
             VNV VGY ++MY+V+PISYWG+NVY A  FP++SSDLF  QGQ Y+IS IVN +FELD +
Sbjct  287   VNVLVGYVLVMYMVIPISYWGMNVYEANKFPIFSSDLFDKQGQLYNISTIVNNKFELDME  346

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
              Y +QGR+YLSTFF++SYG GFA I ST+THVALF G+ I+ + RASTK KMDIHT+LMK
Sbjct  347   NYQQQGRVYLSTFFAISYGIGFAAIVSTLTHVALFNGKGIWQQVRASTKAKMDIHTRLMK  406

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
              YKDIP WWFY LL +++ +SL LCIF+ DE+QMP+WGL+ A+ +A  FT+P+SIITATT
Sbjct  407   KYKDIPGWWFYSLLAISLVLSLVLCIFMKDEIQMPWWGLLLASFMALTFTVPVSIITATT  466

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQTPGLNIITEY+MG++ PG+PIANVCFKTYGY+SM+QAI+FL+DFKLGHYMKIPPRSMF
Sbjct  467   NQTPGLNIITEYLMGVLLPGRPIANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPRSMF  526

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGP  1871
             LVQFIGT+IAGT+N+SVAW+LL S+ENIC ++ L  NSPWTCPSDRVFFDASVIWGLVGP
Sbjct  527   LVQFIGTVIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGP  586

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATS  2051
             KRIF   GNY ALNWFFLGG++GPV+VWLL + FP+++WI  INLPVLLGAT +MPPATS
Sbjct  587   KRIFGRLGNYPALNWFFLGGLIGPVLVWLLQKAFPTKTWISQINLPVLLGATAAMPPATS  646

Query  2052  LNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTIS-  2228
             +N++ WI+VG IFN+FVF+Y KKWWQRYNY+LSA LDAG+AFM VLLYF++ +   +I+ 
Sbjct  647   VNFNCWIIVGVIFNYFVFKYCKKWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISINH  706

Query  2229  WWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             WWG    E+C LASCPTA G+ VDGCPVF
Sbjct  707   WWGAKG-ENCPLASCPTAPGVLVDGCPVF  734



>ref|XP_007018304.1| Oligopeptide transporter 2 [Theobroma cacao]
 gb|EOY15529.1| Oligopeptide transporter 2 [Theobroma cacao]
Length=738

 Score =  1028 bits (2659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/749 (69%), Positives = 635/749 (85%), Gaps = 13/749 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             M ++EIE  A  ++   V++++VSP+EEVRLTV+N DD TLPVWTFRMW LG+ SC LLS
Sbjct  1     MSSLEIEYNADVVSA--VDEDDVSPVEEVRLTVSNDDDTTLPVWTFRMWFLGLFSCCLLS  58

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLN FFSYR EPL +T I++QVA+LP G+F+A  LP  KF+IPGFG+ +F+LNPGPFN+K
Sbjct  59    FLNTFFSYRTEPLQVTMISIQVASLPAGKFLARVLPTTKFKIPGFGNREFTLNPGPFNVK  118

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI+IFANAG AFG G+AYA+GIVNII AFY +KISF A W+L+ITTQVLGYGWAG++
Sbjct  119   EHVLISIFANAGAAFGGGTAYAIGIVNIIRAFYHKKISFLASWILVITTQVLGYGWAGIM  178

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             +K+VVEPA MWWPS+LVQ+SLFR +HEK+ +        MSR KFF+I+L CSF WY FP
Sbjct  179   RKFVVEPAQMWWPSSLVQVSLFRAMHEKDSKR-------MSRGKFFLIALICSFSWYVFP  231

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
             GY+F TL++ISWVCW FPKSVTA Q+GSG++G+G+G+  +DWS IASFL SPLV PFFAI
Sbjct  232   GYLFPTLSAISWVCWAFPKSVTAQQIGSGMDGIGIGSFAIDWSVIASFLGSPLVTPFFAI  291

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
             VN+FVGYA+ MY+++PI+YWG+NVYNAK FP++SS LF  +G+ Y++S IVN +FE++  
Sbjct  292   VNIFVGYALFMYIILPIAYWGVNVYNAKNFPIFSSHLFNHKGEPYNVSGIVNDKFEIELP  351

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
              Y +QGR+ LS FFSL+YG GFA I +T++HVA+F G+EIY + +AS KGK DIHTKLMK
Sbjct  352   AYEQQGRVNLSVFFSLTYGIGFAAIIATLSHVAVFNGKEIYAQLQASFKGKEDIHTKLMK  411

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
              YK+IP+WWF+++LV+T+ +SL +CIFL  E+QMP+WGLIFAA LA  FTLPISIITATT
Sbjct  412   KYKNIPNWWFHLMLVLTLLLSLVMCIFLKREIQMPWWGLIFAAGLALAFTLPISIITATT  471

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQ+PGLN+ITEYIMG I PGKPIANVCFKTYGY+SM QA++FL+DFKLGHYMKIPPRSMF
Sbjct  472   NQSPGLNVITEYIMGYILPGKPIANVCFKTYGYISMAQAVSFLNDFKLGHYMKIPPRSMF  531

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVG  1868
             +VQ +GT+IAGTIN++VAWWLL ++ENIC QD+L   NSPWTCP DRVF+DASVIWGLVG
Sbjct  532   VVQAMGTIIAGTINLAVAWWLLTTVENIC-QDQLLPPNSPWTCPGDRVFYDASVIWGLVG  590

Query  1869  PKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPAT  2048
             PKRIF   GNY ALNWFFLGG LGPV+VWL H+ FP+Q WI LINLPVLLGAT +MPPAT
Sbjct  591   PKRIFGPLGNYAALNWFFLGGALGPVVVWLFHKAFPNQKWISLINLPVLLGATAAMPPAT  650

Query  2049  SLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTIS  2228
             SLN++ WI+VG IFN++VF+YRK WWQRYNY+LSA LDAG+AFM VLLYFT+ ++  +IS
Sbjct  651   SLNFNCWIIVGVIFNYYVFKYRKGWWQRYNYVLSAALDAGLAFMGVLLYFTLTMQGISIS  710

Query  2229  WWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             WWG  + EHCDLASCPTAKGI VDGCPV+
Sbjct  711   WWG-AEGEHCDLASCPTAKGIVVDGCPVY  738



>gb|ABE65610.1| oligopeptide transporter OPT family protein [Arabidopsis thaliana]
Length=734

 Score =  1027 bits (2656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/749 (68%), Positives = 625/749 (83%), Gaps = 17/749 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             M  +E+  P  ++  +D +DE  SP+E+VRLTV+N DDP+LPVWTFRMW LG++SC+LLS
Sbjct  1     MAAIELHKP--EINADDDDDE--SPVEQVRLTVSNHDDPSLPVWTFRMWFLGLLSCILLS  56

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLN FF YR +PL+IT I+VQV TLP+G+ MA  LP  K++I   GS +FS NPGPFN+K
Sbjct  57    FLNTFFGYRTQPLMITMISVQVVTLPLGKLMARVLPETKYKI---GSWEFSFNPGPFNVK  113

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI++FANAG  FG+G+AYAVGIV+II+AFY+RKISF A W+L+ITTQ+LGYGWAG++
Sbjct  114   EHVLISMFANAGAGFGSGTAYAVGIVDIIMAFYKRKISFLASWILVITTQILGYGWAGIM  173

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             +K VV+PA MWWP++++Q+SLFR LHEK+          MSR KFFVI+  CSF WY FP
Sbjct  174   RKLVVDPAQMWWPTSVLQVSLFRALHEKDNAR-------MSRGKFFVIAFVCSFAWYIFP  226

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
              Y+F TL+SISWVCW FPKS+TA QLGSG++GLG+GA  LDWS IAS+L SPLV PFFAI
Sbjct  227   AYLFLTLSSISWVCWAFPKSITAQQLGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAI  286

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
             VNV VGY ++MY+V+PISYWG+NVY A  FP++SSDLF  QGQ Y+IS IVN +FELD +
Sbjct  287   VNVLVGYVLVMYMVIPISYWGMNVYEANKFPIFSSDLFDKQGQLYNISTIVNNKFELDME  346

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
              Y +QGR+YLSTFF++SYG GFA I ST+THVALF G+ I+ + RASTK KMDIHT+LMK
Sbjct  347   NYQQQGRVYLSTFFAISYGIGFAAIVSTLTHVALFNGKGIWQQVRASTKAKMDIHTRLMK  406

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
              YKDIP WWFY LL +++ +SL LCIF+ DE+QMP+WGL+ A+ +A  F +P+SIITATT
Sbjct  407   KYKDIPGWWFYSLLAISLVLSLVLCIFMKDEIQMPWWGLLLASFMALTFIVPVSIITATT  466

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQTPGLNIITEY+MG++ PG+PIANVCFKTYGY+SM+QAI+FL+DFKLGHYMKIPPRSMF
Sbjct  467   NQTPGLNIITEYLMGVLLPGRPIANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPRSMF  526

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGP  1871
             LVQFIGT+IAGT+N+SVAW+LL S+ENIC ++ L  NSPWTCPSDRVFFDASVIWGLVGP
Sbjct  527   LVQFIGTVIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGP  586

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATS  2051
             KRIF   GNY ALNWFFLGG++GPV+VWLL + FP+++WI  INLPVLLGAT +MPPATS
Sbjct  587   KRIFGRLGNYPALNWFFLGGLIGPVLVWLLQKAFPTKTWISQINLPVLLGATAAMPPATS  646

Query  2052  LNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTIS-  2228
             +N++ WI+VG IFN+FVF+Y KKWWQRYNY+LSA LDAG+AFM VLLYF++ +   +I+ 
Sbjct  647   VNFNCWIIVGVIFNYFVFKYCKKWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISINH  706

Query  2229  WWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             WWG    E+C LASCPTA G+ VDGCPVF
Sbjct  707   WWGAKG-ENCPLASCPTAPGVLVDGCPVF  734



>ref|XP_003570148.1| PREDICTED: oligopeptide transporter 4-like [Brachypodium distachyon]
Length=753

 Score =  1026 bits (2653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/756 (70%), Positives = 626/756 (83%), Gaps = 13/756 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLA---GEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCV  245
             MG +  +   L  A   GE+  +EE SPIEEVRLTV + DD +LPVWTFRMW +G+VSC 
Sbjct  1     MGEIAADERGLGAAVGKGEEEEEEETSPIEEVRLTVPSGDDASLPVWTFRMWSIGLVSCA  60

Query  246   LLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGF-GSGQFSLNPGP  422
             L+SFLNQFFSYR EPLI+T ITVQVA+LP+G F+A  LPA KF +P   G G++SLNPGP
Sbjct  61    LMSFLNQFFSYRTEPLIVTQITVQVASLPMGHFLARVLPARKFPVPALLGGGEWSLNPGP  120

Query  423   FNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGW  602
             FNMKEHVLI+IFANAG+AFGNG+AYAV IV+II AFYRR ISF A WLLI+TTQVLGYGW
Sbjct  121   FNMKEHVLISIFANAGYAFGNGNAYAVMIVDIIRAFYRRSISFVAAWLLIMTTQVLGYGW  180

Query  603   AGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCW  782
             AGL++KYVVEPAHMWWP TLVQ+SLFR LHEKEE   G  +  +SR+KFF+++L CSF W
Sbjct  181   AGLMRKYVVEPAHMWWPGTLVQVSLFRALHEKEEFPRGSRQ--ISRSKFFLVALICSFGW  238

Query  783   YFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCP  962
             Y  PGY+F +L SISWVCWVF KSVTA QLGSG+ GLGLGA TLDWS ++SFL SPL+ P
Sbjct  239   YAVPGYLFPSLTSISWVCWVFSKSVTAQQLGSGMKGLGLGAFTLDWSAVSSFLFSPLISP  298

Query  963   FFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFE  1142
             FFA  N+FVGY + +Y+++P +YWG+N+YNAK FP++SS LFT+ G  Y I+ IVN+QF+
Sbjct  299   FFATANIFVGYVMFLYVIVPTAYWGVNLYNAKTFPIFSSHLFTSNGSAYQINDIVNQQFQ  358

Query  1143  LDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHT  1322
             LD D Y K GRI +STFF+LSYG  FATIASTITHV +FYG+EIY R+RAS +   DIHT
Sbjct  359   LDRDAYDKIGRINISTFFALSYGLSFATIASTITHVGIFYGKEIYQRFRASQQQDPDIHT  418

Query  1323  KLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISII  1502
             KLM+ Y+DIP+WWFY LL++++ VSL LC  LND+VQ+PYWGL+ A  +AF+FTLPISII
Sbjct  419   KLMRKYEDIPAWWFYSLLLLSMTVSLILCTVLNDQVQLPYWGLLLACGMAFVFTLPISII  478

Query  1503  TATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPP  1682
             TATTNQTPGLN+ITEY MG+I PG PIANVCFK YGYMSM+QAIAFLSDFKLGHYMKIPP
Sbjct  479   TATTNQTPGLNVITEYAMGLIRPGYPIANVCFKVYGYMSMSQAIAFLSDFKLGHYMKIPP  538

Query  1683  RSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIW  1856
             RSMFLVQF+GTL+AGT+N+SVAWWLL SIENIC QD L   +SPWTCP DRVFFDASVIW
Sbjct  539   RSMFLVQFVGTLVAGTVNLSVAWWLLGSIENIC-QDTLLPPDSPWTCPGDRVFFDASVIW  597

Query  1857  GLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSM  2036
             GLVGP RIF   GNY ALN FFL G  GPVIV++ HR FP+Q WI LINLPVL+GAT SM
Sbjct  598   GLVGPMRIFGPRGNYEALNLFFLIGAAGPVIVYVFHRIFPNQKWILLINLPVLIGATASM  657

Query  2037  PPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLED  2216
             PPAT++NY++W+L+GT FNFFVFRYRKKWWQRYNYILSA LDAGVAFMAVLLYFT+ +E+
Sbjct  658   PPATAVNYNAWLLIGTFFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTLSMEN  717

Query  2217  RTISWWGTTDLEHCDLASCPTAKGIAVDG---CPVF  2315
             R+I WWGT   EHC LA+CPTAKG+ +     CPVF
Sbjct  718   RSIDWWGTAG-EHCPLATCPTAKGVDLGPDSLCPVF  752



>ref|XP_002892535.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68794.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata]
Length=734

 Score =  1026 bits (2653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/749 (67%), Positives = 625/749 (83%), Gaps = 17/749 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             M  +E+  P +       +DE+ SP+EEVRLTV+N DDP+LPVWTFRMW LG++SC+LLS
Sbjct  1     MAAIELHKPEINAD----DDEDESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCILLS  56

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLN FF YR +PL+IT I+VQV TLP+G+ MA  LP  K++I   GS +FS NPGPFN+K
Sbjct  57    FLNTFFGYRTQPLMITMISVQVVTLPLGKLMARVLPETKYKI---GSWEFSFNPGPFNVK  113

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI++FANAG  FG+G+AYAVGIV+II+AFY+RKISF A W+L+ITTQ+LGYGWAG++
Sbjct  114   EHVLISMFANAGAGFGSGTAYAVGIVDIIMAFYKRKISFLASWILVITTQILGYGWAGIM  173

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             +K VV+PA MWWP++++Q+SLFR LHEK+          MSR KFFVI+  CSF WY FP
Sbjct  174   RKLVVDPAQMWWPTSVLQVSLFRALHEKDHAR-------MSRGKFFVIAFVCSFAWYIFP  226

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
              Y+F TL+SISWVCW FPKS+TA QLGSG++GLG+GA  LDWS IAS+L SPLV PFFAI
Sbjct  227   AYLFLTLSSISWVCWAFPKSITAQQLGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAI  286

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
             VNV VGY ++MY+V+PISYWG+NVY A  FP++SSDLF  QGQ Y+IS IVN +FELD +
Sbjct  287   VNVLVGYVLVMYMVIPISYWGMNVYEAHKFPIFSSDLFDKQGQLYNISTIVNNKFELDME  346

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
              Y ++GR+YLSTFF++SYG GFA I ST+THVALF G+ I+ + RASTK K+DIHT+LMK
Sbjct  347   SYQQEGRVYLSTFFAISYGIGFAAIVSTLTHVALFNGKGIWQQVRASTKAKVDIHTRLMK  406

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
              YKDIPSWWFY LL +++ +SL LCIF+ DE+QMP+WGL+ A+ +A  FT+P+SIITATT
Sbjct  407   KYKDIPSWWFYGLLAISLVLSLVLCIFMKDEIQMPWWGLLLASFMAVTFTVPVSIITATT  466

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQTPGLNIITEY+MG++ PG+PIANVCFKTYGY+SM+QAI+FL+DFKLGHYMKIPPRSMF
Sbjct  467   NQTPGLNIITEYLMGVLLPGRPIANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPRSMF  526

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGP  1871
             LVQFIGT+IAGT+N+SVAW+LL S+ENIC ++ L  NSPWTCPSDRVFFDASVIWGLVGP
Sbjct  527   LVQFIGTVIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGP  586

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATS  2051
             KRIF   GNY ALNWFFLGG++GP++VWLL + FP+++WI  INLPVLLGAT +MPPATS
Sbjct  587   KRIFGRLGNYPALNWFFLGGLIGPLLVWLLQKAFPTKTWISQINLPVLLGATAAMPPATS  646

Query  2052  LNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTIS-  2228
             +N++ WI+VG IFN+FVF++ KKWWQRYNY+LSA LDAG+AFM VLLYF++ +  ++I  
Sbjct  647   VNFNCWIIVGVIFNYFVFKHCKKWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGKSIEH  706

Query  2229  WWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             WWG    E+C LASCPTA GI V+GCPVF
Sbjct  707   WWGAKG-ENCPLASCPTAPGIHVEGCPVF  734



>ref|XP_010104576.1| Oligopeptide transporter 2 [Morus notabilis]
 gb|EXC01177.1| Oligopeptide transporter 2 [Morus notabilis]
Length=724

 Score =  1025 bits (2651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/747 (70%), Positives = 623/747 (83%), Gaps = 29/747 (4%)
 Frame = +3

Query  81    TVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFL  260
             T E+E+ A+     D ND+ VSPIEEVRLTV+N DDP+LPVWTFRMW LG+VSCVLLSFL
Sbjct  5     TFELESGAV-----DENDD-VSPIEEVRLTVSNDDDPSLPVWTFRMWSLGLVSCVLLSFL  58

Query  261   NQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEH  440
             N FF YR EPL+I+ I+VQVATLPIGRFM   LP   FR+PG G  + SLNPGPFN KEH
Sbjct  59    NTFFMYRTEPLVISMISVQVATLPIGRFMERVLPTTPFRLPGLG--KVSLNPGPFNTKEH  116

Query  441   VLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKK  620
             VLI+IFANAG AFG G+AYA+ IV+II AFY R ISF+A W+L+ITTQVLGYGWAG+L+K
Sbjct  117   VLISIFANAGAAFGGGAAYAISIVDIIKAFYLRNISFWASWVLVITTQVLGYGWAGILRK  176

Query  621   YVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGY  800
             YVV+PA MWWPS+LVQ+SLFR LHEK+ +        MSR KFF+I+L CSF WY  PGY
Sbjct  177   YVVDPAQMWWPSSLVQVSLFRALHEKDNDR-------MSRGKFFLIALVCSFSWYVVPGY  229

Query  801   IFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVN  980
             +F TL++ISWVCW++PKSVTA Q+GSG+ GLG+G+L+LDWS IAS+L SPL+ PFFAIVN
Sbjct  230   LFPTLSTISWVCWLYPKSVTAQQIGSGMRGLGIGSLSLDWSVIASYLGSPLISPFFAIVN  289

Query  981   VFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEY  1160
             V  GY I M++++PI+YWG+N+YNAK FP++SS LF A GQ Y++SAIVN QFE+D++ Y
Sbjct  290   VAFGYIITMFIMLPIAYWGVNLYNAKNFPIFSSHLFDAHGQIYNVSAIVNNQFEIDQEAY  349

Query  1161  AKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNY  1340
              +QGRI LS FFSLSYG GFA I ST+THVALF GREIY ++RAS   K DIHT+LMK Y
Sbjct  350   QRQGRINLSVFFSLSYGIGFAAIVSTLTHVALFNGREIYTQFRASYNTKEDIHTRLMKKY  409

Query  1341  KDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQ  1520
             +DIPSWWF+ +LVV+I +SLALCIF  DE+QMP+WGLIFAA LA  FTLP          
Sbjct  410   RDIPSWWFHSMLVVSIILSLALCIFKKDEIQMPWWGLIFAAGLALTFTLP----------  459

Query  1521  TPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLV  1700
             TPGLNIITEYIMG+I PGKPIANVCFKTYGY+SM QA++FL+DFKLGHYMKIPP SMF+V
Sbjct  460   TPGLNIITEYIMGVILPGKPIANVCFKTYGYISMAQAVSFLNDFKLGHYMKIPPISMFVV  519

Query  1701  QFIGTLIAGTINMSVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVGPK  1874
             Q +GT+IAGT+N+ VAWWLLH++ENIC QD+L   NSPWTCP DRVFFDASVIWGLVGPK
Sbjct  520   QCVGTIIAGTVNIGVAWWLLHTVENIC-QDQLLPPNSPWTCPGDRVFFDASVIWGLVGPK  578

Query  1875  RIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSL  2054
             RIF SEGNY+ LNWFFL G++GP++VWLLH+ FPSQ WI  +NLPVL GAT  MPPAT++
Sbjct  579   RIFGSEGNYSQLNWFFLIGVMGPLLVWLLHKAFPSQKWIKFVNLPVLFGATAVMPPATTV  638

Query  2055  NYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWW  2234
             N++ WI+VGT+FNFFVFRYRK+WWQ+YNY+LSA LDAG+AFM V+LYFT+ +EDR++SWW
Sbjct  639   NFNCWIIVGTVFNFFVFRYRKQWWQKYNYVLSAALDAGLAFMGVVLYFTLTMEDRSLSWW  698

Query  2235  GTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             G  D EHC+LA+CPTAKGI VDGCPVF
Sbjct  699   G-ADGEHCELATCPTAKGIVVDGCPVF  724



>ref|XP_010553673.1| PREDICTED: oligopeptide transporter 2 [Tarenaya hassleriana]
Length=734

 Score =  1024 bits (2648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/748 (67%), Positives = 623/748 (83%), Gaps = 15/748 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             M  +E++ P +    E+  D + SP+EEVRLTV N DDP+LPVWTFRMW LG+ SCVLLS
Sbjct  1     MAALELQKPVID---EEEGDNDESPVEEVRLTVPNHDDPSLPVWTFRMWFLGLFSCVLLS  57

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLN FF YR +PL+I+ I++QV TLPIG+ MA  LP  KFR+   GS +FSLNPGPFN+K
Sbjct  58    FLNTFFGYRTQPLMISMISIQVVTLPIGKMMARVLPDKKFRV---GSFEFSLNPGPFNVK  114

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI++FANAG  +G+G+AYAVGIV+II AFY+R ISF A WLL+ITTQVLGYGWAG++
Sbjct  115   EHVLISMFANAGAGYGSGTAYAVGIVDIIKAFYKRNISFLASWLLVITTQVLGYGWAGIM  174

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             ++ +VEPA MWWPS+L+Q+SLFR LHEK+ +        MSR KFF+I+  CSF WY FP
Sbjct  175   RRLLVEPAQMWWPSSLLQVSLFRALHEKDTQR-------MSRGKFFLIAFLCSFAWYIFP  227

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
             GY+F TL++ISWVCWVFPKSVTA Q+GSG++GLGLGA  LDWS IAS+L SPL+ PFFAI
Sbjct  228   GYLFPTLSAISWVCWVFPKSVTAQQIGSGMSGLGLGAFALDWSVIASYLGSPLISPFFAI  287

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
             VNV VGY ++MY+ +PI+YWG+N+Y+AK FP++SSDLF ++GQ Y+ SAIVN +FELD  
Sbjct  288   VNVIVGYVLVMYMFIPIAYWGVNMYDAKKFPIFSSDLFDSKGQLYNTSAIVNDEFELDIP  347

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
              Y ++GR+YLSTFFSL+YG GFA I ST+THVALF G+ I  + RAS   K+DIHT+LM+
Sbjct  348   SYGREGRVYLSTFFSLTYGIGFAAIVSTLTHVALFNGKGILQQLRASASDKVDIHTRLMR  407

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
              YKDIPSWWF+ LL+ ++A+SL LCIF+ D+VQMP+WGL+ A+ +A  FT+P+SIITATT
Sbjct  408   KYKDIPSWWFHSLLIGSLALSLVLCIFMKDQVQMPWWGLLLASVMAITFTVPVSIITATT  467

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQTPGLNIITEY+MG++ PG+PIANVCFKTYGY+SM+QAI FL+DFKLGHYMKIPPRSMF
Sbjct  468   NQTPGLNIITEYLMGVLLPGRPIANVCFKTYGYISMSQAITFLNDFKLGHYMKIPPRSMF  527

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGP  1871
             LVQFIGT+IAGT+N+SVAW+LL ++ENIC ++ L  NSPWTCP DRVFFDASVIWGLVGP
Sbjct  528   LVQFIGTIIAGTVNVSVAWYLLTTVENICQKELLPPNSPWTCPGDRVFFDASVIWGLVGP  587

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATS  2051
             +RIF + GNY  LNWFFL G LGP+IVW+LH+ FP+Q WI  INLPVLLG+T +MPPATS
Sbjct  588   RRIFGNLGNYPELNWFFLFGALGPLIVWILHKAFPNQKWISQINLPVLLGSTAAMPPATS  647

Query  2052  LNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISW  2231
             +N++ WI++G IFN+FVF+YRK WWQRYNY+LSA LDAG+AFM VLLYFT+ + D +ISW
Sbjct  648   VNFNCWIIIGVIFNYFVFKYRKSWWQRYNYVLSAALDAGLAFMGVLLYFTLSMNDISISW  707

Query  2232  WGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             WG+   E+C LASCPTA+G+ V+GCP F
Sbjct  708   WGSNG-ENCPLASCPTAEGVEVEGCPAF  734



>ref|XP_007225210.1| hypothetical protein PRUPE_ppa002011mg [Prunus persica]
 gb|EMJ26409.1| hypothetical protein PRUPE_ppa002011mg [Prunus persica]
Length=729

 Score =  1024 bits (2648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/745 (70%), Positives = 631/745 (85%), Gaps = 19/745 (3%)
 Frame = +3

Query  90    IEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQF  269
             + AP L      + D++VSP+EEVRLTV+N DDPTLPVWTFRMW LG++SCVLLSFLN F
Sbjct  1     MSAPTL----HSLPDDDVSPVEEVRLTVSNDDDPTLPVWTFRMWALGLLSCVLLSFLNTF  56

Query  270   FSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLI  449
             F+YR EPL+I+ I+VQVATLPIGRFMA  LP  KFR+   G  +FSLNPGPFNMKEHVLI
Sbjct  57    FAYRTEPLVISMISVQVATLPIGRFMARTLPTKKFRV---GLREFSLNPGPFNMKEHVLI  113

Query  450   TIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVV  629
             +IFANAG  FG+G+AYA+ IVNII AFY R ISF+A W+L+ITTQVLGYGWAG+L+KYVV
Sbjct  114   SIFANAGAGFGSGAAYAISIVNIIKAFYHRNISFWASWILVITTQVLGYGWAGILRKYVV  173

Query  630   EPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQ  809
             +PA MWWPS+LVQ+SLFR LHEK+ +        MSR KFF+I+L CSF W+  PGY+F 
Sbjct  174   DPAEMWWPSSLVQVSLFRALHEKDSKR-------MSRGKFFLIALICSFSWFVVPGYLFP  226

Query  810   TLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFV  989
             TL++ISWVCWV+P SVTA Q+GSG+ GLGLGA +LDW+ IAS+L SPL+ PFFAIVNV  
Sbjct  227   TLSTISWVCWVYPNSVTAQQIGSGMRGLGLGAFSLDWTVIASYLGSPLISPFFAIVNVAA  286

Query  990   GYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQ  1169
             GY ++MY+ +PI+YWG+N+Y+AK FP++SS LF  +GQ Y++SAIVN +FE+D D Y KQ
Sbjct  287   GYLLVMYVGLPIAYWGVNLYSAKNFPIFSSHLFDHRGQIYNVSAIVNDKFEIDMDSYDKQ  346

Query  1170  GRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYR-ASTKGKMDIHTKLMKNYKD  1346
             GRI LS FF+L+YG GFA + ST+THVALF GREIY +YR AS  GK+DIHT+LMK YKD
Sbjct  347   GRINLSVFFALTYGIGFAAVVSTLTHVALFNGREIYKQYRRASHSGKVDIHTRLMKKYKD  406

Query  1347  IPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTP  1526
             IP WWF+++L++++ +SLALC+F+ DEVQMP+WGLIFAA LA +FTLPISIITATTNQ+P
Sbjct  407   IPKWWFHLMLLLSLVLSLALCVFMKDEVQMPWWGLIFAAGLALIFTLPISIITATTNQSP  466

Query  1527  GLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQF  1706
             GLN+ITEYIMG+I PGKPIANVCFKTYGY+SM+QAI+FL+DFKLGHYMKIPP SMF+VQ 
Sbjct  467   GLNVITEYIMGLILPGKPIANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPISMFIVQC  526

Query  1707  IGTLIAGTINMSVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVGPKRI  1880
             IGTLIAGT+N+ VAWWLL +IENIC QD+L   NSPWTCP DRVFFDASVIWGLVGP+RI
Sbjct  527   IGTLIAGTVNLGVAWWLLSTIENIC-QDQLLPPNSPWTCPGDRVFFDASVIWGLVGPRRI  585

Query  1881  FDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNY  2060
             F S GNY ALNWFFL G  GP++VWLLH+ FPS+ WI LINLPVLLGAT  MPPAT++N+
Sbjct  586   FGSLGNYKALNWFFLIGASGPLLVWLLHKAFPSKKWIKLINLPVLLGATAVMPPATTVNF  645

Query  2061  SSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGT  2240
             + WI+VG IFNFFVFRYRKKWWQRYNY+LSA LDAGVAFM VLLYF++ + +++ISWWGT
Sbjct  646   NCWIVVGAIFNFFVFRYRKKWWQRYNYVLSAALDAGVAFMGVLLYFSLTMNEKSISWWGT  705

Query  2241  TDLEHCDLASCPTAKGIAVDGCPVF  2315
                EHC+LA+CPTAKGI VDGCP++
Sbjct  706   NG-EHCELATCPTAKGIVVDGCPLY  729



>ref|XP_008219191.1| PREDICTED: oligopeptide transporter 2-like [Prunus mume]
Length=729

 Score =  1024 bits (2647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/745 (70%), Positives = 631/745 (85%), Gaps = 19/745 (3%)
 Frame = +3

Query  90    IEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQF  269
             + AP L      + D++ SP+EEVRLTV+N DDPTLPVWTFRMW LG++SCVLLSFLN F
Sbjct  1     MSAPTL----HSLPDDDASPVEEVRLTVSNDDDPTLPVWTFRMWALGLLSCVLLSFLNTF  56

Query  270   FSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLI  449
             F+YR EPL+I+ I+VQVATLPIGRFMA  LP  KFR+   GS +FSLNPGPFNMKEHVLI
Sbjct  57    FAYRTEPLVISMISVQVATLPIGRFMARTLPTKKFRV---GSREFSLNPGPFNMKEHVLI  113

Query  450   TIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVV  629
             +IFANAG  FG+G+AYA+ IVNII AFY R ISF+A W+L+ITTQVLGYGWAG+L+KYVV
Sbjct  114   SIFANAGAGFGSGAAYAISIVNIIKAFYHRNISFWASWILVITTQVLGYGWAGILRKYVV  173

Query  630   EPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQ  809
             +PA MWWPS+LVQ+SLFR LHEK+ +        MSR KFF+I+L CSF W   PGY+F 
Sbjct  174   DPAEMWWPSSLVQVSLFRALHEKDSKR-------MSRGKFFLIALICSFSWSVVPGYLFP  226

Query  810   TLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFV  989
             TL++ISWVCWV+P SVTA Q+GSG+ GLGLGA +LDW+ IAS+L SPL+ PFFAIVNV  
Sbjct  227   TLSTISWVCWVYPNSVTAQQIGSGMRGLGLGAFSLDWTVIASYLGSPLISPFFAIVNVAA  286

Query  990   GYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQ  1169
             GY ++MY+ +PI+YWG+N+Y+AK FP++SS LF  +GQ Y++SAIVN +FE+D   Y KQ
Sbjct  287   GYLLVMYVGLPIAYWGVNLYSAKNFPIFSSHLFDHRGQIYNVSAIVNDKFEIDMASYDKQ  346

Query  1170  GRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRY-RASTKGKMDIHTKLMKNYKD  1346
             GRI LS FF+L+YG GFA + ST+THVALF GREIY +Y RAS  GK+DIHT+LMK YKD
Sbjct  347   GRINLSVFFALTYGIGFAAVVSTLTHVALFNGREIYKQYQRASHSGKVDIHTRLMKKYKD  406

Query  1347  IPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTP  1526
             IP+WWF+++L++++ +SLALCIF+ DEVQMP+WGLIFAA LA +FTLPISIITATTNQ+P
Sbjct  407   IPNWWFHLMLLLSLVLSLALCIFMKDEVQMPWWGLIFAAGLALVFTLPISIITATTNQSP  466

Query  1527  GLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQF  1706
             GLN+ITEYIMG+I PGKPIANVCFKTYGY+SM+QAI+FL+DFKLGHYMKIPP SMF+VQ 
Sbjct  467   GLNVITEYIMGLILPGKPIANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPISMFIVQC  526

Query  1707  IGTLIAGTINMSVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVGPKRI  1880
             IGTLIAGT+N+ VAWWLL +IENIC QD+L   NSPWTCP DRVFFDASVIWGLVGP+RI
Sbjct  527   IGTLIAGTVNVGVAWWLLSTIENIC-QDQLLPPNSPWTCPGDRVFFDASVIWGLVGPRRI  585

Query  1881  FDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNY  2060
             F S GNY ALNWFFL G LGP++VWLLH+ FPS+ WI LINLPVLLGAT  MPPAT++N+
Sbjct  586   FGSLGNYKALNWFFLIGALGPLLVWLLHKAFPSKKWIKLINLPVLLGATAVMPPATTVNF  645

Query  2061  SSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGT  2240
             + WI+VG IFNFFVFRYRKKWWQRYNY+LSA LDAGVAFM VLLYF++ + +++ISWWGT
Sbjct  646   NCWIVVGAIFNFFVFRYRKKWWQRYNYVLSAALDAGVAFMGVLLYFSLTMNEKSISWWGT  705

Query  2241  TDLEHCDLASCPTAKGIAVDGCPVF  2315
                EHC+LA+CPTAKGI VDGCPV+
Sbjct  706   NG-EHCELATCPTAKGIVVDGCPVY  729



>dbj|BAJ90957.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=749

 Score =  1024 bits (2647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/729 (72%), Positives = 611/729 (84%), Gaps = 11/729 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIEEVRLTV   DDPTLPVWTFRMW +G++SC L+SFLNQFFSYR EPLI+T ITVQVA
Sbjct  27    SPIEEVRLTVPPGDDPTLPVWTFRMWSIGLLSCALMSFLNQFFSYRTEPLIVTQITVQVA  86

Query  324   TLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
             +LP+G F+A  LP   FR PG   G++SLNPGPFNMKEHVLI+IFANAG+AFGNG+AYAV
Sbjct  87    SLPMGHFLARVLPRRTFRAPG--GGEWSLNPGPFNMKEHVLISIFANAGYAFGNGNAYAV  144

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFR  683
              IV+II AFY R ISF A WLLI TTQVLGYGWAGL++KYVVEPAHMWWPSTLVQ+SLFR
Sbjct  145   MIVDIIRAFYGRSISFIAAWLLITTTQVLGYGWAGLMRKYVVEPAHMWWPSTLVQVSLFR  204

Query  684   TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTA  863
              LHEKEE   G  +  +SR+KFF+ +L CSF WY  PGY+F  L SISWVCWVF KSVTA
Sbjct  205   ALHEKEESSKGSRQ--ISRSKFFLAALICSFAWYVVPGYLFPALTSISWVCWVFSKSVTA  262

Query  864   HQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLN  1043
              QLGSG+ GLGLGA TLDWS ++SFL SPL+ PFFA  N+FVGY   +Y+++P +YWG+N
Sbjct  263   QQLGSGMKGLGLGAFTLDWSAVSSFLFSPLISPFFATANIFVGYVCFLYVLVPTAYWGMN  322

Query  1044  VYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFA  1223
             +YNAK FP++SS LF + G  Y I+ IVN+QF+LD + YA+ GRI LSTFF+LSYG  FA
Sbjct  323   LYNAKTFPIFSSHLFMSNGSAYQITDIVNQQFQLDTEAYARLGRINLSTFFALSYGLSFA  382

Query  1224  TIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLA  1403
             TIASTITHV +FYG+EIY R+RAS + + DIHTKLM+ Y DIP+WWFY L V+++ VSL 
Sbjct  383   TIASTITHVGIFYGKEIYQRFRASQQEEPDIHTKLMRKYDDIPAWWFYSLTVLSMTVSLI  442

Query  1404  LCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPI  1583
             LC  L D+VQ+P+WGL+FA  +AF+FTLPISIITATTNQTPGLN+ITEY MG+I PG PI
Sbjct  443   LCTVLKDQVQLPWWGLLFACGMAFVFTLPISIITATTNQTPGLNVITEYAMGLIMPGYPI  502

Query  1584  ANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLH  1763
             ANVCFK YGYMSM+QA+AFLSDFKLGHYMKIPPRSMF+VQF GTL+AGT+N+SVAWWLL 
Sbjct  503   ANVCFKVYGYMSMSQAVAFLSDFKLGHYMKIPPRSMFIVQFAGTLVAGTVNLSVAWWLLG  562

Query  1764  SIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
             S+ENIC QD+L   +SPWTCP DRVFFDASVIWGLVGPKRIF S GNY A+NWFFL G  
Sbjct  563   SVENIC-QDQLLPPDSPWTCPGDRVFFDASVIWGLVGPKRIFGSHGNYEAVNWFFLIGAA  621

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
             GPVIV++ HR FP Q WI +INLPVL+GAT +MPPAT++NY+SW+L+GTIFNFFVFRYRK
Sbjct  622   GPVIVYIFHRIFPRQRWILMINLPVLIGATANMPPATAVNYNSWLLIGTIFNFFVFRYRK  681

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV  2297
             KWWQRYNYILSA LDAGVAFMAVLLYFT+ +E+RT++WWGT   EHC LASCPTAKG+ +
Sbjct  682   KWWQRYNYILSAALDAGVAFMAVLLYFTLTMENRTVNWWGTAG-EHCPLASCPTAKGVDL  740

Query  2298  ---DGCPVF  2315
                  CPVF
Sbjct  741   GPDSACPVF  749



>gb|EAY75055.1| hypothetical protein OsI_02950 [Oryza sativa Indica Group]
Length=755

 Score =  1023 bits (2646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/755 (68%), Positives = 622/755 (82%), Gaps = 11/755 (1%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             MG  E       +  E   D++ SPIEEVRLTV  TDDP+LPVWTFRMW LG++SCVL+S
Sbjct  1     MGEGEFVDVERGVVAEGALDDDASPIEEVRLTVPVTDDPSLPVWTFRMWTLGLLSCVLMS  60

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGF-GSGQFSLNPGPFNM  431
             FLNQFFSYR EPLI+T ITVQVA+LP+G  +A  LP  KF+ P   G G+ SLNPGPFNM
Sbjct  61    FLNQFFSYRTEPLIVTQITVQVASLPLGHILARVLPRRKFKAPALLGGGECSLNPGPFNM  120

Query  432   KEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGL  611
             KEHVL++IFANAG AFG+GSAYAV IV+II AFY R IS F  WLLI TTQVLGYGWAGL
Sbjct  121   KEHVLVSIFANAGCAFGSGSAYAVMIVDIIRAFYGRSISLFPAWLLITTTQVLGYGWAGL  180

Query  612   LKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrr---MSRAKFFVISLCCSFCW  782
             +++YVVEPA MWWP TLVQ+SLFR LH K EE++         MS+AKFF+I+L CSF W
Sbjct  181   MRRYVVEPAQMWWPGTLVQVSLFRALHGKGEEKEENKEGSGGGMSQAKFFLIALACSFLW  240

Query  783   YFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCP  962
             Y  PGY+F TL S+SWVCW+F KSVTA QLGSG+ GLGLGA TLDW+ +++FL SPL+ P
Sbjct  241   YAVPGYLFPTLTSVSWVCWIFSKSVTAQQLGSGMKGLGLGAFTLDWTAVSAFLYSPLISP  300

Query  963   FFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFE  1142
             FFA  N+  GY ++MY+V+P+SYWGL++YNA+ FP++SS LFTA G  YDI+AIVN +FE
Sbjct  301   FFATANILAGYVLLMYVVVPVSYWGLDLYNARRFPIFSSHLFTATGSTYDITAIVNDRFE  360

Query  1143  LDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHT  1322
             +D D Y + GRI +STFF+LSYG GFATIA+T+THVALF+G+EIY R+RAS + K D+HT
Sbjct  361   IDMDGYHRMGRINMSTFFALSYGLGFATIAATVTHVALFHGKEIYRRFRASQRDKPDVHT  420

Query  1323  KLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISII  1502
             +LMK+Y+D+PSWWFY +L +++AVSL LC  L   VQ+P+WGL+FA A+AF+FTLPISII
Sbjct  421   RLMKSYRDVPSWWFYAMLALSMAVSLLLCTVLRSAVQLPWWGLLFACAMAFVFTLPISII  480

Query  1503  TATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPP  1682
             TATTNQTPGLNIITEY++G++ PGKPIANVCFK YGYMSM+QA++FLSDFKLGHYMKIPP
Sbjct  481   TATTNQTPGLNIITEYVIGLMLPGKPIANVCFKAYGYMSMSQAVSFLSDFKLGHYMKIPP  540

Query  1683  RSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIW  1856
             +SMFLVQ +GT++A T+N+ VA+WLL SI NIC QD L  ++SPWTCP+DRVFFDASVIW
Sbjct  541   KSMFLVQLVGTVVASTVNLVVAYWLLGSIPNIC-QDALLPADSPWTCPNDRVFFDASVIW  599

Query  1857  GLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSM  2036
             GLVGP+RIF   GNY A NWFFL G +GPVIV+LLHR FPS++WIP+INLPVL+GAT  M
Sbjct  600   GLVGPRRIFGPLGNYGAFNWFFLAGAVGPVIVYLLHRAFPSKTWIPMINLPVLIGATSYM  659

Query  2037  PPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLED  2216
             PPAT++NY+SW+++G IFNFFVFRYRK WW+RYNYILSA LDAGVAFMAVLLYF++ +E+
Sbjct  660   PPATAVNYNSWLIIGIIFNFFVFRYRKLWWKRYNYILSAALDAGVAFMAVLLYFSLSMEN  719

Query  2217  RTISWWGTTDLEHCDLASCPTAKGIAVDG---CPV  2312
             R+ISWWGT   EHC LASCPTAKGI +     CPV
Sbjct  720   RSISWWGTAG-EHCPLASCPTAKGINLGADSVCPV  753



>ref|XP_008338986.1| PREDICTED: oligopeptide transporter 2-like [Malus domestica]
Length=733

 Score =  1023 bits (2644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/748 (70%), Positives = 628/748 (84%), Gaps = 21/748 (3%)
 Frame = +3

Query  81    TVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFL  260
             T+EIE PA K    D ND  VSP+EEVRLTV+N DDPTLPVWTFRMW LG+ SC LLSFL
Sbjct  4     TLEIE-PATK---HDEND--VSPVEEVRLTVSNDDDPTLPVWTFRMWTLGLASCALLSFL  57

Query  261   NQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEH  440
             N FFSYR EPL I+ I+VQVATLPIGRFMA  LP  KF+I   G  +FSLNPGPFNMKEH
Sbjct  58    NTFFSYRTEPLXISXISVQVATLPIGRFMARXLPKRKFQI---GXKEFSLNPGPFNMKEH  114

Query  441   VLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKK  620
             VLI+IFANAG  FG+G+AYA+ IV+II AFY RKISF A W+L+ITTQVLGYGWAG+L++
Sbjct  115   VLISIFANAGSGFGSGTAYAISIVDIIKAFYHRKISFLASWILVITTQVLGYGWAGILRR  174

Query  621   YVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGY  800
             YVV+PA MWWPS+LVQ+SLFR LHEK+          MSR KFF I+L CSF W+  PGY
Sbjct  175   YVVDPAEMWWPSSLVQVSLFRALHEKDNNR-------MSRGKFFFIALXCSFAWFVVPGY  227

Query  801   IFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVN  980
             +F TL++ISWVCW++PKSVTA Q+GSG+ GLG+GA +LDW+ IAS+L SPL+ PFFAIVN
Sbjct  228   LFPTLSTISWVCWIYPKSVTAQQIGSGMGGLGIGAFSLDWTVIASYLYSPLISPFFAIVN  287

Query  981   VFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEY  1160
             V  GY ++MY+++PI+YWG+N+YNAK F ++SS LF A GQ Y++SA+VN +FE+D   Y
Sbjct  288   VAAGYVLVMYMLLPIAYWGVNLYNAKNFAIFSSHLFDAGGQIYNVSALVNNKFEIDMPAY  347

Query  1161  AKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRY-RASTKGKMDIHTKLMKN  1337
              +QGRI LS FFSL+YG GFA++ ST+THVALF GREIY +Y RAS   K+DIHT+LM+ 
Sbjct  348   ERQGRINLSXFFSLTYGIGFASVVSTLTHVALFNGREIYKQYXRASQSVKVDIHTRLMRK  407

Query  1338  YKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTN  1517
             YKDIP+WWF+++L+V++ +SL +CIF+ D+VQ P+WGL FAA LA +FTLPISIITATTN
Sbjct  408   YKDIPNWWFHLMLLVSLVLSLVMCIFMKDQVQXPWWGLXFAAGLALVFTLPISIITATTN  467

Query  1518  QTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFL  1697
             Q+PGLNIITEYIMG+I PGKPIANVCFKTYGY+SM+QAI+FL+DFKLGHYMKIPP SMF+
Sbjct  468   QSPGLNIITEYIMGLILPGKPIANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPISMFI  527

Query  1698  VQFIGTLIAGTINMSVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVGP  1871
             VQ IGT+IAGT+N+ VAW LL SIENIC QD+L   NSPWTCP DRVFFDASVIWGLVGP
Sbjct  528   VQCIGTIIAGTVNIXVAWXLLSSIENIC-QDQLLPPNSPWTCPGDRVFFDASVIWGLVGP  586

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATS  2051
             KRIF S GNY ALNWFFL G LGP++VWLLH+ FPSQ WI LINLPVLLGAT +MPPAT+
Sbjct  587   KRIFGSLGNYKALNWFFLIGALGPLLVWLLHKAFPSQKWIKLINLPVLLGATAAMPPATT  646

Query  2052  LNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISW  2231
             +N++ WI+VGTIFN+FVFRYRK+WWQRYNY+LSA LDAGVAFM VLLYF++   +++ISW
Sbjct  647   VNFNCWIVVGTIFNYFVFRYRKQWWQRYNYVLSAALDAGVAFMGVLLYFSLTTYEKSISW  706

Query  2232  WGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             WGT   EHCDLA+CPTAKGI VDGCPV+
Sbjct  707   WGTNG-EHCDLATCPTAKGIVVDGCPVY  733



>ref|XP_006417516.1| hypothetical protein EUTSA_v10009349mg [Eutrema salsugineum]
 gb|ESQ35869.1| hypothetical protein EUTSA_v10009349mg [Eutrema salsugineum]
Length=731

 Score =  1021 bits (2641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/740 (68%), Positives = 625/740 (84%), Gaps = 13/740 (2%)
 Frame = +3

Query  102   ALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYR  281
             AL+L   +++DE+ SP+EEVRLTV+N DDP+LPVWTFRMW LG++SCV+LSFLN FF YR
Sbjct  3     ALELHKLEMDDEDESPVEEVRLTVSNDDDPSLPVWTFRMWFLGLISCVMLSFLNTFFGYR  62

Query  282   REPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfa  461
              +PL+I+ I+VQV TLPIG+ MA  LP  K+RI   GS +FS NPGPFN+KEHVLI++FA
Sbjct  63    TQPLMISMISVQVVTLPIGKLMARVLPETKYRI---GSWEFSFNPGPFNVKEHVLISMFA  119

Query  462   nagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAH  641
             NAG  FG+G+AYAVGIV+II+AFY+RKISF A W+L+ITTQ+LGYGWAG+++K VV+PA 
Sbjct  120   NAGAGFGSGTAYAVGIVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQ  179

Query  642   MWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLAS  821
             MWWP++++Q+SLFR LHEK+          MSR KFFVI+  CSF WY FP Y+F TL+S
Sbjct  180   MWWPTSVLQVSLFRALHEKDNAR-------MSRGKFFVIAFVCSFAWYIFPAYLFLTLSS  232

Query  822   ISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAI  1001
             ISWVCW FPKS+TA Q+GSG++GLG+G+L LDWS IAS+L SPLV PFFAIVNV VGY +
Sbjct  233   ISWVCWAFPKSITAQQIGSGMSGLGIGSLALDWSVIASYLGSPLVTPFFAIVNVIVGYVL  292

Query  1002  IMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIY  1181
             IMY+V+PISYWG+NVY A  FP++SSDLF ++GQ Y+IS IVN +FELDE  Y ++GR+Y
Sbjct  293   IMYMVIPISYWGMNVYEANKFPIFSSDLFDSRGQLYNISTIVNDKFELDEGMYQREGRVY  352

Query  1182  LSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWW  1361
             LSTFF+++YG GFA I ST+THVALF G+ I+ + RAST  K+DIHT+LM+ YKDIPSWW
Sbjct  353   LSTFFAITYGIGFAAIVSTLTHVALFNGKGIWQQVRASTSAKVDIHTRLMRKYKDIPSWW  412

Query  1362  FYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNII  1541
             FY LL V++A+SL LC  + +++QMP+WGLI A+ +A +FT+P+SIITATTNQTPGLNII
Sbjct  413   FYSLLGVSLALSLVLCTVMKEQIQMPWWGLILASFMALLFTVPVSIITATTNQTPGLNII  472

Query  1542  TEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLI  1721
             TEY+MG++ PG+PIANVCFKTYGY+SM+QAI+FL+DFKLGHYMKIPPRSMFLVQFIGT+I
Sbjct  473   TEYLMGVLLPGRPIANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPRSMFLVQFIGTVI  532

Query  1722  AGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGN  1898
             AGT+N+SVAW+LL S+ENIC ++ L  NSPWTCPSDRVFFDASVIWGLVGPKRIF   GN
Sbjct  533   AGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGN  592

Query  1899  YNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILV  2078
             Y ALNWFFLGG++GP++VWLL R FP+++WI  INLPVLLGAT +MPPATS+N++ WI+V
Sbjct  593   YPALNWFFLGGLIGPILVWLLQRAFPTRTWISQINLPVLLGATAAMPPATSVNFNCWIIV  652

Query  2079  GTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTI-SWWGTTDLEH  2255
             G +FN+FVF+  KKWWQRYNY+LSA LDAG+A M VLLYF++ +   +I +WWG+   E+
Sbjct  653   GVVFNYFVFKNYKKWWQRYNYVLSAALDAGLAIMGVLLYFSLTMNGISIGNWWGSNG-EN  711

Query  2256  CDLASCPTAKGIAVDGCPVF  2315
             C LASCPTA GI V+GCPVF
Sbjct  712   CPLASCPTAPGIHVEGCPVF  731



>ref|XP_004953567.1| PREDICTED: oligopeptide transporter 4-like isoform X1 [Setaria 
italica]
Length=797

 Score =  1021 bits (2641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/798 (66%), Positives = 621/798 (78%), Gaps = 53/798 (7%)
 Frame = +3

Query  72    KMGTVEIEAPALKLAGEDVND---EEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSC  242
             ++GT E    A K     V D   EE SP+E+VRLTV +TDDP+LPVWTFRMW +G++SC
Sbjct  3     EVGTAERGQAAGKEEEGIVGDGEEEESSPVEQVRLTVPSTDDPSLPVWTFRMWSIGLLSC  62

Query  243   VLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGF-GSGQFSLNPG  419
              L+SFLNQFF YR EPL++T ITVQVA+LP+G FMA  LP  + R P   G G++SLNPG
Sbjct  63    ALMSFLNQFFVYRTEPLVVTQITVQVASLPVGHFMARVLPRTRHRAPKLLGGGEWSLNPG  122

Query  420   PFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYG  599
             PFNMKEHVLI+IFANAGFAFG GSAYAVGI++II AFY R ISFF  WLL+ITTQVLGYG
Sbjct  123   PFNMKEHVLISIFANAGFAFGGGSAYAVGIIDIIRAFYHRHISFFTAWLLVITTQVLGYG  182

Query  600   WAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFC  779
             WAGL++KYVVEPAHMWWPSTLVQ+SLFR LHEK+E   G  +  +SR+KFF+++L CSF 
Sbjct  183   WAGLMRKYVVEPAHMWWPSTLVQVSLFRALHEKDEASKGSRQ--ISRSKFFLVALACSFA  240

Query  780   WYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVC  959
             WY  PGY+F  L SISWVCWVF KSVTA QLGSG+ GLGLGA TLDWST++SFL SPL+ 
Sbjct  241   WYAVPGYLFPALTSISWVCWVFSKSVTAQQLGSGMKGLGLGAFTLDWSTVSSFLFSPLIS  300

Query  960   PFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQF  1139
             PFFA VN+F GY   +YL+MPI+YWG N+YNAK FP++SS LF + G +YDI +IVN QF
Sbjct  301   PFFATVNIFFGYVFFVYLIMPIAYWGFNLYNAKTFPIFSSHLFMSNGTKYDIPSIVNSQF  360

Query  1140  ELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIH  1319
             ELD+D Y ++GR+ LS FF+LSYGF FATIA+TITHV LFYG+EIY R++AS K K DIH
Sbjct  361   ELDKDAYNQRGRVNLSIFFALSYGFSFATIAATITHVGLFYGKEIYRRFKASQKEKPDIH  420

Query  1320  TKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISI  1499
             TKLM+ Y DIP+WWFY L+ +++ VSL LC  L  EVQ+P+WGLIFA  +AF+FTLPISI
Sbjct  421   TKLMEKYDDIPAWWFYSLMALSVVVSLLLCTVLKREVQLPWWGLIFACGMAFIFTLPISI  480

Query  1500  ITATTN-------------------------------------------QTPGLNIITEY  1550
             ITATTN                                           QTPGLN+ITEY
Sbjct  481   ITATTNQASKTTACLVFLRKKKGHILQVLSCIVIIYVKKKLIDPLKCIAQTPGLNVITEY  540

Query  1551  IMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGT  1730
              MG+I PG PIANVCFK YGYMSM+QA+AFLSDFKLGHYMKIPP+SMFLVQFIGT++AGT
Sbjct  541   AMGLIMPGYPIANVCFKVYGYMSMSQAVAFLSDFKLGHYMKIPPKSMFLVQFIGTIVAGT  600

Query  1731  INMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNAL  1910
             +N+  AWWLL SI++IC       SPWTCPSDRVFFDASVIWGLVGP+RIF S GNY AL
Sbjct  601   VNLGTAWWLLGSIKDICSDSLPPESPWTCPSDRVFFDASVIWGLVGPRRIFGSAGNYGAL  660

Query  1911  NWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIF  2090
             NWFFL G  GPVIV+ LHR +P+Q WIPLINLPVLLGAT SMPPAT++NY+SW+L+GTIF
Sbjct  661   NWFFLIGAAGPVIVYALHRMYPNQRWIPLINLPVLLGATASMPPATAVNYNSWLLIGTIF  720

Query  2091  NFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLAS  2270
             NFFVFRY+KKWW RYNYILSA LDAGVAFM V+LYF++ +E++TI WWGT   EHC LAS
Sbjct  721   NFFVFRYQKKWWTRYNYILSAALDAGVAFMGVVLYFSLTMENKTIDWWGTAG-EHCPLAS  779

Query  2271  CPTAKGIAVDG---CPVF  2315
             CPTAKG+ +     CPVF
Sbjct  780   CPTAKGMDLGPDSVCPVF  797



>ref|XP_010475851.1| PREDICTED: oligopeptide transporter 2-like [Camelina sativa]
Length=735

 Score =  1021 bits (2640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/730 (69%), Positives = 617/730 (85%), Gaps = 11/730 (2%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
             +DE+ SP+EEVRLTV+N DDP+LPVWTFRMW LG++SCVLLSFLN FF YR +PL+IT I
Sbjct  16    DDEDESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMI  75

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgng  488
             +VQV TLP+G+ MA  LP  K++I   GS +FSLNPGPFN+KEHVLI++FANAG  FG+G
Sbjct  76    SVQVVTLPLGKLMARVLPETKYKI---GSWEFSLNPGPFNVKEHVLISMFANAGAGFGSG  132

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
             +AYAVGIV+II+AFY+RKISF A W+L+ITTQ+LGYGWAG+++K VV+PA MWWP++++Q
Sbjct  133   TAYAVGIVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQ  192

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +SLFR LHEK++         MSR KFFVI+  CSF WY FP Y+F TL+SISWVCW FP
Sbjct  193   VSLFRALHEKDKAR-------MSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFP  245

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
             KS+TA QLGSG++GLG+GA  LDWS IAS+L SPLV PFFAIVNV VGY +IMY+V+PIS
Sbjct  246   KSITAQQLGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAIVNVLVGYILIMYMVIPIS  305

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             Y+G+N+Y A  FP++SSDLF  QGQ Y+IS IVN +FELD   Y ++GR+YLSTFF++SY
Sbjct  306   YYGMNMYEANKFPIFSSDLFDKQGQLYNISTIVNDKFELDMGNYQQEGRVYLSTFFAISY  365

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTI  1388
             G GFA I ST+THVALF G+ I+ + RASTK K+DIHT+LMK YKDIP WWFY LL ++I
Sbjct  366   GIGFAAIVSTLTHVALFNGKGIWQQVRASTKSKVDIHTRLMKKYKDIPGWWFYGLLAISI  425

Query  1389  AVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIY  1568
              +SL LCIF+ DE+QMP+WGL+ A+ +A  FT+P+SIITATTNQTPGLNIITEY+MG++ 
Sbjct  426   VLSLVLCIFMKDEIQMPWWGLLLASFMAVTFTVPVSIITATTNQTPGLNIITEYLMGVLL  485

Query  1569  PGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVA  1748
             PG+PIANVCFKTYGY+SM+QAI+FL+DFKLGHYMKIPPRSMFLVQ IGT+IAGT+N+SVA
Sbjct  486   PGRPIANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPRSMFLVQLIGTVIAGTVNISVA  545

Query  1749  WWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             W+LL S+ENIC ++ L  NSPWTCPSDRVFFDASVIWGLVGPKRIF   GNY+ALNWFFL
Sbjct  546   WYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYSALNWFFL  605

Query  1926  GGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVF  2105
             GG++GPV+VWLL + FP+++WI LINLPVLLGAT +MPPATS+N++ WI+VG IFN+FVF
Sbjct  606   GGLIGPVLVWLLQKAFPTKTWISLINLPVLLGATAAMPPATSVNFNCWIIVGVIFNYFVF  665

Query  2106  RYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAK  2285
             +Y K WWQRYNY+LSA LDAG+AFM VLLYF++ +   +I  W   + E+C LASCPTA 
Sbjct  666   KYYKGWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISIDHWWGANGENCPLASCPTAP  725

Query  2286  GIAVDGCPVF  2315
             GI V+GCPVF
Sbjct  726   GIQVEGCPVF  735



>dbj|BAB89477.1| isp4 protein-like [Oryza sativa Japonica Group]
 gb|EAZ12783.1| hypothetical protein OsJ_02700 [Oryza sativa Japonica Group]
Length=755

 Score =  1020 bits (2637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/755 (68%), Positives = 622/755 (82%), Gaps = 11/755 (1%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             MG  E       +  E   D++ SPIEEVRLTV  TDD +LPVWTFRMW LG++SCVL+S
Sbjct  1     MGEGEFVDVERGVVAEGALDDDASPIEEVRLTVPVTDDSSLPVWTFRMWTLGLLSCVLMS  60

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGF-GSGQFSLNPGPFNM  431
             FLNQFFSYR EPLI+T ITVQVA+LP+G  +A  LP  KF+ P   G G+ SLNPGPFNM
Sbjct  61    FLNQFFSYRTEPLIVTQITVQVASLPLGHILARVLPRRKFKAPALLGGGECSLNPGPFNM  120

Query  432   KEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGL  611
             KEHVL++IFANAG AFG+GSAYAV IV+II AFY R IS F  WLLI TTQVLGYGWAGL
Sbjct  121   KEHVLVSIFANAGCAFGSGSAYAVMIVDIIRAFYGRSISLFPAWLLITTTQVLGYGWAGL  180

Query  612   LKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrr---MSRAKFFVISLCCSFCW  782
             +++YVVEPA MWWP TLVQ+SLFR LH K EE++         MS+AKFF+I+L CSF W
Sbjct  181   MRRYVVEPAQMWWPGTLVQVSLFRALHGKGEEKEENKEGSGGGMSQAKFFLIALACSFLW  240

Query  783   YFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCP  962
             Y  PGY+F TL S+SWVCW+F KSVTA QLGSG+ GLGLGA TLDW+ +++FL SPL+ P
Sbjct  241   YAVPGYLFPTLTSVSWVCWIFSKSVTAQQLGSGMKGLGLGAFTLDWTAVSAFLYSPLISP  300

Query  963   FFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFE  1142
             FFA  N+  GY ++MY+V+P+SYWGL++YNA+ FP++SS LFTA G  YDI+AIVN +FE
Sbjct  301   FFATANILAGYVLLMYVVVPVSYWGLDLYNARRFPIFSSHLFTATGSTYDITAIVNDRFE  360

Query  1143  LDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHT  1322
             +D D Y + GRI +STFF+LSYG GFATIA+T+THVALF+G+EIY R+RAS + K D+HT
Sbjct  361   IDMDGYHRMGRINMSTFFALSYGLGFATIAATVTHVALFHGKEIYRRFRASQRDKPDVHT  420

Query  1323  KLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISII  1502
             +LMK+Y+D+PSWWFY +L +++AVSL LC  L   VQ+P+WGL+FA A+AF+FTLPISII
Sbjct  421   RLMKSYRDVPSWWFYAMLALSMAVSLLLCTVLRSAVQLPWWGLLFACAMAFVFTLPISII  480

Query  1503  TATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPP  1682
             TATTNQTPGLNIITEY++G++ PGKPIANVCFK YGYMSM+QA++FLSDFKLGHYMKIPP
Sbjct  481   TATTNQTPGLNIITEYVIGLMLPGKPIANVCFKAYGYMSMSQAVSFLSDFKLGHYMKIPP  540

Query  1683  RSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIW  1856
             +SMFLV+ +GT++A T+N+ VA+WLL SI NIC QD L  ++SPWTCP+DRVFFDASVIW
Sbjct  541   KSMFLVKLVGTVVASTVNLVVAYWLLGSIPNIC-QDALLPADSPWTCPNDRVFFDASVIW  599

Query  1857  GLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSM  2036
             GLVGP+RIF   GNY ALNWFFL G +GPVIV+LLHR FPS++WIP+INLPVL+GAT  M
Sbjct  600   GLVGPRRIFGPLGNYGALNWFFLAGAVGPVIVYLLHRAFPSKTWIPMINLPVLIGATSYM  659

Query  2037  PPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLED  2216
             PPAT++NY+SW+++G IFNFFVFRYRK WW+RYNYILSA LDAGVAFMAVLLYF++ +E+
Sbjct  660   PPATAVNYNSWLIIGIIFNFFVFRYRKLWWKRYNYILSAALDAGVAFMAVLLYFSLSMEN  719

Query  2217  RTISWWGTTDLEHCDLASCPTAKGIAVDG---CPV  2312
             R+ISWWGT   EHC LASCPTAKGI +     CPV
Sbjct  720   RSISWWGTAG-EHCPLASCPTAKGINLGADSVCPV  753



>ref|XP_006422647.1| hypothetical protein CICLE_v10027887mg [Citrus clementina]
 gb|ESR35887.1| hypothetical protein CICLE_v10027887mg [Citrus clementina]
Length=692

 Score =  1017 bits (2629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/731 (70%), Positives = 598/731 (82%), Gaps = 53/731 (7%)
 Frame = +3

Query  123   DVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIIT  302
             D++ +E+SP+EEVRLTV N+DDP+LPVWTFRMW LG++SC LLSFLNQFF+YR EPLIIT
Sbjct  13    DIDRDELSPVEEVRLTVLNSDDPSLPVWTFRMWFLGLLSCALLSFLNQFFAYRTEPLIIT  72

Query  303   SITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafg  482
              ITVQVATLPIGRF+ A LP  +FRIPG GS  FSLN GPFN+KEHVLI+IFANAG AFG
Sbjct  73    QITVQVATLPIGRFLEATLPETRFRIPGCGSRLFSLNSGPFNVKEHVLISIFANAGSAFG  132

Query  483   ngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTL  662
              GS +AV IVNII AFY RKISF A WLLIITTQVLGYGWAGLL+KYVVEPAHMWWPSTL
Sbjct  133   AGSTFAVSIVNIIKAFYHRKISFLASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTL  192

Query  663   VQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWV  842
             VQ+SLFR LHEK+++        MSRAKFFVI+L CSF WY  PGY+  TL+SISWVCW 
Sbjct  193   VQVSLFRALHEKDDQR-------MSRAKFFVIALICSFSWYLVPGYLVPTLSSISWVCWA  245

Query  843   FPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMP  1022
             F KSVTA Q                       L S +                       
Sbjct  246   FSKSVTAQQ-----------------------LGSGM---------------------RG  261

Query  1023  ISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSL  1202
             +    L +  A  FP++SS LFT++GQ+YDISAIVN +FELD+D+Y +QGRI+LS FF+L
Sbjct  262   LGLGALTLDCAHKFPIFSSHLFTSEGQKYDISAIVNDKFELDQDKYQEQGRIHLSMFFAL  321

Query  1203  SYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVV  1382
             +YGFGFATIASTITHV  FYGREIY+R+RAS KGK DIHT+LM+ Y+DIP WWFY++LVV
Sbjct  322   TYGFGFATIASTITHVGFFYGREIYERFRASYKGKEDIHTRLMRRYEDIPHWWFYLMLVV  381

Query  1383  TIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGI  1562
             T+ VSL LC FL D+VQMP+WGL+FA A+AF+FTLPISIITATTNQTPGLNIITEY+MGI
Sbjct  382   TLVVSLVLCTFLKDQVQMPWWGLLFAGAMAFVFTLPISIITATTNQTPGLNIITEYVMGI  441

Query  1563  IYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMS  1742
             IYPG+PIANVCFK YGYMS+ QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGTIN++
Sbjct  442   IYPGRPIANVCFKVYGYMSVAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTINLA  501

Query  1743  VAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWF  1919
             VAWWLL+SIENIC  + L  +SPWTCP DRVFFDASVIWGL GPKRIF S+GNY A+NWF
Sbjct  502   VAWWLLNSIENICQDELLPPDSPWTCPGDRVFFDASVIWGLAGPKRIFGSQGNYPAMNWF  561

Query  1920  FLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFF  2099
             F+GG LGPV+VWLLH+ FP QSWI LINLPVLLGATG MPPAT++NY+SWI+VGTIFNFF
Sbjct  562   FVGGALGPVLVWLLHKAFPKQSWIALINLPVLLGATGMMPPATAVNYNSWIIVGTIFNFF  621

Query  2100  VFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPT  2279
             +FRYRK+WWQRYNYILSA +DAGVAFMAV+LYF+VG+ED+ +SWWG T+ EHCDLA+CPT
Sbjct  622   IFRYRKQWWQRYNYILSAAMDAGVAFMAVILYFSVGMEDKGLSWWG-TEGEHCDLATCPT  680

Query  2280  AKGIAVDGCPV  2312
             AKGI +DGCPV
Sbjct  681   AKGILIDGCPV  691



>ref|XP_002452706.1| hypothetical protein SORBIDRAFT_04g031070 [Sorghum bicolor]
 gb|EES05682.1| hypothetical protein SORBIDRAFT_04g031070 [Sorghum bicolor]
Length=760

 Score =  1016 bits (2627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/754 (68%), Positives = 614/754 (81%), Gaps = 11/754 (1%)
 Frame = +3

Query  78    GTVEIEAP----ALKLAG-EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSC  242
             G  E EA     A+K  G  D ++EE SPIEEVRLTV  TDDP+LPVWTFRMW +G+ SC
Sbjct  10    GLAEAEAEPVGGAVKEEGILDDDEEEASPIEEVRLTVPTTDDPSLPVWTFRMWSIGLFSC  69

Query  243   VLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGF-GSGQFSLNPG  419
              L+SFLNQFFSYR EPL++T ITVQVA+LP+G FMA  LP  +FR+P   G G++SLNPG
Sbjct  70    ALMSFLNQFFSYRTEPLVVTGITVQVASLPVGHFMARVLPRTRFRVPALLGGGEWSLNPG  129

Query  420   PFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYG  599
             PFN+KEHVLI+IFANAGFAFG GSAYAV I+NII AFY R ISF   WLL+ITTQVLGYG
Sbjct  130   PFNIKEHVLISIFANAGFAFGGGSAYAVSIINIIRAFYGRHISFITAWLLVITTQVLGYG  189

Query  600   WAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFC  779
             WAGL++KYVVEPAHMWWP TLVQ+SLF+ LHEK+E      +  +SR+KFFV+ L CSF 
Sbjct  190   WAGLIRKYVVEPAHMWWPGTLVQVSLFQALHEKDESAKASRQ--ISRSKFFVVVLTCSFA  247

Query  780   WYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVC  959
             WY  PGY+F TL SISWVCW+F KSVTA QLGSG+NGLG+GA TLDWS ++SFL SPL+ 
Sbjct  248   WYAVPGYLFPTLTSISWVCWIFSKSVTAQQLGSGMNGLGIGAFTLDWSAVSSFLFSPLIS  307

Query  960   PFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQF  1139
             PFFA  N+F GY   +Y++MPI+YWG ++YNAK FP++SS LF + G  YD+ +IVN QF
Sbjct  308   PFFATANIFFGYTFFLYIIMPIAYWGFDLYNAKTFPIFSSHLFMSNGTNYDVQSIVNNQF  367

Query  1140  ELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIH  1319
             ELD++ Y K G + LS FF+L+YGF FATIA+TITHV LFYG+EIY R+++S K K DIH
Sbjct  368   ELDQEAYRKSGNVNLSIFFALTYGFSFATIAATITHVGLFYGKEIYYRFKSSQKEKPDIH  427

Query  1320  TKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISI  1499
             TKLMK Y +IP+WWFY+L+ ++I VSL LC  L  EVQ+P+WGLIFA  +AF+FTLPISI
Sbjct  428   TKLMKKYSEIPAWWFYLLMALSITVSLILCTVLKHEVQLPWWGLIFACGMAFIFTLPISI  487

Query  1500  ITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIP  1679
             ITATTNQ+PGLN+ITEY MG+I PG PIA VCFK YGYMSM+QA+AFLSDFKLGHYMKIP
Sbjct  488   ITATTNQSPGLNVITEYAMGLIMPGYPIAVVCFKVYGYMSMSQAVAFLSDFKLGHYMKIP  547

Query  1680  PRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWG  1859
             P+SMFLVQF+GT++AGT+N+  AWWLL SI  IC      +SPWTCPSDRVFFDASVIWG
Sbjct  548   PKSMFLVQFVGTIVAGTVNVGTAWWLLGSIHGICSDSLPPDSPWTCPSDRVFFDASVIWG  607

Query  1860  LVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMP  2039
             LVGP+RIF  EGNY ALN FFL G+ GPVIV+  HR FP+Q WIPLINLPVL GAT  MP
Sbjct  608   LVGPRRIFGPEGNYGALNSFFLIGLAGPVIVYAFHRMFPNQKWIPLINLPVLFGATALMP  667

Query  2040  PATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDR  2219
             PA ++NY+SW+++GTIFNFFVFRYRK+WW RYNYILSAGLDAGVAFM V+LYF++ ++++
Sbjct  668   PARAVNYNSWLIIGTIFNFFVFRYRKRWWTRYNYILSAGLDAGVAFMGVVLYFSLTMQNK  727

Query  2220  TISWWGTTDLEHCDLASCPTAKGIAV-DG-CPVF  2315
             +I WWGT   EHC LA+CPTAKG+ + DG CPVF
Sbjct  728   SIDWWGTAG-EHCLLATCPTAKGVDLGDGICPVF  760



>ref|XP_010501399.1| PREDICTED: oligopeptide transporter 2 [Camelina sativa]
Length=735

 Score =  1015 bits (2625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/731 (68%), Positives = 616/731 (84%), Gaps = 13/731 (2%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
             +DE+ SP+EEVRLTV+N DDP+LPVWTFRMW LG++SCVLLSFLN FF YR +PL+IT I
Sbjct  16    DDEDESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMI  75

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgng  488
             +VQV TLP+G+ MA  LP  K++I   GS +FSLNPGPFN+KEHVLI++FANAG  FG+G
Sbjct  76    SVQVVTLPLGKLMARVLPETKYKI---GSWEFSLNPGPFNVKEHVLISMFANAGAGFGSG  132

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
             +AYAVGIV+II+AFY+RKISF A W+L+ITTQ+LGYGWAG+++K VV+PA MWWP++++Q
Sbjct  133   TAYAVGIVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQ  192

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +SLFR LHEK+          MSR KFFVI+  CSF WY FP Y+F TL+SISWVCW FP
Sbjct  193   VSLFRALHEKDNAR-------MSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFP  245

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
             KS+TA QLGSG++GLG+GA  LDWS IAS+L SPLV PFFAIVNVFVGY ++MY+V+PIS
Sbjct  246   KSITAQQLGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAIVNVFVGYILVMYMVIPIS  305

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             Y+G+N+Y A  FP++SSDLF  QGQ Y+IS IVN +FELD   Y ++GR+YLSTFF++SY
Sbjct  306   YYGMNMYEANKFPIFSSDLFDKQGQLYNISTIVNDKFELDMGSYQQEGRVYLSTFFAISY  365

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTI  1388
             G GFA I ST+THVALF G+ I+ + RASTK K+DIHT+LMK YKDIP WWFY LL ++I
Sbjct  366   GIGFAAIVSTLTHVALFNGKGIWQQVRASTKTKVDIHTRLMKKYKDIPGWWFYGLLAISI  425

Query  1389  AVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIY  1568
              +SL LCIF+ D++QMP+WGL+ A+ +A  FT+P+SIITATTNQTPGLNIITEY+MG++ 
Sbjct  426   VLSLVLCIFMKDQIQMPWWGLLLASFMAVTFTVPVSIITATTNQTPGLNIITEYLMGVLL  485

Query  1569  PGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVA  1748
             PG+PIANVCFKTYGY+SM+QAI+FL+DFKLGHYMKIPPRSMFLVQ IGT+IAGT+N+SVA
Sbjct  486   PGRPIANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPRSMFLVQLIGTVIAGTVNVSVA  545

Query  1749  WWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             W+LL S+ENIC ++ L  NSPWTCPSDRVFFDASVIWGLVGPKRIF   GNY ALNWFFL
Sbjct  546   WYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYPALNWFFL  605

Query  1926  GGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVF  2105
             GG++GPV+VWLL + FP+++WI  INLPVLLGAT +MPPATS+N++ WI+VG IFN+FVF
Sbjct  606   GGLIGPVLVWLLQKAFPTRTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVIFNYFVF  665

Query  2106  RYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTIS-WWGTTDLEHCDLASCPTA  2282
             +Y K WWQRYNY+LSA LDAG+AFM VLLYF++ +   +I  WWG    E+C LA+CPTA
Sbjct  666   KYYKGWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISIDHWWGAKG-ENCPLAACPTA  724

Query  2283  KGIAVDGCPVF  2315
              GI V+GCPVF
Sbjct  725   PGIQVEGCPVF  735



>ref|XP_010244696.1| PREDICTED: oligopeptide transporter 4-like [Nelumbo nucifera]
Length=742

 Score =  1015 bits (2624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/727 (70%), Positives = 608/727 (84%), Gaps = 12/727 (2%)
 Frame = +3

Query  141   VSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQV  320
             +SPIEEVRLTV NTDDP+LP+WTFRMW +G++SC LLSFLNQFFSYR EP+IIT ITVQV
Sbjct  26    LSPIEEVRLTVMNTDDPSLPIWTFRMWFMGLISCALLSFLNQFFSYRTEPIIITQITVQV  85

Query  321   ATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYA  500
             ATLPIGRFMA+ LP  KFR+PGFGS +FSLNPGPFNMKEHVL+++FANAG AFG GS YA
Sbjct  86    ATLPIGRFMASVLPRTKFRLPGFGSTEFSLNPGPFNMKEHVLVSMFANAGSAFGGGSPYA  145

Query  501   VGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLF  680
             V I+NII  FY R ISFFAGW+L+ITTQVLGYGWAGLL+KYVVEPAHMWWP TL Q+S+F
Sbjct  146   VEIINIIKVFYHRNISFFAGWMLVITTQVLGYGWAGLLRKYVVEPAHMWWPYTLAQVSMF  205

Query  681   RTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVT  860
             R LH           + MSR KFF+I+L CSFCW   PGY+F TL+SISW+CW F KSVT
Sbjct  206   RALH-------EKDDQGMSRGKFFLIALICSFCWCIVPGYLFPTLSSISWICWAFSKSVT  258

Query  861   AHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGL  1040
             AHQ+GSG+ GLG+GA +LDW+ ++SFL SPL+ PFFAIVNV++GY + +Y+++PISYWGL
Sbjct  259   AHQIGSGMQGLGIGAFSLDWTVVSSFLYSPLLSPFFAIVNVYIGYVVFIYIIIPISYWGL  318

Query  1041  NVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGF  1220
             N+YNAK FP++SS LFT+ GQ Y++SAIVN +FE+D   Y KQGR+++S  F+LSYGF F
Sbjct  319   NLYNAKTFPIFSSHLFTSHGQMYNVSAIVNDKFEIDIANYEKQGRVHVSMLFALSYGFAF  378

Query  1221  ATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSL  1400
             AT+A+T+THVALF+GREIY+RY  S  GK DIHT+LMK Y DIP WWFY+LLVVT+ VSL
Sbjct  379   ATVAATLTHVALFHGREIYERY-CSYNGKEDIHTRLMKKYSDIPGWWFYLLLVVTLVVSL  437

Query  1401  ALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKP  1580
              LCIFL  +VQMP+WG +FA+ +AF+FTLPI++I ATTNQ P LN +TEYIMGII PGKP
Sbjct  438   LLCIFLKSQVQMPWWGFLFASVIAFVFTLPITVIVATTNQVPPLNKLTEYIMGIILPGKP  497

Query  1581  IANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLL  1760
             IAN C KTYG +S+ QA++FL DFKLGHYMKIPP+SMFLVQFIGT++AGTIN++ A W+L
Sbjct  498   IANACLKTYGSISVMQAVSFLGDFKLGHYMKIPPKSMFLVQFIGTILAGTINVAAAMWML  557

Query  1761  HSIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGI  1934
              SI NIC QD++   +SPWTCP+DRVFFDASVIWGLVGPKRI  S GNY ALNWFFLGG 
Sbjct  558   KSIPNIC-QDQILPPDSPWTCPNDRVFFDASVIWGLVGPKRIVGSLGNYGALNWFFLGGA  616

Query  1935  LGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYR  2114
             L P++VWLLH+ FP ++WI LIN PVLLGAT +MP AT++N++SW LVGTIFNFF+FRYR
Sbjct  617   LAPLLVWLLHKTFPKKTWISLINFPVLLGATVTMPAATTVNFNSWALVGTIFNFFIFRYR  676

Query  2115  KKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIA  2294
             K WWQRYNY+LS  LDAGVAFM V LYF++ +  + + WWG    EHCDLASCPTAKGI 
Sbjct  677   KSWWQRYNYVLSGALDAGVAFMGVFLYFSLHMGGKHLDWWGAGG-EHCDLASCPTAKGIV  735

Query  2295  VDGCPVF  2315
             VDGCP++
Sbjct  736   VDGCPIY  742



>ref|XP_003522744.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 2-like 
[Glycine max]
Length=730

 Score =  1014 bits (2622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/733 (68%), Positives = 611/733 (83%), Gaps = 10/733 (1%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
             E   ++++SPIEEVRL V+N DDP  PVWTFRMW LG+V+ +LLSFLN FF YR++PL++
Sbjct  7     ESAKEDDISPIEEVRLVVSNEDDPRQPVWTFRMWFLGIVAVILLSFLNTFFGYRKQPLLV  66

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
             T I+VQVATLPIGRFMA  LP  KFRI G     FSLNPGPFN+KEHVLI+IFANAG AF
Sbjct  67    TMISVQVATLPIGRFMARVLPPTKFRIRG---RDFSLNPGPFNIKEHVLISIFANAGAAF  123

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
             GNG+AYAVGIV+II AFY RKI+F AGWLL++TTQVLGYGWAG++KKYVVEPA MWWPST
Sbjct  124   GNGAAYAVGIVDIIRAFYGRKITFLAGWLLVLTTQVLGYGWAGIMKKYVVEPAEMWWPST  183

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR LHEKE++        MS+  FF+I+L CSF WY  PGY+F  L+ ISWVCW
Sbjct  184   LVQVSLFRALHEKEKKRGR-----MSKETFFLIALTCSFVWYVVPGYLFTALSIISWVCW  238

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
             +FP SVTA Q+GSG  GLGLG+ +LDW+T+A+FL +PLV PFFA  NV VGY +++YL++
Sbjct  239   IFPHSVTAQQIGSGEKGLGLGSFSLDWTTVAAFLGNPLVSPFFATANVLVGYILLIYLII  298

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             P+SYWGLN+YNAK FP+YSS LF A G EY++ AIVN++FE+D   Y KQGR+ LS FF+
Sbjct  299   PVSYWGLNIYNAKNFPIYSSSLFVANGTEYNVKAIVNEKFEIDMLAYEKQGRVNLSAFFA  358

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLV  1379
             +SYG GFA IAS++THVA+F GREIY+++R+S   K DIH +LMK YK IPSWWF+V L+
Sbjct  359   ISYGIGFAAIASSLTHVAIFNGREIYEQFRSSRSKKEDIHARLMKKYKRIPSWWFHVTLL  418

Query  1380  VTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMG  1559
             V+ A++L LCI + D++QMP+WGLIFA+ +A  FTLP+SIITATTNQTPGLNIITEYIMG
Sbjct  419   VSFALALLLCIVMKDQIQMPWWGLIFASGIALTFTLPVSIITATTNQTPGLNIITEYIMG  478

Query  1560  IIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINM  1739
             +I PGKPIANVCFKTYGY+SM+QA++FLSDFKLGHYMKIPPRSMF+VQ +GTLIAGT+++
Sbjct  479   VILPGKPIANVCFKTYGYISMSQAVSFLSDFKLGHYMKIPPRSMFIVQVVGTLIAGTMDV  538

Query  1740  SVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNW  1916
              VAWWLL S++NIC+QD L ++SPWTCP D+VFFDASVIWGLVGPKRIF + GNY  LNW
Sbjct  539   GVAWWLLGSVKNICNQDLLPADSPWTCPGDKVFFDASVIWGLVGPKRIFGTLGNYPKLNW  598

Query  1917  FFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNF  2096
             FFL G LGP+++WLL + F  Q+WI LI+LPVLLGAT +MPPA+S+N+++WI VGTIFN+
Sbjct  599   FFLIGALGPLVIWLLQKAFRKQTWISLIHLPVLLGATANMPPASSVNFNAWITVGTIFNY  658

Query  2097  FVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCP  2276
             FVF+YRK WWQRYNY+L A LDAG+AFM VLLYF V +E++ I WWG  D + C LA CP
Sbjct  659   FVFKYRKNWWQRYNYVLPAALDAGLAFMTVLLYFAVNVEEKGIVWWG-NDGDQCKLAKCP  717

Query  2277  TAKGIAVDGCPVF  2315
             TAKG+  +GCPVF
Sbjct  718   TAKGVVTEGCPVF  730



>ref|XP_008677393.1| PREDICTED: oligopeptide transporter 4 isoform X1 [Zea mays]
 gb|ACN26883.1| unknown [Zea mays]
 gb|AFW63464.1| oligopeptide transporter 4 [Zea mays]
Length=760

 Score =  1014 bits (2621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/763 (67%), Positives = 613/763 (80%), Gaps = 19/763 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEE-------------VSPIEEVRLTVTNTDDPTLPVWTFR  215
             MG +  +   L  A   V  +E              SP+E+VRLTV +TDDP+LPVWTFR
Sbjct  1     MGEIGTDHRGLAEAEAGVGGKEEGIVLGGHEEEEETSPVEQVRLTVPSTDDPSLPVWTFR  60

Query  216   MWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGF-G  392
             MW +G++SC L+SFLNQFFSYR EPLI+T ITVQVA+LP+G FMA ALP A+FR P   G
Sbjct  61    MWSIGLLSCALMSFLNQFFSYRTEPLIVTQITVQVASLPLGHFMARALPRARFRAPALLG  120

Query  393   SGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLI  572
              G++SLNPGPFN+KEHVLI+IFANAGFAFGNGSAYAV I++II AFY R ISFF  WLL+
Sbjct  121   GGEWSLNPGPFNVKEHVLISIFANAGFAFGNGSAYAVAIIDIIRAFYHRHISFFTAWLLV  180

Query  573   ITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFF  752
             +TTQVLGYGWAGLL+KYVV+PAHMWWP TLVQ+SLFR LHEK+E      +  +SR+KFF
Sbjct  181   VTTQVLGYGWAGLLRKYVVQPAHMWWPGTLVQVSLFRALHEKDESAKASRQ--ISRSKFF  238

Query  753   VISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIA  932
             ++ L CSF WY  PGY+F TL SISWVCWVF +SVTA QLGSG++GLGLGA TLDWST++
Sbjct  239   LVVLACSFAWYAVPGYLFPTLTSISWVCWVFSRSVTAQQLGSGMSGLGLGAFTLDWSTVS  298

Query  933   SFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYD  1112
             SFL SPL+ PFFA  N+F GY   +Y++MP +YWG ++Y+AK FP++SS LF + G  YD
Sbjct  299   SFLFSPLISPFFATANIFFGYVFFVYVIMPAAYWGFDLYSAKTFPIFSSHLFMSNGSSYD  358

Query  1113  ISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRA  1292
             + +IVN +FELD D Y K G++ LS FF+LSYGF FATIA+TITHV LFYG+EIY R+R+
Sbjct  359   VQSIVNNRFELDLDAYGKNGKVSLSVFFALSYGFSFATIAATITHVGLFYGKEIYYRFRS  418

Query  1293  STKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALA  1472
             S K K DIHTKLM+ Y +IP+WWFY L+ ++I VSL LC  L  EVQ+P+WGLIFA  +A
Sbjct  419   SQKEKPDIHTKLMERYSEIPAWWFYSLMALSIVVSLLLCTVLKREVQLPWWGLIFACGMA  478

Query  1473  FMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDF  1652
             F+FTLPISIITATTNQTPGLN+ITEY MG+I PG PIA VCFK YGYMSM QA+AFLSDF
Sbjct  479   FVFTLPISIITATTNQTPGLNVITEYAMGLIMPGSPIAVVCFKVYGYMSMAQAVAFLSDF  538

Query  1653  KLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRV  1832
             KLGHYMKIPP+SMFLVQF+GT++AGT+N+  AWWLL SI+ IC      +SPWTCP+DRV
Sbjct  539   KLGHYMKIPPKSMFLVQFVGTIVAGTVNIGTAWWLLGSIDGICSDSLPPDSPWTCPNDRV  598

Query  1833  FFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPV  2012
             FFDASVIWGLVGP+RIF  +GNY ALNWFFL G  GPVIV+ LHR FP Q WIPLINLPV
Sbjct  599   FFDASVIWGLVGPRRIFGPDGNYGALNWFFLIGAAGPVIVYALHRTFPGQRWIPLINLPV  658

Query  2013  LLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLL  2192
             L GAT  MPPAT++NY+SW+LVGT+FNFFVFRYRKKWW RYNYILSA LDAGVAFM V+L
Sbjct  659   LFGATAYMPPATAVNYNSWLLVGTVFNFFVFRYRKKWWTRYNYILSAALDAGVAFMGVVL  718

Query  2193  YFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV-DG-CPVF  2315
             YF++ +++++I WWGT   EHC LA CPTAKG+ + DG CPVF
Sbjct  719   YFSLTMQNKSIDWWGTAG-EHCPLARCPTAKGVDLGDGVCPVF  760



>ref|XP_004972025.1| PREDICTED: oligopeptide transporter 4-like [Setaria italica]
Length=760

 Score =  1013 bits (2618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/743 (69%), Positives = 620/743 (83%), Gaps = 13/743 (2%)
 Frame = +3

Query  114   AGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPL  293
             AGE+ +D+E SPIEEVR+TV  TDDPTLPVWTFRMW LG++SCVL+SFLNQFFSYR EP+
Sbjct  19    AGEE-DDDEASPIEEVRMTVPATDDPTLPVWTFRMWTLGLLSCVLMSFLNQFFSYRTEPI  77

Query  294   IITSITVQVATLPIGRFMAAALPAAKFRIPGF-GSGQFSLNPGPFNMKEHVLITIfanag  470
             I+T +TVQVA+LP+G F+A  LP  KF+ P   G G++SLNPGPFNMKEHVLI+IFANAG
Sbjct  78    IVTQVTVQVASLPLGHFLARVLPTRKFKAPALLGGGEWSLNPGPFNMKEHVLISIFANAG  137

Query  471   fafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWW  650
              AFGNGSAYAV IV+II AFYRR ISFFA WLLI TTQVLGYGWAGL++KYVVEPAHMWW
Sbjct  138   CAFGNGSAYAVMIVDIIRAFYRRSISFFAAWLLITTTQVLGYGWAGLMRKYVVEPAHMWW  197

Query  651   PSTLVQISLFRTLHekeeeedgggr---rrMSRAKFFVISLCCSFCWYFFPGYIFQTLAS  821
             P TLVQ+SLFR LHEKE+++        RR SRAKFF+++L CSF WY  PGY+F TL S
Sbjct  198   PGTLVQVSLFRALHEKEDDQRVAEGGGPRRTSRAKFFLVALACSFLWYAVPGYLFPTLTS  257

Query  822   ISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAI  1001
             +SWVCW+F KSVTA QLGSG+ GLGLGA TLDW+ ++SFL SPLV PFFA  N+  G+ +
Sbjct  258   VSWVCWIFSKSVTAQQLGSGMRGLGLGAFTLDWTAVSSFLFSPLVSPFFATANILAGFVL  317

Query  1002  IMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIY  1181
              MY+++P +YWGL++YNA+ FP++SS LF   G  YDI+AIVN +FE+D D Y ++GRI 
Sbjct  318   FMYVIVPAAYWGLDLYNARRFPIFSSHLFMFNGTGYDINAIVNDRFEIDMDAYQQRGRIN  377

Query  1182  LSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK-NYKDIPSW  1358
             +ST F+L+YG  FA IA+T+THVALF+ +EIY R+RAS K K DIHT+LMK NY+D P W
Sbjct  378   MSTLFALTYGLSFAAIAATVTHVALFHSKEIYRRFRASQKDKPDIHTRLMKKNYEDAPGW  437

Query  1359  WFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNI  1538
             WFY LLV+++AVSL LC  L +EVQ+P+WGL+FA A+AF+FTLP+SIITATTNQTPGLN+
Sbjct  438   WFYSLLVLSVAVSLILCTVLKEEVQLPWWGLLFACAMAFVFTLPVSIITATTNQTPGLNV  497

Query  1539  ITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTL  1718
             ++EY++G+I PGKPIANVCFK YGYMSM+QA++FL DFKLGHYMKIPP+SMFLVQF+GT+
Sbjct  498   LSEYVIGLILPGKPIANVCFKVYGYMSMSQAVSFLQDFKLGHYMKIPPKSMFLVQFVGTI  557

Query  1719  IAGTINMSVAWWLLHSIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSE  1892
             +AGT+N++VA+WLL SI NIC QD L  ++SPWTCPSDRVFFD+SVIWGLVGP+RIF + 
Sbjct  558   VAGTVNLAVAYWLLGSIPNIC-QDALLPADSPWTCPSDRVFFDSSVIWGLVGPRRIFGAL  616

Query  1893  GNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWI  2072
             GNY ALNW FL G  GP IV+ LH+ FP Q WI +INLPVL+GAT SMPPAT++NY+SW+
Sbjct  617   GNYGALNWSFLVGAAGPAIVYGLHKAFPGQRWIRMINLPVLMGATASMPPATAVNYNSWL  676

Query  2073  LVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLE  2252
             L+G  FNFFVFRYRKKWW+RYNYILSA LDAGVAFM VLLYFT+ +E+R ISWWGT   E
Sbjct  677   LIGIAFNFFVFRYRKKWWERYNYILSAALDAGVAFMGVLLYFTLSMENRNISWWGTAG-E  735

Query  2253  HCDLASCPTAKGIAVDG---CPV  2312
             HC LASCPTA+G+ +     CPV
Sbjct  736   HCLLASCPTARGVDLGAESVCPV  758



>ref|XP_002452707.1| hypothetical protein SORBIDRAFT_04g031080 [Sorghum bicolor]
 gb|EES05683.1| hypothetical protein SORBIDRAFT_04g031080 [Sorghum bicolor]
Length=755

 Score =  1012 bits (2617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/734 (70%), Positives = 613/734 (84%), Gaps = 6/734 (1%)
 Frame = +3

Query  123   DVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIIT  302
             D +DE+ SP+E+VRLTV  TDDP+LPVWTFRMW +G++SC L+SFLNQFF+YR EPL++T
Sbjct  25    DDDDEDASPVEQVRLTVPTTDDPSLPVWTFRMWSIGLLSCALMSFLNQFFAYRTEPLVVT  84

Query  303   SITVQVATLPIGRFMAAALPAAKFRIPG-FGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
              ITVQVA+LP+G F+A  LP  +FR P   G G++SLNPGPFN+KEHVLI+IFANAGFAF
Sbjct  85    QITVQVASLPVGHFLARVLPRTRFRAPAMLGGGEWSLNPGPFNIKEHVLISIFANAGFAF  144

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
             G GSAYAVGI+NII AFY+R+ISFF  WLL+ITTQVLGYGWAGL++KYVVEPAHMWWPST
Sbjct  145   GVGSAYAVGIINIIRAFYQRQISFFTAWLLVITTQVLGYGWAGLMRKYVVEPAHMWWPST  204

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR LHEK+E      +  +SR+KFF++ L CSF WY  PGY+F TL SISWVCW
Sbjct  205   LVQVSLFRALHEKDESAKASRQ--ISRSKFFLVVLICSFAWYVVPGYLFPTLTSISWVCW  262

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
             VF KSVTA QLGSG+ GLGLGA TLDWST++S+L SPL+ PFFA  N+F GY   +Y+++
Sbjct  263   VFSKSVTAQQLGSGMLGLGLGAFTLDWSTVSSYLYSPLISPFFATANIFFGYVFFLYVIL  322

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             PISYWG N+YNAK FP++SS LF + G EY+I +IVN QF+LD+D Y K G+I LS FF+
Sbjct  323   PISYWGFNLYNAKTFPIFSSHLFMSNGTEYNIPSIVNSQFQLDKDTYDKNGKINLSVFFA  382

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLV  1379
             + YGF FATIA+TITHV LFYG+EIY R+++S K K D+HTKLM  Y DIP+WWF+ L+ 
Sbjct  383   VGYGFSFATIAATITHVGLFYGKEIYQRFKSSQKEKPDVHTKLMNKYSDIPAWWFHSLMA  442

Query  1380  VTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMG  1559
             ++IAV+L LC  LN EVQ+ +WGLIFA  +AF+FTLPISIITATTNQ+PGLN+ITEYIMG
Sbjct  443   LSIAVALLLCTVLNHEVQLQWWGLIFACGMAFIFTLPISIITATTNQSPGLNVITEYIMG  502

Query  1560  IIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINM  1739
             +I PG PIANVCFKTYGYMSM QA+AFLSDFKLGHYMKIPP+SMFLVQF+GT++AGT+N+
Sbjct  503   LIKPGYPIANVCFKTYGYMSMQQAVAFLSDFKLGHYMKIPPKSMFLVQFVGTIVAGTVNI  562

Query  1740  SVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWF  1919
               AWWLL SI  IC     ++SPWTCPSDRVFFDASVIWGLVGP+RIF  EGNY ALNWF
Sbjct  563   GTAWWLLGSIHGICSDSLPADSPWTCPSDRVFFDASVIWGLVGPRRIFGPEGNYGALNWF  622

Query  1920  FLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFF  2099
             FL G+ GPVIV+  HR FP+Q WIPLINLPVL GAT +MPPAT++NY+SW+L GTIFNFF
Sbjct  623   FLIGLAGPVIVYAFHRMFPNQKWIPLINLPVLFGATAAMPPATAVNYNSWLLFGTIFNFF  682

Query  2100  VFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPT  2279
             VFRYRK WW RYNYILSA LDAGVAFM V+LYF++ +E+++I WWGT   EHC LA CPT
Sbjct  683   VFRYRKMWWTRYNYILSAALDAGVAFMGVVLYFSLTMENKSIDWWGTAG-EHCPLAKCPT  741

Query  2280  AKGIAV-DG-CPVF  2315
             AKG+ + DG CPVF
Sbjct  742   AKGVDLGDGICPVF  755



>ref|XP_006304646.1| hypothetical protein CARUB_v10011782mg [Capsella rubella]
 gb|EOA37544.1| hypothetical protein CARUB_v10011782mg [Capsella rubella]
Length=735

 Score =  1009 bits (2608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/748 (67%), Positives = 621/748 (83%), Gaps = 14/748 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             M  +E   P +  A +D   E+ SP+EEVRLTV+N DDP+LPVWTFRMW LG++SCVLLS
Sbjct  1     MAAIESHKPEITNADDD---EDESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLS  57

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLN FF YR +PL+IT I+VQV TLP+G+ MA  LP  K++I   GS +FS NPGPFN+K
Sbjct  58    FLNTFFGYRTQPLMITMISVQVVTLPLGKLMARVLPETKYKI---GSWEFSFNPGPFNVK  114

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI++FANAG  FG+G+AYAVGIV+II+AFY+RKISF A W+L+ITTQ+LGYGWAG++
Sbjct  115   EHVLISMFANAGAGFGSGTAYAVGIVDIIMAFYKRKISFLASWILVITTQILGYGWAGIM  174

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             +K VV+PA MWWP++++Q+SLFR LHEK+          MSR KFFVI+  CSF WY FP
Sbjct  175   RKLVVDPAQMWWPTSVLQVSLFRALHEKDNAR-------MSRGKFFVIAFVCSFAWYIFP  227

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
              Y+F TL+SISWVCW FPKS+TA QLGSG++GLG+GA  LDWS IAS+L SPLV PFFAI
Sbjct  228   AYLFLTLSSISWVCWAFPKSITAQQLGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAI  287

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
             VNV VGY ++MY+V+PISYWG+NVY A  FP++SSDLF  QG+ Y+IS IVN +FELD  
Sbjct  288   VNVLVGYILVMYMVIPISYWGMNVYEANKFPIFSSDLFDKQGELYNISTIVNNKFELDMG  347

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
              Y ++GR+YLSTFF++SYG GFA I ST+THVALF G+ I+ + RASTK K+DIHT+LMK
Sbjct  348   NYQQEGRVYLSTFFAISYGIGFAAIVSTLTHVALFNGKGIWQQVRASTKAKVDIHTRLMK  407

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
              YKDIPSWWFY LL +++A+SL LCIF+ D++QMP+WGL+ A+ +A  FT+P+SIITATT
Sbjct  408   KYKDIPSWWFYGLLAISLALSLVLCIFMKDQIQMPWWGLLLASFMALTFTVPVSIITATT  467

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQTPGLNIITEY+MG++ PG+PIANVCFKTYGY+SM+QAI+FL+DFKLGHYMKIPPRSMF
Sbjct  468   NQTPGLNIITEYLMGVLLPGRPIANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPRSMF  527

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGP  1871
             LVQ IGT+IAGT+N+SVAW+LL S+ENIC ++ L  NSPWTCPSDRVFFDASVIWGLVGP
Sbjct  528   LVQLIGTVIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGP  587

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATS  2051
             KRIF   GNY ALNWFFLGG++GPV+VWLL + FP+++WI  INLPVLLGAT +MPPATS
Sbjct  588   KRIFGRLGNYPALNWFFLGGLIGPVLVWLLQKAFPTKTWISQINLPVLLGATAAMPPATS  647

Query  2052  LNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISW  2231
             +N++ WI+VG IFN+FVF+Y K WWQRYNY+LSA LDAG+AFM VLLYF++ +   +I  
Sbjct  648   VNFNCWIIVGVIFNYFVFKYYKGWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISIDH  707

Query  2232  WGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             W   + E+C LASCPTA GI V+GCPVF
Sbjct  708   WWGANGENCPLASCPTAPGIQVEGCPVF  735



>ref|XP_010458316.1| PREDICTED: oligopeptide transporter 2-like [Camelina sativa]
Length=736

 Score =  1008 bits (2607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/726 (68%), Positives = 612/726 (84%), Gaps = 13/726 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SP+EEVRLTV+N DDP+LPVWTFRMW LG++SCVLLSFLN FF YR +PL+IT I+VQV 
Sbjct  22    SPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMISVQVV  81

Query  324   TLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
             TLP+G+ MA  LP  K++I   GS +FSLNPGPFN+KEHVLI++FANAG  FG+G+AYAV
Sbjct  82    TLPLGKLMARVLPETKYKI---GSWEFSLNPGPFNVKEHVLISMFANAGAGFGSGTAYAV  138

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFR  683
             GIV+II+AFY+RKISF A W+L+ITTQ+LGYGWAG+++K VV+PA MWWP++++Q+SLFR
Sbjct  139   GIVDIIVAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQVSLFR  198

Query  684   TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTA  863
              LHEK+          MSR KFFVI+  CSF WY FP Y+F TL+SISWVCW FPKS+TA
Sbjct  199   ALHEKDNAR-------MSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFPKSITA  251

Query  864   HQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLN  1043
              QLGSG++GLG+GA  LDWS IAS+L SPLV PFFAIVNVFVGY ++MY+V+PISY+G+N
Sbjct  252   QQLGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAIVNVFVGYILVMYMVIPISYYGMN  311

Query  1044  VYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFA  1223
             +Y A  FP++SSDLF  QGQ Y+IS IVN +FELD   Y ++GR+YLSTFF++SYG GFA
Sbjct  312   MYEANKFPIFSSDLFDKQGQLYNISTIVNDKFELDMGNYQQEGRVYLSTFFAISYGIGFA  371

Query  1224  TIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLA  1403
              I ST+THVALF G+ I+ + RASTK K+DIHT+LMK YKDIP WWFY LL ++I +SL 
Sbjct  372   AIVSTLTHVALFNGKGIWQQVRASTKSKVDIHTRLMKKYKDIPGWWFYGLLAISIVLSLV  431

Query  1404  LCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPI  1583
             LCIF+ +++QMP+WGL+ A+ +A  FT+P+SIITATTNQTPGLNIITEY+MG++ PG+PI
Sbjct  432   LCIFMKEQIQMPWWGLLLASFMAVTFTVPVSIITATTNQTPGLNIITEYLMGVLLPGRPI  491

Query  1584  ANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLH  1763
             ANVCFKTYGY+SM+QAI+FL+DFKLGHYMKIPPRSMFLVQ IGT+IAGT+N+SVAW+LL 
Sbjct  492   ANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPRSMFLVQLIGTVIAGTVNISVAWYLLT  551

Query  1764  SIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILG  1940
             S+ENIC ++ L  NSPWTCPSDRVFFDASVIWGLVGPKRIF   GNY ALNWFFLGG++G
Sbjct  552   SVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYPALNWFFLGGLIG  611

Query  1941  PVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKK  2120
             PV+VWLL + FP+++WI  INLPVLLGAT +MPPATS+N++ WI+VG IFN+FVF+Y K 
Sbjct  612   PVLVWLLQKAFPTRTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVIFNYFVFKYYKG  671

Query  2121  WWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTIS-WWGTTDLEHCDLASCPTAKGIAV  2297
             WWQRYNY+LSA LDAG+AFM VLLYF++ +   +I  WWG    E+C LA+CPTA GI V
Sbjct  672   WWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISIDHWWGAKG-ENCPLAACPTAPGIQV  730

Query  2298  DGCPVF  2315
             +GCPVF
Sbjct  731   EGCPVF  736



>ref|XP_008646108.1| PREDICTED: oligopeptide transporter 4-like [Zea mays]
 gb|AFW72904.1| hypothetical protein ZEAMMB73_956147 [Zea mays]
Length=758

 Score =  1007 bits (2604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/740 (69%), Positives = 610/740 (82%), Gaps = 5/740 (1%)
 Frame = +3

Query  105   LKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRR  284
             +K  G   +DEE SPIE+VRLTV  TDD +LPVWTFRMW +G++SC L+SFLNQFFSYR 
Sbjct  21    VKEEGILDDDEETSPIEQVRLTVPTTDDSSLPVWTFRMWSIGLLSCALMSFLNQFFSYRT  80

Query  285   EPLIITSITVQVATLPIGRFMAAALPAAKFRIPGF-GSGQFSLNPGPFNMKEHVLITIfa  461
             EPL++T ITVQVA+LP+G FMA ALP  +FR P   G G +SLNPGPFN+KEHVLI IFA
Sbjct  81    EPLVVTQITVQVASLPVGHFMARALPRTRFRAPALLGGGAWSLNPGPFNIKEHVLICIFA  140

Query  462   nagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAH  641
             NAGFAFG GSAYAVGI+NII AFY R ISF   WLL++TTQVLGYGWAGL++KYVV+PAH
Sbjct  141   NAGFAFGGGSAYAVGIINIIRAFYGRHISFLTAWLLVVTTQVLGYGWAGLMRKYVVQPAH  200

Query  642   MWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLAS  821
             MWWP TLVQ+SLF+ LHEK++E     R+ +SR+KFFV+ L CSF WY  PGY+F TL S
Sbjct  201   MWWPGTLVQVSLFQALHEKKDESAKASRQ-ISRSKFFVVVLACSFAWYAVPGYLFPTLTS  259

Query  822   ISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAI  1001
             ISW+CWVF KSVTA QLGSG+ GLGL A TLDWST++SFL SPL+ PFFA  N+FVGY +
Sbjct  260   ISWLCWVFSKSVTAQQLGSGMKGLGLFAFTLDWSTVSSFLFSPLISPFFATANIFVGYVV  319

Query  1002  IMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIY  1181
              +Y++MP++YWG ++Y+AK FP++SS LF + G EYD+ +IVN QFELD   Y + G++ 
Sbjct  320   FVYVIMPMAYWGFDLYSAKTFPIFSSHLFMSNGTEYDVKSIVNNQFELDRQAYDRNGKVN  379

Query  1182  LSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWW  1361
             LS FF+L+YGF FATIASTITHV LFYG+EIY R+++S + K DIHT+LM  Y +IP+WW
Sbjct  380   LSVFFALTYGFSFATIASTITHVGLFYGKEIYHRFKSSQREKPDIHTRLMSKYSEIPAWW  439

Query  1362  FYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNII  1541
             FY L+ ++IAVSL LC  L  EVQ+P+WGLIFA  +AF+FTLPISIITATTNQ+PGLN+I
Sbjct  440   FYSLMALSIAVSLILCTVLKREVQLPWWGLIFACGMAFLFTLPISIITATTNQSPGLNVI  499

Query  1542  TEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLI  1721
             TEY MG+I PG PIA VCFK YGYMSM+QA+AFLSDFKLGHYMKIPP+SMFLVQF+GT++
Sbjct  500   TEYAMGLIMPGSPIAVVCFKVYGYMSMSQAVAFLSDFKLGHYMKIPPKSMFLVQFVGTIV  559

Query  1722  AGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNY  1901
             AGTIN+  AWWLL SI  IC      +SPWTCP+DRVFFDASVIWGLVGP RIF   GNY
Sbjct  560   AGTINIGTAWWLLGSIHGICSDSLPPDSPWTCPNDRVFFDASVIWGLVGPMRIFGPGGNY  619

Query  1902  NALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVG  2081
              A+NWFFL G  GPVIV+ LHR FPSQSWIPLINLPVL GAT SMPPAT++NY+SW+LVG
Sbjct  620   GAVNWFFLIGAAGPVIVYALHRVFPSQSWIPLINLPVLFGATASMPPATAVNYNSWLLVG  679

Query  2082  TIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCD  2261
             TIFNFFVFRYRK+WW RYNYILSAGLDAGVAFM VLLYF++ +++++I WWGT   EHC 
Sbjct  680   TIFNFFVFRYRKRWWTRYNYILSAGLDAGVAFMGVLLYFSLTMQNKSIDWWGTAG-EHCP  738

Query  2262  LASCPTAKGIAV-DG-CPVF  2315
             LA CPTAKG+ + DG CPVF
Sbjct  739   LAKCPTAKGVDLGDGVCPVF  758



>ref|XP_011016978.1| PREDICTED: oligopeptide transporter 2 [Populus euphratica]
Length=738

 Score =  1007 bits (2603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/750 (66%), Positives = 611/750 (81%), Gaps = 15/750 (2%)
 Frame = +3

Query  75    MGTVEIEA-PALKLAGEDVN-DEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVL  248
             M ++EIE  P      E++  D+ VSPIEEVRLTV   DD TLPVWTFRMW LG+ SC++
Sbjct  1     MDSLEIEGKPQNPNMNENIEEDDGVSPIEEVRLTVPTRDDHTLPVWTFRMWFLGIASCII  60

Query  249   LSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFN  428
             LSFLN FFSYR EPL I+ I+VQV TLP+GRFMA  LP  KFR+PGFG  +FSLNPGPFN
Sbjct  61    LSFLNTFFSYRTEPLTISMISVQVVTLPVGRFMAKTLPTTKFRVPGFGGREFSLNPGPFN  120

Query  429   MKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAG  608
             +KEHVLI+IFAN G +    +AYAVGI++II+AFY+RKISF A W+L++TTQ+LGYGWAG
Sbjct  121   VKEHVLISIFANVGSS----TAYAVGIIDIIMAFYKRKISFLASWILVLTTQMLGYGWAG  176

Query  609   LLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYF  788
             +++KYVV+PA MWWP +L+Q+SLFR LHEK+          MSR KFF+++L CSF WY 
Sbjct  177   IMRKYVVDPAEMWWPLSLMQVSLFRALHEKDNSR-------MSRGKFFLVALICSFSWYV  229

Query  789   FPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFF  968
             FPGY+F  + +ISWVCW FPKSVTA QLGSG+ GLG+GA  LDWS IASF+ SPL+ PFF
Sbjct  230   FPGYLFPAIGTISWVCWAFPKSVTAQQLGSGMRGLGIGAFGLDWSVIASFIGSPLITPFF  289

Query  969   AIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELD  1148
             A+VNV VGYA  MY+++PI+YW LN+YNAK FP++SS LF  +G  Y++SAIV+  FELD
Sbjct  290   AVVNVLVGYAAFMYVILPIAYWRLNIYNAKTFPIFSSHLFDNKGHVYNVSAIVDNNFELD  349

Query  1149  EDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKL  1328
             E  + +QG I LS FFSL+YG GFA I ST+THV +F G+EI+ ++RAS KGKMD+HT+L
Sbjct  350   EAAFQRQGNINLSVFFSLTYGIGFAAIMSTLTHVLMFNGKEIWQQFRASYKGKMDVHTRL  409

Query  1329  MKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITA  1508
             MK Y+DIP WWF++ LV++  +SL LCI + D+VQMP+W LIFA+ LA +FTLP+S+ITA
Sbjct  410   MKRYEDIPGWWFHLTLVLSFLLSLVLCIVMKDQVQMPWWALIFASGLALIFTLPVSVITA  469

Query  1509  TTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRS  1688
             TTNQTPGLNIITEYIMG+IYPG+PIANVCFKTYGY+SMTQA++FLSDFKLGHYMKIPPRS
Sbjct  470   TTNQTPGLNIITEYIMGLIYPGRPIANVCFKTYGYISMTQAVSFLSDFKLGHYMKIPPRS  529

Query  1689  MFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLV  1865
             MF+VQ IGTLI GT+N +VAWWLL  IENIC  + L  NSPWTCP DRVF+DASVIWGL+
Sbjct  530   MFVVQCIGTLINGTLNTAVAWWLLTGIENICQDELLPPNSPWTCPGDRVFYDASVIWGLI  589

Query  1866  GPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPA  2045
             GP RIF   GNY ALNWFFLGG+LGPV+VW LHR FP Q WI LINLPVLLG+T +MPPA
Sbjct  590   GPARIFGRLGNYTALNWFFLGGVLGPVLVWGLHRLFPKQKWIKLINLPVLLGSTAAMPPA  649

Query  2046  TSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTI  2225
             T++N++ WI+V   FN+FVF++ K WWQRYNY+LSA LDAG+AFM VLLYF++ +++ ++
Sbjct  650   TTVNFNCWIVVAITFNYFVFKFHKVWWQRYNYVLSAALDAGLAFMGVLLYFSLTMKEISL  709

Query  2226  SWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             +WWG    EHC LA+CPTAKG+ VDGCPV+
Sbjct  710   NWWGAAG-EHCPLATCPTAKGVIVDGCPVY  738



>ref|XP_008378664.1| PREDICTED: oligopeptide transporter 2-like [Malus domestica]
Length=743

 Score =  1004 bits (2597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/745 (68%), Positives = 608/745 (82%), Gaps = 11/745 (1%)
 Frame = +3

Query  84    VEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLN  263
             +E+EA A+    ED ND++VS +E+VRLTV+N DD +LPVWTFRMW +G+ SC LLSFLN
Sbjct  8     LEVEAAAITEIEEDKNDDDVSSVEQVRLTVSNEDDSSLPVWTFRMWTIGICSCFLLSFLN  67

Query  264   QFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHV  443
              FFSYR EPL+I+ I+VQVA+LPIGRFMA  LP  KF I   G   FSLNPG FN+KEHV
Sbjct  68    TFFSYRTEPLVISMISVQVASLPIGRFMARTLPRRKFWI---GGKSFSLNPGEFNIKEHV  124

Query  444   LITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKY  623
             LI+IFANAG  FGNG AYAVGIVNII AFY RKISFFA W L+ITTQVLGYGWAG+++KY
Sbjct  125   LISIFANAGSGFGNGPAYAVGIVNIIKAFYGRKISFFASWALVITTQVLGYGWAGIIRKY  184

Query  624   VVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYI  803
             VV+PA MWWPS+LVQ+SLFR LHEK++         MSR KFF+I+L CSF WY  PGY+
Sbjct  185   VVDPAAMWWPSSLVQVSLFRALHEKDKNR-------MSRGKFFLIALVCSFSWYAVPGYL  237

Query  804   FQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNV  983
             F TL+ ISW+CW++PKS+ A Q+GSG  GLGLG+ TLDWS I+S+L SPL+ PFFAI N+
Sbjct  238   FTTLSIISWICWIYPKSIRAQQIGSGYRGLGLGSFTLDWSVISSYLGSPLISPFFAIANI  297

Query  984   FVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYA  1163
              VGY  IMY+++PI+YW LN+YNAK F ++SS LF + GQ Y++  IVN QF++D   Y 
Sbjct  298   TVGYIAIMYVIIPIAYWRLNLYNAKNFAIFSSHLFDSDGQIYNVKGIVNDQFQIDMPAYE  357

Query  1164  KQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYK  1343
             KQG I LS FF+LSYG GFA + ST+THVALF GR+IY+RY++S  GK+DIHTKLM+ Y+
Sbjct  358   KQGYINLSVFFTLSYGLGFAAVISTLTHVALFNGRDIYERYKSSYSGKIDIHTKLMRKYR  417

Query  1344  DIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQT  1523
             DIPSWWF+VLLVV+   SLALCIF+ DEVQMP+WGLIFAA +A +FTLPISIITATTN T
Sbjct  418   DIPSWWFHVLLVVSFVFSLALCIFMKDEVQMPWWGLIFAAGIALIFTLPISIITATTNVT  477

Query  1524  PGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQ  1703
             PGLNIITEY+MG+I PG PIANVCFKTYGY+SM+QAI+FLSDFKLGHYMKIPP SMF+VQ
Sbjct  478   PGLNIITEYVMGLILPGYPIANVCFKTYGYISMSQAISFLSDFKLGHYMKIPPISMFVVQ  537

Query  1704  FIGTLIAGTINMSVAWWLLHSIENICHQDKLSN-SPWTCPSDRVFFDASVIWGLVGPKRI  1880
              IGT++AGT+N+  AWWLL ++ENIC+ D L + SPWTCP+D VFF ASVIWGLVGP RI
Sbjct  538   CIGTIVAGTVNIGTAWWLLTTVENICNTDLLPDTSPWTCPNDSVFFTASVIWGLVGPTRI  597

Query  1881  FDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNY  2060
             F S G Y  LNWFF+ G LGPV+VWLLH+ FPSQ WI  INLPVL GAT +MPPAT++N+
Sbjct  598   FGSLGLYGGLNWFFVVGALGPVLVWLLHKAFPSQXWIAYINLPVLFGATAAMPPATTVNF  657

Query  2061  SSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGT  2240
             +SWI+VG +FN+FVFRYRKKWWQRYNY+LSA LDAGVAFM VL+Y  + + + +ISWWGT
Sbjct  658   NSWIVVGIVFNYFVFRYRKKWWQRYNYVLSAALDAGVAFMGVLIYICLTINNVSISWWGT  717

Query  2241  TDLEHCDLASCPTAKGIAVDGCPVF  2315
              D +HC L++CPT+KGI +D   VF
Sbjct  718   ADYDHCILSTCPTSKGIELDHACVF  742



>gb|EEE57620.1| hypothetical protein OsJ_08019 [Oryza sativa Japonica Group]
Length=748

 Score =  1004 bits (2597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/728 (70%), Positives = 603/728 (83%), Gaps = 7/728 (1%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIEEVRLTV   DD  LPVWTFRMW +G++SC LLSFLNQFFSYR EPLI+T ITVQVA
Sbjct  24    SPIEEVRLTVPAGDDTALPVWTFRMWSIGLLSCALLSFLNQFFSYRTEPLIVTQITVQVA  83

Query  324   TLPIGRFMAAALPAAKFRIPGF-GSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYA  500
             +LP+G F+A  LP   FR P   G G++SLNPGPFNMKEHVLI+IFANAG AFGNG+AYA
Sbjct  84    SLPVGHFLARVLPRRAFRAPALLGGGEWSLNPGPFNMKEHVLISIFANAGCAFGNGNAYA  143

Query  501   VGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLF  680
             V IV+II AFY+R ISF A WLLIITTQVLGYGWAGL++K+VVEPAHMWWP TLVQ+SLF
Sbjct  144   VMIVDIIRAFYKRSISFVAAWLLIITTQVLGYGWAGLMRKFVVEPAHMWWPGTLVQVSLF  203

Query  681   RTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVT  860
             R LHEK+E   G  +  +SR+KFF+++L CSF WY  PGY+F TL SISWVCWVF KSVT
Sbjct  204   RALHEKDELPHGSRQ--ISRSKFFLVALICSFAWYAVPGYLFPTLTSISWVCWVFSKSVT  261

Query  861   AHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGL  1040
             A QLGSGL GLG+GA +LDW+ I+SFL SPL+ PFFA  N+FVG+ + +Y+++PI+YWG 
Sbjct  262   AQQLGSGLKGLGVGAFSLDWTAISSFLFSPLISPFFATANIFVGFVLFLYVLVPIAYWGF  321

Query  1041  NVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGF  1220
             ++YNAK FP++SS LF + G  YDI+AIVN +FELD D Y K GRI LS FF+L+YG  F
Sbjct  322   DLYNAKTFPIFSSHLFMSNGTSYDITAIVNDKFELDIDAYNKLGRINLSVFFALAYGLSF  381

Query  1221  ATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSL  1400
             ATIAST+THV LFYG+EIY R+RAS K K DIHT+LMK Y DIP WWFY L+ +++ V+L
Sbjct  382   ATIASTVTHVGLFYGKEIYHRFRASQKEKPDIHTRLMKKYDDIPVWWFYSLMALSMTVAL  441

Query  1401  ALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKP  1580
              LC  L  EVQ+P+WGL+FA  +AF+FTLPISII+ATTNQTPGLN+ITEY +G+I PG P
Sbjct  442   ILCTVLKHEVQLPWWGLLFACGMAFIFTLPISIISATTNQTPGLNVITEYAIGLIIPGHP  501

Query  1581  IANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLL  1760
             IANVCFK YGYMSM+QAIAFLSDFKLGHYMKIPP+SMFLVQFIGT++AGT+N+ VAWWLL
Sbjct  502   IANVCFKVYGYMSMSQAIAFLSDFKLGHYMKIPPKSMFLVQFIGTIVAGTVNLGVAWWLL  561

Query  1761  HSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILG  1940
              SI +IC     ++SPWTCP+DRVFFDASVIWGL+GP RIF   GNY+ALNWFFL G  G
Sbjct  562   GSIHDICQDSLPADSPWTCPNDRVFFDASVIWGLIGPIRIFGPHGNYSALNWFFLIGAAG  621

Query  1941  PVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKK  2120
             PVIV++ H+ FP++ WI L NLPVL+GAT SMPPAT++NY+SW+L GTIFNFFVFRYRKK
Sbjct  622   PVIVYIFHKMFPNKKWITLTNLPVLIGATASMPPATAVNYNSWLLFGTIFNFFVFRYRKK  681

Query  2121  WWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVD  2300
             WW+RYNYILSA LDAGVAFMAVLLYF++ +E+R+I WWGT   EHC LA+CPTAKG+ + 
Sbjct  682   WWERYNYILSAALDAGVAFMAVLLYFSLSMENRSIDWWGTAG-EHCPLATCPTAKGVDLG  740

Query  2301  G---CPVF  2315
                 CPVF
Sbjct  741   PTSVCPVF  748



>gb|EEC73829.1| hypothetical protein OsI_08562 [Oryza sativa Indica Group]
Length=757

 Score =  1001 bits (2589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/737 (69%), Positives = 604/737 (82%), Gaps = 16/737 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIEEVRLTV   DD  LPVWTFRMW +G++SC LLSFLNQFFSYR EPLI+T ITVQVA
Sbjct  24    SPIEEVRLTVPAGDDTALPVWTFRMWSIGLLSCALLSFLNQFFSYRTEPLIVTQITVQVA  83

Query  324   TLPIGRFMAAALPAAKFRIPGF-GSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYA  500
             +LP+G F+A  LP   FR P   G G++SLNPGPFNMKEHVLI+IFANAG AFGNG+AYA
Sbjct  84    SLPVGHFLARVLPRRAFRAPALLGGGEWSLNPGPFNMKEHVLISIFANAGCAFGNGNAYA  143

Query  501   VGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLF  680
             V IV+II AFY+R ISF A WLLIITTQVLGYGWAGL++K+VVEPAHMWWP TLVQ+SLF
Sbjct  144   VMIVDIIRAFYKRSISFVAAWLLIITTQVLGYGWAGLMRKFVVEPAHMWWPGTLVQVSLF  203

Query  681   R---------TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWV  833
             R          LHEK+E   G  +  +SR+KFF+++L CSF WY  PGY+F TL SISWV
Sbjct  204   RGNIVPVRLTALHEKDELPHGSRQ--ISRSKFFLVALICSFAWYAVPGYLFPTLTSISWV  261

Query  834   CWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYL  1013
             CWVF KSVTA QLGSGL GLG+GA +LDW+ I+SFL SPL+ PFFA  N+FVG+ + +Y+
Sbjct  262   CWVFSKSVTAQQLGSGLKGLGVGAFSLDWTAISSFLFSPLISPFFATANIFVGFVLFLYV  321

Query  1014  VMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTF  1193
             ++PI+YWG N+YNAK FP++SS LF + G  YDI+AIVN +FELD D Y K GRI LS F
Sbjct  322   LVPIAYWGFNLYNAKTFPIFSSHLFMSNGTSYDITAIVNDKFELDIDAYNKLGRINLSVF  381

Query  1194  FSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVL  1373
             F+L+YG  FATIAST+THV LFYG+EIY R+RAS K K DIHT+LMK Y DIP WWFY L
Sbjct  382   FALAYGLSFATIASTVTHVGLFYGKEIYHRFRASQKEKPDIHTRLMKKYDDIPVWWFYSL  441

Query  1374  LVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYI  1553
             + +++ V+L LC  L  EVQ+P+WGL+FA  +AF+FTLPISII+ATTNQTPGLN+ITEY 
Sbjct  442   MALSMTVALILCTVLKHEVQLPWWGLLFACGMAFIFTLPISIISATTNQTPGLNVITEYA  501

Query  1554  MGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTI  1733
             +G+I PG PIANVCFK YGYMSM+QAIAFLSDFKLGHYMKIPP+SMFLVQFIGT++AGT+
Sbjct  502   IGLIIPGHPIANVCFKVYGYMSMSQAIAFLSDFKLGHYMKIPPKSMFLVQFIGTIVAGTV  561

Query  1734  NMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALN  1913
             N+ VAWWLL SI +IC     ++SPWTCP+DRVFFDASVIWGL+GP RIF   GNY+ALN
Sbjct  562   NLGVAWWLLGSIHDICQDSLPADSPWTCPNDRVFFDASVIWGLIGPIRIFGPHGNYSALN  621

Query  1914  WFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFN  2093
             WFFL G  GPVIV++ H+ FP++ WI LINLPVL+GAT SMPPAT++NY+SW+L GTIFN
Sbjct  622   WFFLIGAAGPVIVYIFHKMFPNKKWITLINLPVLIGATASMPPATAVNYNSWLLFGTIFN  681

Query  2094  FFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASC  2273
             FFVFRYRKKWW+RYNYILSA LDAGVAFMAVLLYF++ +E+R+I WWGT   EHC LA+C
Sbjct  682   FFVFRYRKKWWERYNYILSAALDAGVAFMAVLLYFSLSMENRSIDWWGTAG-EHCALATC  740

Query  2274  PTAKGIAVDG---CPVF  2315
             PTAKG+ +     CPVF
Sbjct  741   PTAKGVDLGPTSVCPVF  757



>gb|EYU21027.1| hypothetical protein MIMGU_mgv1a026700mg [Erythranthe guttata]
Length=735

 Score =  1001 bits (2588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/728 (69%), Positives = 609/728 (84%), Gaps = 10/728 (1%)
 Frame = +3

Query  135   EEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITV  314
             EEVSPIE+VRLTV N DDPTLPVWTFRMW LG++SC+LLSFLN FFSYR EPL +T I+V
Sbjct  15    EEVSPIEQVRLTVPNGDDPTLPVWTFRMWFLGLLSCILLSFLNTFFSYRTEPLTVTMISV  74

Query  315   QVATLPIGRFMAAALPAAKFRIPGFGSGQ-FSLNPGPFNMKEHVLITIfanagfafgngS  491
             QVATLPIGRFMA  LP  KF +PGFGS + FSLNPGPFNMKEHVLI+IFANAG AFG GS
Sbjct  75    QVATLPIGRFMANVLPTTKFTVPGFGSSRLFSLNPGPFNMKEHVLISIFANAGSAFGGGS  134

Query  492   AYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQI  671
             AYAV IV+II A Y+R ISF A  LL++TTQVLGYGWAG+L+KYV+EPA MWWPS+LVQ+
Sbjct  135   AYAVEIVDIIKAIYKRNISFTASLLLVLTTQVLGYGWAGILRKYVIEPAEMWWPSSLVQV  194

Query  672   SLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPK  851
             SLFR LHEKE  ++       SRA+FF+I++ CSFCWY FPGY+F TL++IS +C  +P 
Sbjct  195   SLFRALHEKESSKN-------SRARFFLIAMGCSFCWYIFPGYLFPTLSNISLLCLAYPN  247

Query  852   SVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISY  1031
             SVTA Q+GSG+ GLG+ + T DWS +ASFL SPLV PFFAI+NVF+GY + +Y+++PI Y
Sbjct  248   SVTAQQIGSGMRGLGIASFTFDWSVVASFLGSPLVTPFFAILNVFLGYFVTLYIMIPICY  307

Query  1032  WGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYG  1211
             WGLN+Y AK FP++SS +F  +GQ Y++SAIVN +FE+D   Y K GRI LS FF+++YG
Sbjct  308   WGLNLYAAKTFPIFSSHMFDHKGQVYNVSAIVNDKFEIDLPTYDKLGRINLSMFFAVTYG  367

Query  1212  FGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIA  1391
               FA I +T+THVA F G EIY+R++ S KGK DIHT+LM+ Y+DIP+WWFY +LV+T  
Sbjct  368   LNFAAIVATLTHVAFFNGNEIYERFKDSHKGKQDIHTRLMRKYEDIPNWWFYGILVITFG  427

Query  1392  VSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYP  1571
             VSL LC  + D+VQ+P+WGLI +AALA MFTLPISIITATTNQTPGLNIITEYI+G IYP
Sbjct  428   VSLLLCTVMIDQVQLPWWGLILSAALALMFTLPISIITATTNQTPGLNIITEYIIGYIYP  487

Query  1572  GKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAW  1751
             G+PIANVCFKTYGY+SM QAI+FL+DFKLGHYMK+PPRSMF+VQ +GTLIAG +N++VAW
Sbjct  488   GRPIANVCFKTYGYISMHQAISFLNDFKLGHYMKVPPRSMFIVQLVGTLIAGLVNIAVAW  547

Query  1752  WLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLG  1928
             +LL +IENIC  + L  NS WTCP+DRVF+DASVIWGLVGPKR F + GNYNALNWFFLG
Sbjct  548   YLLTNIENICQDELLPPNSQWTCPNDRVFYDASVIWGLVGPKRFFGTLGNYNALNWFFLG  607

Query  1929  GILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFR  2108
             G +GP  VW+LH+  PSQ WI  +NLP+LLGAT +MPPAT+LN++SW+LVGTIFN FVFR
Sbjct  608   GAVGPFFVWILHKALPSQKWIKSVNLPILLGATAAMPPATTLNFNSWMLVGTIFNLFVFR  667

Query  2109  YRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKG  2288
             YRK WWQRYNY+LSA LDAG+AFM V LYFT+G+E+ T++WWG+   EHCDLA+CPTA+G
Sbjct  668   YRKAWWQRYNYVLSAALDAGLAFMGVALYFTLGIEEVTLTWWGSKG-EHCDLATCPTARG  726

Query  2289  IAVDGCPV  2312
             + VDGCPV
Sbjct  727   VIVDGCPV  734



>dbj|BAD08158.1| putative sexual differentiation process protein isp4 [Oryza sativa 
Japonica Group]
Length=751

 Score =  1000 bits (2585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/731 (69%), Positives = 603/731 (82%), Gaps = 10/731 (1%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIEEVRLTV   DD  LPVWTFRMW +G++SC LLSFLNQFFSYR EPLI+T ITVQVA
Sbjct  24    SPIEEVRLTVPAGDDTALPVWTFRMWSIGLLSCALLSFLNQFFSYRTEPLIVTQITVQVA  83

Query  324   TLPIGRFMAAALPAAKFRIPGF-GSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYA  500
             +LP+G F+A  LP   FR P   G G++SLNPGPFNMKEHVLI+IFANAG AFGNG+AYA
Sbjct  84    SLPVGHFLARVLPRRAFRAPALLGGGEWSLNPGPFNMKEHVLISIFANAGCAFGNGNAYA  143

Query  501   VGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLF  680
             V IV+II AFY+R ISF A WLLIITTQVLGYGWAGL++K+VVEPAHMWWP TLVQ+SLF
Sbjct  144   VMIVDIIRAFYKRSISFVAAWLLIITTQVLGYGWAGLMRKFVVEPAHMWWPGTLVQVSLF  203

Query  681   RTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVT  860
             R LHEK+E   G  +  +SR+KFF+++L CSF WY  PGY+F TL SISWVCWVF KSVT
Sbjct  204   RALHEKDELPHGSRQ--ISRSKFFLVALICSFAWYAVPGYLFPTLTSISWVCWVFSKSVT  261

Query  861   AHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGL  1040
             A QLGSGL GLG+GA +LDW+ I+SFL SPL+ PFFA  N+FVG+ + +Y+++PI+YWG 
Sbjct  262   AQQLGSGLKGLGVGAFSLDWTAISSFLFSPLISPFFATANIFVGFVLFLYVLVPIAYWGF  321

Query  1041  NVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGF  1220
             ++YNAK FP++SS LF + G  YDI+AIVN +FELD D Y K GRI LS FF+L+YG  F
Sbjct  322   DLYNAKTFPIFSSHLFMSNGTSYDITAIVNDKFELDIDAYNKLGRINLSVFFALAYGLSF  381

Query  1221  ATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSL  1400
             ATIAST+THV LFYG+EIY R+RAS K K DIHT+LMK Y DIP WWFY L+ +++ V+L
Sbjct  382   ATIASTVTHVGLFYGKEIYHRFRASQKEKPDIHTRLMKKYDDIPVWWFYSLMALSMTVAL  441

Query  1401  ALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQ---TPGLNIITEYIMGIIYP  1571
              LC  L  EVQ+P+WGL+FA  +AF+FTLPISII+ATTNQ   TPGLN+ITEY +G+I P
Sbjct  442   ILCTVLKHEVQLPWWGLLFACGMAFIFTLPISIISATTNQASYTPGLNVITEYAIGLIIP  501

Query  1572  GKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAW  1751
             G PIANVCFK YGYMSM+QAIAFLSDFKLGHYMKIPP+SMFLVQFIGT++AGT+N+ VAW
Sbjct  502   GHPIANVCFKVYGYMSMSQAIAFLSDFKLGHYMKIPPKSMFLVQFIGTIVAGTVNLGVAW  561

Query  1752  WLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGG  1931
             WLL SI +IC     ++SPWTCP+DRVFFDASVIWGL+GP RIF   GNY+ALNWFFL G
Sbjct  562   WLLGSIHDICQDSLPADSPWTCPNDRVFFDASVIWGLIGPIRIFGPHGNYSALNWFFLIG  621

Query  1932  ILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRY  2111
               GPVIV++ H+ FP++ WI L NLPVL+GAT SMPPAT++NY+SW+L GTIFNFFVFRY
Sbjct  622   AAGPVIVYIFHKMFPNKKWITLTNLPVLIGATASMPPATAVNYNSWLLFGTIFNFFVFRY  681

Query  2112  RKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGI  2291
             RKKWW+RYNYILSA LDAGVAFMAVLLYF++ +E+R+I WWGT   EHC LA+CPTAKG+
Sbjct  682   RKKWWERYNYILSAALDAGVAFMAVLLYFSLSMENRSIDWWGTAG-EHCPLATCPTAKGV  740

Query  2292  AVDG---CPVF  2315
              +     CPVF
Sbjct  741   DLGPTSVCPVF  751



>emb|CDY69955.1| BnaCnng66090D [Brassica napus]
Length=732

 Score =   998 bits (2581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/719 (68%), Positives = 606/719 (84%), Gaps = 11/719 (2%)
 Frame = +3

Query  162   RLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGR  341
             RLTV+N DDP+LPVWTFRMW LG++SCVLLSFLN FF YR +PL+IT I+VQV TLP+G+
Sbjct  24    RLTVSNEDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMISVQVVTLPLGK  83

Query  342   FMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNII  521
              MA  LP  K+RI   GS +FS NPGPFN+KEHVLI++FANAG  FG+G+AYAVGIV+II
Sbjct  84    IMARILPETKYRI---GSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAYAVGIVDII  140

Query  522   IAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHeke  701
             +AFY+RKISF A W+L+ITTQ+LGYGWAG+++K VV+PA MWWP++++Q+SLFR LHEK+
Sbjct  141   MAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQVSLFRALHEKD  200

Query  702   eeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsg  881
             +         MSR KFFVI+  CSF WY FP Y+F TL+SISWVCW FPKS+TA Q+GSG
Sbjct  201   KAR-------MSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFPKSITAQQIGSG  253

Query  882   lnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKI  1061
             ++GLG+G+  LDWS IAS+L SPLV PFFAIVNV VGY +IMY+V+P+SYWG+NVY A  
Sbjct  254   MSGLGVGSFALDWSVIASYLGSPLVTPFFAIVNVLVGYVLIMYMVIPVSYWGMNVYEAHK  313

Query  1062  FPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTI  1241
             FP++SSDLF +QGQ Y+IS IVN +FELDE  Y ++GR+YLSTFF+++YG GFA I ST+
Sbjct  314   FPIFSSDLFDSQGQLYNISTIVNDKFELDEVMYQREGRVYLSTFFAITYGIGFAAIVSTL  373

Query  1242  THVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLN  1421
             THVALF G+ I+ + RAS   K+DIHT+LMK YKDIPSWWFY +L V++A+SL LC  + 
Sbjct  374   THVALFNGKGIWQQVRASATAKVDIHTRLMKKYKDIPSWWFYSMLAVSLALSLVLCTVMK  433

Query  1422  DEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFK  1601
             DE+QMP+WGL+ A+ +A +FT+P+SIITATTNQTPGLNIITEY+MG++ PG+PIANV FK
Sbjct  434   DEIQMPWWGLLLASFMALIFTVPVSIITATTNQTPGLNIITEYLMGVLLPGRPIANVVFK  493

Query  1602  TYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENIC  1781
             TYGY+SM+QAI+FL+DFKLGHYMKIPPRSMFLVQFIGT+IAGT+N+SVAW+LL S+ENIC
Sbjct  494   TYGYISMSQAISFLNDFKLGHYMKIPPRSMFLVQFIGTIIAGTVNISVAWYLLTSVENIC  553

Query  1782  HQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWL  1958
              ++ L  NSPWTCPSDRVFFDASVIWGLVGPKRIF S GNY ALNWFFLGG++GPV+VWL
Sbjct  554   QKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGSLGNYPALNWFFLGGLVGPVLVWL  613

Query  1959  LHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYN  2138
             L + FP+++WI  INLPVLLGAT +MPPATS+N++ WI+VG +FN+FVF+  KKWWQRYN
Sbjct  614   LQKAFPTRTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVVFNYFVFKNYKKWWQRYN  673

Query  2139  YILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             Y+LSA LDAG+AFM VLLYF++ +   +I  W   + E+C LASCPTA G+ V+GCPVF
Sbjct  674   YVLSAALDAGLAFMGVLLYFSLTMNGISIGHWWGAEGENCPLASCPTAPGVHVEGCPVF  732



>ref|XP_002301110.1| oligopeptide transporter OPT family protein [Populus trichocarpa]
 gb|EEE80383.1| oligopeptide transporter OPT family protein [Populus trichocarpa]
Length=724

 Score =   998 bits (2581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/730 (67%), Positives = 599/730 (82%), Gaps = 13/730 (2%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
              D+ VSPIEEVRLTV   DD TLPVWTFRMW LG+ SC++LSFLN FFSYR EPL I+ I
Sbjct  7     EDDGVSPIEEVRLTVPTRDDHTLPVWTFRMWFLGIASCIILSFLNTFFSYRTEPLTISMI  66

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgng  488
             +VQV TLPIGRFMA  LP AKFR+PGFG  +FSLNPGPFN+KEHVLI+IFAN G +    
Sbjct  67    SVQVVTLPIGRFMAKTLPTAKFRVPGFGGREFSLNPGPFNVKEHVLISIFANVGSS----  122

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
             +AYAVGI++II+AFY+RKISF A W+L++TTQ+LGYGWAG+++KYVV+PA MWWP +L+Q
Sbjct  123   TAYAVGIIDIIMAFYKRKISFLASWILVLTTQMLGYGWAGIMRKYVVDPAEMWWPLSLMQ  182

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +SLFR LHEK+          MSR KFF+I+L CSF WY FPGY+F  + +ISWVCW FP
Sbjct  183   VSLFRALHEKDNSR-------MSRGKFFLIALICSFSWYVFPGYLFPAIGTISWVCWAFP  235

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
             KSVTA QLGSG+ GLG+GA  LDWS IASF+ SPL+ PFFA VNV VGYA  MY+++PI+
Sbjct  236   KSVTAQQLGSGMRGLGIGAFGLDWSVIASFIGSPLITPFFAAVNVLVGYAAFMYVILPIA  295

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             YW  N+YNAK FP++SS LF  +G  Y++SAIV+  FELD   + +QG I LS FFSL+Y
Sbjct  296   YWRFNLYNAKTFPIFSSHLFDTKGHVYNVSAIVDNNFELDVAAFQRQGNINLSVFFSLTY  355

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTI  1388
             G GFA I ST+THV +F G+EI+ ++RAS KGKMD+HT+LMK Y+DIP WWF++ LV++ 
Sbjct  356   GIGFAAIMSTLTHVLVFNGKEIWQQFRASYKGKMDVHTRLMKRYEDIPGWWFHLTLVLSF  415

Query  1389  AVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIY  1568
              +SL LCI + D+VQMP+W LIFA+ LA +FTLP+S+ITATTNQTPGLNIITEYIMG+IY
Sbjct  416   LLSLVLCIVMKDQVQMPWWALIFASGLALIFTLPVSVITATTNQTPGLNIITEYIMGLIY  475

Query  1569  PGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVA  1748
             PG+PIANVCFKTYGY+SMTQA++FLSDFKLGHYMKIPPRSMF+VQ IGTLI GT+N +VA
Sbjct  476   PGRPIANVCFKTYGYISMTQAVSFLSDFKLGHYMKIPPRSMFVVQCIGTLINGTLNTAVA  535

Query  1749  WWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             WWLL  IENIC  + L  NSPWTCP DRVF+DASVIWGL+GP RIF   GNY ALNWFFL
Sbjct  536   WWLLTGIENICQDELLPPNSPWTCPGDRVFYDASVIWGLIGPARIFGRLGNYTALNWFFL  595

Query  1926  GGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVF  2105
             GG+LGPV+VW LHR FP Q WI LINLPVLLG+T +MPPAT++N++ WI+V   FN+F+F
Sbjct  596   GGVLGPVLVWGLHRLFPKQKWIKLINLPVLLGSTAAMPPATTVNFNCWIVVAITFNYFIF  655

Query  2106  RYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAK  2285
             ++ K WWQRYNY+LSA LDAG+AFM VLLYF++ +++ +++WWG    EHC LA+CPTAK
Sbjct  656   KFHKVWWQRYNYVLSAALDAGLAFMGVLLYFSLTMKEISLNWWGAAG-EHCPLATCPTAK  714

Query  2286  GIAVDGCPVF  2315
             G+ VDGCPV+
Sbjct  715   GVIVDGCPVY  724



>ref|XP_009118291.1| PREDICTED: oligopeptide transporter 2 [Brassica rapa]
Length=732

 Score =   996 bits (2575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/719 (68%), Positives = 605/719 (84%), Gaps = 11/719 (2%)
 Frame = +3

Query  162   RLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGR  341
             RLTV+N DDP+LPVWTFRMW LG++SCVLLSFLN FF YR +PL+IT I+VQV TLP+G+
Sbjct  24    RLTVSNEDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMISVQVVTLPLGK  83

Query  342   FMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNII  521
              MA  LP  K+RI   GS +FS NPGPFN+KEHVLI++FANAG  FG+G+AYAVGIV+II
Sbjct  84    IMARILPETKYRI---GSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAYAVGIVDII  140

Query  522   IAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHeke  701
             +AFY+RKISF A W+L+ITTQ+LGYGWAG+++K VV+PA MWWP++++Q+SLFR LHEK+
Sbjct  141   MAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQVSLFRALHEKD  200

Query  702   eeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsg  881
             +         MSR KFFVI+  CSF WY FP Y+F TL+SISWVCW FPKS+TA Q+GSG
Sbjct  201   KAR-------MSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFPKSITAQQIGSG  253

Query  882   lnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKI  1061
             ++GLGLG+  LDWS IAS+L SPLV PFFAIVNV VGY +IMY+V+P+SYWG+NVY A  
Sbjct  254   MSGLGLGSFALDWSVIASYLGSPLVTPFFAIVNVLVGYVLIMYMVIPVSYWGMNVYEAHK  313

Query  1062  FPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTI  1241
             FP++SSDLF +QGQ Y+IS IVN +FELDE  Y ++GR+YLSTFF+++YG GFA I ST+
Sbjct  314   FPIFSSDLFDSQGQLYNISTIVNDKFELDEVMYQQEGRVYLSTFFAITYGIGFAAIVSTL  373

Query  1242  THVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLN  1421
             THVALF G+ I+ + RAS   K+DIHT+LMK YKDIPSWWFY +L V++A+SL LC  + 
Sbjct  374   THVALFNGKGIWQQVRASATAKVDIHTRLMKKYKDIPSWWFYSMLAVSLALSLVLCTVMK  433

Query  1422  DEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFK  1601
             DE+QMP+WGL+ A+ +A +FT+P+SIITATTNQTPGLNIITEY+MG++ PG+PIANV FK
Sbjct  434   DEIQMPWWGLLLASFMALIFTVPVSIITATTNQTPGLNIITEYLMGVLLPGRPIANVVFK  493

Query  1602  TYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENIC  1781
             TYGY+SM+QAI+FL+DFKLGHYMKIPPRSMFLVQFIGT+IAGT+N+SVAW+LL S+ENIC
Sbjct  494   TYGYISMSQAISFLNDFKLGHYMKIPPRSMFLVQFIGTIIAGTVNISVAWYLLTSVENIC  553

Query  1782  HQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWL  1958
              ++ L  NSPWTCPSDRVFFDASVIWGLVGPKRIF   GNY ALNWFFLGG++GPV+VWL
Sbjct  554   QKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYPALNWFFLGGLVGPVLVWL  613

Query  1959  LHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYN  2138
             L + FP+++WI  INLPVLLGAT +MPPATS+N++ WI+VG +FN+FVF+  KKWWQRYN
Sbjct  614   LQKAFPTRTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVVFNYFVFKNYKKWWQRYN  673

Query  2139  YILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             Y+LSA LDAG+AFM VLLYF++ +   +I  W   + E+C LASCPTA G+ V+GCPVF
Sbjct  674   YVLSAALDAGLAFMGVLLYFSLTMNGISIGHWWGAEGENCPLASCPTAPGVHVEGCPVF  732



>ref|XP_010671041.1| PREDICTED: oligopeptide transporter 2 [Beta vulgaris subsp. vulgaris]
Length=729

 Score =   994 bits (2570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/726 (67%), Positives = 607/726 (84%), Gaps = 10/726 (1%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIE+VRLTV+NTDDP LPVWTFRMW LGV+SCVLLSFLN +F+Y+ EPLIIT ITVQVA
Sbjct  12    SPIEQVRLTVSNTDDPNLPVWTFRMWFLGVISCVLLSFLNTYFNYQDEPLIITMITVQVA  71

Query  324   TLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
             TLPIGR M   LP  K+++   GS +F LNPGPFN+KEHVLI++FANAG AFG+G+AYA+
Sbjct  72    TLPIGRLMERVLPTTKYKL---GSWEFCLNPGPFNVKEHVLISMFANAGSAFGSGTAYAI  128

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFR  683
              IV+II  FY RKISF A W+L+ITTQVLGYGWAG+L+KYVV+PA MWWPS+LVQ+SLFR
Sbjct  129   SIVDIIKVFYMRKISFLASWILVITTQVLGYGWAGILRKYVVDPAEMWWPSSLVQVSLFR  188

Query  684   TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTA  863
              LHEK++ +       +++ +FF I+L CSFCW   P Y+F T+++++ +C  FPKS+ A
Sbjct  189   ALHEKQDRKTDRT---LTKGQFFAIALVCSFCWQVVPSYLFPTISNLAIICLAFPKSILA  245

Query  864   HQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLN  1043
             HQ+GSGL GLG+GA + DW+ +A+F  SPLV PFFAI N+ VGYA++MYLV+PISYWGLN
Sbjct  246   HQIGSGLQGLGIGAFSFDWNVVAAFNLSPLVTPFFAIANIAVGYALMMYLVIPISYWGLN  305

Query  1044  VYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFA  1223
             +YNAK FP +SS LFT  G+ YD+ AIVNK+FELD   YAKQGR+ LS FF+L+YGFGFA
Sbjct  306   LYNAKTFPFFSSHLFTPAGKRYDVRAIVNKKFELDLPAYAKQGRVNLSMFFALTYGFGFA  365

Query  1224  TIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLA  1403
              + +T+THVALF+G++IY ++RA +  ++DIHT+LM+ Y+DIP+WWFY+LL+V++A+SL 
Sbjct  366   AVVATLTHVALFHGKDIYRQFRALSSREVDIHTRLMRKYRDIPNWWFYILLIVSLALSLV  425

Query  1404  LCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPI  1583
             LCIF+ D++QMP+W LIFAA LA  FTLP+SIITATTNQTPGLN+ITEYIMG+I PGKPI
Sbjct  426   LCIFMKDQIQMPWWALIFAAGLALSFTLPVSIITATTNQTPGLNVITEYIMGLILPGKPI  485

Query  1584  ANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLH  1763
             ANVCFKTYGY+SM QA++FL+DFKLGHYMK+PPRSMFLVQ IGT+IAGT N+  AW+ L+
Sbjct  486   ANVCFKTYGYISMAQAVSFLNDFKLGHYMKVPPRSMFLVQLIGTIIAGTTNLMAAWYFLN  545

Query  1764  SIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
             +++NIC QD+L    S WTCP+D VFFDASVIWGL+GP+R+F   GNY ++NWFFLGG +
Sbjct  546   TVQNIC-QDQLLPPGSTWTCPNDNVFFDASVIWGLIGPRRMFGPLGNYGSINWFFLGGAI  604

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
             GP++VW LH+ FP   WIPLINLPVLLGATG+MPP++S+N++SWI +G IFN+ V RYRK
Sbjct  605   GPLLVWSLHKAFPKYKWIPLINLPVLLGATGNMPPSSSINFTSWIFIGFIFNYLVLRYRK  664

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV  2297
              WWQ+YNYILSA LDAGVAF+ VLLYF +G  DR ISWWG +  E+CDLA+CPTAKGI  
Sbjct  665   NWWQKYNYILSAALDAGVAFITVLLYFALG-SDRGISWWGGSGSEYCDLATCPTAKGIVA  723

Query  2298  DGCPVF  2315
             DGCPVF
Sbjct  724   DGCPVF  729



>emb|CDY22616.1| BnaC08g42500D [Brassica napus]
Length=880

 Score =   994 bits (2570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/717 (68%), Positives = 604/717 (84%), Gaps = 11/717 (2%)
 Frame = +3

Query  162   RLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGR  341
             RLTV+N DDP+LPVWTFRMW LG++SCVLLSFLN FF YR +PL+IT I+VQV TLP+G+
Sbjct  24    RLTVSNEDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMISVQVVTLPLGK  83

Query  342   FMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNII  521
              MA  LP  K+RI   GS +FS NPGPFN+KEHVLI++FANAG  FG+G AYAVGIV+II
Sbjct  84    IMARILPETKYRI---GSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGIAYAVGIVDII  140

Query  522   IAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHeke  701
             +AFY+RKISF A W+L+ITTQ+LGYGWAG+++K VV+PA MWWP++++Q+SLFR LHEK+
Sbjct  141   MAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQVSLFRALHEKD  200

Query  702   eeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsg  881
             +         MSR KFFVI+  CSF WY FP Y+F TL+SISWVCW FPKS+TA Q+GSG
Sbjct  201   KAR-------MSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFPKSITAQQIGSG  253

Query  882   lnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKI  1061
             ++GLGLG+  LDWS IAS+L SPLV PFFAIVNV VGY +IMY+V+PISYWG+NVY A  
Sbjct  254   MSGLGLGSFALDWSVIASYLGSPLVTPFFAIVNVLVGYVLIMYMVIPISYWGMNVYEAHK  313

Query  1062  FPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTI  1241
             FP++SSDLF +QGQ Y+IS IVN +FELDE  Y ++GR+YLSTFF+++YG GFA I ST+
Sbjct  314   FPIFSSDLFDSQGQLYNISTIVNDKFELDEVMYQREGRVYLSTFFAITYGIGFAAIVSTL  373

Query  1242  THVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLN  1421
             THVALF G+ I+ + RAST  K+DIHT+LMK YKDIPSWWFY +L V++A+SL LC  + 
Sbjct  374   THVALFNGKGIWQQIRASTTAKVDIHTRLMKKYKDIPSWWFYSMLAVSLALSLVLCTVMK  433

Query  1422  DEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFK  1601
             DE+QMP+WGL+ A+ +A +FT+P+SIITATTNQTPGLNIITEY+MG++ PG+PIANV FK
Sbjct  434   DEIQMPWWGLLLASFMALIFTVPVSIITATTNQTPGLNIITEYLMGVLLPGRPIANVVFK  493

Query  1602  TYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENIC  1781
             TYGY+SM+QAI+FL+DFKLGHYMKIPPRSMFLVQFIGT+IAGT+N+SVAW+LL S+ENIC
Sbjct  494   TYGYISMSQAISFLNDFKLGHYMKIPPRSMFLVQFIGTIIAGTVNISVAWYLLTSVENIC  553

Query  1782  HQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWL  1958
              ++ L  NSPWTCPSDRVFFDASVIWGLVGPKRIF S GNY ALNWFFLGG++GPV+VWL
Sbjct  554   QKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGSLGNYPALNWFFLGGLVGPVLVWL  613

Query  1959  LHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYN  2138
             L + FP+++WI  INLPVLLGAT +MPPATS+N++ WI+VG +FN+FVF+  KKWWQRYN
Sbjct  614   LQKAFPTRTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVVFNYFVFKNYKKWWQRYN  673

Query  2139  YILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCP  2309
             Y+LSA LDAG+AFM VLLYF++ +   +I  W   + E+C LASCPTA G+ V+GCP
Sbjct  674   YVLSAALDAGLAFMGVLLYFSLTMNGISIGHWWGAEGENCPLASCPTAPGVHVEGCP  730



>ref|XP_003581597.1| PREDICTED: oligopeptide transporter 4-like [Brachypodium distachyon]
Length=736

 Score =   994 bits (2569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/731 (67%), Positives = 596/731 (82%), Gaps = 13/731 (2%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
              D++VSP+E+VRLTV  TDDPTLP+WTFRMW +G VSC LLSF NQFF+YR EP+II+ I
Sbjct  17    EDDDVSPVEQVRLTVPVTDDPTLPLWTFRMWTIGFVSCALLSFFNQFFAYRTEPIIISQI  76

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgng  488
             T+QVA LPIG FMA  LP  K R+ G    + SLNPGPFN+KEHVLI+IFANAG AFG+G
Sbjct  77    TIQVAALPIGHFMARVLPERKLRVFGH---ECSLNPGPFNVKEHVLISIFANAGAAFGSG  133

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
             SAYAVGIVNI+ AFY+R ISFF   LLIITTQVLGYGWAGLL+KYVVEPAHMWWP +LVQ
Sbjct  134   SAYAVGIVNIVKAFYKRNISFFTSLLLIITTQVLGYGWAGLLRKYVVEPAHMWWPQSLVQ  193

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +SL R +HEKE          M+R KFF+I+L CSF WY  PGY+F TL +ISWVCWVFP
Sbjct  194   VSLMRAMHEKENRR-------MTRGKFFLIALICSFAWYTVPGYLFPTLTAISWVCWVFP  246

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
              S+T  Q+GSG+NGLG+GA+TLDWS +ASFLSSPLV PFFA  NVF GY + +Y+++P+S
Sbjct  247   SSITMQQIGSGMNGLGVGAVTLDWSMVASFLSSPLVSPFFATANVFAGYVLFVYIMLPVS  306

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             YW LN+YNA  +PL+S+DLFT  GQ Y+ISAIVN +F +D D Y KQG+I+LS FF++SY
Sbjct  307   YWVLNLYNASTYPLFSNDLFTGSGQLYNISAIVNDRFAIDLDAYGKQGKIHLSLFFAVSY  366

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTI  1388
             G GFATIA+T++HV LFYG+E+Y R+R S KGK D+HT+LM+ Y+DIP+WWFY+LL V++
Sbjct  367   GLGFATIAATLSHVVLFYGKEMYQRFRESYKGKTDVHTRLMRKYEDIPNWWFYLLLTVSM  426

Query  1389  AVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIY  1568
              +S+ LC    +EVQ+P+WGL+ A  +AF+FTLPIS+ITATTN TPGLNIITEY +G+I 
Sbjct  427   VLSMVLCTVFKEEVQLPWWGLLLACVVAFVFTLPISVITATTNTTPGLNIITEYCLGLIM  486

Query  1569  PGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVA  1748
             PGKPIANVCFK YGYMSM QA++FL+DFKLGHYMKIPP+SMFLVQFIGTLIA T+NM VA
Sbjct  487   PGKPIANVCFKVYGYMSMNQAVSFLTDFKLGHYMKIPPKSMFLVQFIGTLIASTVNMIVA  546

Query  1749  WWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             WWLL ++ +IC +D L   SPWTCP D VFFDASVIWGLVGP+RIF   G YNALNWFFL
Sbjct  547   WWLLTTVPHICEKDMLPEGSPWTCPGDHVFFDASVIWGLVGPRRIFGPLGYYNALNWFFL  606

Query  1926  GGILGPVIVWLLHRKFPSQS-WIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFV  2102
              G+ GPV+VWL  R  P  + WI L+N+PV+LGAT +MPPA++LNY+SW LVGT+FNFFV
Sbjct  607   VGLFGPVVVWLAARAVPRHAGWISLVNMPVILGATANMPPASALNYTSWCLVGTVFNFFV  666

Query  2103  FRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTA  2282
             FRYRK WW+RYNY+LSA +DAGVA M VL++F +    R + WWG+   EHCDLA+CPTA
Sbjct  667   FRYRKGWWKRYNYVLSAAMDAGVAIMGVLIFFALTSSGRQLDWWGSRG-EHCDLAACPTA  725

Query  2283  KGIAVDGCPVF  2315
             KG+ VDGCPV 
Sbjct  726   KGVVVDGCPVL  736



>gb|KHN33580.1| Oligopeptide transporter 4 [Glycine soja]
Length=773

 Score =   990 bits (2560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/667 (76%), Positives = 578/667 (87%), Gaps = 9/667 (1%)
 Frame = +3

Query  315   QVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSA  494
             ++  LPIG FMAA LP   F IPGFGS  FS NPGPFNMKEHVLITIFANAG AFG+GS 
Sbjct  114   ELIKLPIGHFMAAFLPTTTFSIPGFGSKSFSFNPGPFNMKEHVLITIFANAGSAFGSGSP  173

Query  495   YAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQIS  674
             YAVGIVNII AFY R ISF A WLLIITTQVLGYGWAGLL+KYVVEPAHMWWPSTLVQ+S
Sbjct  174   YAVGIVNIIKAFYGRSISFAASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVS  233

Query  675   LFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKS  854
             LFR LHEK++         +SRAKFF I+L CSF WY  PGY+F TL +ISWVCW+F KS
Sbjct  234   LFRALHEKDDHR-------LSRAKFFFIALVCSFSWYVVPGYLFTTLTNISWVCWIFSKS  286

Query  855   VTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYW  1034
             VTA Q+GSG+ GLG+GALTLDW+ +ASFL SPL+ PFFAIVNVFVGYA+I+Y+V+P+SYW
Sbjct  287   VTAQQIGSGMRGLGVGALTLDWAAVASFLFSPLISPFFAIVNVFVGYALIVYVVIPVSYW  346

Query  1035  GLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGF  1214
             GLNVYNA  FP++SS LFTAQGQ+Y+I  IV+  FEL+  EY KQGRI+LS FF+L+YGF
Sbjct  347   GLNVYNANRFPIFSSHLFTAQGQKYNIPKIVDNHFELNVAEYEKQGRIHLSVFFALTYGF  406

Query  1215  GFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAV  1394
             GFATIAST+THV  FYGREI +RYRAS+KGK DIHTKLM+ YKDIPSWWF+ LL+VT+ V
Sbjct  407   GFATIASTLTHVVCFYGREIMERYRASSKGKEDIHTKLMRRYKDIPSWWFHSLLLVTLLV  466

Query  1395  SLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPG  1574
             SLALCIFL D+VQMP+WGL+FA  LAF FTLPISIITATTNQTPGLNIITEY+ G+IYPG
Sbjct  467   SLALCIFLKDQVQMPWWGLLFAGVLAFGFTLPISIITATTNQTPGLNIITEYVFGLIYPG  526

Query  1575  KPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWW  1754
             +PIANVCFKTYGY+SM QA++FLSDFKLGHYMKIPPRSMFLVQFIGT++AGTIN+ VAWW
Sbjct  527   RPIANVCFKTYGYISMAQAVSFLSDFKLGHYMKIPPRSMFLVQFIGTMLAGTINIGVAWW  586

Query  1755  LLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGG  1931
             LL+SI+NICH D L   SPWTCP DRVFFDASVIWGLVGPKRIF S+GNY+A+NWFFLGG
Sbjct  587   LLNSIKNICHDDLLPEGSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYSAMNWFFLGG  646

Query  1932  ILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRY  2111
              +GP+IVWLLH+ FP QSWIPLINLPVLLGATG MPPAT LNY++WI VGTIFNFF+FRY
Sbjct  647   AVGPIIVWLLHKAFPKQSWIPLINLPVLLGATGMMPPATPLNYNAWIFVGTIFNFFIFRY  706

Query  2112  RKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGI  2291
             RKKWWQRYNY+LSA LD+GVAFM VLLYF +GLE+++++WWG  D EHC LA CPTAKG+
Sbjct  707   RKKWWQRYNYVLSAALDSGVAFMTVLLYFALGLENKSLNWWG-NDGEHCPLAVCPTAKGV  765

Query  2292  AVDGCPV  2312
              VDGCP 
Sbjct  766   IVDGCPA  772



>ref|XP_007137663.1| hypothetical protein PHAVU_009G145300g [Phaseolus vulgaris]
 gb|ESW09657.1| hypothetical protein PHAVU_009G145300g [Phaseolus vulgaris]
Length=733

 Score =   990 bits (2559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/748 (67%), Positives = 613/748 (82%), Gaps = 16/748 (2%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             M T+++E    + A  D   ++VSPIEEVR+ V+N D+P  PVWTFRMW+LG+++ VLLS
Sbjct  1     MSTIDMEGEGAESAKRD---DDVSPIEEVRMVVSNEDNPNEPVWTFRMWLLGIMAVVLLS  57

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLN FF YR +PL +T I+VQVATLPIGRFMA  LP  K RI   G  +FSLNPGPFN K
Sbjct  58    FLNTFFGYRSQPLTVTMISVQVATLPIGRFMAKVLPRRKVRI---GGREFSLNPGPFNTK  114

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI+IFANAG AFG+GSAYAVGIV+II  FY RKI+F A WLL++TTQVLGYGWAG++
Sbjct  115   EHVLISIFANAGAAFGSGSAYAVGIVDIIRVFYGRKITFLASWLLVLTTQVLGYGWAGIM  174

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             KKYVVEPA MWWP TLVQ+SLFR LHEKE +        MS+ KFF+I+L CSF WY  P
Sbjct  175   KKYVVEPAEMWWPGTLVQVSLFRALHEKERKR-------MSKEKFFIIALTCSFAWYVVP  227

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
             GY+F TL+ ISWVCW+FP SVTAHQ+GSG NGLGLG+ +LDW+TIASFL +PLV PFFAI
Sbjct  228   GYLFPTLSIISWVCWIFPHSVTAHQVGSGTNGLGLGSFSLDWTTIASFLGNPLVTPFFAI  287

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
              NVFVGY +++YL++P +YWGLN+Y+AK FP+YSS LFTA G  Y+++AIVN++FE+D  
Sbjct  288   ANVFVGYILLIYLIIPTAYWGLNLYSAKNFPIYSSSLFTANGDAYNVTAIVNQKFEIDMQ  347

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
              Y KQG + LS FF++SYG GFA IAS++THVA+F GREIY+++R+S  GK DIHT+LMK
Sbjct  348   AYEKQGLVNLSVFFAISYGLGFAAIASSLTHVAIFNGREIYEQFRSSRSGKEDIHTRLMK  407

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
              YK IP+WWF+V L+++  ++L LC  + D+VQMP+WGLIFA+ LA  FTLPISIITATT
Sbjct  408   KYKSIPNWWFHVTLLLSFLLALLLCTVMKDQVQMPWWGLIFASGLALTFTLPISIITATT  467

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQ+PGLNIITEYIMG+I PGKPIANVCFKTYGY+SM+QA++FLSDFKLGHYMKIPPRSMF
Sbjct  468   NQSPGLNIITEYIMGVILPGKPIANVCFKTYGYISMSQAVSFLSDFKLGHYMKIPPRSMF  527

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGP  1871
             +VQ IGTLIAG++++ VAWWLL SI+NIC QD L  NSPWTCP D VFFDASVIWGLVGP
Sbjct  528   IVQVIGTLIAGSVDVGVAWWLLGSIKNICKQDLLPENSPWTCPGDHVFFDASVIWGLVGP  587

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATS  2051
             KRIF + G Y  LNWFFL G +GPV++W L + FP Q WI LI+LPVLLGAT +MPPA++
Sbjct  588   KRIFGTLGKYQKLNWFFLIGAVGPVVIWALRKLFPKQHWISLIHLPVLLGATANMPPAST  647

Query  2052  LNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISW  2231
             +N++SWI+VGTIFN+FVF+YRK WWQRYNY+L+A LDAG+AFM VLLYF V +E + I W
Sbjct  648   VNFNSWIVVGTIFNYFVFKYRKNWWQRYNYVLAAALDAGLAFMTVLLYFAVTMEGKGIEW  707

Query  2232  WGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             WGT   EHC LA CPTAKG+  D CP+F
Sbjct  708   WGTG--EHCPLAKCPTAKGVVADACPLF  733



>ref|XP_004288878.1| PREDICTED: oligopeptide transporter 2-like [Fragaria vesca subsp. 
vesca]
Length=746

 Score =   982 bits (2539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/718 (68%), Positives = 609/718 (85%), Gaps = 12/718 (2%)
 Frame = +3

Query  141   VSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQV  320
             +SPIE+VRLTV+N DDP+LPVWTFRMW +G++SCVLLSF+N FFSYR EPL+I+ IT+QV
Sbjct  32    LSPIEQVRLTVSNDDDPSLPVWTFRMWSIGLLSCVLLSFVNTFFSYRTEPLVISMITIQV  91

Query  321   ATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYA  500
             A+LPIG+FMA  LP  KFRI   GS +FSLNPG FN+KEHVLI+IFAN G  FG+G AYA
Sbjct  92    ASLPIGKFMARTLPTRKFRI---GSKEFSLNPGEFNIKEHVLISIFANTGAGFGSGPAYA  148

Query  501   VGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLF  680
             +GIV I+ AFY R+ISF A W+L+ITTQVLGYGWAG+L+KYVV+PA MWWPS+LVQ+SLF
Sbjct  149   IGIVTIVKAFYGRRISFLASWILVITTQVLGYGWAGILRKYVVDPATMWWPSSLVQVSLF  208

Query  681   RTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVT  860
             R LHEK+          MSR KFF+I+L CSF +Y  PGY+F T+ +ISW+CW++PKS+T
Sbjct  209   RALHEKDNNR-------MSRGKFFLIALVCSFSFYIVPGYLFMTIGTISWICWLYPKSIT  261

Query  861   AHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGL  1040
             A Q+GSG+ GLG+G+LTLDWS IAS+L SPL+ PFFAIVN+ VG+ +IMY+V+P +YWG 
Sbjct  262   AQQIGSGMRGLGIGSLTLDWSVIASYLGSPLISPFFAIVNITVGFMLIMYVVLPTAYWGF  321

Query  1041  NVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGF  1220
             N+YNAK F ++S +LF   GQ Y+++AIVN +FE+D   Y +QG + LS FFSL+YG GF
Sbjct  322   NLYNAKNFAIFSKNLFDDNGQIYNVTAIVNDKFEIDMPAYKQQGHVNLSVFFSLTYGIGF  381

Query  1221  ATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSL  1400
             A + STITHV LF+GRE+Y++Y+A+  GK+DIHT+LM+NY+DIP+WWF++LL++++A+SL
Sbjct  382   AGVISTITHVVLFHGREMYEKYKAAHSGKVDIHTRLMRNYRDIPTWWFHILLLLSLALSL  441

Query  1401  ALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKP  1580
              LCIF+ DEVQMP+WGLIFAAA+A +FTLPIS+ITATTNQTPGLN+ITEYIMG+I PGKP
Sbjct  442   GLCIFMKDEVQMPWWGLIFAAAIASIFTLPISVITATTNQTPGLNVITEYIMGLILPGKP  501

Query  1581  IANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLL  1760
             IANVCFKTYGY+SM QAI+FLSDFKLGHYMKIPP SMF+VQ IGT+I+GT+N+  AWWLL
Sbjct  502   IANVCFKTYGYISMAQAISFLSDFKLGHYMKIPPISMFIVQCIGTIISGTVNIGTAWWLL  561

Query  1761  HSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
              ++ENIC +D L + SPWTC SD VFFDASVIWGLVGPKRIF S G Y+ALNWFFL G +
Sbjct  562   TTVENICREDLLPAGSPWTCASDGVFFDASVIWGLVGPKRIFGSLGYYSALNWFFLFGAI  621

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
             GP+IVW+LH+ FP+Q WI LINLPVLLGAT  MPPAT++N++ WI+VG +FN++VFRYRK
Sbjct  622   GPLIVWMLHKAFPTQRWIALINLPVLLGATAVMPPATTVNFNCWIIVGVVFNYYVFRYRK  681

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGI  2291
             KWWQRYNY+LSA LDAGVAFM VL+Y ++ + ++ ISWWG  D EHCDLA+CPTA+G+
Sbjct  682   KWWQRYNYVLSAALDAGVAFMTVLIYLSLSMNNKGISWWG-NDGEHCDLATCPTAEGL  738



>ref|XP_002447030.1| hypothetical protein SORBIDRAFT_06g027230 [Sorghum bicolor]
 gb|EES11358.1| hypothetical protein SORBIDRAFT_06g027230 [Sorghum bicolor]
Length=736

 Score =   979 bits (2532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/749 (66%), Positives = 605/749 (81%), Gaps = 18/749 (2%)
 Frame = +3

Query  84    VEIEA-PALKLA--GEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             +EIE  P+ ++A  GE+ +D +V+ +E+VRLTV  TDDPTLPVWTFRMW +G+VSC LLS
Sbjct  1     MEIERHPSRRVAAVGEEEDDGDVALVEQVRLTVPTTDDPTLPVWTFRMWTIGIVSCALLS  60

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             F NQFF+YR EP+II+ ITVQVA LP+G FMA  LP  K    G    ++++NPGPFN+K
Sbjct  61    FFNQFFAYRTEPIIISQITVQVAALPVGHFMARVLPETKRSALG---REWTMNPGPFNVK  117

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI IFANAG AFGNG AYAV I++II AFY+R ISF  G LLIITTQVLGYGWAGLL
Sbjct  118   EHVLICIFANAGTAFGNGGAYAVLIIDIIKAFYKRNISFVVGLLLIITTQVLGYGWAGLL  177

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             +KYVVEPA MWWP +LVQ+SL R LHEKEE         M+R KFF+I+L CSF WY  P
Sbjct  178   RKYVVEPAQMWWPQSLVQVSLLRALHEKEERG-------MTRGKFFLIALICSFAWYLVP  230

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
             GY+F T++++SWVCW FPKSVT HQ+GSG+NG+G+GA TLDWS +ASFL SPLV PFFAI
Sbjct  231   GYLFPTISTVSWVCWAFPKSVTMHQIGSGMNGIGIGAFTLDWSVVASFLQSPLVSPFFAI  290

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
             VNVFVG+ + +Y+++P+ YWG N+Y+A  FP++S+DLFT  GQ Y+ISAIVN  FE+D D
Sbjct  291   VNVFVGFVLFIYIILPVCYWGFNLYDASTFPIFSTDLFTGAGQLYNISAIVNDSFEIDMD  350

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
              YAKQG+I+LS  F++SYG GFA+IA+T++HVALFYG+EIY R R S KGK D+HT++M 
Sbjct  351   AYAKQGKIHLSLLFAISYGLGFASIAATLSHVALFYGKEIYQRMRESYKGKPDVHTRMMS  410

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
              Y+DIP WWFY+LLVVT A+++ LC     EVQ+P+WGL+FA  +AF+FTLPISIITATT
Sbjct  411   KYEDIPKWWFYLLLVVTAAMAMVLCTAFKSEVQLPWWGLLFACVIAFVFTLPISIITATT  470

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             N TPGLN+ITEY MG+I PGKPIANVCFK YGYMSM Q+++FL+DFKLGHYMKIPPRSMF
Sbjct  471   NMTPGLNVITEYCMGLIMPGKPIANVCFKVYGYMSMNQSVSFLTDFKLGHYMKIPPRSMF  530

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGP  1871
             LVQ IGTL+AGT+N +VAWWLL ++ +IC ++ L + SPWTCPSD VFFDASVIWGLVGP
Sbjct  531   LVQLIGTLVAGTVNTTVAWWLLTTVPHICEKELLPAGSPWTCPSDHVFFDASVIWGLVGP  590

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQS-WIPLINLPVLLGATGSMPPAT  2048
             +RIF   G Y+ALNWFFLGG++ P +VWLL R  P  + WI LINLPV+LGAT +MPPA+
Sbjct  591   RRIFGPLGYYSALNWFFLGGLILPAVVWLLARALPGHAWWISLINLPVVLGATANMPPAS  650

Query  2049  SLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTIS  2228
              +NY++W  VGT+FNFFVFRYRK WW+RYNY+LSA +DAGVA M V++YF   L    + 
Sbjct  651   PINYTAWCFVGTVFNFFVFRYRKAWWKRYNYVLSAAMDAGVAIMGVVIYF--ALSGHPLD  708

Query  2229  WWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             WWG+   EHCDLA+CPTA+G+ VDGCPV 
Sbjct  709   WWGSRG-EHCDLATCPTARGVLVDGCPVL  736



>ref|XP_006652734.1| PREDICTED: oligopeptide transporter 4-like [Oryza brachyantha]
Length=736

 Score =   976 bits (2524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/748 (64%), Positives = 602/748 (80%), Gaps = 16/748 (2%)
 Frame = +3

Query  84    VEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLN  263
             +E E P  + A  D +DE  SP+E+VRLTV  TDDP+LPVWTFRMW +GV+SC  LSF+N
Sbjct  1     MEAEHPGCRAAATDEDDE--SPVEQVRLTVPTTDDPSLPVWTFRMWTIGVLSCATLSFIN  58

Query  264   QFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHV  443
             QFFSYR EP++IT ITVQVA LPIG F+A  LP  KF + G+   + SLNPGPFN+KEHV
Sbjct  59    QFFSYRSEPIVITQITVQVAALPIGHFLARVLPERKFTVFGW---ECSLNPGPFNVKEHV  115

Query  444   LITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKY  623
             LI+IFANAG AFGNG AYA+ I+NII AFYRR ISF  G LL+ITTQVLGYGWAGL++KY
Sbjct  116   LISIFANAGAAFGNGGAYAIDIINIIKAFYRRNISFPTGLLLVITTQVLGYGWAGLMRKY  175

Query  624   VVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYI  803
             VVEPAHMWWP +LVQ+SL R LHEKE          M+RAKFF+I+L CS  WY  PGY+
Sbjct  176   VVEPAHMWWPQSLVQVSLLRALHEKENLR-------MTRAKFFLIALICSAAWYVVPGYL  228

Query  804   FQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNV  983
             F T+ ++SW+CW +P+SVT  Q+GSG++GLG+GA TLDW+T+ SFL SPLV PFFAIVNV
Sbjct  229   FPTVGAVSWLCWAYPRSVTMQQVGSGMSGLGVGAFTLDWATVVSFLGSPLVYPFFAIVNV  288

Query  984   FVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYA  1163
             + G+ +  Y+++P++YW LN++ A  FPL+S+ LF   GQEY+ISAIVN +FE+D D YA
Sbjct  289   WAGFVLFAYIMLPVAYWALNLFQASTFPLFSAHLFDRAGQEYNISAIVNDRFEIDPDAYA  348

Query  1164  KQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYK  1343
             +QGRI+LS FF++SYG GFATIA+T++HVALFYG+E+Y ++R + + K D+HT+LM+ Y+
Sbjct  349   RQGRIHLSLFFAISYGLGFATIAATLSHVALFYGKEMYQKFRKAAREKPDVHTRLMRRYE  408

Query  1344  DIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQT  1523
             DIP+WWFY +L + +A SL LC    DEVQ+P+W L+ A A+AF FTLPIS+ITATTN T
Sbjct  409   DIPNWWFYGMLALAMATSLVLCTVFKDEVQLPWWALLAAMAVAFFFTLPISVITATTNTT  468

Query  1524  PGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQ  1703
             PGLNIITEY+MG+I PGKPIANVCFK YGY+SM QA++FL+DFKLGHYMKIPPRSMFLVQ
Sbjct  469   PGLNIITEYVMGLIMPGKPIANVCFKVYGYISMNQAVSFLTDFKLGHYMKIPPRSMFLVQ  528

Query  1704  FIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRI  1880
             FIGT++AGT+NM+VAWWLL ++ +IC +  L + SPWTCP  RVFFDASVIWGLVGP+RI
Sbjct  529   FIGTIVAGTVNMAVAWWLLSTVPHICDRKHLPAGSPWTCPGSRVFFDASVIWGLVGPRRI  588

Query  1881  FDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQS-WIPLINLPVLLGATGSMPPATSLN  2057
             F   G Y +LNWFFLGG+ GP +VWLL R  P  + WI LI+LPVLLGAT +MPPA++LN
Sbjct  589   FGPLGYYGSLNWFFLGGLAGPAVVWLLARALPRHAGWIRLIHLPVLLGATANMPPASTLN  648

Query  2058  YSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWG  2237
             Y++W  VG +FN+ VFR RK WWQRYNY+LSA LDAGVA M VL++F +   D TI WWG
Sbjct  649   YTAWCSVGAVFNYLVFRRRKAWWQRYNYVLSAALDAGVAIMGVLIFFCLSNRDITIDWWG  708

Query  2238  T--TDLEHCDLASCPTAKGIAVDGCPVF  2315
             T  ++++HCDL++CPTAKG+ VDGCPVF
Sbjct  709   TSSSNIDHCDLSTCPTAKGVIVDGCPVF  736



>ref|XP_004288877.1| PREDICTED: oligopeptide transporter 2-like [Fragaria vesca subsp. 
vesca]
Length=727

 Score =   974 bits (2519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/730 (68%), Positives = 600/730 (82%), Gaps = 15/730 (2%)
 Frame = +3

Query  132   DEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSIT  311
             ++++SP+E+VRLTV+N DD TLP+WTFRMW LG++SCVLLSFLN FFSYR EP +IT IT
Sbjct  11    EDDLSPVEQVRLTVSNEDDLTLPIWTFRMWTLGLLSCVLLSFLNTFFSYRTEPFVITMIT  70

Query  312   VQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngS  491
             +QV TLPIGRFMA  LP  KF I   GS +FSLNPGPFN KEHVLI+IFANAG  FG+G+
Sbjct  71    IQVITLPIGRFMARTLPTRKFSI---GSMEFSLNPGPFNKKEHVLISIFANAGTGFGSGT  127

Query  492   AYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQI  671
             AYA+GIV+II  FY  KISF A W+L+ TTQVLGYGWAG+L+KYVV+P  MWWP++L Q+
Sbjct  128   AYAIGIVDIIKVFYHWKISFLASWILVNTTQVLGYGWAGILRKYVVDPGEMWWPASLSQV  187

Query  672   SLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPK  851
             +    LHEK+ +        MSR KFF+I+  CSF W F PGY+F T+A+ISW+CW++PK
Sbjct  188   NF--ALHEKDNKG-------MSRVKFFLIAFICSFSWGFVPGYLFPTIATISWICWIYPK  238

Query  852   SVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISY  1031
             SVTA Q+GSG+NGLG+ A +LDW++IASFL SPLV PFFA VNV VGY   MYL+MP  Y
Sbjct  239   SVTAQQIGSGMNGLGVAAFSLDWTSIASFLGSPLVSPFFATVNVAVGYVAFMYLIMPTVY  298

Query  1032  WGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYG  1211
             WG N++NAK FP++SSDLF + GQ Y++SAIVN QF++D   Y KQGR+ LS FF+LSYG
Sbjct  299   WGFNLFNAKNFPIFSSDLFDSHGQVYNVSAIVNNQFQIDMPAYEKQGRVSLSMFFALSYG  358

Query  1212  FGFATIASTITHVALFYGREIYDRYRASTK-GKMDIHTKLMKNYKDIPSWWFYVLLVVTI  1388
              GFA I ST+THVALF GREIY+++RAS K GK+DIHTKLM+ YKDIP+WWFY+ L+V++
Sbjct  359   IGFAAIVSTLTHVALFNGREIYEQFRASKKDGKVDIHTKLMRKYKDIPNWWFYLTLLVSL  418

Query  1389  AVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIY  1568
              ++LAL IF+ DEVQMP+W LI AA+LA +FTLPISIITATTNQTPGLN+ITEY +G+I 
Sbjct  419   LLALALSIFMKDEVQMPWWTLILAASLALIFTLPISIITATTNQTPGLNVITEYAIGLIL  478

Query  1569  PGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVA  1748
             PGKPI NVCFKTYGY+SM QAI+FL+DFKLGHYMKIPPRSMF+VQ IGT+IAGT+N+ VA
Sbjct  479   PGKPILNVCFKTYGYISMAQAISFLNDFKLGHYMKIPPRSMFIVQLIGTVIAGTVNIGVA  538

Query  1749  WWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             WWLL ++ENIC  + L  NSPWTCP+DRVFFDASV+WGLVGPKR+F S GNY ALNWFFL
Sbjct  539   WWLLSTMENICQHELLPPNSPWTCPNDRVFFDASVLWGLVGPKRMFGSLGNYPALNWFFL  598

Query  1926  GGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVF  2105
              G  GP++VWLLHR FPS  WI LINL VLLGAT +MPPAT++NY+ WI+ GTIF +FVF
Sbjct  599   LGAFGPLLVWLLHRAFPSHKWIQLINLLVLLGATTNMPPATAVNYNCWIITGTIFGYFVF  658

Query  2106  RYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAK  2285
             RYRK  W RYNY+LSA LD GVAFMAVLLYFT+ + + ++SWWG    EHC+L +CPT K
Sbjct  659   RYRKARWLRYNYVLSAALDVGVAFMAVLLYFTLTMNETSVSWWGANG-EHCELVTCPTTK  717

Query  2286  GIAVDGCPVF  2315
             GI VDGCPV+
Sbjct  718   GIVVDGCPVY  727



>ref|XP_003603705.1| Oligopeptide transporter [Medicago truncatula]
 gb|AES73956.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=726

 Score =   974 bits (2518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/731 (66%), Positives = 603/731 (82%), Gaps = 10/731 (1%)
 Frame = +3

Query  126   VNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITS  305
             V +++VSPIEEVR  V+N DD  LP+WTFRMW +G++S VLLS++N FF YR +PL +T 
Sbjct  5     VIEDDVSPIEEVRAVVSNEDDQNLPIWTFRMWTMGIISVVLLSYINTFFIYRTQPLTVTM  64

Query  306   ITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgn  485
             IT+QVATLPIGRFMA  LP  KFRI GFG  +FSLNPGPFN+KEHVLI++FANAG AFG+
Sbjct  65    ITIQVATLPIGRFMAKVLPTKKFRIIGFGEREFSLNPGPFNVKEHVLISMFANAGAAFGS  124

Query  486   gSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLV  665
             G+AYA+ IV+II  FY RKI+F   W+L++TTQVLGYGWAG+++KYVV+PA MWWPSTL+
Sbjct  125   GTAYALSIVDIIRVFYYRKITFLTSWILVLTTQVLGYGWAGIMRKYVVDPAEMWWPSTLM  184

Query  666   QISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVF  845
             Q+SLFRTLHEK+E         MS+ KFF+I+L CSF WY  PGY+F TL+ ISWVCW+F
Sbjct  185   QVSLFRTLHEKDENR-------MSKGKFFLIALMCSFAWYVVPGYLFATLSIISWVCWIF  237

Query  846   PKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPI  1025
             P SVTAHQ+GSG NGLGLG+ +LDW+TIASFL +PLV P FA VN+ VGY +++Y+++P 
Sbjct  238   PNSVTAHQIGSGKNGLGLGSFSLDWTTIASFLGNPLVTPIFATVNILVGYILLIYILIPT  297

Query  1026  SYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLS  1205
             +YWG N+YNAK FP+YS++LF+AQG  Y+++AIVN +FE+D D Y  QG I +S FFS+S
Sbjct  298   AYWGFNLYNAKNFPIYSNELFSAQGVRYNVTAIVNNKFEIDMDAYNNQGHINMSIFFSIS  357

Query  1206  YGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVT  1385
             YG GFA I ST+THVA+F G++IY + ++S  GK DIHT+LMK YKDIP+WWF+V LVV+
Sbjct  358   YGIGFAAIVSTLTHVAIFNGKDIYHQLQSSRTGKEDIHTRLMKKYKDIPNWWFHVTLVVS  417

Query  1386  IAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGII  1565
               ++LALCIF  +E+QMP+W LIFA+ LA +FTLP++IITATTNQTPGLN+ITEYIMG+I
Sbjct  418   FLLALALCIFKKEEIQMPWWALIFASGLALIFTLPVAIITATTNQTPGLNVITEYIMGVI  477

Query  1566  YPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSV  1745
              PG+PIANVCFKTYGYMSM+QAI+FLSDFKLGHYMKIPPRSMF+VQ +GTLIAGT+++ V
Sbjct  478   LPGRPIANVCFKTYGYMSMSQAISFLSDFKLGHYMKIPPRSMFIVQILGTLIAGTVDVGV  537

Query  1746  AWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFF  1922
             AWWLL SI+NICH+D+L   SPWTCP+D VFFDASVIWGLVGP+RIF   GNY  LNW F
Sbjct  538   AWWLLGSIKNICHEDQLPKGSPWTCPNDNVFFDASVIWGLVGPRRIFGPLGNYEKLNWAF  597

Query  1923  LGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFV  2102
             L G+L P+I+W L + FPSQ WI  I++PVLLGAT SMPPA+++N++SWI V  IFN+F+
Sbjct  598   LIGLLSPIIIWALIKAFPSQKWISYIHIPVLLGATASMPPASTVNFNSWITVAVIFNYFI  657

Query  2103  FRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTA  2282
              +YRKKWW+RYNYIL+A LDAG+AFM  LLYFTV     +++WWG    EHC LA+CPTA
Sbjct  658   HKYRKKWWERYNYILAAALDAGLAFMTTLLYFTVSSGGISLNWWGQD--EHCPLATCPTA  715

Query  2283  KGIAVDGCPVF  2315
             KGI  DGCP F
Sbjct  716   KGIVTDGCPTF  726



>ref|XP_007224505.1| hypothetical protein PRUPE_ppa022679mg [Prunus persica]
 gb|EMJ25704.1| hypothetical protein PRUPE_ppa022679mg [Prunus persica]
Length=731

 Score =   972 bits (2514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/726 (67%), Positives = 590/726 (81%), Gaps = 11/726 (2%)
 Frame = +3

Query  123   DVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIIT  302
             D  D+++SPIEEVRLTV N DD +LPVWTFRMW +G+ SC+LLSFLN FFS+R EPL+IT
Sbjct  10    DETDDDLSPIEEVRLTVLNEDDTSLPVWTFRMWTIGLFSCILLSFLNTFFSFRTEPLVIT  69

Query  303   SITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafg  482
              I+VQVA+LPIGRFMA  LP  K  +   G   FSLNPG FN+KEHVLI+IFANAG  FG
Sbjct  70    MISVQVASLPIGRFMARTLPRTKVWV---GGKSFSLNPGEFNIKEHVLISIFANAGAGFG  126

Query  483   ngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTL  662
             +G AYAV IV II AFY RKISFFA W L+ITTQVLGYGWAG+L+KYVV+PA MWWPS+L
Sbjct  127   SGPAYAVDIVTIIKAFYGRKISFFASWALVITTQVLGYGWAGILRKYVVDPAAMWWPSSL  186

Query  663   VQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWV  842
             VQ+SLFR LHE +          MSR+KFF+I+L CSF WY  PGY+F TL++ISW+CW+
Sbjct  187   VQVSLFRALHENDSNR-------MSRSKFFLIALICSFSWYVMPGYLFTTLSTISWICWL  239

Query  843   FPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMP  1022
              PKS+TA Q+GSG  GLGLGA+TLDWS IAS+L SPL+ PFFAI N+ VGY I MY+++P
Sbjct  240   SPKSITAQQIGSGFRGLGLGAVTLDWSVIASYLGSPLISPFFAIANIAVGYIITMYVIIP  299

Query  1023  ISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSL  1202
             I+YW LN+YNA  F ++SS LF +QGQ YD+ AIVN +FE+D   Y K G I LS FFSL
Sbjct  300   IAYWKLNLYNASNFAIFSSHLFDSQGQIYDVKAIVNDKFEIDMPSYEKHGLINLSVFFSL  359

Query  1203  SYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVV  1382
             +YG GFA + ST+THVALF+GR+IY +Y++S  GK+DIHTKLM+ YKDIP+WWF+ LL +
Sbjct  360   TYGIGFAAVISTLTHVALFHGRDIYKQYKSSHTGKIDIHTKLMRKYKDIPNWWFHSLLFL  419

Query  1383  TIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGI  1562
              +A+SLAL IFL  EVQMP+WGLIFAA +AF+FTLPISIITATTN TPGLN+ITEYIMG+
Sbjct  420   AMALSLALFIFLKKEVQMPWWGLIFAAGIAFVFTLPISIITATTNVTPGLNVITEYIMGL  479

Query  1563  IYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMS  1742
             I PG+PI NVCFKTYGY+SM QAI+FLSDFKLGHYMKIPP SMF+VQ IGT++AGTIN+ 
Sbjct  480   ILPGQPITNVCFKTYGYISMAQAISFLSDFKLGHYMKIPPISMFVVQCIGTIVAGTINIG  539

Query  1743  VAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWF  1919
              AWWLL S+ENIC+ + L SNSPWTCP+  VFF ASVIWGLVGP+RIF S G Y+ALNWF
Sbjct  540   TAWWLLGSVENICNVELLPSNSPWTCPNHGVFFTASVIWGLVGPRRIFGSLGLYSALNWF  599

Query  1920  FLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFF  2099
             FL G LGP++VW LH+ FP Q WI  INLPVL GAT  MPPAT++N++ WI++G +FN+F
Sbjct  600   FLVGALGPLLVWSLHKAFPKQKWIAYINLPVLFGATAVMPPATTVNFNCWIVMGIVFNYF  659

Query  2100  VFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPT  2279
             VFRYRK+WWQRYNY+LSA LDAG+AFM VL+Y  + + D +ISWWGT D +HC LA+CPT
Sbjct  660   VFRYRKRWWQRYNYVLSAALDAGLAFMGVLIYMCLTINDISISWWGTEDYDHCPLATCPT  719

Query  2280  AKGIAV  2297
              K I +
Sbjct  720   NKDIVL  725



>ref|XP_009366375.1| PREDICTED: oligopeptide transporter 2-like [Pyrus x bretschneideri]
Length=743

 Score =   970 bits (2508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/746 (66%), Positives = 602/746 (81%), Gaps = 11/746 (1%)
 Frame = +3

Query  81    TVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFL  260
             T+E+EA A     E  ND++VS +E+VRLTV+N DD +LPVWTFRMW +G++SC+LLSFL
Sbjct  7     TLEVEAAAKTKLDESENDDDVSSVEQVRLTVSNEDDSSLPVWTFRMWTIGMLSCILLSFL  66

Query  261   NQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEH  440
             N FFSYR EPL+I+ I+VQVA+LPIGRFMA ALP  K  I G     +SLNPG FN+KEH
Sbjct  67    NTFFSYRTEPLVISMISVQVASLPIGRFMARALPRRKVWIRG---KSYSLNPGEFNVKEH  123

Query  441   VLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKK  620
             VLI+IFANAG  FG+G AYAV IV II AFY RKISFFA W L+ITTQVLGYGWAG+++K
Sbjct  124   VLISIFANAGAGFGSGPAYAVNIVTIIKAFYGRKISFFASWALVITTQVLGYGWAGIIRK  183

Query  621   YVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGY  800
             YVV+P  MWWPS+LVQ+SLFR LHE +          MSR KFF+I+L CSF WY  PGY
Sbjct  184   YVVDPGAMWWPSSLVQVSLFRALHENDNHR-------MSRGKFFLIALVCSFSWYLVPGY  236

Query  801   IFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVN  980
             +F TL+ ISW+CW++P+S+ A Q+GSG  GLG+GA TLDWS I+S+L SPL+ PFFAIVN
Sbjct  237   LFTTLSIISWICWIYPRSIRAQQIGSGFRGLGVGAFTLDWSVISSYLGSPLISPFFAIVN  296

Query  981   VFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEY  1160
             + VGY IIMY+V+PISYW LN+YNAK F ++SS LF + GQ Y++  IVN +F++D   Y
Sbjct  297   ITVGYIIIMYVVIPISYWKLNLYNAKNFAIFSSHLFDSDGQIYNVKGIVNDRFQIDMPAY  356

Query  1161  AKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNY  1340
              KQG I LS FF+L+YG GFA + ST+ HVALF GR+IY+RY++S  GK+DIHTKLM+ Y
Sbjct  357   KKQGFINLSVFFALTYGLGFAAVVSTLIHVALFNGRDIYERYQSSYSGKIDIHTKLMRKY  416

Query  1341  KDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQ  1520
             +DIPSWWF++LLVV++ +SLALCIF+ DEVQMP+WGLIFAA +A +FTLPISIITATTN 
Sbjct  417   RDIPSWWFHILLVVSLVLSLALCIFMKDEVQMPWWGLIFAAGIALIFTLPISIITATTNV  476

Query  1521  TPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLV  1700
             TPGLNIITEY+MG+I PG PIANVCFKTYGY+SM QAI+FLSDFKLGHYMKIPP SMFLV
Sbjct  477   TPGLNIITEYVMGLILPGYPIANVCFKTYGYISMAQAISFLSDFKLGHYMKIPPISMFLV  536

Query  1701  QFIGTLIAGTINMSVAWWLLHSIENICHQDKLSN-SPWTCPSDRVFFDASVIWGLVGPKR  1877
             Q +GT++AGT+N+  AWWLL +++NIC+ + L + SPWTCP D VFF+ASVIWGLVGPKR
Sbjct  537   QCVGTVVAGTVNIGTAWWLLTTVKNICNTELLPDTSPWTCPGDSVFFNASVIWGLVGPKR  596

Query  1878  IFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLN  2057
             IF S G Y  LNWFF+ G LGPVIVWL H+ FP Q WI  INLPVL G+T  MPPAT++N
Sbjct  597   IFGSLGLYGGLNWFFVVGALGPVIVWLFHKAFPRQKWIAYINLPVLFGSTAVMPPATTVN  656

Query  2058  YSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWG  2237
             ++SWI+VG +FN+FVFRYRKKWWQRYNY+LSA LDAGVAFM VL+Y  + + + +ISWWG
Sbjct  657   FNSWIVVGIVFNYFVFRYRKKWWQRYNYVLSAALDAGVAFMGVLIYICLTINEVSISWWG  716

Query  2238  TTDLEHCDLASCPTAKGIAVDGCPVF  2315
             T D +HC L++CPT+K + +    VF
Sbjct  717   TQDYDHCKLSTCPTSKSVELGHACVF  742



>ref|XP_004976663.1| PREDICTED: oligopeptide transporter 4-like [Setaria italica]
Length=735

 Score =   968 bits (2503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/738 (65%), Positives = 597/738 (81%), Gaps = 14/738 (2%)
 Frame = +3

Query  108   KLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRRE  287
             ++A    +D++V  +E+VRLTV  TDDPTLPVWTFRMW +GVVSC LLSF NQFF+YR E
Sbjct  10    RVAAVGGDDDDVELVEQVRLTVPTTDDPTLPVWTFRMWTIGVVSCALLSFFNQFFAYRSE  69

Query  288   PLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfana  467
             P+II+ ITVQVA LP+G FMA ALP  KF    FG  ++S+NPGPFN+KEHVLI +FANA
Sbjct  70    PIIISQITVQVAALPVGHFMARALPDKKFS--AFGR-EWSMNPGPFNVKEHVLICVFANA  126

Query  468   gfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMW  647
             G AFGNG AYAVGIV II AFYRR ISF  G LLIITTQVLGYGWAGL+++YV+EPA MW
Sbjct  127   GAAFGNGGAYAVGIVTIIKAFYRRNISFVVGLLLIITTQVLGYGWAGLMRRYVIEPAQMW  186

Query  648   WPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASIS  827
             WP +LVQ+SL R LHEKE+         M+R KFF+I+L CSF WY  PGYIF T+ ++S
Sbjct  187   WPQSLVQVSLLRALHEKEQGRR------MTRGKFFLIALVCSFTWYTVPGYIFPTITAVS  240

Query  828   WVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIM  1007
             WVCW FPKSVT  Q+GSGLNGLG+GA TLDWS +ASFLSSPLV PFFAIVNV+VG+ +++
Sbjct  241   WVCWAFPKSVTMQQIGSGLNGLGVGAFTLDWSVVASFLSSPLVSPFFAIVNVYVGFVLLV  300

Query  1008  YLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLS  1187
             Y+++P  YW  N+Y+A  FP+YS+DLFT  GQ Y+I+AIVN +FE+D   Y +QG+I+LS
Sbjct  301   YIIVPACYWAFNLYDAGTFPIYSTDLFTGAGQLYNITAIVNDRFEIDMGAYEQQGKIHLS  360

Query  1188  TFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFY  1367
              FF++SYG GFA+IA+T++HVALFYG+EIY R+R S +GK D+HT++M+ Y DIP+WWFY
Sbjct  361   LFFAISYGLGFASIAATLSHVALFYGKEIYQRFRESYRGKPDVHTRMMRRYDDIPNWWFY  420

Query  1368  VLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITE  1547
             VLL +T+AV++ LC    DEVQ+P+WGL+FA A+AF+FTLPIS+ITATTN TPGLN+ITE
Sbjct  421   VLLALTMAVAMVLCTVFKDEVQLPWWGLLFACAIAFIFTLPISVITATTNTTPGLNVITE  480

Query  1548  YIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAG  1727
             Y +G+I PGKPIANVCFK YGYMSM Q+++FL+DFKLGHYMK+PPRSMFLVQ IGT++AG
Sbjct  481   YTLGLIMPGKPIANVCFKVYGYMSMNQSVSFLNDFKLGHYMKVPPRSMFLVQLIGTVVAG  540

Query  1728  TINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYN  1904
             T+N  VAWWLL ++ +IC +  L   SPWTCP D VFFDASVIWGLVGP+RIF   G YN
Sbjct  541   TVNTIVAWWLLTTVPHICEKALLPEGSPWTCPGDHVFFDASVIWGLVGPRRIFGPLGYYN  600

Query  1905  ALNWFFLGGILGPVIVWLLHRKFPSQS-WIPLINLPVLLGATGSMPPATSLNYSSWILVG  2081
             ALNW FLGG++ P+ VWLL R  P  + WI L+NLPV+LGAT +MPPA++LNY++W  VG
Sbjct  601   ALNWCFLGGLVCPLFVWLLARALPGHAWWISLVNLPVILGATANMPPASTLNYTAWCFVG  660

Query  2082  TIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCD  2261
             T+FNFFVFRYRK WW+RYNY+LSA LDAGVA M V++YF   L    + WWG+   EHCD
Sbjct  661   TVFNFFVFRYRKGWWKRYNYVLSAALDAGVAIMGVVIYF--ALSGHPLDWWGSRG-EHCD  717

Query  2262  LASCPTAKGIAVDGCPVF  2315
             LA+CPTA+G+ VDGCP+ 
Sbjct  718   LATCPTARGVQVDGCPIL  735



>ref|XP_009615074.1| PREDICTED: oligopeptide transporter 4-like [Nicotiana tomentosiformis]
Length=734

 Score =   967 bits (2500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/730 (65%), Positives = 589/730 (81%), Gaps = 10/730 (1%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
             N++E SP+EEVRLTV   DDP++PVWTFRMW LG++SC LLSF+N FFSYR+ PLII+ I
Sbjct  12    NEDEQSPVEEVRLTVPTDDDPSVPVWTFRMWFLGIISCALLSFINIFFSYRQNPLIISMI  71

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgng  488
             T QVA+LP+GR MA  LP  KF +PGFGS +FSLNPGPF+MKEHVLI+IFANAG  FG G
Sbjct  72    TAQVASLPLGRLMAKVLPTRKFHLPGFGSREFSLNPGPFSMKEHVLISIFANAGAGFGGG  131

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
             +AYA+ IV+II  FY RKISF AGW+L+ITTQVLGYGWAG+++KYVVEPA MWWPSTLVQ
Sbjct  132   TAYAISIVDIIKVFYHRKISFLAGWILVITTQVLGYGWAGIMRKYVVEPAEMWWPSTLVQ  191

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +S+FR LHEK+   +       SR KFF+I + CSF WY  PGY+F+TL+++S +C  F 
Sbjct  192   VSIFRALHEKDNSGNY------SRGKFFLIVMTCSFTWYIVPGYLFKTLSTVSVLCLAFR  245

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
             KSV AHQLGSG NGLG+ + T DWS +A +L+SPLV PFFAI+N+ VGY II+Y+++P +
Sbjct  246   KSVLAHQLGSGQNGLGILSFTFDWSVVA-YLTSPLVTPFFAILNILVGYVIIVYIMIPAA  304

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             YWG N+YNA  FPL+S++LF A GQ+Y++SAIVN +FE+D   Y KQGRI LS  F+LSY
Sbjct  305   YWGFNLYNANKFPLFSTNLFDANGQKYNVSAIVNDKFEIDMPTYEKQGRINLSIMFALSY  364

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTI  1388
             G  FATI +T+THV LF GREIY R+RAS KGK DIHT+LM+ Y DIPSWWF+ +LV++ 
Sbjct  365   GLSFATIVATLTHVILFNGREIYGRFRASYKGKTDIHTRLMRKYNDIPSWWFHTILVLSF  424

Query  1389  AVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIY  1568
             A+SL LC  L  E+Q+P+WGLIFA  +A +FTLPISII ATTN +PGLN+ITEYI+G+I 
Sbjct  425   ALSLVLCTVLKSEIQLPWWGLIFACGIALIFTLPISIIQATTNNSPGLNVITEYIIGLII  484

Query  1569  PGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVA  1748
             PGKPIANVCFKTYGY+SM QA++FL DFKLGHYMKIPPRSMF+VQ +GT IA TINM+ A
Sbjct  485   PGKPIANVCFKTYGYISMAQAVSFLQDFKLGHYMKIPPRSMFVVQLVGTFIAATINMASA  544

Query  1749  WWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             W++L  +  IC  D L   SPWTC  D VF+DASVIWGLVGPKR F   GNY ALNWFFL
Sbjct  545   WYMLTHVPFICQLDSLPKGSPWTCRGDHVFYDASVIWGLVGPKRFFGPLGNYGALNWFFL  604

Query  1926  GGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVF  2105
             GG + P++VWLLH+ FP QSWI LIN+PVLLGAT +MPPA++LN++SW ++GT+FNF +F
Sbjct  605   GGAIAPILVWLLHKSFPKQSWIKLINIPVLLGATAAMPPASTLNFNSWFVIGTLFNFIIF  664

Query  2106  RYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLED-RTISWWGTTDLEHCDLASCPTA  2282
             +YRKKWWQRYNY+LSA LDAG+AFM V +Y   GL +   I+WWG  + ++CDLA CPTA
Sbjct  665   QYRKKWWQRYNYVLSAALDAGLAFMGVFIYLFFGLTNHENINWWGNVE-DYCDLAKCPTA  723

Query  2283  KGIAVDGCPV  2312
             KGI VDGCP+
Sbjct  724   KGIQVDGCPL  733



>ref|XP_009775420.1| PREDICTED: oligopeptide transporter 2-like [Nicotiana sylvestris]
Length=733

 Score =   966 bits (2497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/725 (67%), Positives = 594/725 (82%), Gaps = 19/725 (3%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIEEVRLTV+N DDP+LPVWTFRMW LG++SC +L+FLN FFSYR +PL I+ ITVQ+A
Sbjct  25    SPIEEVRLTVSNEDDPSLPVWTFRMWFLGILSCGILAFLNTFFSYRTQPLSISMITVQIA  84

Query  324   TLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
              LP+G+ MA  LP  KF+I   GS +FS NPGPFNMKEHVLI+IFAN G      +AYAV
Sbjct  85    ALPLGKIMARVLPTRKFKI---GSWEFSFNPGPFNMKEHVLISIFANCGSG----TAYAV  137

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFR  683
              IV II AFY R ISF AGW+L++TTQVLGYGWAG+++KYVV+PA MWWP  +V +SLFR
Sbjct  138   SIVTIIKAFYLRNISFVAGWILVVTTQVLGYGWAGIMRKYVVDPAEMWWPGNMVLVSLFR  197

Query  684   TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTA  863
              LHEK+ +         SR KFF++ L CSF WY  PG++F TL++IS +C  +PKSV A
Sbjct  198   ALHEKDADGKS------SRGKFFLVVLACSFTWYIVPGFLFPTLSNISLLCLFYPKSVLA  251

Query  864   HQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLN  1043
              Q+GSG+ GLG+ + T DWS +AS+L SPLVCP FAI+NV VGY  ++Y+++PISYWG N
Sbjct  252   QQIGSGMKGLGILSFTFDWSVVASYLGSPLVCPLFAIINVIVGYVAVVYILIPISYWGFN  311

Query  1044  VYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFA  1223
             +YNA+ FPL SS LF AQGQ YDI+AIVN +FELDE  YAK+GRI +STFF+L+YG  FA
Sbjct  312   IYNARTFPLLSSHLFNAQGQTYDITAIVNDKFELDEMAYAKEGRINISTFFALTYGLNFA  371

Query  1224  TIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLA  1403
              + +T+  VALF G+E Y+R+RA   GK DIHT+LMK Y DIPSWWF+ +LV+++A+SL 
Sbjct  372   AVVATLAQVALFNGKETYERFRAINSGKPDIHTRLMKKYADIPSWWFHGMLVLSLALSLV  431

Query  1404  LCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPI  1583
             LCI   D+VQ+P+WGL+FAAA+A +FTLPISIITATTN TPGLN+ITEYI+G+I PG+PI
Sbjct  432   LCIVWEDQVQLPWWGLLFAAAIALIFTLPISIITATTNMTPGLNVITEYIIGLIIPGRPI  491

Query  1584  ANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLH  1763
             ANVCFKT+GY+SM+QA++FLSDFKLGHYMKIPPRSMF+VQ +GTLIAGTINMSVAWWLL 
Sbjct  492   ANVCFKTFGYISMSQAVSFLSDFKLGHYMKIPPRSMFIVQLLGTLIAGTINMSVAWWLLT  551

Query  1764  SIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
             +I++IC QD+L  +NSPWTCP +RVFFDASVIWGLVGPKR+F S GNY+A NWFFLGG +
Sbjct  552   NIDHIC-QDQLLPTNSPWTCPGNRVFFDASVIWGLVGPKRMFGSLGNYSAQNWFFLGGAI  610

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
             GP++VWLLH+ FPSQSWI LIN+PVLLGAT +MPPAT LN++SWI  G +FNFF+FRYRK
Sbjct  611   GPLLVWLLHKAFPSQSWIKLINIPVLLGATAAMPPATPLNFNSWIFFGILFNFFIFRYRK  670

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV  2297
             KWWQ+YNY+LSA LDAG+AFM V +YF +G  D   SWWGT   E+CDLA+CPT KGI V
Sbjct  671   KWWQKYNYVLSAALDAGLAFMGVFIYFCLG--DVKFSWWGTGG-EYCDLATCPTTKGIVV  727

Query  2298  DGCPV  2312
             +GCP+
Sbjct  728   EGCPL  732



>ref|XP_004238545.1| PREDICTED: oligopeptide transporter 4-like [Solanum lycopersicum]
Length=745

 Score =   966 bits (2496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/725 (66%), Positives = 589/725 (81%), Gaps = 10/725 (1%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SP+E+VRLTV   DDP++PVWTFRMW LG++ C L+SF+N FFSYR+ PLII+ IT QVA
Sbjct  26    SPVEQVRLTVPTEDDPSVPVWTFRMWFLGIIFCGLMSFINIFFSYRQNPLIISMITAQVA  85

Query  324   TLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
             +LP+G+F+A  LP  KF +PGFG  +FSLNPGPF+MKEHVLI+IFANAG  FG+G AYA+
Sbjct  86    SLPLGKFLAKVLPTRKFHLPGFGLSEFSLNPGPFSMKEHVLISIFANAGAGFGSGGAYAI  145

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFR  683
              I++II  FY RKISF AGW+L+ITTQVLGYGWAG+++KYVVEPA MWWPSTL Q+S+FR
Sbjct  146   TIIDIIKVFYHRKISFLAGWILVITTQVLGYGWAGIMRKYVVEPAEMWWPSTLAQVSIFR  205

Query  684   TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTA  863
              LHEKE   +       SR KFF+I++ CSF WY  PGY+F+TL++ S +C VFPKSV A
Sbjct  206   ALHEKENGVNY------SRGKFFLIAMICSFAWYIVPGYLFKTLSTFSVLCLVFPKSVVA  259

Query  864   HQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLN  1043
             HQLGSG +GLGL + T DWS +A FL++PLV PFFAI+N+  GY +I+Y+++P++YWGLN
Sbjct  260   HQLGSGQHGLGLLSFTFDWSVVA-FLTNPLVTPFFAILNILAGYVVIVYIMIPVAYWGLN  318

Query  1044  VYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFA  1223
             +YNAK FPL+S+DLF A GQ+Y++SAIVN +FE+D   Y KQGRI LS  F++SYG GFA
Sbjct  319   LYNAKTFPLFSTDLFNANGQKYNVSAIVNNKFEIDTAAYEKQGRINLSIMFAISYGLGFA  378

Query  1224  TIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLA  1403
             TI +T+THV LF G+EIY R+ AS  G++DIHTKLM+ YKDIPSWWF+ +LV++ A+SL 
Sbjct  379   TIIATLTHVFLFNGKEIYSRFHASYNGRIDIHTKLMRKYKDIPSWWFHTILVLSFALSLL  438

Query  1404  LCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPI  1583
             LC  L  +VQ+P+WGLIFA  +A +FTLPISII ATTN +PGLNIITEYI+G+I PGKPI
Sbjct  439   LCTVLKSQVQLPWWGLIFACTIALIFTLPISIIQATTNNSPGLNIITEYILGLIIPGKPI  498

Query  1584  ANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLH  1763
             ANVCFKTYGY+SM+QA++FL DFKLGHYMKIPPRSMF+VQ +GTLIA TINM+ AW++L 
Sbjct  499   ANVCFKTYGYISMSQAVSFLQDFKLGHYMKIPPRSMFVVQLVGTLIASTINMATAWYMLT  558

Query  1764  SIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILG  1940
              +  IC  D L   SPWTC  D VFFDASVIWGLVGPKR F   GNY ALNWFFLGG + 
Sbjct  559   HVPYICQLDSLPEGSPWTCRGDHVFFDASVIWGLVGPKRFFGPLGNYGALNWFFLGGAMA  618

Query  1941  PVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKK  2120
             PV+VWLLH+ FP Q WI LIN+PVLLGAT +MPPA  LN++SWI+VG +FNFF+FRYRKK
Sbjct  619   PVLVWLLHKAFPKQRWIKLINIPVLLGATSNMPPANVLNFNSWIVVGFVFNFFIFRYRKK  678

Query  2121  WWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDR-TISWWGTTDLEHCDLASCPTAKGIAV  2297
             WWQRYNY+LSA LDAG+AFM VL+Y   GL +   I+WWG  D E+C+LA+CPTA+G+ V
Sbjct  679   WWQRYNYVLSAALDAGLAFMVVLIYLVFGLTNHDNINWWGNVD-EYCNLANCPTAQGVHV  737

Query  2298  DGCPV  2312
              GCP+
Sbjct  738   KGCPL  742



>emb|CDP19590.1| unnamed protein product [Coffea canephora]
Length=751

 Score =   964 bits (2492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/726 (66%), Positives = 595/726 (82%), Gaps = 9/726 (1%)
 Frame = +3

Query  138   EVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQ  317
             E+SP+E+VRLTV   DDP++PVWTFRMW LG++SC LL+FLN FF YR EPLIIT I+ Q
Sbjct  32    EISPVEQVRLTVPTHDDPSIPVWTFRMWFLGILSCGLLAFLNTFFGYRTEPLIITMISAQ  91

Query  318   VATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAY  497
             VATLP+G+FMA  LP  KF+IPGFGS +FSLNPGPFN+KEH LI+IFAN G  FG+G+AY
Sbjct  92    VATLPVGKFMAKVLPEKKFKIPGFGSREFSLNPGPFNIKEHALISIFANTGSGFGSGAAY  151

Query  498   AVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISL  677
             A+ IV+I+  FY RKISF A W+L++TTQVLGYGWAG+++KYVVE A MWWP++LVQ+SL
Sbjct  152   AISIVDIVKVFYHRKISFLASWILVVTTQVLGYGWAGIIRKYVVEAAEMWWPASLVQVSL  211

Query  678   FRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSV  857
              R LHEK+          MSR KFF+I++ CSF WY FPG +F TL+S+S +C VFP+S+
Sbjct  212   LRALHEKDSRR-------MSRGKFFLIAVTCSFSWYTFPGLLFPTLSSLSVLCLVFPRSI  264

Query  858   TAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWG  1037
             TA Q+GSGL GLG+GA T DWS IASFL SPLV PFFA VN+ VGY   +Y+++PI+YWG
Sbjct  265   TAQQIGSGLKGLGIGAFTFDWSVIASFLGSPLVSPFFATVNILVGYVAAIYVLIPIAYWG  324

Query  1038  LNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFG  1217
             LN+YNA  +P +S  LF +QGQ Y++SAIVN  FELD   Y KQGRI+++ FF+++Y   
Sbjct  325   LNLYNANKYPFFSPHLFDSQGQPYNVSAIVNDNFELDLPTYEKQGRIHITMFFAIAYALN  384

Query  1218  FATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVS  1397
             FAT+ +TI HVA F G++IY R+ AS KGK DIHTKLM+ Y+D+PSWWF +LL  ++A+S
Sbjct  385   FATVIATIVHVACFNGKDIYRRFMASNKGKPDIHTKLMRQYEDVPSWWFGLLLSFSLALS  444

Query  1398  LALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGK  1577
             L LCIFLND+VQ+P+WGL+FAA +A +FTLPIS ITATTNQTPGLN+ITEY+ GII+PG+
Sbjct  445   LLLCIFLNDQVQLPWWGLLFAAGIALLFTLPISTITATTNQTPGLNVITEYVFGIIHPGR  504

Query  1578  PIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWL  1757
             P+ANVCFKTYGY+SM+QA+AFL+DFKLGHYMKIPPRSMF+VQF+GT+IAGTIN+S AW++
Sbjct  505   PVANVCFKTYGYISMSQAVAFLNDFKLGHYMKIPPRSMFIVQFLGTIIAGTINISTAWYM  564

Query  1758  LHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGI  1934
             L SIENICH + L  +SPWTCP D  F+ ASVIWGL+GP RIF   G+Y+ALNW F+ G 
Sbjct  565   LTSIENICHPELLPPDSPWTCPGDNTFYSASVIWGLIGPMRIFGRLGDYSALNWGFVIGG  624

Query  1935  LGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYR  2114
             L P++VWL H+ FPSQ WI L+N PVL GAT  M PATS+NY+ W +VG +FN+FV+RY+
Sbjct  625   LAPILVWLTHKTFPSQDWIKLVNFPVLFGATSLMFPATSVNYNGWFVVGIVFNYFVYRYK  684

Query  2115  KKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIA  2294
             KKWWQRYNYILSAGLDAG+AFM VLLYF +  E++TISWWG ++ +HC+LASCPTA GI 
Sbjct  685   KKWWQRYNYILSAGLDAGLAFMGVLLYFCLQYENKTISWWG-SEGDHCNLASCPTAMGIE  743

Query  2295  VDGCPV  2312
             VDGCP+
Sbjct  744   VDGCPL  749



>ref|NP_001152089.1| oligopeptide transporter 4 [Zea mays]
 gb|ACG45738.1| oligopeptide transporter 4 [Zea mays]
Length=753

 Score =   964 bits (2491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/735 (67%), Positives = 584/735 (79%), Gaps = 19/735 (3%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEE-------------VSPIEEVRLTVTNTDDPTLPVWTFR  215
             MG +  +   L  A   V  +E              SP+E+VRLTV +TDDP+LPVWTFR
Sbjct  1     MGEIGTDHRGLAEAEAGVGGKEEGIVLGGHEEEEETSPVEQVRLTVPSTDDPSLPVWTFR  60

Query  216   MWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGF-G  392
             MW +G++SC L+SFLNQFFSYR EPLI+T ITVQVA+LP+G FMA ALP A+FR P   G
Sbjct  61    MWSIGLLSCALMSFLNQFFSYRTEPLIVTQITVQVASLPLGHFMARALPRARFRAPALLG  120

Query  393   SGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLI  572
              G++SLNPGPFN+KEHVLI+IFANAGFAFGNGSAYAV I++II AFY R ISFF  WLL+
Sbjct  121   GGEWSLNPGPFNVKEHVLISIFANAGFAFGNGSAYAVAIIDIIRAFYHRHISFFTAWLLV  180

Query  573   ITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFF  752
             +TTQVLGYGWAGLL+KYVV+PAHMWWP TLVQ+SLFR LHEK+E      +  +SR+KFF
Sbjct  181   VTTQVLGYGWAGLLRKYVVQPAHMWWPGTLVQVSLFRALHEKDESAKASRQ--ISRSKFF  238

Query  753   VISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIA  932
             ++ L CSF WY  PGY+F TL S+SWVCWVF +SVTA QLGSG++GLGLGA TLDWST++
Sbjct  239   LVVLACSFAWYAVPGYLFPTLTSVSWVCWVFSRSVTAQQLGSGMSGLGLGAFTLDWSTVS  298

Query  933   SFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYD  1112
             SFL SPL+ PFFA  N+F GY   +Y++MP +YWG ++Y+AK FP++SS LF + G  YD
Sbjct  299   SFLFSPLISPFFATANIFFGYVFFVYVIMPAAYWGFDLYSAKTFPIFSSHLFMSNGSSYD  358

Query  1113  ISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRA  1292
             + +IVN +FELD D Y K G++ LS FF+L+YGF FATIA+TITHV LFYG+EIY R+R+
Sbjct  359   VQSIVNSRFELDLDAYGKNGKVSLSVFFALTYGFSFATIAATITHVGLFYGKEIYYRFRS  418

Query  1293  STKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALA  1472
             S K K DIHTKLM+ Y +IP+WWFY L+ ++IAVSL LC  L  EVQ+P+WGLIFA  + 
Sbjct  419   SQKEKPDIHTKLMERYSEIPAWWFYSLMALSIAVSLLLCTVLKREVQLPWWGLIFACGMT  478

Query  1473  FMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDF  1652
             F+FTLPISIITATTNQTPGLN+ITEY MG+I PG PIA VCFK YGYMSM QA+AFLSDF
Sbjct  479   FVFTLPISIITATTNQTPGLNVITEYAMGLIMPGSPIAVVCFKVYGYMSMAQAVAFLSDF  538

Query  1653  KLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRV  1832
             KLGHYMKIPP+SMFLVQF+GT++AGT+N+  AWWLL SI+ IC      +SPWTCP+DRV
Sbjct  539   KLGHYMKIPPKSMFLVQFVGTIVAGTVNIGTAWWLLGSIDGICSDSLPPDSPWTCPNDRV  598

Query  1833  FFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPV  2012
             FFDASVIWGLVGP+RIF  +GNY ALNWFFL G  GPVIV+ LHR FP Q WIPLINLPV
Sbjct  599   FFDASVIWGLVGPRRIFGPDGNYGALNWFFLIGAAGPVIVYALHRTFPGQRWIPLINLPV  658

Query  2013  LLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFM---A  2183
             L GAT  MPPAT++NY+SW+LVGT+FNFFVFRYRKKWW RYNYILSA LDAGVAFM   A
Sbjct  659   LFGATAYMPPATAVNYNSWLLVGTVFNFFVFRYRKKWWTRYNYILSAALDAGVAFMGVGA  718

Query  2184  VLLYFTVGLEDRTIS  2228
             VLL      E R + 
Sbjct  719   VLLVDHAEQEHRLVG  733



>emb|CDP00949.1| unnamed protein product [Coffea canephora]
Length=752

 Score =   957 bits (2475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/733 (64%), Positives = 593/733 (81%), Gaps = 9/733 (1%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
             +D++ EE SP+E+VRLTV+N DDP+LPVWTFRMW LG++SCVLLSFLN FF YR +PL I
Sbjct  26    KDIDPEEESPVEQVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRSQPLTI  85

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
             T I+ QVATLP+GRFMA  LP  KFRIPGFGS QFSLNPGPFNMKEH LI++FANAG +F
Sbjct  86    TMISAQVATLPLGRFMAKVLPKKKFRIPGFGSRQFSLNPGPFNMKEHALISVFANAGSSF  145

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQ-VLGYGWAGLLKKYVVEPAHMWWPS  656
             G G+AYA+ IV I+ AFY R+ISF A W+L+ TTQ VLGYGWAG++++YVVEPAHMWWPS
Sbjct  146   GGGTAYAIDIVTIVRAFYHRRISFLASWILVTTTQQVLGYGWAGIMRRYVVEPAHMWWPS  205

Query  657   TLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVC  836
             +LVQ+SLFR LHEK++         MSR KFFVI+L CSF WY FPG++   L ++S +C
Sbjct  206   SLVQVSLFRALHEKDKSR-------MSRGKFFVIALICSFSWYTFPGFLMPMLTNVSLLC  258

Query  837   WVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLV  1016
              VFP+S+T  Q+GSGL+G+G+G+ +LDWS +ASFL SPLV PFFA +N FVGY +I+Y++
Sbjct  259   LVFPRSITMQQIGSGLSGIGIGSFSLDWSAVASFLGSPLVSPFFATLNAFVGYVVIVYVL  318

Query  1017  MPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFF  1196
             +P++YW  N+Y+ K +P +SS L+  QG+ Y+ISAIV  +F+LD  EY K G + +S  F
Sbjct  319   IPLAYWKFNLYDGKTYPFFSSQLYDNQGKHYNISAIVTDKFQLDLPEYEKLGPVNMSVIF  378

Query  1197  SLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLL  1376
             + +Y   FA + ST+THVALFYG+EI DR++AS+KGK DIHTKLM+ YKDIPSWWF V+L
Sbjct  379   ATTYALSFANLTSTLTHVALFYGKEIKDRFQASSKGKPDIHTKLMRKYKDIPSWWFMVML  438

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
              + +A+SL LC  + D+VQ+P+WGL+F+A +A  FTLPISIITATTNQ PGLN+ITEY+ 
Sbjct  439   SLALALSLVLCTVMIDQVQLPWWGLLFSAGIALFFTLPISIITATTNQQPGLNVITEYVF  498

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             G +YPGKP+ANVCFKT+GY+SM QA++FL+DFKLGHYMKIPPRSMF+VQF+GT+IAGTIN
Sbjct  499   GYVYPGKPVANVCFKTFGYISMGQAVSFLNDFKLGHYMKIPPRSMFIVQFLGTIIAGTIN  558

Query  1737  MSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALN  1913
             + VAW+LL SI+NIC +D L  +SPWTCP + VF+ ASVIWGL+GPKR+F   G Y+ALN
Sbjct  559   IGVAWYLLTSIDNICQKDLLPPDSPWTCPGNDVFYSASVIWGLIGPKRMFGPLGRYSALN  618

Query  1914  WFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFN  2093
             W FL G L P++VWL+H+ FPSQ WI LIN PVLLGAT  MPPA ++NY++W +   +FN
Sbjct  619   WAFLAGALAPLLVWLVHKVFPSQKWIKLINFPVLLGATAMMPPARAVNYNAWFVFAFVFN  678

Query  2094  FFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASC  2273
             F+V+RYRKKWWQRYNY+LSA LDAG+ FM VLLYF +      + WWG+ + +HC L +C
Sbjct  679   FYVYRYRKKWWQRYNYVLSAALDAGLGFMGVLLYFCLQYGGFYLLWWGSEEDDHCPLVAC  738

Query  2274  PTAKGIAVDGCPV  2312
             PTAKGIAVDGCPV
Sbjct  739   PTAKGIAVDGCPV  751



>ref|XP_008663549.1| PREDICTED: oligopeptide transporter 4-like [Zea mays]
 gb|AFW59311.1| hypothetical protein ZEAMMB73_934591 [Zea mays]
Length=737

 Score =   957 bits (2475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/723 (66%), Positives = 587/723 (81%), Gaps = 14/723 (2%)
 Frame = +3

Query  153   EEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLP  332
             E+VRLTV  TDDPTLPVWTFRMW +G+VSC LLSF NQFF+YR EP+II+ ITVQVA LP
Sbjct  27    EQVRLTVPTTDDPTLPVWTFRMWTIGIVSCALLSFFNQFFAYRTEPIIISQITVQVAALP  86

Query  333   IGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIV  512
             +G FMA  LP  K ++  FG  ++++NPGPFN+KEHVLI IFANAG AFGNG AYA+ I+
Sbjct  87    VGHFMARVLP--KTKLSAFGR-EWTMNPGPFNVKEHVLICIFANAGTAFGNGGAYAISII  143

Query  513   NIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLH  692
              II AFY+R ISF    LLI+TTQVLGYGWAGL++K+VVEPA MWWP +LVQ+SL R LH
Sbjct  144   TIIKAFYKRNISFVVSLLLIMTTQVLGYGWAGLMRKHVVEPAQMWWPQSLVQVSLLRALH  203

Query  693   ekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQl  872
             EKEE+        M+R+KFF+I+L CS  WY  PGY+  T++++SWVCW FP+SVT HQ+
Sbjct  204   EKEEQRR------MTRSKFFLIALICSCAWYIVPGYLVPTVSAVSWVCWAFPRSVTMHQI  257

Query  873   gsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYN  1052
             GSG+NG+GLGA TLDWS +A+FL SPLV PFFAIVNV+VG+   +Y+V+P+ YW  N+YN
Sbjct  258   GSGMNGIGLGAFTLDWSVVAAFLGSPLVSPFFAIVNVYVGFVGFIYVVLPVCYWAFNLYN  317

Query  1053  AKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIA  1232
             A  FP++S+DLFT  GQ Y+ISAIVN +FE+D D YAKQGRI+LS  F++SYG GFA+IA
Sbjct  318   ASTFPIFSTDLFTGAGQLYNISAIVNDRFEIDMDAYAKQGRIHLSLLFAVSYGLGFASIA  377

Query  1233  STITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCI  1412
             +T++HV+LFYG+EIY R R S KGK D+HT++MK Y DIP+WWFY+LLVVT+AV+L LC 
Sbjct  378   ATLSHVSLFYGKEIYQRMRESYKGKADVHTRMMKRYDDIPNWWFYLLLVVTMAVALVLCT  437

Query  1413  FLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANV  1592
                 EVQ+P+WGL+FA A+AF FTLPIS+ITATTN TPGLN+ITEY MG+I PGKPIANV
Sbjct  438   AFKHEVQLPWWGLLFACAIAFFFTLPISVITATTNTTPGLNVITEYCMGLIMPGKPIANV  497

Query  1593  CFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIE  1772
             CFK +GYMSM Q+++FL+DFKLGHYMKIPPRSMFLVQ IGTL+AGT+N  VAWWLL ++ 
Sbjct  498   CFKVFGYMSMNQSVSFLTDFKLGHYMKIPPRSMFLVQLIGTLVAGTVNTIVAWWLLTTVP  557

Query  1773  NICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVI  1949
             +IC ++ L   SPWTCP D VFFDASVIWGLVGP+RIF   G YNALNWFFLGG++ PV 
Sbjct  558   HICEKELLPQGSPWTCPGDHVFFDASVIWGLVGPRRIFGPLGYYNALNWFFLGGLVCPVF  617

Query  1950  VWLLHRKFPSQS-WIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWW  2126
             VWLL R  P  + WI L+NLPV+LGAT SMPPA+ +N+++W  VG +FNFFVFRYRK+WW
Sbjct  618   VWLLARALPRHAWWIRLVNLPVILGATASMPPASPINFTAWCFVGAVFNFFVFRYRKQWW  677

Query  2127  QRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGC  2306
             +RYNY+LSA +DAGVA M V++YF   L    I WWG+   EHCDLA+CPTA+G+ VDGC
Sbjct  678   KRYNYVLSAAMDAGVAIMGVIIYF--ALSGHPIDWWGSRG-EHCDLATCPTARGVMVDGC  734

Query  2307  PVF  2315
             PVF
Sbjct  735   PVF  737



>ref|XP_009795358.1| PREDICTED: oligopeptide transporter 2-like [Nicotiana sylvestris]
Length=737

 Score =   957 bits (2473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/731 (69%), Positives = 608/731 (83%), Gaps = 15/731 (2%)
 Frame = +3

Query  123   DVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIIT  302
             + NDEE SPIE+VRLTV+N DDP+LPVWTFRMW LG++SC LLSFLN FFSYR EPL+IT
Sbjct  20    EENDEE-SPIEQVRLTVSNDDDPSLPVWTFRMWFLGLLSCALLSFLNTFFSYRAEPLVIT  78

Query  303   SITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafg  482
              ITVQVATLP+GR MA  LP  KF+I    S +F+LNPGPFNMKEHVLI+IFANAG AFG
Sbjct  79    MITVQVATLPLGRIMARVLPTRKFKI---RSCEFTLNPGPFNMKEHVLISIFANAGSAFG  135

Query  483   ngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTL  662
             NG AYAVGIV+I  AFY R ISF AGW+L+I TQVLGYGWAG+++KYVV+PA MWWPS+L
Sbjct  136   NGPAYAVGIVDITKAFYFRNISFLAGWILVIATQVLGYGWAGIMRKYVVDPAEMWWPSSL  195

Query  663   VQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWV  842
             VQ+SLFR LHEKEE +        SR KFF++ L CSF WY  PG++F TL+S+S +C  
Sbjct  196   VQVSLFRALHEKEEGKS-------SRGKFFLVVLACSFIWYIVPGFLFPTLSSLSLLCLA  248

Query  843   FPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMP  1022
             FPKSV A Q+GSG++GLG+ + T DW+TIAS+LSSPLV PFF+IVNV VGY  I+Y+++P
Sbjct  249   FPKSVLAQQIGSGMHGLGIFSFTFDWATIASYLSSPLVYPFFSIVNVIVGYVAIVYILIP  308

Query  1023  ISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSL  1202
              SYWGLN+YNAK FPL+S+DLF AQGQ Y+I+AIVN +FELD+  YAK G I+LS FF++
Sbjct  309   FSYWGLNLYNAKNFPLFSADLFNAQGQVYNITAIVNDKFELDKVSYAKHGHIHLSMFFAV  368

Query  1203  SYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVV  1382
             +YG  FA + +T+T VALF G+EIY R+RA+ +GK DIHT+LM  YKDIPSWWF++ L +
Sbjct  369   TYGLNFAAVVATLTQVALFNGKEIYQRFRATFQGKPDIHTRLMMKYKDIPSWWFHITLAL  428

Query  1383  TIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGI  1562
             ++A+SL LCIF+ D+VQ+ +WGL+ AA LA +FTLPISIITATTN +PGLN+ITEYI+G+
Sbjct  429   SLALSLVLCIFMKDQVQLSWWGLLLAAFLALIFTLPISIITATTNMSPGLNVITEYIIGM  488

Query  1563  IYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMS  1742
             I PG PIANVCFKTYGYMSM+QA++FL DFKLGHYMK+PPRSMF+VQ IGT++ GTINM 
Sbjct  489   IIPGYPIANVCFKTYGYMSMSQAVSFLQDFKLGHYMKVPPRSMFIVQLIGTILGGTINMG  548

Query  1743  VAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWF  1919
             VAWWLL+SI++IC  D L  NSPWTC SDRVFFDASVIWGLVGPKRIF   G+Y ALNWF
Sbjct  549   VAWWLLNSIKHICQPDLLPPNSPWTCNSDRVFFDASVIWGLVGPKRIF--WGDYIALNWF  606

Query  1920  FLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFF  2099
             F+GG + P++VWLLH+ FPSQSWI LIN+PVLLGAT +MPPAT+LN++SWI  G +FNF 
Sbjct  607   FVGGAVAPILVWLLHKTFPSQSWIKLINIPVLLGATAAMPPATTLNFNSWIFFGILFNFV  666

Query  2100  VFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPT  2279
             +FRYRKKWWQRYNY+LSA LDAGVA M V+L+F + LE+   SWWGT   E+CDLA+CPT
Sbjct  667   IFRYRKKWWQRYNYVLSAALDAGVALMGVVLFFCLSLENVNFSWWGTGG-EYCDLATCPT  725

Query  2280  AKGIAVDGCPV  2312
             AKGI VDGCP+
Sbjct  726   AKGIFVDGCPL  736



>ref|XP_009616769.1| PREDICTED: oligopeptide transporter 2-like [Nicotiana tomentosiformis]
Length=738

 Score =   953 bits (2464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/729 (68%), Positives = 605/729 (83%), Gaps = 14/729 (2%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
              D+E SPIE+VRLTV+N DDP+LPVWTFRMW LG++SC LLSFLN FFSYR EPL+IT I
Sbjct  22    EDDEESPIEQVRLTVSNDDDPSLPVWTFRMWFLGLLSCALLSFLNTFFSYRAEPLVITMI  81

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgng  488
             TVQVATLP+GR MA  LP  KF+I    S +F+LNPGPFNMKEHVLI+IFANAG AFGNG
Sbjct  82    TVQVATLPLGRIMARVLPTRKFKI---RSWEFTLNPGPFNMKEHVLISIFANAGSAFGNG  138

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
              AYAVGIV+I  AFY R ISF AGW+L+I TQVLGYGWAG+++KYVV+PA MWWPS+LVQ
Sbjct  139   PAYAVGIVDITKAFYFRNISFLAGWILVIATQVLGYGWAGIMRKYVVDPAEMWWPSSLVQ  198

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +SLFR LHEKEE +        SR KFF++ L CSF WY  PG++F TL+S+S +C  FP
Sbjct  199   VSLFRALHEKEEGKS-------SRGKFFLVVLACSFIWYIVPGFLFPTLSSLSLLCLAFP  251

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
             KSV A Q+GSG++GLG+ + T DW+TIAS+L SPLV P F+IVNV VGY  I+Y+++PIS
Sbjct  252   KSVLAQQIGSGMHGLGIFSFTFDWATIASYLGSPLVYPLFSIVNVIVGYVAIVYILIPIS  311

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             YWGLN+YNAK FPL+SSDLF AQGQ Y+I+AIVN +FELD+  YAK G I+LS FF+++Y
Sbjct  312   YWGLNLYNAKNFPLFSSDLFNAQGQVYNITAIVNDKFELDKVSYAKHGHIHLSMFFAVTY  371

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTI  1388
             G  FA + +T+T VALF G+EIY R+RA+ KGK DIHT+LM  YKDIPSWWF+V L +++
Sbjct  372   GLNFAAVVATLTQVALFNGKEIYQRFRATFKGKPDIHTRLMMKYKDIPSWWFHVTLALSL  431

Query  1389  AVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIY  1568
             A+SL LCIF+ D+VQ+ +WGL+ AA LA +FTLPISIITATTN +PGLN+ITEYI+G+I 
Sbjct  432   ALSLVLCIFMKDQVQLSWWGLLLAAFLALIFTLPISIITATTNMSPGLNVITEYIIGMII  491

Query  1569  PGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVA  1748
             PG PIANVCFKT+GYMSM+QA++FL DFKLGHYMK+PPRSMF+VQ IGT++ GTINM VA
Sbjct  492   PGYPIANVCFKTFGYMSMSQAVSFLQDFKLGHYMKVPPRSMFIVQLIGTILGGTINMGVA  551

Query  1749  WWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             WWLL+SI++IC  D L  NSPWTC SDRVFFDASVIWGLVGPKRIF   G+Y ALNWFF+
Sbjct  552   WWLLNSIKHICQPDLLPPNSPWTCNSDRVFFDASVIWGLVGPKRIF--WGDYIALNWFFV  609

Query  1926  GGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVF  2105
             GG + P++VWLLH+ FPSQSWI LIN+PVLLGAT +MPPAT+LN++SWI+ G +FNF +F
Sbjct  610   GGAVAPILVWLLHKTFPSQSWIKLINIPVLLGATAAMPPATTLNFNSWIVFGILFNFVIF  669

Query  2106  RYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAK  2285
             RY KKWWQRYNY+LSA LDAGVA M V+L+F + LE+   SWWGT   E+CDLA+CPTAK
Sbjct  670   RYTKKWWQRYNYVLSAALDAGVALMGVVLFFCLSLENVNFSWWGTGG-EYCDLATCPTAK  728

Query  2286  GIAVDGCPV  2312
             GI VDGCP+
Sbjct  729   GIFVDGCPL  737



>ref|XP_008219210.1| PREDICTED: oligopeptide transporter 2-like [Prunus mume]
Length=730

 Score =   953 bits (2463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/726 (67%), Positives = 590/726 (81%), Gaps = 12/726 (2%)
 Frame = +3

Query  123   DVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIIT  302
             D  D+++SPIEEVRLTV N DD +LPVWTFRMW +G+ SC+LLSFLN FFS+R EPL+IT
Sbjct  10    DETDDDLSPIEEVRLTVLNEDDTSLPVWTFRMWTIGLFSCILLSFLNTFFSFRTEPLVIT  69

Query  303   SITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafg  482
              I+VQVA+LPIGRFMA  LP  K  +   G   FSLNPG FN+KEHVLI+IFANAG  FG
Sbjct  70    MISVQVASLPIGRFMARTLPRTKVWV---GGKSFSLNPGEFNIKEHVLISIFANAGAGFG  126

Query  483   ngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTL  662
             +G AYAV IV II AFY RKISFFA W L+ITTQVLGYGWAG+L+KYVV+PA MWWPS+L
Sbjct  127   SGPAYAVDIVTIIKAFYGRKISFFASWALVITTQVLGYGWAGILRKYVVDPAAMWWPSSL  186

Query  663   VQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWV  842
             VQ+SLFR LHE +          MSR KFF+I+L CSF WY  PGY+F TL++ISW+CW+
Sbjct  187   VQVSLFRALHENDSNR-------MSRGKFFLIALICSFSWYVMPGYLFTTLSTISWICWL  239

Query  843   FPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMP  1022
              PKS+TA Q+GSG  GLGLGA+TLDWS IAS+L SPL+ PFFAI N+ VGY IIMY+++P
Sbjct  240   SPKSITAQQIGSGFRGLGLGAVTLDWSVIASYLGSPLISPFFAIANIAVGYIIIMYVIIP  299

Query  1023  ISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSL  1202
             I+YW LN+YNA  F ++SS LF +QGQ YD+ AIVN +FE+D   Y K G I LS FFSL
Sbjct  300   IAYWKLNLYNASNFAIFSSHLFDSQGQIYDVKAIVNDKFEIDMPSYEKHGLINLSVFFSL  359

Query  1203  SYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVV  1382
             +YG GFA + ST+THVALF+GR+IY +Y++S  G +DIHTKLM+ YKDIP+WWF+ LL +
Sbjct  360   TYGIGFAAVISTLTHVALFHGRDIYKQYKSSHTG-IDIHTKLMRKYKDIPNWWFHSLLFL  418

Query  1383  TIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGI  1562
             ++A+SLAL IFL  EVQMP+WGLIFAA LA +FTLPISIITATTN TPGLN+ITEYIMG+
Sbjct  419   SMALSLALFIFLKKEVQMPWWGLIFAAGLALVFTLPISIITATTNVTPGLNVITEYIMGL  478

Query  1563  IYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMS  1742
             I PG+PI NVCFKTYGY+SM QAI+FLSDFKLGHYMKIPP SMF+VQ IGT++AGTIN+ 
Sbjct  479   ILPGQPITNVCFKTYGYISMAQAISFLSDFKLGHYMKIPPISMFVVQCIGTIVAGTINIG  538

Query  1743  VAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWF  1919
              AWWLL S+ENIC+ + L SNSPWTCP+  VFF ASVIWGLVGPKRIF S G+Y+ALNWF
Sbjct  539   TAWWLLGSVENICNVELLPSNSPWTCPNHGVFFTASVIWGLVGPKRIFGSLGHYSALNWF  598

Query  1920  FLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFF  2099
             FL G LGP++VW LH+ FP Q WI  INLPVL GAT  MPPAT++N++ WI++G +FN+F
Sbjct  599   FLVGALGPLLVWSLHKAFPKQKWIAYINLPVLFGATAVMPPATTVNFNCWIVMGIVFNYF  658

Query  2100  VFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPT  2279
             VFRYRK+WWQRYNY+LSA LDAG+AFM VL+Y  + + D +ISWWGT D +HC LA+CPT
Sbjct  659   VFRYRKRWWQRYNYVLSAALDAGLAFMGVLIYMCLTINDISISWWGTEDYDHCPLATCPT  718

Query  2280  AKGIAV  2297
              K I +
Sbjct  719   NKDIVL  724



>ref|XP_006364985.1| PREDICTED: oligopeptide transporter 2-like isoform X2 [Solanum 
tuberosum]
Length=726

 Score =   948 bits (2450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/729 (66%), Positives = 601/729 (82%), Gaps = 11/729 (2%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
              +++ SPIE+VRLTV+N DDP+LPVWTFRMW LG++SC LLSFLN FFSYR EPL+I+ I
Sbjct  7     EEDDESPIEQVRLTVSNDDDPSLPVWTFRMWFLGLLSCALLSFLNTFFSYRAEPLVISMI  66

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgng  488
             TVQVATLPIGR MA  LP  KF I    S +FSLNPGPFN+KEHVLI+IFANAG AFGNG
Sbjct  67    TVQVATLPIGRLMAKVLPKRKFTIK---SWEFSLNPGPFNVKEHVLISIFANAGSAFGNG  123

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
              AYAVGIV+II AFY R I+F AGW+L++ TQVLGYGWAG+++KYVV+PA MWWPS+LVQ
Sbjct  124   PAYAVGIVDIIKAFYFRNITFLAGWILVVATQVLGYGWAGIMRKYVVDPAEMWWPSSLVQ  183

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +SLFR LH+KE E         SR KFF++ L CSF WY  PG++F TL+++S +C  +P
Sbjct  184   VSLFRALHDKEGEGKT------SRGKFFLVVLACSFIWYIVPGFLFPTLSNLSLLCLAYP  237

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
             KSV A QLGSG+ GLG+ + T DW+ IAS+L SPLV PFF IVNV VGY  ++Y+++P S
Sbjct  238   KSVVAQQLGSGMKGLGILSFTFDWAVIASYLGSPLVYPFFVIVNVIVGYIGVVYILIPAS  297

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             YWGLN+YNAK FPL+SS+LF AQGQ Y+++ IVN +FE+D+  YA+ GRI+LS FF+++Y
Sbjct  298   YWGLNLYNAKNFPLFSSELFDAQGQIYNVTQIVNDKFEIDKVSYAQHGRIHLSMFFAVTY  357

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTI  1388
             G  FA + +T++ VALF G+EI  R+RAS KGK DIHT+LM  YKDIP+WWFY++L +++
Sbjct  358   GLNFAAVMATLSQVALFNGKEIVQRFRASYKGKPDIHTRLMMKYKDIPNWWFYLMLALSL  417

Query  1389  AVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIY  1568
             A+SL LCIF+ D+VQ+ +WGL+ AA LA ++TLPIS+ITATTN +PGLN+ITEY++G+I 
Sbjct  418   ALSLVLCIFMKDQVQLSWWGLLLAACLALIYTLPISVITATTNMSPGLNVITEYVIGMII  477

Query  1569  PGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVA  1748
             PGKPIANVCFKT+ YMSM+QA++FL DFKLGHYMK+PPRSMF+VQ +GT++ GTINM VA
Sbjct  478   PGKPIANVCFKTFAYMSMSQAVSFLQDFKLGHYMKVPPRSMFIVQLVGTILGGTINMGVA  537

Query  1749  WWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             WWLL+SI++IC  + L  NSPWTC SDRVFFDASVIWGLVGP+RIF   G Y+ALNW F+
Sbjct  538   WWLLNSIDHICQPNLLPPNSPWTCQSDRVFFDASVIWGLVGPRRIFLGLGEYSALNWCFI  597

Query  1926  GGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVF  2105
             GG++ P +VWLLH+ FPSQSWI LIN+PVLL AT SMPPAT+LN++SWI+VGT+FNFFVF
Sbjct  598   GGLVAPFLVWLLHKSFPSQSWIKLINIPVLLAATASMPPATTLNFNSWIIVGTVFNFFVF  657

Query  2106  RYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAK  2285
             RYRK+WWQRYNY+LSA LDAGVA M V+L+F V + +   SWWGT   E+CDLASCPT K
Sbjct  658   RYRKQWWQRYNYVLSAALDAGVAVMGVVLFFCVTVWNVNFSWWGTGG-EYCDLASCPTGK  716

Query  2286  GIAVDGCPV  2312
             GI VDGCP+
Sbjct  717   GIFVDGCPL  725



>ref|XP_008339039.1| PREDICTED: oligopeptide transporter 2-like [Malus domestica]
Length=743

 Score =   946 bits (2445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/749 (65%), Positives = 599/749 (80%), Gaps = 11/749 (1%)
 Frame = +3

Query  72    KMGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLL  251
             ++ T+E+EA A     E  ND++VS +E+VRLTV+N DD +LPVWTFRMW +G++SC+LL
Sbjct  4     QVTTLEVEAAAKTKLDESENDDDVSSVEQVRLTVSNEDDSSLPVWTFRMWTIGMLSCILL  63

Query  252   SFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNM  431
             SFLN FFSYR EPL+I+ I+VQVA+LPIGRFMA  LP  K  I G     +SLNPG FN+
Sbjct  64    SFLNTFFSYRTEPLVISMISVQVASLPIGRFMARTLPRRKVWIRG---KSYSLNPGEFNV  120

Query  432   KEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGL  611
             KEHVLI+IFANAG  FG+G AYAV IV II AFY RKISFFA W L+ITTQVLGYGWAG+
Sbjct  121   KEHVLISIFANAGAGFGSGPAYAVNIVTIIKAFYGRKISFFASWALVITTQVLGYGWAGI  180

Query  612   LKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFF  791
             ++KYVV+P  MWWPS+LVQ+SLFR LHEK+          MSR KFF+I+L CSF WY  
Sbjct  181   IRKYVVDPGAMWWPSSLVQVSLFRALHEKDNNR-------MSRGKFFLIALVCSFSWYLV  233

Query  792   PGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFA  971
             PGY+F TL+ ISW+CW++PKS+ A Q+GSG  GLG+GA TLDWS I+S+L SPL+ PFFA
Sbjct  234   PGYLFTTLSIISWICWIYPKSIRAQQIGSGFRGLGVGAFTLDWSVISSYLGSPLISPFFA  293

Query  972   IVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDE  1151
             IVN+ VGY IIMY+++PISYW LN+YNA+ F ++SS LF + GQ Y++  IVN +F++D 
Sbjct  294   IVNITVGYIIIMYVIIPISYWKLNLYNARNFAIFSSHLFDSDGQIYNVKGIVNDRFQIDM  353

Query  1152  DEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLM  1331
               Y KQG I LS FF+L+YG GFA + ST+THVALF GR+IY+RY++S  GK+DIHTKLM
Sbjct  354   PAYEKQGFINLSVFFALTYGLGFAAVVSTLTHVALFNGRDIYERYQSSYSGKIDIHTKLM  413

Query  1332  KNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITAT  1511
             + Y+DIPSWWF++LLVV++ +SLALCIF+ DEVQMP+WGLIFAA +A +FTLPISIITAT
Sbjct  414   RKYRDIPSWWFHILLVVSLVLSLALCIFMKDEVQMPWWGLIFAAGIALIFTLPISIITAT  473

Query  1512  TNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSM  1691
             TN TPGLNIITEY+MG+I PG PIANVCFKTYGY+SM QAI+FLSDFKLGHYMKIPP SM
Sbjct  474   TNVTPGLNIITEYVMGLILPGYPIANVCFKTYGYISMAQAISFLSDFKLGHYMKIPPISM  533

Query  1692  FLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSN-SPWTCPSDRVFFDASVIWGLVG  1868
             FLVQ +GT++AGT+N+  AWWLL +++NIC+ + L + SPWTCP D VFF+ASV WGLVG
Sbjct  534   FLVQCVGTVVAGTVNIGTAWWLLTTVKNICNTELLPDTSPWTCPGDXVFFNASVJWGLVG  593

Query  1869  PKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPAT  2048
             PKRIF S G Y  LNWFF  G LGPVIVWL H  FP Q WI  INLPVL G+T  MPPAT
Sbjct  594   PKRIFGSRGLYGGLNWFFXVGALGPVIVWLFHXAFPRQKWIAYINLPVLFGSTAVMPPAT  653

Query  2049  SLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTIS  2228
             ++N++SWI+VG +FN+FVFRYRKKWWQRYNY+ SA LDAGVAFM VL+Y  + + + +IS
Sbjct  654   TVNFNSWIVVGIVFNYFVFRYRKKWWQRYNYVXSAALDAGVAFMGVLIYICLTINEVSIS  713

Query  2229  WWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             W GT D +HC L++CPT+K I +     F
Sbjct  714   WXGTQDYDHCKLSTCPTSKSIXLGHACXF  742



>ref|XP_002963418.1| hypothetical protein SELMODRAFT_166204 [Selaginella moellendorffii]
 gb|EFJ35289.1| hypothetical protein SELMODRAFT_166204 [Selaginella moellendorffii]
Length=743

 Score =   946 bits (2445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/750 (63%), Positives = 592/750 (79%), Gaps = 16/750 (2%)
 Frame = +3

Query  78    GTVEIE---APALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVL  248
             G+ E E   AP ++  G+D      SP+EEV LTV   DDPTLPV TFRMW LG++SC+L
Sbjct  6     GSSESEPLVAPQVEAEGDDQ-----SPVEEVALTVDTRDDPTLPVGTFRMWFLGLLSCIL  60

Query  249   LSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFN  428
             LSFLNQFFSYR EP II  I+VQ+  LP GRFMA  LP   FR+P F S  FSLNPGPFN
Sbjct  61    LSFLNQFFSYRTEPFIIGLISVQIVALPFGRFMANVLPERSFRVP-FTSSSFSLNPGPFN  119

Query  429   MKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAG  608
             +KEHVLITIFANAG  FGNG AYA+GIVNI  AFY+R + F AG LL++TTQVLGYGWAG
Sbjct  120   VKEHVLITIFANAGSGFGNGGAYAMGIVNITRAFYKRSMGFTAGLLLVMTTQVLGYGWAG  179

Query  609   LLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYF  788
             L+KK++VEPAHMWWP  LVQ+SLFRTLHE+++++  G     SR++FF I +  SFC+Y 
Sbjct  180   LMKKHLVEPAHMWWPGNLVQVSLFRTLHEEDQQQKKG----FSRSQFFAIVMTLSFCYYV  235

Query  789   FPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFF  968
              PGY+F  L S+SWVCW+FPKSV A QLGSGL GLGLG+ +LDW+TI+++L SPLV P+F
Sbjct  236   LPGYMFMMLTSMSWVCWIFPKSVLAQQLGSGLKGLGLGSFSLDWATISAYLGSPLVTPWF  295

Query  969   AIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELD  1148
             AI NV  GY ++MY+V P  YW  N+Y+AKI+PL+SS LFT  GQ YD++++V+K F+LD
Sbjct  296   AICNVIFGYLVVMYIVTPACYWS-NIYDAKIYPLFSSYLFTKDGQVYDVTSVVDKNFDLD  354

Query  1149  EDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKL  1328
              + YA++G +++STFF+ SYG GFA +AST+THVA F+G+ I++R RA+   K DIHT+L
Sbjct  355   LEAYARKGPVHMSTFFAFSYGLGFAAVASTLTHVACFHGKYIWERSRAALTEKPDIHTRL  414

Query  1329  MKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITA  1508
             M+ Y D+P WWF+ L+V++IA S+A C +   E+Q+P+WG++ A  +A  FTLPI +ITA
Sbjct  415   MRKYPDVPQWWFHTLMVISIAASIATCAYYKAELQLPWWGVLLACVVASSFTLPIGVITA  474

Query  1509  TTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRS  1688
             TTN TPGLNIITEY+MG + PG+P+ANVCFKTYGY+SMTQAI+FL DFKLGHYMK+P RS
Sbjct  475   TTNITPGLNIITEYLMGYLLPGQPMANVCFKTYGYISMTQAISFLQDFKLGHYMKVPHRS  534

Query  1689  MFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLV  1865
             MF VQFIGT++A  +NM  AWWLL SIENIC +  L  NSPWTCPSDRVFFDASVIWGL+
Sbjct  535   MFHVQFIGTIVAAIVNMCCAWWLLGSIENICDKSLLPPNSPWTCPSDRVFFDASVIWGLI  594

Query  1866  GPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPA  2045
             GPKR+F S G Y  L WFFLGG LGPV+VWL  R FP+  WIPLINLPV+LGAT  MPPA
Sbjct  595   GPKRMFGSHGEYKELQWFFLGGALGPVLVWLASRTFPNVKWIPLINLPVILGATAYMPPA  654

Query  2046  TSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTI  2225
             TS+NY SW +VG IFN+F+FRY K WWQRYNY+ SA +DAGVAFM VLLY  +G+E+R++
Sbjct  655   TSVNYISWSIVGIIFNYFIFRYHKGWWQRYNYVFSAAMDAGVAFMGVLLYLCLGIENRSL  714

Query  2226  SWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             SWWG  ++++C LA CPTAKGI + GCPV+
Sbjct  715   SWWG-NNVDNCPLADCPTAKGIVIAGCPVY  743



>ref|XP_009619170.1| PREDICTED: oligopeptide transporter 2-like [Nicotiana tomentosiformis]
Length=733

 Score =   945 bits (2443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/725 (67%), Positives = 596/725 (82%), Gaps = 19/725 (3%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIE+VRLTV+N DDP+LPVWTFRMW LG++SC +L+FLN FFSYR +PL I+ ITVQ+A
Sbjct  25    SPIEQVRLTVSNQDDPSLPVWTFRMWFLGILSCGILAFLNTFFSYRTQPLSISMITVQIA  84

Query  324   TLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
              LP+G+ MA  LP  KF+I   GS +FS NPGPFNMKEHVLI+IFAN G      +AYAV
Sbjct  85    ALPLGKIMARVLPTRKFKI---GSWEFSFNPGPFNMKEHVLISIFANCGSG----TAYAV  137

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFR  683
              IV II AFY R ISF AGW+L++TTQVLGYGWAG+++KYVV+PA MWWP  +V +SLFR
Sbjct  138   SIVTIIKAFYLRNISFVAGWILVVTTQVLGYGWAGIMRKYVVDPAEMWWPGNMVLVSLFR  197

Query  684   TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTA  863
              LHEK+ +         SR KFF++ L CSF WY  PG++F TL++IS +C  +PKSV A
Sbjct  198   ALHEKDADGKS------SRGKFFLVVLACSFIWYIVPGFLFPTLSNISLLCLFYPKSVLA  251

Query  864   HQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLN  1043
              Q+GSG+ GLG+ + T DWS +AS+L SPLVCP FAI+NV VGY +++Y+++PISYWG N
Sbjct  252   QQIGSGMKGLGILSFTFDWSVVASYLGSPLVCPLFAIINVIVGYVVVVYILIPISYWGFN  311

Query  1044  VYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFA  1223
             +Y+A+ FPL SS LF AQGQ YDI+AIVN +FELDE  YAKQGRI +STFF+L+YG  FA
Sbjct  312   IYDARTFPLLSSHLFNAQGQTYDITAIVNDKFELDEVAYAKQGRINISTFFALTYGLNFA  371

Query  1224  TIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLA  1403
              + +T+  VALF G+EIY+R+RA   GK DIHT+LMK Y DIPSWWF+ +LV+++A+SL 
Sbjct  372   AVVATLAQVALFNGKEIYERFRAINSGKPDIHTRLMKKYADIPSWWFHGMLVLSLALSLV  431

Query  1404  LCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPI  1583
             LCI   D+VQ+P+WGL+FAAA+A +FTLPISIITATTN TPGLN+ITEYI+G+I PGKPI
Sbjct  432   LCIVWEDQVQLPWWGLLFAAAIALIFTLPISIITATTNMTPGLNVITEYIIGLIIPGKPI  491

Query  1584  ANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLH  1763
             ANVCFKT+GY+SM+QA++FLSDFKLGHYMKIPPRSMF+VQ +GTLIAGTINMSVAWWLL 
Sbjct  492   ANVCFKTFGYISMSQAVSFLSDFKLGHYMKIPPRSMFIVQLLGTLIAGTINMSVAWWLLT  551

Query  1764  SIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
             +I++IC QD+L  +NSPWTCP +RVFFDASVIWGLVGPKR+F S GNY+A NWFFLGG +
Sbjct  552   NIDHIC-QDQLLPTNSPWTCPGNRVFFDASVIWGLVGPKRMFGSLGNYSAQNWFFLGGAI  610

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
             GP++VWLLH+ FPSQSWI LIN+PVLLGAT +MPPAT LN++SWI  G +FNFF+FRYRK
Sbjct  611   GPLLVWLLHKAFPSQSWIKLINIPVLLGATAAMPPATPLNFNSWIFFGILFNFFIFRYRK  670

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV  2297
             KWWQ+YNY+LSA LDAG+AFM V +YF +G  D   SWWGT   E+CDLA+CPT KGI V
Sbjct  671   KWWQKYNYVLSAALDAGLAFMGVFIYFCLG--DVKFSWWGTGG-EYCDLATCPTTKGIVV  727

Query  2298  DGCPV  2312
             +GCP+
Sbjct  728   EGCPL  732



>ref|XP_006364984.1| PREDICTED: oligopeptide transporter 2-like isoform X1 [Solanum 
tuberosum]
Length=737

 Score =   945 bits (2443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/724 (67%), Positives = 598/724 (83%), Gaps = 11/724 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIE+VRLTV+N DDP+LPVWTFRMW LG++SC LLSFLN FFSYR EPL+I+ ITVQVA
Sbjct  23    SPIEQVRLTVSNDDDPSLPVWTFRMWFLGLLSCALLSFLNTFFSYRAEPLVISMITVQVA  82

Query  324   TLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
             TLPIGR MA  LP  KF I    S +FSLNPGPFN+KEHVLI+IFANAG AFGNG AYAV
Sbjct  83    TLPIGRLMAKVLPKRKFTIK---SWEFSLNPGPFNVKEHVLISIFANAGSAFGNGPAYAV  139

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFR  683
             GIV+II AFY R I+F AGW+L++ TQVLGYGWAG+++KYVV+PA MWWPS+LVQ+SLFR
Sbjct  140   GIVDIIKAFYFRNITFLAGWILVVATQVLGYGWAGIMRKYVVDPAEMWWPSSLVQVSLFR  199

Query  684   TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTA  863
              LH+KE E         SR KFF++ L CSF WY  PG++F TL+++S +C  +PKSV A
Sbjct  200   ALHDKEGEGKT------SRGKFFLVVLACSFIWYIVPGFLFPTLSNLSLLCLAYPKSVVA  253

Query  864   HQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLN  1043
              QLGSG+ GLG+ + T DW+ IAS+L SPLV PFF IVNV VGY  ++Y+++P SYWGLN
Sbjct  254   QQLGSGMKGLGILSFTFDWAVIASYLGSPLVYPFFVIVNVIVGYIGVVYILIPASYWGLN  313

Query  1044  VYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFA  1223
             +YNAK FPL+SS+LF AQGQ Y+++ IVN +FE+D+  YA+ GRI+LS FF+++YG  FA
Sbjct  314   LYNAKNFPLFSSELFDAQGQIYNVTQIVNDKFEIDKVSYAQHGRIHLSMFFAVTYGLNFA  373

Query  1224  TIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLA  1403
              + +T++ VALF G+EI  R+RAS KGK DIHT+LM  YKDIP+WWFY++L +++A+SL 
Sbjct  374   AVMATLSQVALFNGKEIVQRFRASYKGKPDIHTRLMMKYKDIPNWWFYLMLALSLALSLV  433

Query  1404  LCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPI  1583
             LCIF+ D+VQ+ +WGL+ AA LA ++TLPIS+ITATTN +PGLN+ITEY++G+I PGKPI
Sbjct  434   LCIFMKDQVQLSWWGLLLAACLALIYTLPISVITATTNMSPGLNVITEYVIGMIIPGKPI  493

Query  1584  ANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLH  1763
             ANVCFKT+ YMSM+QA++FL DFKLGHYMK+PPRSMF+VQ +GT++ GTINM VAWWLL+
Sbjct  494   ANVCFKTFAYMSMSQAVSFLQDFKLGHYMKVPPRSMFIVQLVGTILGGTINMGVAWWLLN  553

Query  1764  SIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILG  1940
             SI++IC  + L  NSPWTC SDRVFFDASVIWGLVGP+RIF   G Y+ALNW F+GG++ 
Sbjct  554   SIDHICQPNLLPPNSPWTCQSDRVFFDASVIWGLVGPRRIFLGLGEYSALNWCFIGGLVA  613

Query  1941  PVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKK  2120
             P +VWLLH+ FPSQSWI LIN+PVLL AT SMPPAT+LN++SWI+VGT+FNFFVFRYRK+
Sbjct  614   PFLVWLLHKSFPSQSWIKLINIPVLLAATASMPPATTLNFNSWIIVGTVFNFFVFRYRKQ  673

Query  2121  WWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVD  2300
             WWQRYNY+LSA LDAGVA M V+L+F V + +   SWWGT   E+CDLASCPT KGI VD
Sbjct  674   WWQRYNYVLSAALDAGVAVMGVVLFFCVTVWNVNFSWWGTGG-EYCDLASCPTGKGIFVD  732

Query  2301  GCPV  2312
             GCP+
Sbjct  733   GCPL  736



>gb|EMT01286.1| Oligopeptide transporter 4 [Aegilops tauschii]
Length=730

 Score =   945 bits (2443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/738 (65%), Positives = 595/738 (81%), Gaps = 13/738 (2%)
 Frame = +3

Query  105   LKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRR  284
             ++ AG   ++++ SP+E+VRLTV  TDDP+LPVWTFRMW +G +SC LLSFLNQFF+YR 
Sbjct  3     IERAGGAGDEDDASPVEQVRLTVPVTDDPSLPVWTFRMWTMGFLSCALLSFLNQFFAYRA  62

Query  285   EPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfan  464
             EP+II+ IT+QVA LPIG F+A  LP  KFR+  FG  + S+NPGPFN+KEHVLI+IFAN
Sbjct  63    EPIIISQITIQVAALPIGHFLARVLPEKKFRV--FGR-ECSVNPGPFNVKEHVLISIFAN  119

Query  465   agfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHM  644
             AG +FG G+AYA+GIV II AFY+R ISF    LL+ITTQVLGYGWAGL++KYVVEPAHM
Sbjct  120   AGASFGGGNAYAIGIVTIIKAFYKRNISFVTSLLLVITTQVLGYGWAGLMRKYVVEPAHM  179

Query  645   WWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASI  824
             WWP++LVQ+SL R +HEKE+         M+R KFF+I+L CSF WY  PGY+F TL ++
Sbjct  180   WWPTSLVQVSLMRAMHEKEKRR-------MTRGKFFLIALICSFAWYTVPGYLFPTLTAV  232

Query  825   SWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAII  1004
             SWVCWVFPKS+T  Q+GSGLNGLG+GA TLDW+T+ S+L SPLV PFFA  NV VGY ++
Sbjct  233   SWVCWVFPKSITMQQIGSGLNGLGIGAFTLDWATVVSWLGSPLVTPFFATANVLVGYVLL  292

Query  1005  MYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYL  1184
             +Y+++P++YW +N+Y+A  +PL+S++LF A GQ YDI AIVN +FE+D D YA+QGRI+L
Sbjct  293   IYIMLPVAYWVINLYSASSYPLFSNELFDAHGQLYDIHAIVNDRFEIDMDAYARQGRIHL  352

Query  1185  STFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWF  1364
             S FF++SYG GFATIA+T THVA FYG+E+Y R+R S KGKMD+H +LMK Y DIP+WWF
Sbjct  353   SLFFAVSYGLGFATIAATFTHVACFYGKEMYQRFRESYKGKMDVHARLMKRYDDIPNWWF  412

Query  1365  YVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIIT  1544
             Y+LL V++AVSL LC    +EVQ+P+WGL+ A A+AF+FTLPIS+ITATTN TPGLNIIT
Sbjct  413   YILLAVSMAVSLVLCTVFKEEVQLPWWGLLIACAIAFVFTLPISVITATTNTTPGLNIIT  472

Query  1545  EYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIA  1724
             EY  G+I PGKPIANVCFK YGYMSM QA++FL+DFKLGHYMKIPPRSMFLVQF+GT++A
Sbjct  473   EYCWGLIMPGKPIANVCFKVYGYMSMNQAVSFLTDFKLGHYMKIPPRSMFLVQFVGTVVA  532

Query  1725  GTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNY  1901
              T+N  VAWWLL ++ +IC + +L   SPWTCP D VFFDASVIWGLVGP+RIF   G Y
Sbjct  533   STVNTVVAWWLLTTVPHICEKGQLPEGSPWTCPGDHVFFDASVIWGLVGPRRIFGPLGYY  592

Query  1902  NALNWFFLGGILGPVIVWLLHRKFPSQS-WIPLINLPVLLGATGSMPPATSLNYSSWILV  2078
             +ALNWFFL G+ GPV+VWL  +  P  + WI LINLPV+LG T  MPPA++LNY++W  V
Sbjct  593   SALNWFFLIGLAGPVVVWLFAKALPRHAGWISLINLPVILGGTAMMPPASALNYTAWGFV  652

Query  2079  GTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHC  2258
             G +FNFFVFRYRK WW+RYNY+LSA +D GVA M VLLYF +      + WWG+   E+C
Sbjct  653   GFVFNFFVFRYRKGWWKRYNYVLSAAMDGGVAIMGVLLYFALTSWGHQLDWWGSRG-EYC  711

Query  2259  DLASCPTAKGIAVDGCPV  2312
             DLA+CPTAKG+ VDGCPV
Sbjct  712   DLAACPTAKGVLVDGCPV  729



>ref|XP_002971556.1| hypothetical protein SELMODRAFT_172313 [Selaginella moellendorffii]
 gb|EFJ27305.1| hypothetical protein SELMODRAFT_172313 [Selaginella moellendorffii]
Length=743

 Score =   944 bits (2440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/747 (64%), Positives = 591/747 (79%), Gaps = 10/747 (1%)
 Frame = +3

Query  78    GTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSF  257
             G+ E E P +    E   D++ SP+EEV LTV   DDPTLPV TFRMW LG++SC+LLSF
Sbjct  6     GSSESE-PLVTREVEPEGDDQ-SPVEEVALTVDTRDDPTLPVGTFRMWFLGLLSCILLSF  63

Query  258   LNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKE  437
             LNQFFSYR EP II  I+VQ+  LP GRFMA  LP   FR+P F S  FSLNPGPFN+KE
Sbjct  64    LNQFFSYRTEPFIIGLISVQIVALPFGRFMANVLPERSFRVP-FTSSSFSLNPGPFNVKE  122

Query  438   HVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLK  617
             HVLITIFANAG  FGNG AYA+GIVNI  AFY+R + F AG LL++TTQVLGYGWAGL+K
Sbjct  123   HVLITIFANAGSGFGNGGAYAMGIVNITRAFYKRSMGFTAGLLLVMTTQVLGYGWAGLMK  182

Query  618   KYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPG  797
             K++VEPAHMWWP  LVQ+SLFRTLHE+++++  G     SR++FF I +  SFC+Y  PG
Sbjct  183   KHLVEPAHMWWPGNLVQVSLFRTLHEEDQQQKKG----FSRSQFFAIVMTLSFCYYVLPG  238

Query  798   YIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIV  977
             Y+F  L S+SWVCW+FPKSV A QLGSGL GLGLG+ +LDW+TI+++L SPLV P+FAI 
Sbjct  239   YMFMMLTSMSWVCWIFPKSVLAQQLGSGLKGLGLGSFSLDWATISAYLGSPLVTPWFAIC  298

Query  978   NVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDE  1157
             NV  GY ++MY+V P  YW  N+YNAKI+PL+SS LFT  GQ YD++++V+K F+LD + 
Sbjct  299   NVIFGYLVVMYIVTPACYWS-NIYNAKIYPLFSSYLFTKDGQVYDVTSVVDKNFDLDLEA  357

Query  1158  YAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKN  1337
             YA++G +++STFF+ SYG GFA +AST+THVA F+G+ I++R RA+   K DIHT+LM+ 
Sbjct  358   YARKGPVHMSTFFAFSYGLGFAAVASTLTHVACFHGKYIWERSRAALNEKPDIHTRLMRK  417

Query  1338  YKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTN  1517
             Y D+P WWF+ L+V++IA S+A C +   E+Q+P+WG++ A  +A  FTLPI +ITATTN
Sbjct  418   YPDVPQWWFHTLMVISIAASIATCAYYKAELQLPWWGVLLACVVASSFTLPIGVITATTN  477

Query  1518  QTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFL  1697
              TPGLNIITEY+MG + PG+P+ANVCFKTYGY+SMTQAI+FL DFKLGHYMK+P RSMF 
Sbjct  478   ITPGLNIITEYLMGYLLPGQPMANVCFKTYGYISMTQAISFLQDFKLGHYMKVPHRSMFH  537

Query  1698  VQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPK  1874
             VQFIGT++A  +NM  AWWLL SIENIC +  L  NSPWTCPSDRVFFDASVIWGL+GPK
Sbjct  538   VQFIGTIVAAIVNMCCAWWLLGSIENICDKSLLPPNSPWTCPSDRVFFDASVIWGLIGPK  597

Query  1875  RIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSL  2054
             R+F S G Y  L WFFLGG LGPV+VWL  R FP+  WIPLINLPV+LGAT  MPPATS+
Sbjct  598   RMFGSHGEYKELQWFFLGGALGPVLVWLASRTFPNVKWIPLINLPVILGATAYMPPATSV  657

Query  2055  NYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWW  2234
             NY SW +VG IF++F+FRY K WWQRYNY+ SA +DAGVAFM VLLY  +G+E+R++SWW
Sbjct  658   NYISWSIVGIIFSYFIFRYHKGWWQRYNYVFSAAMDAGVAFMGVLLYLCLGIENRSLSWW  717

Query  2235  GTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             G  ++++C LA CPTAKGI + GCPV+
Sbjct  718   G-NNVDNCPLADCPTAKGIVIAGCPVY  743



>gb|AAB60748.1| Similar to S. pombe ISP4 (gb|D83992) [Arabidopsis thaliana]
Length=722

 Score =   943 bits (2437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/741 (64%), Positives = 584/741 (79%), Gaps = 55/741 (7%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             M  +E+  P  ++  +D +DE  SP+E+VRLTV+N DDP+LPVWTFRMW LG++SC+LLS
Sbjct  1     MAAIELHKP--EINADDDDDE--SPVEQVRLTVSNHDDPSLPVWTFRMWFLGLLSCILLS  56

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLN FF YR +PL+IT I+VQV TLP+G+ MA  LP  K++I   GS +FS NPGPFN+K
Sbjct  57    FLNTFFGYRTQPLMITMISVQVVTLPLGKLMARVLPETKYKI---GSWEFSFNPGPFNVK  113

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLI++FANAG  FG+G+AYAVGIV+II+AFY+RKISF A W+L+ITTQ          
Sbjct  114   EHVLISMFANAGAGFGSGTAYAVGIVDIIMAFYKRKISFLASWILVITTQ----------  163

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
                                                   RMSR KFFVI+  CSF WY FP
Sbjct  164   -----------------------------------DNARMSRGKFFVIAFVCSFAWYIFP  188

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
              Y+F TL+SISWVCW FPKS+TA QLGSG++GLG+GA  LDWS IAS+L SPLV PFFAI
Sbjct  189   AYLFLTLSSISWVCWAFPKSITAQQLGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAI  248

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
             VNV VGY ++MY+V+PISYWG+NVY A  FP++SSDLF  QGQ Y+IS IVN +FELD +
Sbjct  249   VNVLVGYVLVMYMVIPISYWGMNVYEANKFPIFSSDLFDKQGQLYNISTIVNNKFELDME  308

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMK  1334
              Y +QGR+YLSTFF++SYG GFA I ST+THVALF G+ I+ + RASTK KMDIHT+LMK
Sbjct  309   NYQQQGRVYLSTFFAISYGIGFAAIVSTLTHVALFNGKGIWQQVRASTKAKMDIHTRLMK  368

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
              YKDIP WWFY LL +++ +SL LCIF+ DE+QMP+WGL+ A+ +A  FT+P+SIITATT
Sbjct  369   KYKDIPGWWFYSLLAISLVLSLVLCIFMKDEIQMPWWGLLLASFMALTFTVPVSIITATT  428

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQTPGLNIITEY+MG++ PG+PIANVCFKTYGY+SM+QAI+FL+DFKLGHYMKIPPRSMF
Sbjct  429   NQTPGLNIITEYLMGVLLPGRPIANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPRSMF  488

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGP  1871
             LVQFIGT+IAGT+N+SVAW+LL S+ENIC ++ L  NSPWTCPSDRVFFDASVIWGLVGP
Sbjct  489   LVQFIGTVIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGP  548

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATS  2051
             KRIF   GNY ALNWFFLGG++GPV+VWLL + FP+++WI  INLPVLLGAT +MPPATS
Sbjct  549   KRIFGRLGNYPALNWFFLGGLIGPVLVWLLQKAFPTKTWISQINLPVLLGATAAMPPATS  608

Query  2052  LNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTIS-  2228
             +N++ WI+VG IFN+FVF+Y KKWWQRYNY+LSA LDAG+AFM VLLYF++ +   +I+ 
Sbjct  609   VNFNCWIIVGVIFNYFVFKYCKKWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISINH  668

Query  2229  WWGTTDLEHCDLASCPTAKGI  2291
             WWG    E+C LASCPTA G+
Sbjct  669   WWGAKG-ENCPLASCPTAPGV  688



>gb|KHN08229.1| Oligopeptide transporter 4 [Glycine soja]
Length=698

 Score =   942 bits (2435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/733 (66%), Positives = 588/733 (80%), Gaps = 37/733 (5%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
             E   ++++SPIEEVRL V+N DDP  PVWTFRMW LG+V                     
Sbjct  2     ESAKEDDISPIEEVRLVVSNEDDPRQPVWTFRMWFLGIV---------------------  40

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
                   VATLPIGRFMA  LP  KFRI G     FSLNPGPFN+KEHVLI+IFANAG AF
Sbjct  41    ------VATLPIGRFMARVLPPTKFRIRG---RDFSLNPGPFNIKEHVLISIFANAGAAF  91

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
             GNG+AYAVGIV+II AFY RKI+F AGWLL++TTQVLGYGWAG++KKYVVEPA MWWPST
Sbjct  92    GNGAAYAVGIVDIIRAFYGRKITFLAGWLLVLTTQVLGYGWAGIMKKYVVEPAEMWWPST  151

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR LHEKE++        MS+  FF+I+L CSF WY  PGY+F  L+ ISWVCW
Sbjct  152   LVQVSLFRALHEKEKKRGR-----MSKETFFLIALTCSFVWYVVPGYLFTALSIISWVCW  206

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
             +FP SVTA Q+GSG  GLGLG+ +LDW+T+A+FL +PLV PFFA  NV VGY +++YL++
Sbjct  207   IFPHSVTAQQIGSGEKGLGLGSFSLDWTTVAAFLGNPLVSPFFATANVLVGYILLIYLII  266

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             P+SYWGLN+YNAK FP+YSS LF A G EY++ AIVN++FE+D   Y KQGR+ LS FF+
Sbjct  267   PVSYWGLNIYNAKNFPIYSSSLFVANGTEYNVKAIVNEKFEIDMLAYEKQGRVNLSAFFA  326

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLV  1379
             +SYG GFA IAS++THVA+F GREIY+++R+S   K DIH +LMK YK IPSWWF+V L+
Sbjct  327   ISYGIGFAAIASSLTHVAIFNGREIYEQFRSSRSKKEDIHARLMKKYKRIPSWWFHVTLL  386

Query  1380  VTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMG  1559
             V+ A++L  CI + D++QMP+WGLIFA+ +A  FTLP+SIITATTNQTPGLNIITEYIMG
Sbjct  387   VSFALALLQCIVMKDQIQMPWWGLIFASGIALTFTLPVSIITATTNQTPGLNIITEYIMG  446

Query  1560  IIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINM  1739
             +I PGKPIANVCFKTYGY+SM+QA++FLSDFKLGHYMKIPPRSMF+VQ +GTLIAGT+++
Sbjct  447   VILPGKPIANVCFKTYGYISMSQAVSFLSDFKLGHYMKIPPRSMFIVQVVGTLIAGTMDV  506

Query  1740  SVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNW  1916
              VAWWLL S++NIC+QD L ++SPWTCP D+VFFDASVIWGLVGPKRIF + GNY  LNW
Sbjct  507   GVAWWLLGSVKNICNQDLLPADSPWTCPGDKVFFDASVIWGLVGPKRIFGTLGNYPKLNW  566

Query  1917  FFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNF  2096
             FFL G LGP+++WLL + F  Q+WI LI+LPVLLGAT +MPPA+S+N+++WI VGTIFN+
Sbjct  567   FFLIGALGPLVIWLLQKAFRKQTWISLIHLPVLLGATANMPPASSVNFNAWITVGTIFNY  626

Query  2097  FVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCP  2276
             FVF+YRK WWQRYNY+L+A LDAG+AFM VLLYF V +E++ I WWG  D + C LA CP
Sbjct  627   FVFKYRKNWWQRYNYVLAAALDAGLAFMTVLLYFAVNVEEKGIVWWG-NDGDQCKLAKCP  685

Query  2277  TAKGIAVDGCPVF  2315
             TAKG+  +GCPVF
Sbjct  686   TAKGVVTEGCPVF  698



>ref|XP_009780017.1| PREDICTED: oligopeptide transporter 4-like [Nicotiana sylvestris]
Length=734

 Score =   941 bits (2432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/730 (65%), Positives = 584/730 (80%), Gaps = 10/730 (1%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
             N++E S +EEVRLTV   DDP++PVWTFRM  LG++SC LLSF+N FFSYR+ PLII+ I
Sbjct  12    NEDEQSTVEEVRLTVPTDDDPSVPVWTFRMCFLGIISCALLSFINIFFSYRQNPLIISMI  71

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgng  488
             T QVA+LP+G+ MA  LP  KF +PGF S +FSLNPGPF+MKEHVLI+IFANAG  FG G
Sbjct  72    TAQVASLPLGQLMAKVLPTRKFHLPGFASREFSLNPGPFSMKEHVLISIFANAGAGFGGG  131

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
             +AYA+ IV+II  FY RKISF AGW+L+ITTQVLGYGWAG+++KYVVEPA MWWPSTLVQ
Sbjct  132   TAYAISIVDIIKVFYHRKISFLAGWILVITTQVLGYGWAGIMRKYVVEPAEMWWPSTLVQ  191

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +S+FR LHEK+   +       SR KFF+I + CSF WY  PGY+F+TL+++S +C  F 
Sbjct  192   VSIFRALHEKDNSGNY------SRGKFFLIVMTCSFTWYIIPGYLFKTLSTVSVLCLAFR  245

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
             KSV AHQLGSG NGLG+ + T DWS +A +L+SPLV PFFAIVN+ VGY II+Y+++P +
Sbjct  246   KSVLAHQLGSGQNGLGILSFTFDWSVVA-YLTSPLVTPFFAIVNILVGYVIIVYMMIPAA  304

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             YWG N+YNA  FPL+S++LF A G +Y++SAIVN +FE+D   Y KQGRI LS  F+LSY
Sbjct  305   YWGFNLYNANKFPLFSTNLFDANGHKYNVSAIVNDKFEIDMPVYEKQGRINLSIMFALSY  364

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTI  1388
             G  FATI +T+THV LF GREIY R+RAS KGK DIHT+LM+ Y DIPSWWF+ +LV+++
Sbjct  365   GLSFATIVATLTHVILFNGREIYGRFRASYKGKTDIHTRLMRKYNDIPSWWFHTILVLSL  424

Query  1389  AVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIY  1568
             A+SL LC  +  E+Q+P+WGLIFA  +A +FTLPISII ATTN +PGLN+ITEYI+G+I 
Sbjct  425   ALSLVLCTVMKSEIQLPWWGLIFACGIALIFTLPISIIQATTNNSPGLNVITEYIIGLII  484

Query  1569  PGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVA  1748
             PGKPIANVCFKTYGY+SM QA++FL DFKLGHYMKIPPRSMF+VQ +GT IA TINM+ A
Sbjct  485   PGKPIANVCFKTYGYISMAQAVSFLQDFKLGHYMKIPPRSMFVVQLVGTFIAATINMASA  544

Query  1749  WWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             W++L  I  IC  D L   SPWTC  D VF+DASVIWGLVGPKR F   GNY ALNWFFL
Sbjct  545   WYMLTHIPFICQLDSLPKGSPWTCRGDHVFYDASVIWGLVGPKRFFGPLGNYGALNWFFL  604

Query  1926  GGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVF  2105
             GG + P++VWLLH+ FP Q WI LIN+PVLLGAT +MPPA++LN++SW +VG +FNF +F
Sbjct  605   GGAIAPILVWLLHKSFPKQRWIKLINIPVLLGATAAMPPASTLNFNSWFVVGFLFNFIIF  664

Query  2106  RYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLED-RTISWWGTTDLEHCDLASCPTA  2282
             RYRKKWWQRYNY+LSA LDAG+AFM V +Y   GL +   I+WWG  D ++CDLA CPTA
Sbjct  665   RYRKKWWQRYNYVLSAALDAGLAFMGVFIYLFFGLTNHENINWWGNVD-DYCDLAKCPTA  723

Query  2283  KGIAVDGCPV  2312
             KGI VDGCP+
Sbjct  724   KGIQVDGCPL  733



>gb|EMS68344.1| Oligopeptide transporter 4 [Triticum urartu]
Length=727

 Score =   940 bits (2430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/731 (65%), Positives = 591/731 (81%), Gaps = 13/731 (2%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
             ++++ SP+E+VRLTV  TDD +LPVWTFRMW +G +SC LLSFLNQFF+YR EP+II+ I
Sbjct  8     DEDDASPVEQVRLTVPVTDDHSLPVWTFRMWTMGFLSCALLSFLNQFFAYRAEPIIISQI  67

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgng  488
             T+QVA LPIGRF++  LP  KFR+  FG  + S+NPGPFN+KEHVLI+IFANAG +FG G
Sbjct  68    TIQVAALPIGRFLSRVLPEKKFRV--FGR-ECSVNPGPFNVKEHVLISIFANAGASFGGG  124

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
             +AYA+GIV II AFY+R ISF    LL+ITTQVLGYGWAGL++KYVVEPAHMWWP++LVQ
Sbjct  125   NAYAIGIVTIIKAFYKRNISFVTSLLLVITTQVLGYGWAGLMRKYVVEPAHMWWPTSLVQ  184

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +SL R +HEKE+         M+R KFF+I+L CSF WY  PGY+F TL ++SWVCWVFP
Sbjct  185   VSLMRAMHEKEKRR-------MTRGKFFLIALICSFAWYTVPGYLFPTLTAVSWVCWVFP  237

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
             KS+T  Q+GSGLNGLG+GA TLDW+T+ S+L SPLV PFFA  NV VGY +++YL++PI+
Sbjct  238   KSITMQQIGSGLNGLGIGAFTLDWATVVSWLGSPLVTPFFATANVLVGYVLLIYLMLPIA  297

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             YW +N+Y+A  +PL+S++LF A GQ YDI +IVN +FE+D D YA+QGRI+LS FF++SY
Sbjct  298   YWVINLYSASSYPLFSNELFDAHGQLYDIHSIVNDKFEIDMDAYARQGRIHLSLFFAVSY  357

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTI  1388
             G GFATIA+T THVA FYG+E+Y R+R S KGKMD+H +LMK Y DIP+WWFY+LL V++
Sbjct  358   GLGFATIAATFTHVACFYGKEMYQRFRESYKGKMDVHARLMKRYDDIPNWWFYILLAVSM  417

Query  1389  AVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIY  1568
             AVSL LC    +EVQ+P+WGL+ A A+AF+FTLPIS+ITATTN TPGLNIITEY  G+I 
Sbjct  418   AVSLVLCTVFKEEVQLPWWGLLIACAIAFVFTLPISVITATTNTTPGLNIITEYCWGLIM  477

Query  1569  PGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVA  1748
             PGKPIANVCFK YGYMSM QA++FL+DFKLGHYMKIPPRSMFLVQF+GT++A T+N  VA
Sbjct  478   PGKPIANVCFKVYGYMSMNQAVSFLTDFKLGHYMKIPPRSMFLVQFVGTVVASTVNTVVA  537

Query  1749  WWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             WWLL ++ +IC + +L   SPWTCP D VFFDASVIWGLVGP+RIF   G Y+ALNWFFL
Sbjct  538   WWLLTTVPHICEKGQLPEGSPWTCPGDHVFFDASVIWGLVGPRRIFGPLGYYSALNWFFL  597

Query  1926  GGILGPVIVWLLHRKFPSQS-WIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFV  2102
              G+ GPV+VWL  +  P  + WI LINLPV+LG T  MPPA++LNY++W  VG +FNFFV
Sbjct  598   IGLAGPVVVWLFAKALPRHAGWISLINLPVILGGTAMMPPASALNYTAWGFVGFVFNFFV  657

Query  2103  FRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTA  2282
             FRYRK WW+RYNY+LSA +D GVA M VLLYF +      + WWG+   E+CDLA+CPTA
Sbjct  658   FRYRKGWWKRYNYVLSAAMDGGVAIMGVLLYFALTSWGHQLDWWGSRG-EYCDLAACPTA  716

Query  2283  KGIAVDGCPVF  2315
             +G+ VDGCPV 
Sbjct  717   RGVLVDGCPVL  727



>ref|XP_006364990.1| PREDICTED: oligopeptide transporter 4-like [Solanum tuberosum]
Length=739

 Score =   940 bits (2429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/733 (66%), Positives = 593/733 (81%), Gaps = 10/733 (1%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
             E  +DE+ SPIE+VRLTV   DDP++PVWTFRMW LG++ C L+SF+N FFSYR+ PLII
Sbjct  12    EIFDDEDESPIEQVRLTVPTDDDPSVPVWTFRMWFLGIIFCGLMSFINIFFSYRQNPLII  71

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
             + IT QVA+LP+G+ +A  LP  KF +PGFG  +FSLNPGPF+MKEHVLI+IFANAG  F
Sbjct  72    SMITAQVASLPLGKLLAKVLPTRKFHLPGFGLSEFSLNPGPFSMKEHVLISIFANAGAGF  131

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
             GNG AYAV IV+II  FY RKISF AGW+L+ITTQVLGYGWAG+++KYVVEPA MWWPST
Sbjct  132   GNGGAYAVTIVDIIKVFYHRKISFLAGWILVITTQVLGYGWAGIMRKYVVEPAEMWWPST  191

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             L Q+S+FR LHEKE   +       SR KFF+I+L CSF WY  PGY+F+TL++ S +C 
Sbjct  192   LAQVSIFRALHEKENSGNY------SRGKFFLIALICSFTWYIVPGYLFKTLSTFSVLCM  245

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
              FPKSV AHQLGSG +GLG+ + T DWS +A FL+SPLV PFFAI+N+  GY II+Y+++
Sbjct  246   AFPKSVLAHQLGSGQHGLGILSFTFDWSVVA-FLTSPLVTPFFAILNILAGYVIIVYMMI  304

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             P++YWGLN+YNAK FPL+S+DLF A GQ+Y++SAIVN +FE+D   Y  QGRI LS  F+
Sbjct  305   PVAYWGLNLYNAKTFPLFSTDLFDANGQKYNVSAIVNNKFEIDTAAYEAQGRINLSIMFA  364

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLV  1379
             +SYG GFATI +T+THV LF G+EIY R+RAS  GK+DIHTKLM+ YKDIPSWWF+ +L 
Sbjct  365   ISYGLGFATIIATLTHVFLFNGKEIYSRFRASYNGKIDIHTKLMRKYKDIPSWWFHTILA  424

Query  1380  VTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMG  1559
             +++A+SL LC  L  +VQ+P+WGLI A A+A +FTLPISII ATTN +PGLNIITEYI+G
Sbjct  425   LSLALSLLLCTVLKSQVQLPWWGLILACAIALIFTLPISIIQATTNNSPGLNIITEYILG  484

Query  1560  IIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINM  1739
             +I PGKPIANVCFKTYGY+SM+QA++FL DFKLGHYMKIPPRSMF+VQ +GTLIA TINM
Sbjct  485   LIIPGKPIANVCFKTYGYISMSQAVSFLQDFKLGHYMKIPPRSMFVVQLVGTLIASTINM  544

Query  1740  SVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNW  1916
             + AW++L  +  IC  D L   SPWTC  D VF+DASVIWGLVGPKR F   GNY ALNW
Sbjct  545   ATAWYMLTHVPYICQLDSLPEGSPWTCRGDHVFYDASVIWGLVGPKRFFGPLGNYGALNW  604

Query  1917  FFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNF  2096
             FFLGG + PV+VWLLH+ FP QSWI LIN+PVLLGAT +MPPA  LN++SWI+VG +FNF
Sbjct  605   FFLGGAIAPVLVWLLHKAFPRQSWIKLINIPVLLGATANMPPANVLNFNSWIVVGFVFNF  664

Query  2097  FVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDR-TISWWGTTDLEHCDLASC  2273
             FVFRYRKKWWQRYNY+LSA LDAG+AFM VL+Y   GL +   ++WWG  D E+C+LA C
Sbjct  665   FVFRYRKKWWQRYNYVLSAALDAGLAFMVVLIYLVFGLTNHDNLNWWGNVD-EYCNLADC  723

Query  2274  PTAKGIAVDGCPV  2312
             PTA+GI V+GCP+
Sbjct  724   PTAQGIQVEGCPL  736



>emb|CAH67988.1| OSIGBa0142I02-OSIGBa0101B20.31 [Oryza sativa Indica Group]
 gb|EEC77900.1| hypothetical protein OsI_17219 [Oryza sativa Indica Group]
Length=737

 Score =   937 bits (2422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/733 (64%), Positives = 585/733 (80%), Gaps = 14/733 (2%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
              +++ SP+E+VRLTV  TDDP+LPVWTFRMW +G++SC +LS++NQFFSYR EP++IT I
Sbjct  15    GEDDQSPVEQVRLTVPTTDDPSLPVWTFRMWTIGLLSCAMLSYINQFFSYRSEPIVITQI  74

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgng  488
             TVQVA LPIG F+A  LP  KF +  FG  + SLNPGPFN+KEHVLI+IFANAG AFGNG
Sbjct  75    TVQVAALPIGHFLARVLPKRKFTV--FGR-ECSLNPGPFNVKEHVLISIFANAGAAFGNG  131

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
              AYA+ I+NII AFY R ISF    LL+ITTQVLGYGWAGL++KYVVEPAHMWWP +LVQ
Sbjct  132   GAYAIDIINIIKAFYHRSISFPTSLLLVITTQVLGYGWAGLMRKYVVEPAHMWWPQSLVQ  191

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +SL R LHEKE          M+RAKFF+I+L CS  WY  PGY+F T+ ++SW+CW FP
Sbjct  192   VSLLRALHEKENLR-------MTRAKFFLIALICSAAWYVVPGYLFPTVGAVSWLCWAFP  244

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
             +SVT  Q+GSG++GLG+GA TLDW+T+ SFL SPLV PFFAIVNV+VG+ +++Y+++PI+
Sbjct  245   RSVTMQQIGSGMSGLGVGAFTLDWATVVSFLGSPLVYPFFAIVNVWVGFVLLVYVMLPIA  304

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             YW LN+Y A  FP +S+ LF   G+EY IS IVN +FELD D YA+QG+I+LS FF+ SY
Sbjct  305   YWVLNLYQASTFPFFSASLFDHTGEEYRISEIVNDRFELDTDAYARQGKIHLSLFFATSY  364

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTI  1388
             G GFATIA+T++HV LFYG E+Y R+R + + K D+HT+LM+ Y DIP+WWFY +L + +
Sbjct  365   GLGFATIAATLSHVTLFYGTEMYRRFRQAAREKPDVHTRLMRRYDDIPNWWFYGMLALAM  424

Query  1389  AVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIY  1568
               +L LC    DEVQ+P+W L+ A A+AF FTLPIS+ITATTN TPGLNIITEY+MG+I 
Sbjct  425   VAALLLCTVFKDEVQLPWWALLCAVAVAFFFTLPISVITATTNTTPGLNIITEYVMGLIM  484

Query  1569  PGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVA  1748
             PGKPIANVCFK YGY+SM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGT+NMSVA
Sbjct  485   PGKPIANVCFKVYGYISMNQAVSFLTDFKLGHYMKIPPRSMFLVQFIGTIVAGTVNMSVA  544

Query  1749  WWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             WWLL ++ +IC +  L   SPWTCP  RVFFDASVIWGLVGP+RIF   G Y ALNWFFL
Sbjct  545   WWLLSTVPHICDKKHLPEGSPWTCPGSRVFFDASVIWGLVGPRRIFGPLGYYGALNWFFL  604

Query  1926  GGILGPVIVWLLHRKFPSQS-WIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFV  2102
             GG+ GP +VWLL R  P  + WI LI+LPVLLGAT +MPPA++LNY++W  VG +FN+ V
Sbjct  605   GGLAGPAVVWLLARALPRHAGWIRLIHLPVLLGATANMPPASTLNYTAWCSVGAVFNYLV  664

Query  2103  FRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTD--LEHCDLASCP  2276
             FR RK WWQRYNY+LSA +DAGVA M VL+YF +     T  WWG +D  ++HCDL++CP
Sbjct  665   FRRRKAWWQRYNYVLSAAMDAGVAIMGVLIYFCLSSRGITPDWWGNSDINIDHCDLSTCP  724

Query  2277  TAKGIAVDGCPVF  2315
             TAKG+ V+GCPVF
Sbjct  725   TAKGVIVEGCPVF  737



>emb|CDP19589.1| unnamed protein product [Coffea canephora]
Length=750

 Score =   932 bits (2409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/747 (65%), Positives = 608/747 (81%), Gaps = 16/747 (2%)
 Frame = +3

Query  90    IEAPALKLAG---EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFL  260
             + AP  K  G   E ++ EE SPIE+VRLTV N DDP+LPVWTFRMW LG++SC +LSFL
Sbjct  13    MNAPKTKGHGYEAEGIDPEEESPIEQVRLTVLNHDDPSLPVWTFRMWFLGLLSCGVLSFL  72

Query  261   NQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEH  440
             N FFSYR EPL+IT I+ QVATLP+G FMA  LP  KF+I   GS +FSLNPGPFN+KEH
Sbjct  73    NTFFSYRSEPLVITMISAQVATLPMGHFMAKVLPTKKFQI---GSWEFSLNPGPFNIKEH  129

Query  441   VLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKK  620
              LI+IFAN G AFG G+AYA+ IV+I+ AFY RKISF A W+L++TTQVLGYGWAG+++K
Sbjct  130   ALISIFANTGSAFGGGTAYAISIVDIVKAFYHRKISFLASWILVVTTQVLGYGWAGIMRK  189

Query  621   YVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGY  800
             YV+EPA MWWPS+LVQ+SLFR LHEK++         MSR KFF+I+L CSF WY FPGY
Sbjct  190   YVIEPAEMWWPSSLVQVSLFRALHEKDDSR-------MSRGKFFLIALICSFSWYTFPGY  242

Query  801   IFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVN  980
             +  TL+++S +C +FP+SVT  QLGSG+ GLG+G+ T DW+ IASFLSSPLV PFFA VN
Sbjct  243   LMNTLSNLSLLCLLFPRSVTMQQLGSGIRGLGIGSFTFDWTVIASFLSSPLVSPFFATVN  302

Query  981   VFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEY  1160
             V VGY +++Y+++P+ YWGL++YNAK +PL+SSDLF   GQ+Y++SAIVN +FE+D   Y
Sbjct  303   VLVGYVLVVYVLIPVGYWGLDIYNAKTYPLFSSDLFDIHGQKYNVSAIVNDKFEIDMTAY  362

Query  1161  AKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNY  1340
               QG+++++ FF++SY   FA + +TITHVA F G+EIY+ +RAS+KGK DIHTKLM+ Y
Sbjct  363   ENQGQVHITMFFAVSYALTFAAVVATITHVACFNGKEIYNLFRASSKGKPDIHTKLMRKY  422

Query  1341  KDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQ  1520
             K IP WWF ++L +++A+SL L IF+ D+VQ+P+W L+ +A LA  FTLP SII ATTNQ
Sbjct  423   KGIPGWWFVLMLALSLALSLGLSIFMKDQVQLPWWALLLSAGLALFFTLPTSIIAATTNQ  482

Query  1521  TPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLV  1700
             TPGLN+ITEY+ GI+YPG+P+ANVCFKTYGYMSM+QA++FL+DFKLGHYMKIPPRSMF+V
Sbjct  483   TPGLNVITEYVFGILYPGRPVANVCFKTYGYMSMSQAVSFLNDFKLGHYMKIPPRSMFMV  542

Query  1701  QFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKR  1877
             Q IGT+IAGTIN+ VAW++L SI+NICH + L +NSPWTCP D VF+ ASV+WGLVGP R
Sbjct  543   QLIGTIIAGTINIGVAWYMLTSIKNICHSELLPANSPWTCPGDSVFYSASVLWGLVGPLR  602

Query  1878  IFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLN  2057
             +F  +G Y+ALNW FLGG L P++VWLLH+ FPSQ WI LIN PV+LG+TG+MPPATSLN
Sbjct  603   VFGPQGKYSALNWCFLGGALAPILVWLLHKIFPSQKWIKLINFPVILGSTGNMPPATSLN  662

Query  2058  YSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWG  2237
             ++SWI +GTIFNFFV+R+RK WWQ+YNY+LSAGLDAG+AFM VLLYF +  E   ISWWG
Sbjct  663   FNSWIFIGTIFNFFVYRFRKSWWQKYNYVLSAGLDAGLAFMCVLLYFCLQYEGIGISWWG  722

Query  2238  TTD--LEHCDLASCPTAKGIAVDGCPV  2312
             T     EHC+L SCPTAKGI VDGCPV
Sbjct  723   TKTHMAEHCELPSCPTAKGIEVDGCPV  749



>ref|XP_010320236.1| PREDICTED: oligopeptide transporter 2-like [Solanum lycopersicum]
Length=737

 Score =   932 bits (2408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/720 (66%), Positives = 591/720 (82%), Gaps = 11/720 (2%)
 Frame = +3

Query  156   EVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPI  335
             +VRLTV+N DDP+LPVWTFRMW LG++SC LLSFLN FFSYR EPL+I+ ITVQVATLPI
Sbjct  27    QVRLTVSNDDDPSLPVWTFRMWFLGLLSCALLSFLNTFFSYRAEPLVISMITVQVATLPI  86

Query  336   GRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVN  515
             GR MA  LP  KF I    S +FS NPGPFN+KEHVLI+IFANAG AFGNG AYAVGIV+
Sbjct  87    GRLMAKVLPKRKFTIK---SWEFSFNPGPFNVKEHVLISIFANAGSAFGNGPAYAVGIVD  143

Query  516   IIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHe  695
             II AFY R I+F AGW+L++ TQVLGYGWAG+++KYVV+PA MWWPS+LVQ+SLFR LH+
Sbjct  144   IIKAFYFRNITFLAGWILVVATQVLGYGWAGIMRKYVVDPAEMWWPSSLVQVSLFRALHD  203

Query  696   keeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlg  875
             KE E         SR KFF++ L CSF WY  PG++F TL+++S +C  +PKSV A Q+G
Sbjct  204   KEVEGKT------SRGKFFLVVLACSFIWYTVPGFLFPTLSNLSLLCLAYPKSVIAQQIG  257

Query  876   sglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNA  1055
             SG+ GLG+ + T DW+ IAS+L SPLV PFF IVNV VGY  ++Y+++P SYWGLN+YNA
Sbjct  258   SGMKGLGILSFTFDWAVIASYLGSPLVYPFFVIVNVIVGYIGVVYILIPASYWGLNLYNA  317

Query  1056  KIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIAS  1235
             K FPL+SS+LF A+GQ Y+++AIVN +FE+D+  YA+ GRI+LS FF+++YG  FA + +
Sbjct  318   KNFPLFSSELFDARGQIYNVTAIVNDKFEIDKVSYAQHGRIHLSMFFAVTYGLNFAAVMA  377

Query  1236  TITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIF  1415
             T++ VALF G+EI  R+RAS KGK DIHT+LM  YKDIP+WWFY+ L +++A+SL LCIF
Sbjct  378   TLSQVALFNGKEIVQRFRASYKGKPDIHTRLMMKYKDIPNWWFYLTLALSLALSLVLCIF  437

Query  1416  LNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVC  1595
             + D+VQ+ +WGL+ AA LA ++TLPISIITATTN +PGLN+ITEY++G+I PGKPIANVC
Sbjct  438   MKDQVQLSWWGLLLAACLALIYTLPISIITATTNMSPGLNVITEYVIGMIIPGKPIANVC  497

Query  1596  FKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIEN  1775
             FKT+ YMSM+QA++FL DFKLGHYMK+PPRSMF+VQ +GT++ GTINM VAWWLL+SI++
Sbjct  498   FKTFAYMSMSQAVSFLQDFKLGHYMKVPPRSMFIVQLVGTILGGTINMGVAWWLLNSIDH  557

Query  1776  ICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIV  1952
             IC  + L  NSPWTC SDRVFFDASVIWGLVGP+RIF   G Y ALNW F+GG++ P +V
Sbjct  558   ICQPNLLPPNSPWTCQSDRVFFDASVIWGLVGPRRIFLGLGEYGALNWCFIGGLVAPFLV  617

Query  1953  WLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQR  2132
             WLLH+ FP QSWI LIN+PVLL AT SMPPAT+LN++SWI+VGT+FNFFVFRYRK+WWQR
Sbjct  618   WLLHKSFPRQSWIKLINIPVLLAATASMPPATTLNFNSWIVVGTVFNFFVFRYRKQWWQR  677

Query  2133  YNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             YNY+LSA LDAGVA M V+L+F V + +   SWWGT   E+CDLA+CPT KGI VDGCP+
Sbjct  678   YNYVLSAALDAGVAVMGVVLFFCVTVWNVNFSWWGTGG-EYCDLATCPTGKGIFVDGCPL  736



>ref|XP_002960906.1| hypothetical protein SELMODRAFT_229868 [Selaginella moellendorffii]
 gb|EFJ38445.1| hypothetical protein SELMODRAFT_229868 [Selaginella moellendorffii]
Length=739

 Score =   929 bits (2402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/730 (63%), Positives = 583/730 (80%), Gaps = 9/730 (1%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
             + EE SPIE+V LTV   DDP+ PVWTFRMW +G+++C +LSFLNQFFSYR EPL+IT  
Sbjct  17    SKEEQSPIEQVALTVDVEDDPSQPVWTFRMWAIGILACAMLSFLNQFFSYRTEPLVITLT  76

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgng  488
             + Q+  LPIGRFMAA LP   +R+P F   +FSLNPGPFN KEHVLITIFANAG AFGNG
Sbjct  77    SAQIVALPIGRFMAAVLPTRIYRVP-FTGFEFSLNPGPFNKKEHVLITIFANAGSAFGNG  135

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
              AYAV IV+II AFY+RKI F+ G LL+ITTQVLGYGWAGLL+KY+VEPA MWWP  LVQ
Sbjct  136   GAYAVFIVDIIKAFYKRKIHFYTGLLLVITTQVLGYGWAGLLRKYLVEPASMWWPGNLVQ  195

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +SLF+TLH+KE  +       ++R +FF+I L   F +Y  PGY+F  L+SISWVCW FP
Sbjct  196   VSLFKTLHDKESVKG------LTRIQFFLIFLTVGFAYYALPGYLFSVLSSISWVCWAFP  249

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
              SV A QLGSG  GLGLGA+ LDW++ +S+L SPLV PFFAI NV VGY +I Y++MP  
Sbjct  250   NSVLAQQLGSGFQGLGLGAIGLDWASASSYLGSPLVSPFFAIANVAVGYILIAYVMMPTF  309

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             YW  N+YNAK FP++SS LFT++GQ YDI  +VN +FELD  EY +QG I++STFF+++Y
Sbjct  310   YWA-NIYNAKTFPIFSSHLFTSKGQIYDIQKVVNDKFELDMAEYQRQGPIHMSTFFAMTY  368

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTI  1388
             GFGFA +ASTITHV  F+G++I+   R++ K   D+H ++M+ Y  IP+ WF +L++V++
Sbjct  369   GFGFAAVASTITHVLCFHGKDIWRMSRSALKSPPDVHARMMQRYPTIPNLWFVILMLVSL  428

Query  1389  AVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIY  1568
              V++A C+   +++Q+P+WG+I + A+A  FTLP+ +ITATTN TPGLNIITEYI+G + 
Sbjct  429   GVAIATCLGFKEQIQLPWWGVILSCAIAATFTLPVGVITATTNITPGLNIITEYIVGYML  488

Query  1569  PGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVA  1748
             PGKPIANV FKTYGYMSMTQA++FLSDFKLGHYMKIPPRSMF VQ +GT+IA T+NM VA
Sbjct  489   PGKPIANVVFKTYGYMSMTQALSFLSDFKLGHYMKIPPRSMFTVQIVGTIIAATVNMGVA  548

Query  1749  WWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             WWLL+ I+NIC  +KL ++SPWTCPSDRVFFDASVIWGLVGPKRIF S G Y+ L+WFFL
Sbjct  549   WWLLNGIDNICDTEKLPASSPWTCPSDRVFFDASVIWGLVGPKRIFGSLGEYSQLSWFFL  608

Query  1926  GGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVF  2105
              GIL P+ VW+L R  P   ++  +N+PV+LGATG MPPATS+NY++WI +G +FN+FV+
Sbjct  609   IGILAPIPVWILSRALPKVEFLRYVNIPVILGATGYMPPATSVNYTTWITLGVVFNYFVY  668

Query  2106  RYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAK  2285
             +YRK WW+RYNY+LSA LDAG AFMAV+LYF++GLED +++WWGT+D +HC LA CPT  
Sbjct  669   KYRKAWWKRYNYVLSAALDAGSAFMAVVLYFSLGLEDVSLTWWGTSDRDHCPLAKCPTQP  728

Query  2286  GIAVDGCPVF  2315
             GI VDGCPV+
Sbjct  729   GIVVDGCPVY  738



>ref|XP_002967106.1| hypothetical protein SELMODRAFT_87413 [Selaginella moellendorffii]
 gb|EFJ31705.1| hypothetical protein SELMODRAFT_87413 [Selaginella moellendorffii]
Length=739

 Score =   928 bits (2398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/730 (63%), Positives = 583/730 (80%), Gaps = 9/730 (1%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
             + EE SPIE+V LTV   DDP+ PVWTFRMW +G+++C +LSFLNQFFSYR EPL+IT  
Sbjct  17    SKEEQSPIEQVALTVDVEDDPSQPVWTFRMWAIGILACAMLSFLNQFFSYRTEPLVITLT  76

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgng  488
             + Q+  LPIGRFMAA LP   +R+P F   +FSLNPGPFN KEHVLITIFANAG AFGNG
Sbjct  77    SAQIVALPIGRFMAAVLPTRIYRVP-FTGFEFSLNPGPFNKKEHVLITIFANAGSAFGNG  135

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
              AYAV IV+II AFY+RKI F+ G LL+ITTQVLGYGWAGLL+K++VEPA MWWP  LVQ
Sbjct  136   GAYAVFIVDIIKAFYKRKIHFYTGLLLVITTQVLGYGWAGLLRKFLVEPASMWWPGNLVQ  195

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +SLF+TLH+KE  +       ++R +FF+I L   F +Y  PGY+F  L+SISWVCW FP
Sbjct  196   VSLFKTLHDKESVKG------LTRIQFFLIFLTVGFAYYALPGYLFSVLSSISWVCWAFP  249

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
              SV A QLGSG  GLGLGA+ LDW++ +S+L SPLV PFFAI NV VGY +I Y++MP  
Sbjct  250   NSVLAQQLGSGFQGLGLGAIGLDWASASSYLGSPLVSPFFAIANVAVGYILIAYVMMPTF  309

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             YW  N+YNAK FP++SS LFT++GQ YDI  +VN +FELD  EY +QG I++STFF+++Y
Sbjct  310   YWA-NIYNAKTFPIFSSHLFTSKGQIYDIQKVVNDKFELDMAEYQRQGPIHMSTFFAMTY  368

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTI  1388
             GFGFA +ASTITHV  F+G++I+   R++ K   D+H ++M+ Y  IP+ WF +L++V++
Sbjct  369   GFGFAAVASTITHVLCFHGKDIWRMSRSALKSPPDVHARMMQRYPTIPNLWFVILMLVSL  428

Query  1389  AVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIY  1568
              V++A C+   +++Q+P+WG+I + A+A  FTLP+ +ITATTN TPGLNIITEYI+G + 
Sbjct  429   GVAIATCLGFKEQIQLPWWGVILSCAIAATFTLPVGVITATTNITPGLNIITEYIVGYML  488

Query  1569  PGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVA  1748
             PGKPIANV FKTYGYMSMTQA++FLSDFKLGHYMKIPPRSMF VQ +GT+IA T+NM VA
Sbjct  489   PGKPIANVVFKTYGYMSMTQALSFLSDFKLGHYMKIPPRSMFTVQIVGTIIAATVNMGVA  548

Query  1749  WWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             WWLL+ I+NIC  +KL ++SPWTCPSDRVFFDASVIWGLVGPKRIF S G Y+ L+WFFL
Sbjct  549   WWLLNGIDNICDTEKLPASSPWTCPSDRVFFDASVIWGLVGPKRIFGSLGEYSQLSWFFL  608

Query  1926  GGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVF  2105
              GIL P+ VW+L R  P   ++  +N+PV+LGATG MPPATS+NY++WI +G +FN+FV+
Sbjct  609   IGILAPIPVWILSRALPKVEFLRYVNIPVILGATGYMPPATSVNYTTWITLGVVFNYFVY  668

Query  2106  RYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAK  2285
             +YRK WW+RYNY+LSA LDAG AFMAV+LYF++GLED +++WWGT+D +HC LA CPT  
Sbjct  669   KYRKAWWKRYNYVLSAALDAGSAFMAVVLYFSLGLEDVSLTWWGTSDRDHCPLAKCPTQP  728

Query  2286  GIAVDGCPVF  2315
             GI VDGCPV+
Sbjct  729   GIVVDGCPVY  738



>ref|NP_001053729.2| Os04g0594800 [Oryza sativa Japonica Group]
 dbj|BAF15643.2| Os04g0594800, partial [Oryza sativa Japonica Group]
Length=762

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/733 (64%), Positives = 583/733 (80%), Gaps = 14/733 (2%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
              +++ SP+E+VRLTV  TDDP+LPVWTFRMW +G++SC +LS++NQFFSYR EP++IT I
Sbjct  40    GEDDQSPVEQVRLTVPTTDDPSLPVWTFRMWTIGLLSCAMLSYINQFFSYRSEPIVITQI  99

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgng  488
             TVQVA LPIG F+A  LP  KF +  FG  + SLNPGPFN+KEHVLI+IFANAG AFGNG
Sbjct  100   TVQVAALPIGHFLARVLPKRKFTV--FGR-ECSLNPGPFNVKEHVLISIFANAGAAFGNG  156

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
              AYA+ I+NII AFY R ISF    LL+ITTQVLGYGWAGL++KYVVEPAHMWWP +LVQ
Sbjct  157   GAYAIDIINIIKAFYHRSISFPTSLLLVITTQVLGYGWAGLMRKYVVEPAHMWWPQSLVQ  216

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +SL R LHEKE          M+RAKFF+I+L CS  WY  PGY+F T+ ++SW+CW FP
Sbjct  217   VSLLRALHEKENLR-------MTRAKFFLIALICSAAWYVVPGYLFPTVGAVSWLCWAFP  269

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
             +SVT  Q+GSG++GLG+GA TLDW+T+ SFL SPLV PFFAIVNV+VG+ +++Y+++PI+
Sbjct  270   RSVTMQQIGSGMSGLGVGAFTLDWATVVSFLGSPLVYPFFAIVNVWVGFVLLVYVMLPIA  329

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             YW LN+Y A  FP +S+ LF   G+EY IS IVN +FELD D YA+QG+I+LS FF+ SY
Sbjct  330   YWVLNLYQASTFPFFSASLFDHTGEEYRISEIVNDRFELDTDAYARQGKIHLSLFFATSY  389

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTI  1388
             G GFATIA+T++HV LFYG E+Y R+R + +   D+HT+LM+ Y DIP+WWFY +L + +
Sbjct  390   GLGFATIAATLSHVTLFYGTEMYRRFRQAARENPDVHTRLMRRYDDIPNWWFYGMLALAM  449

Query  1389  AVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIY  1568
               +L LC    DEVQ+P+W L+ A A+A  FTLPIS+ITATTN TPGLNIITEY+MG+I 
Sbjct  450   VAALLLCTVFKDEVQLPWWALLCAVAVAAFFTLPISVITATTNTTPGLNIITEYVMGLIM  509

Query  1569  PGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVA  1748
             PGKPIANVCFK YGY+SM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGT+NMSVA
Sbjct  510   PGKPIANVCFKVYGYISMNQAVSFLTDFKLGHYMKIPPRSMFLVQFIGTIVAGTVNMSVA  569

Query  1749  WWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             WWLL ++ +IC +  L   SPWTCP  RVFFDASVIWGLVGP+RIF   G Y ALNWFFL
Sbjct  570   WWLLSTVPHICDKKHLPEGSPWTCPGSRVFFDASVIWGLVGPRRIFGPLGYYGALNWFFL  629

Query  1926  GGILGPVIVWLLHRKFPSQS-WIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFV  2102
             GG+ GP +VWLL R  P  + WI LI+LPVLLGAT +MPPA++LNY++W  VG +FN+ V
Sbjct  630   GGLAGPAVVWLLARALPRHAGWIRLIHLPVLLGATANMPPASTLNYTAWCSVGAVFNYLV  689

Query  2103  FRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTD--LEHCDLASCP  2276
             FR RK WWQRYNY+LSA +DAGVA M VL+YF +     T  WWG +D  ++HCDL++CP
Sbjct  690   FRRRKAWWQRYNYVLSAAMDAGVAIMGVLIYFCLSSRGITPDWWGNSDINIDHCDLSTCP  749

Query  2277  TAKGIAVDGCPVF  2315
             TAKG+ V+GCPVF
Sbjct  750   TAKGVIVEGCPVF  762



>emb|CAE04152.1| OSJNBa0009P12.37 [Oryza sativa Japonica Group]
 emb|CAD41562.3| OSJNBa0006A01.17 [Oryza sativa Japonica Group]
 dbj|BAG92149.1| unnamed protein product [Oryza sativa Japonica Group]
Length=737

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/733 (64%), Positives = 583/733 (80%), Gaps = 14/733 (2%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
              +++ SP+E+VRLTV  TDDP+LPVWTFRMW +G++SC +LS++NQFFSYR EP++IT I
Sbjct  15    GEDDQSPVEQVRLTVPTTDDPSLPVWTFRMWTIGLLSCAMLSYINQFFSYRSEPIVITQI  74

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgng  488
             TVQVA LPIG F+A  LP  KF +  FG  + SLNPGPFN+KEHVLI+IFANAG AFGNG
Sbjct  75    TVQVAALPIGHFLARVLPKRKFTV--FGR-ECSLNPGPFNVKEHVLISIFANAGAAFGNG  131

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
              AYA+ I+NII AFY R ISF    LL+ITTQVLGYGWAGL++KYVVEPAHMWWP +LVQ
Sbjct  132   GAYAIDIINIIKAFYHRSISFPTSLLLVITTQVLGYGWAGLMRKYVVEPAHMWWPQSLVQ  191

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +SL R LHEKE          M+RAKFF+I+L CS  WY  PGY+F T+ ++SW+CW FP
Sbjct  192   VSLLRALHEKENLR-------MTRAKFFLIALICSAAWYVVPGYLFPTVGAVSWLCWAFP  244

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
             +SVT  Q+GSG++GLG+GA TLDW+T+ SFL SPLV PFFAIVNV+VG+ +++Y+++PI+
Sbjct  245   RSVTMQQIGSGMSGLGVGAFTLDWATVVSFLGSPLVYPFFAIVNVWVGFVLLVYVMLPIA  304

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             YW LN+Y A  FP +S+ LF   G+EY IS IVN +FELD D YA+QG+I+LS FF+ SY
Sbjct  305   YWVLNLYQASTFPFFSASLFDHTGEEYRISEIVNDRFELDTDAYARQGKIHLSLFFATSY  364

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTI  1388
             G GFATIA+T++HV LFYG E+Y R+R + +   D+HT+LM+ Y DIP+WWFY +L + +
Sbjct  365   GLGFATIAATLSHVTLFYGTEMYRRFRQAARENPDVHTRLMRRYDDIPNWWFYGMLALAM  424

Query  1389  AVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIY  1568
               +L LC    DEVQ+P+W L+ A A+A  FTLPIS+ITATTN TPGLNIITEY+MG+I 
Sbjct  425   VAALLLCTVFKDEVQLPWWALLCAVAVAAFFTLPISVITATTNTTPGLNIITEYVMGLIM  484

Query  1569  PGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVA  1748
             PGKPIANVCFK YGY+SM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGT+NMSVA
Sbjct  485   PGKPIANVCFKVYGYISMNQAVSFLTDFKLGHYMKIPPRSMFLVQFIGTIVAGTVNMSVA  544

Query  1749  WWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             WWLL ++ +IC +  L   SPWTCP  RVFFDASVIWGLVGP+RIF   G Y ALNWFFL
Sbjct  545   WWLLSTVPHICDKKHLPEGSPWTCPGSRVFFDASVIWGLVGPRRIFGPLGYYGALNWFFL  604

Query  1926  GGILGPVIVWLLHRKFPSQS-WIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFV  2102
             GG+ GP +VWLL R  P  + WI LI+LPVLLGAT +MPPA++LNY++W  VG +FN+ V
Sbjct  605   GGLAGPAVVWLLARALPRHAGWIRLIHLPVLLGATANMPPASTLNYTAWCSVGAVFNYLV  664

Query  2103  FRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTD--LEHCDLASCP  2276
             FR RK WWQRYNY+LSA +DAGVA M VL+YF +     T  WWG +D  ++HCDL++CP
Sbjct  665   FRRRKAWWQRYNYVLSAAMDAGVAIMGVLIYFCLSSRGITPDWWGNSDINIDHCDLSTCP  724

Query  2277  TAKGIAVDGCPVF  2315
             TAKG+ V+GCPVF
Sbjct  725   TAKGVIVEGCPVF  737



>gb|KHN33579.1| Oligopeptide transporter 4 [Glycine soja]
Length=666

 Score =   923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/699 (70%), Positives = 566/699 (81%), Gaps = 36/699 (5%)
 Frame = +3

Query  216   MWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGS  395
             MW LG++SC L+SFLNQFF+Y  E +IIT ITVQVATLPIG FMAA LP   F IPGFGS
Sbjct  1     MWFLGLLSCSLVSFLNQFFAYHTEGIIITQITVQVATLPIGHFMAALLPKTTFSIPGFGS  60

Query  396   GQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLII  575
               FS NPGPFNMKEHVLITIFANAG AFG+GS YAVGIVNII AFY R +SF A WLLI+
Sbjct  61    KSFSFNPGPFNMKEHVLITIFANAGSAFGDGSPYAVGIVNIIKAFYGRSVSFVASWLLIV  120

Query  576   TTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFV  755
             TTQ                           ++ + R LHEK++         +SR KFF 
Sbjct  121   TTQA--------------------------KLLVCRALHEKDDHR-------ISRTKFFF  147

Query  756   ISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIAS  935
              +   S  WY  PGY+F TL +ISWVCW+F KSVTA Q+GSG+ GLG+GALTLDW+ +A 
Sbjct  148   FAQLFSMSWYVVPGYLFTTLTNISWVCWIFSKSVTAQQIGSGMRGLGVGALTLDWAAVA-  206

Query  936   FLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDI  1115
             +L SPL  PFF IVNVFVGYA+ +Y+V+P++YWGLNVYNA  FP++SS  FTAQGQ+Y+I
Sbjct  207   YLFSPLNSPFFVIVNVFVGYALTVYVVIPVAYWGLNVYNANRFPIFSSHFFTAQGQKYNI  266

Query  1116  SAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRAS  1295
               IV+  FEL+  EY KQGRI+LS FF+L+YGFGFATIAST+THV  FYGREI +RYRAS
Sbjct  267   PKIVDNHFELNVAEYEKQGRIHLSVFFALTYGFGFATIASTLTHVVCFYGREIMERYRAS  326

Query  1296  TKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAF  1475
             +KGK DIHTKLM+ YKDIPSWWF+ LL+VT+ VSLALCIFL D+VQMP+WGL+FA  LAF
Sbjct  327   SKGKEDIHTKLMRRYKDIPSWWFHSLLLVTLLVSLALCIFLKDQVQMPWWGLLFAGVLAF  386

Query  1476  MFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFK  1655
              FTLPISIITATTNQTPGLNIITEY+ G+IYPG+PIANVCFKTYG+ SM QA++FLSDFK
Sbjct  387   GFTLPISIITATTNQTPGLNIITEYVFGLIYPGRPIANVCFKTYGHNSMAQAVSFLSDFK  446

Query  1656  LGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRV  1832
             LGHYMKIPPRSMFLVQFIGT++AGTIN+ VAWWLL+SI+NICH D L   SPWTCP+D V
Sbjct  447   LGHYMKIPPRSMFLVQFIGTILAGTINIGVAWWLLNSIKNICHDDLLPEGSPWTCPNDLV  506

Query  1833  FFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPV  2012
             FFDASVIWGLVGPKRIF S+GNY A+NWFFLGG +GP+IVWLLH+ FP QSWIPLINLPV
Sbjct  507   FFDASVIWGLVGPKRIFGSQGNYGAMNWFFLGGAVGPIIVWLLHKAFPKQSWIPLINLPV  566

Query  2013  LLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLL  2192
             LLGATG MPPA  LNY++WI VGTIFNFF+FRYRKKWWQRYNY+LSA LD+GV FM V+L
Sbjct  567   LLGATGIMPPARPLNYNAWIFVGTIFNFFIFRYRKKWWQRYNYVLSAALDSGVVFMTVML  626

Query  2193  YFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCP  2309
             YF++GLE+++++WWG  D EHC LA+CPTAKGI VDGCP
Sbjct  627   YFSLGLENKSLNWWG-NDGEHCPLAACPTAKGIIVDGCP  664



>gb|EAZ26400.1| hypothetical protein OsJ_10283 [Oryza sativa Japonica Group]
Length=737

 Score =   923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/733 (64%), Positives = 583/733 (80%), Gaps = 14/733 (2%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
              +++ SP+E+VRLTV  TDDP+LPVWTFRMW +G++SC +LS++NQFFSYR EP++IT I
Sbjct  15    GEDDQSPVEQVRLTVPTTDDPSLPVWTFRMWTIGLLSCAMLSYINQFFSYRSEPIVITQI  74

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgng  488
             TVQVA LPIG F+A  LP  KF +  FG  + SLNPGPFN+KEHVLI+IFANAG AFGNG
Sbjct  75    TVQVAALPIGHFLARVLPKRKFTV--FGR-ECSLNPGPFNVKEHVLISIFANAGAAFGNG  131

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
              AYA+ I+NII AFY R ISF    LL+ITTQVLGYGWAGL++KYVVEPAHMWWP +LVQ
Sbjct  132   GAYAIDIINIIKAFYHRSISFPTSLLLVITTQVLGYGWAGLMRKYVVEPAHMWWPQSLVQ  191

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +SL R LHEKE          M+RAKFF+I+L CS  WY  PGY+F T+ ++SW+CW FP
Sbjct  192   VSLLRALHEKENLR-------MTRAKFFLIALICSAAWYVVPGYLFPTVGAVSWLCWAFP  244

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
             +SVT  Q+GSG++GLG+GA TLDW+T+ SFL SPLV PFFAIVNV+VG+ +++Y+++PI+
Sbjct  245   RSVTMQQIGSGMSGLGVGAFTLDWATVVSFLGSPLVYPFFAIVNVWVGFVLLVYVMLPIA  304

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             YW LN+Y A  FP +S+ LF   G+EY IS IVN +FELD D YA+QG+I+LS FF+ SY
Sbjct  305   YWVLNLYQASTFPFFSASLFDHTGEEYRISEIVNDRFELDTDAYARQGKIHLSLFFATSY  364

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTI  1388
             G GFATIA+T++HV LFYG E+Y R+R + +   D+HT+LM+ Y DIP+WWFY +L + +
Sbjct  365   GLGFATIAATLSHVTLFYGTEMYRRFRQAARENPDVHTRLMRRYDDIPNWWFYGMLALAM  424

Query  1389  AVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIY  1568
               +L LC    DEVQ+P+W L+ A A+A  FTLPIS+ITATTN TPGLNIITEY+MG+I 
Sbjct  425   VAALLLCTVFKDEVQLPWWALLCAVAVAAFFTLPISVITATTNTTPGLNIITEYVMGLIM  484

Query  1569  PGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVA  1748
             PGKPIANVCFK YGY+SM QA++FL+DFKLGHYMKIPPRSMFLVQFIGT++AGT+NMSVA
Sbjct  485   PGKPIANVCFKVYGYISMNQAVSFLTDFKLGHYMKIPPRSMFLVQFIGTIVAGTVNMSVA  544

Query  1749  WWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             WWLL ++ +IC +  L   +PWTCP  RVFFDASVIWGLVGP+RIF   G Y ALNWFFL
Sbjct  545   WWLLSTVPHICDKKHLPEGNPWTCPGSRVFFDASVIWGLVGPRRIFGPLGYYGALNWFFL  604

Query  1926  GGILGPVIVWLLHRKFPSQS-WIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFV  2102
             GG+ GP +VWLL R  P  + WI LI+LPVLLGAT +MPPA++LNY++W  VG +FN+ V
Sbjct  605   GGLAGPAVVWLLARALPRHAGWIRLIHLPVLLGATANMPPASTLNYTAWCSVGAVFNYLV  664

Query  2103  FRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTD--LEHCDLASCP  2276
             FR RK WWQRYNY+LSA +DAGVA M VL+YF +     T  WWG +D  ++HCDL++CP
Sbjct  665   FRRRKAWWQRYNYVLSAAMDAGVAIMGVLIYFCLSSRGITPDWWGNSDINIDHCDLSTCP  724

Query  2277  TAKGIAVDGCPVF  2315
             TAKG+ V+GCPVF
Sbjct  725   TAKGVIVEGCPVF  737



>ref|XP_004252726.1| PREDICTED: oligopeptide transporter 2-like [Solanum lycopersicum]
Length=731

 Score =   923 bits (2385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/727 (66%), Positives = 584/727 (80%), Gaps = 21/727 (3%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIE+VRLTV+N DD +LPVWTFRMW LG++SC +L+FLN FFSYR +PL I+ ITVQ+A
Sbjct  21    SPIEQVRLTVSNQDDTSLPVWTFRMWFLGLLSCSILAFLNTFFSYRTQPLSISMITVQIA  80

Query  324   TLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
              LP+G+ MA  LP  KF+I   GS +FSLNPGPFNMKEHVLI+IFAN G      +AYAV
Sbjct  81    ALPVGKLMAKVLPTRKFKI---GSWEFSLNPGPFNMKEHVLISIFANCGAG----TAYAV  133

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFR  683
              IV II AFY R ISF AGW+L++TTQVLGYGWAG+++KYVV+PA MWWP  +V +SLFR
Sbjct  134   SIVTIIKAFYLRNISFVAGWVLVVTTQVLGYGWAGIMRKYVVDPAEMWWPGCMVIVSLFR  193

Query  684   TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTA  863
              LHEK+ +         SR KFF++ L CSF WY  PG++F TL++IS +C  +PKSV A
Sbjct  194   ALHEKDADGKS------SRGKFFLVVLACSFIWYIVPGFLFPTLSNISLLCLFYPKSVIA  247

Query  864   HQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLN  1043
             HQLGSG+ GLG+ + T DWS +AS+L SPLVCP FAIVNV VGY  ++Y+++PISYWG +
Sbjct  248   HQLGSGMKGLGILSFTFDWSVVASYLGSPLVCPLFAIVNVVVGYVFVVYIMIPISYWGYD  307

Query  1044  VYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFA  1223
             +YNAK FP+ SS LF AQGQ+YDI  IVN +FELD+  Y KQGRI +STFF+LSYG  FA
Sbjct  308   IYNAKTFPILSSHLFNAQGQKYDIHRIVNDKFELDQVAYGKQGRINISTFFALSYGLNFA  367

Query  1224  TIASTITHVALFYGREIYDRYRASTK-GKMD-IHTKLMKNYKDIPSWWFYVLLVVTIAVS  1397
              + +T+T V LF G+EI  R+RAS K GK D IHTKLMK Y DIP WWF+ +LVV++ +S
Sbjct  368   AVVATLTQVGLFNGKEIISRFRASNKSGKSDDIHTKLMKKYPDIPGWWFHGMLVVSLVLS  427

Query  1398  LALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGK  1577
             L LCI   D+VQ+P+WGL+ AAA+A +FTLPISIITATTN TPGLN++TEYI+G+I PG+
Sbjct  428   LILCIVWVDQVQLPWWGLLLAAAIALIFTLPISIITATTNMTPGLNVMTEYIIGLIIPGR  487

Query  1578  PIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWL  1757
             PIANVCFKT+GY+SM QA++FL+DFKLGHYMKIPPRSMF+VQ +GTLIAGTINM+VAWWL
Sbjct  488   PIANVCFKTFGYISMAQAVSFLADFKLGHYMKIPPRSMFIVQLLGTLIAGTINMTVAWWL  547

Query  1758  LHSIENICHQDKL--SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGG  1931
             L +I+NIC QD L   NSPWTCP  RVFFDASVIWGLVGPKR+F   GNY ALNWFFLGG
Sbjct  548   LTNIDNIC-QDALLPVNSPWTCPGSRVFFDASVIWGLVGPKRMFGDLGNYGALNWFFLGG  606

Query  1932  ILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRY  2111
             +  P+IVWLLH+ FP QSWI LIN+PVLLGAT SMPPAT LN++SWI+   IFN+F+F+Y
Sbjct  607   LCAPIIVWLLHKAFPKQSWIKLINIPVLLGATASMPPATPLNFNSWIVFAIIFNYFIFKY  666

Query  2112  RKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGI  2291
             +KKWWQ+YNY+LSA LDAG+AFM V +YF   L+   ++WWGT   E+C LASCPTAKGI
Sbjct  667   QKKWWQKYNYVLSAALDAGLAFMGVFIYFF--LDKVKLNWWGTGG-EYCGLASCPTAKGI  723

Query  2292  AVDGCPV  2312
             AV GCP+
Sbjct  724   AVHGCPL  730



>emb|CDP19591.1| unnamed protein product [Coffea canephora]
Length=591

 Score =   907 bits (2345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/590 (77%), Positives = 522/590 (88%), Gaps = 6/590 (1%)
 Frame = +3

Query  564   LLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeee------edgggr  725
             +L +  QVLGYGWAGLL+KYVVEPAHMWWPS LVQISLFR LH +E+       E  G +
Sbjct  1     MLTLGGQVLGYGWAGLLRKYVVEPAHMWWPSNLVQISLFRVLHFEEDADGNENGERNGNK  60

Query  726   rrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglga  905
             R+ SR KFFV++L CSF WY  PG++FQ L+SISWVCW +P SVTA QLGSGLNGLGLGA
Sbjct  61    RQTSRTKFFVVALVCSFIWYLVPGFLFQALSSISWVCWAYPNSVTAQQLGSGLNGLGLGA  120

Query  906   ltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDL  1085
              TLDWST+ASFL SPL+ PFFAI NVFVGY +++Y+V+PISYWGLNVYNAK FP++SSDL
Sbjct  121   FTLDWSTVASFLFSPLISPFFAIANVFVGYVLVVYVVIPISYWGLNVYNAKNFPIFSSDL  180

Query  1086  FTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYG  1265
             FTAQGQEY+I AIVN++FELD+ +Y +QGRI LSTFF+L+YGFGFATIAST+THVALFYG
Sbjct  181   FTAQGQEYNILAIVNQKFELDKVQYEQQGRINLSTFFALAYGFGFATIASTLTHVALFYG  240

Query  1266  REIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYW  1445
             REIYDRYRAS+  + DIHT+LM+ YKDIP+ WF VLL  T+ VSLALCIFL  EVQMPYW
Sbjct  241   REIYDRYRASSNARPDIHTRLMRKYKDIPNMWFIVLLSATLIVSLALCIFLKKEVQMPYW  300

Query  1446  GLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMT  1625
             GL+ AAA++F+FTLPISIITATTNQTPGLNIITEY+MG++YPGKP A V FKTYGYMSMT
Sbjct  301   GLLLAAAVSFLFTLPISIITATTNQTPGLNIITEYLMGVMYPGKPTATVAFKTYGYMSMT  360

Query  1626  QAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNS  1805
             QAI+FLSDFKLGHYMKIPPRSMFLVQF+GT+IAGT+N+ VAWWLLH++E+ICH D  SNS
Sbjct  361   QAISFLSDFKLGHYMKIPPRSMFLVQFLGTIIAGTVNLGVAWWLLHTVEDICHPDMASNS  420

Query  1806  PWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQS  1985
             PWTCP DRVFFDASVIWGLVGPKRIF   GNY+ALNWFFLGG+LGP+ +WLLH++FP QS
Sbjct  421   PWTCPGDRVFFDASVIWGLVGPKRIFGPHGNYSALNWFFLGGLLGPLAIWLLHKQFPKQS  480

Query  1986  WIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDA  2165
             WIPLINLPV+LGAT SMPPAT+LNY+SWI+VGTIFNFFVFRYRKKWWQRYNYILSA LDA
Sbjct  481   WIPLINLPVILGATASMPPATALNYNSWIVVGTIFNFFVFRYRKKWWQRYNYILSAALDA  540

Query  2166  GVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             GVAFMA LLYFTVG+E+R+ISWWG  + EHCDLA+CPTAKGI+VDGCP F
Sbjct  541   GVAFMAFLLYFTVGMENRSISWWGNNNPEHCDLATCPTAKGISVDGCPTF  590



>ref|XP_010267482.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=766

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/746 (59%), Positives = 576/746 (77%), Gaps = 16/746 (2%)
 Frame = +3

Query  87    EIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQ  266
             ++ A + + +  D ++ E+SPI++V LTV  TDD TLPV TFRMWVLG VSC+LLSFLNQ
Sbjct  33    QVLASSSQSSAHDFSESEISPIKQVALTVPTTDDHTLPVLTFRMWVLGTVSCILLSFLNQ  92

Query  267   FFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHV  443
             FF YR EPL IT+I+ Q+A +P+GR MA+ +     R+   GS  +F+LNPGPFN+KEHV
Sbjct  93    FFWYRTEPLTITAISAQIAVVPLGRLMASMITN---RVFFKGSRWEFTLNPGPFNVKEHV  149

Query  444   LITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKY  623
             LITIFAN+G      + YA+ IV  +  FY++ I+FF   +++ITTQVLG+GWAG+ ++Y
Sbjct  150   LITIFANSGAG----TVYAIHIVTAVKIFYKKNITFFVSLIVVITTQVLGFGWAGIFRRY  205

Query  624   VVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYI  803
             +VEPA MWWP+ LVQ+SLFR LHEKEE   GG    ++R +FF+I+  CSF +Y FPGY+
Sbjct  206   LVEPAAMWWPANLVQVSLFRALHEKEERGKGG----LTRTQFFLIAFICSFAYYIFPGYL  261

Query  804   FQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNV  983
             F  L S+SWVCW+FPKS+ A QLGSGL GLGLGA+ +DWSTI+S+L SPL  P+FA  NV
Sbjct  262   FPMLTSLSWVCWIFPKSILAQQLGSGLYGLGLGAIGVDWSTISSYLGSPLASPWFATANV  321

Query  984   FVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYA  1163
               G+ I+MY++ PI YW LNVY AK FP++S DLFT+ GQ Y+IS+I++  F LD   Y 
Sbjct  322   GAGFFIVMYILTPIMYW-LNVYKAKTFPIFSEDLFTSSGQTYNISSIIDSNFHLDIQAYD  380

Query  1164  KQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTK-GKMDIHTKLMKNY  1340
             K G +YLSTFF+++YG GFA + +TI HV LF+G EI+++ +++ K  KMDIHT+LM+ Y
Sbjct  381   KNGPLYLSTFFAMTYGVGFAALTATIVHVLLFHGSEIWEQSKSAFKEKKMDIHTRLMRRY  440

Query  1341  KDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQ  1520
               +P WWF  +LV  IA ++  C + ND++Q+P+WG++ A  LA +FTLPI IITATTNQ
Sbjct  441   NQVPEWWFVCILVANIAATIFACEYYNDQLQLPWWGVLLACGLAILFTLPIGIITATTNQ  500

Query  1521  TPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLV  1700
             TPGLNIITEYI+G +YPG+P+AN+CFK YGY+SMTQA+ FL DFKLGHYMKIPPR+MF+ 
Sbjct  501   TPGLNIITEYIIGYLYPGRPVANICFKVYGYISMTQAVTFLQDFKLGHYMKIPPRTMFMA  560

Query  1701  QFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKR  1877
             Q +GTLIAG + +   WWL+ +I NIC    L S+SPWTCPSDRVF+DASVIWGL+GP+R
Sbjct  561   QVVGTLIAGLVYLGTGWWLMETIPNICDTSVLPSDSPWTCPSDRVFYDASVIWGLIGPRR  620

Query  1878  IFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLN  2057
             IF   G Y A+NWFFL G + PV+VW  H+ FP Q+WI LIN+P+L+GATG MPPAT++N
Sbjct  621   IFGDLGTYEAINWFFLAGAVAPVLVWFAHKAFPEQNWIRLINMPILIGATGMMPPATAVN  680

Query  2058  YSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWG  2237
             Y+SW++VG +  F ++RYR+ WWQR+NY+LS  LDAG+AFMAVLLY  +GLE  T+SWWG
Sbjct  681   YTSWVIVGFLSGFLLYRYRQDWWQRHNYVLSGALDAGLAFMAVLLYLCLGLEGITLSWWG  740

Query  2238  TTDLEHCDLASCPTAKGIAVDGCPVF  2315
              +DL+ C LASCPTAKG+ V+GCPVF
Sbjct  741   -SDLDGCPLASCPTAKGVVVEGCPVF  765



>gb|KEH36459.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=552

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/558 (78%), Positives = 495/558 (89%), Gaps = 8/558 (1%)
 Frame = +3

Query  642   MWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLAS  821
             MWWPSTLVQ+SLFR LHEK+++        +SRAKFF I+L CSF WY  PGY+F TL S
Sbjct  1     MWWPSTLVQVSLFRALHEKDDDHR------ISRAKFFFIALVCSFSWYVIPGYLFTTLTS  54

Query  822   ISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAI  1001
             ISWVCWVF KSVTA QLGSG+ GLG+GA+TLDW+ +ASFL SPL+ PFFAIVNVFVGY +
Sbjct  55    ISWVCWVFTKSVTAQQLGSGMKGLGIGAITLDWTAVASFLFSPLISPFFAIVNVFVGYVL  114

Query  1002  IMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIY  1181
             I+Y V+PI+YWGLN YNAK FPL+SS LFTAQGQ+Y+ISAIVN +FELDE +YA+QGRI+
Sbjct  115   IIYAVVPIAYWGLNAYNAKTFPLFSSHLFTAQGQKYNISAIVNDKFELDEAKYAEQGRIH  174

Query  1182  LSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKMDIHTKLMKNYKDIPSWW  1361
             LS FFSL+YGFGFATIAST+THVA FYGREI +RYRAS+KGK DIHTKLMK YKDIPSWW
Sbjct  175   LSVFFSLTYGFGFATIASTLTHVACFYGREIMERYRASSKGKEDIHTKLMKRYKDIPSWW  234

Query  1362  FYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNII  1541
             FY LLVVT+AVSL LCIFLND++QMP+WGL+FA ALAF FTLPISIITATTNQTPGLNII
Sbjct  235   FYALLVVTLAVSLVLCIFLNDQIQMPWWGLLFAGALAFAFTLPISIITATTNQTPGLNII  294

Query  1542  TEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLI  1721
             TEY+ G+IYPG+PIANVCFKTYGY+SM QA++FLSDFKLGHYMKIPPRSMFLVQFIGT++
Sbjct  295   TEYVFGLIYPGRPIANVCFKTYGYISMAQAVSFLSDFKLGHYMKIPPRSMFLVQFIGTML  354

Query  1722  AGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGN  1898
             AGTIN+ VAWWLL+S+ENICH D L   SPWTCP DRVFFDASVIWGLVGPKRIF S+GN
Sbjct  355   AGTINIGVAWWLLNSVENICHDDLLPEGSPWTCPGDRVFFDASVIWGLVGPKRIFGSKGN  414

Query  1899  YNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILV  2078
             Y+A+NWFF+GG +GP+IVWLLH+ FP QSWI LINLPVLLGAT  MPPAT LNY+SWI V
Sbjct  415   YSAMNWFFIGGAIGPIIVWLLHKAFPRQSWIALINLPVLLGATAMMPPATPLNYNSWIFV  474

Query  2079  GTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHC  2258
             GTIFNFFVFRYRKKWWQRYNY+LSA LD GVAFM VLLYF++ LE+R+ISWWG T+ EHC
Sbjct  475   GTIFNFFVFRYRKKWWQRYNYVLSAALDTGVAFMTVLLYFSLSLENRSISWWG-TEGEHC  533

Query  2259  DLASCPTAKGIAVDGCPV  2312
              LASCPTAKGIAVDGCPV
Sbjct  534   PLASCPTAKGIAVDGCPV  551



>gb|EYU18387.1| hypothetical protein MIMGU_mgv1a0036351mg, partial [Erythranthe 
guttata]
Length=569

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/577 (75%), Positives = 501/577 (87%), Gaps = 9/577 (2%)
 Frame = +3

Query  588   LGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLC  767
             LGYGW  LL+KYVVEPAHMWWP TLVQ+SLFR LHEK+E+        MSRAKFF+I+L 
Sbjct  1     LGYGWPALLRKYVVEPAHMWWPGTLVQVSLFRALHEKDEQR-------MSRAKFFLIALI  53

Query  768   CSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSS  947
             CSF WY  PGYIF TL SISWVCW F KSVTA Q+GSGL GLG GALTLDW+ +ASFL S
Sbjct  54    CSFSWYLVPGYIFPTLTSISWVCWTFSKSVTAQQIGSGLRGLGFGALTLDWTAVASFLLS  113

Query  948   PLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIV  1127
             PL+CPFFAI+N+F GY +I+YLV+PI+YWG ++Y A  FP++SS LFTAQG +Y+ISAIV
Sbjct  114   PLICPFFAIMNIFAGYVLIIYLVLPIAYWGFDLYGASKFPIFSSHLFTAQGHKYNISAIV  173

Query  1128  NKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGK  1307
             N +FELD   Y +QGRI+LS FF+L+YGFGFATIA+T+THV  FYGREIY R+RAS K K
Sbjct  174   NDKFELDLQSYEEQGRIHLSMFFALTYGFGFATIAATLTHVGCFYGREIYARFRASYKEK  233

Query  1308  MDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTL  1487
              D+HT+LM+ Y+DIPSWWFY+LL VT+A SL LCIFLND+VQMP+WGLIFA+ ++F FTL
Sbjct  234   DDVHTRLMRRYEDIPSWWFYILLAVTLAASLILCIFLNDQVQMPWWGLIFASVISFTFTL  293

Query  1488  PISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHY  1667
             PISIITATTNQTPGLNIITEY+MGIIYPG+PIANVCFKTYGYMSM QA++FLSDFKLGHY
Sbjct  294   PISIITATTNQTPGLNIITEYVMGIIYPGRPIANVCFKTYGYMSMAQAVSFLSDFKLGHY  353

Query  1668  MKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDA  1844
             MKIPPRSMF+VQF+GT+IAGT+N++VAWWLL SI NIC  D L  +SPWTCP DRVFFDA
Sbjct  354   MKIPPRSMFIVQFLGTIIAGTVNIAVAWWLLTSITNICQDDLLPPDSPWTCPGDRVFFDA  413

Query  1845  SVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGA  2024
             SVIWGLVGPKRIF S GNY+++NWFFLGG +GPV+VW LH+ FP QSWIPLINLPVLLGA
Sbjct  414   SVIWGLVGPKRIFGSLGNYSSMNWFFLGGAIGPVLVWFLHKAFPKQSWIPLINLPVLLGA  473

Query  2025  TGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTV  2204
             TG+MPPAT LNY++WI++GTIFNFFVFRYRK WWQRYNYILSA LDAGVAFMAV LYFT+
Sbjct  474   TGAMPPATPLNYNAWIIIGTIFNFFVFRYRKIWWQRYNYILSAALDAGVAFMAVGLYFTL  533

Query  2205  GLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             G+E++ I WWGT+  EHC LA+CPTAKGI VDGCP++
Sbjct  534   GMEEKGIDWWGTSG-EHCKLATCPTAKGIRVDGCPIY  569



>ref|XP_006851884.1| hypothetical protein AMTR_s00041p00121000 [Amborella trichopoda]
 gb|ERN13351.1| hypothetical protein AMTR_s00041p00121000 [Amborella trichopoda]
Length=734

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/734 (60%), Positives = 569/734 (78%), Gaps = 14/734 (2%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
             E     E SPIE+V LTV  TDDP+LPV TFRMW LG +SCV+LSFLNQFF YR EPL I
Sbjct  13    EPNTSPENSPIEQVALTVPVTDDPSLPVLTFRMWFLGGLSCVVLSFLNQFFWYRTEPLSI  72

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
             TS++ Q+A +P+G  MAA LP   F   G    +F+LNPGPFN+KEHVLITIFAN+G   
Sbjct  73    TSVSAQIAVVPLGHLMAAVLPTRPF-FKG-KRWEFTLNPGPFNVKEHVLITIFANSGAG-  129

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
                S YA+ IV+ +  FY+  +SFF  +L++ITTQVLG+GWAG+ +KY+VEPA MWWP  
Sbjct  130   ---SVYAIHIVSAVKIFYKETLSFFVAFLVVITTQVLGFGWAGIFRKYLVEPAAMWWPYN  186

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLF  LHEKEE   G     ++R +FF+I+L CSF +Y  PGY+F  L S+SW+CW
Sbjct  187   LVQVSLFGALHEKEERRKGS----LTRNQFFLIALMCSFAYYVLPGYLFPMLTSLSWICW  242

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
             +FPKSV A QLGSGL GLGLGA+ LDWSTI+S+L SPL  P+FA  NV  G+ I+MY++ 
Sbjct  243   IFPKSVLAQQLGSGLYGLGLGAIGLDWSTISSYLGSPLASPWFATANVAAGFFIVMYVIT  302

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             P+SYW L++Y+AK FP++S DLFT  GQEY+I+AI++  F +D + Y K+G++YLSTFF+
Sbjct  303   PLSYW-LDLYHAKRFPIFSEDLFTYSGQEYNITAIIDSNFNIDLEAYEKEGKLYLSTFFA  361

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRAS-TKGKMDIHTKLMKNYKDIPSWWFYVLL  1376
             ++YG GFA++++T+ HVALF+GREI+   +++  + KMDIHT+LM  YK +P WWF  +L
Sbjct  362   MTYGVGFASLSATVVHVALFHGREIWQLSKSAFQEKKMDIHTRLMSKYKQVPEWWFITIL  421

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
             ++ IA ++  C + N ++Q+P+WG++ A  +A  FTLPI IITATTNQ PGLNIITEYI+
Sbjct  422   IINIAATIFACEYYNAQLQLPWWGVLLACGIAISFTLPIGIITATTNQQPGLNIITEYII  481

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             G +YPG+P+AN+CFK YGY+SMTQA+ FL DFKLGHYMKIPPR+MF+ Q +GTLIA  + 
Sbjct  482   GYLYPGRPVANICFKVYGYISMTQAVTFLQDFKLGHYMKIPPRAMFMAQIVGTLIAAMVY  541

Query  1737  MSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALN  1913
             +  AWWL+++I NIC    L S+SPWTCP DRVF+DASVIWGL+GP+RIF   G Y+A+N
Sbjct  542   LGTAWWLMNAIPNICDTSVLSSDSPWTCPMDRVFYDASVIWGLIGPRRIFGDLGTYSAIN  601

Query  1914  WFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFN  2093
             WFFLGG + P++VWL HR FP + WI LIN+PVL+GAT  MPPAT +NY+SWIL+G IF+
Sbjct  602   WFFLGGAIAPLLVWLAHRAFPDKEWIRLINMPVLIGATSMMPPATVVNYTSWILMGFIFS  661

Query  2094  FFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASC  2273
             F V+RY++ WW R+NY+LS  LDAG+AFM VLLY  +GLED +ISWWG +DL+ C LASC
Sbjct  662   FVVYRYKRDWWTRHNYVLSGALDAGLAFMGVLLYLCLGLEDISISWWG-SDLDGCPLASC  720

Query  2274  PTAKGIAVDGCPVF  2315
             PTAKG+ V+GCPV+
Sbjct  721   PTAKGVVVEGCPVY  734



>ref|XP_008806363.1| PREDICTED: oligopeptide transporter 7-like [Phoenix dactylifera]
Length=765

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/726 (59%), Positives = 564/726 (78%), Gaps = 14/726 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIE+V LTV   DDP++PV TFRMWVLG +SC LLSFLNQFF YR+EPL ITSI+ Q+A
Sbjct  52    SPIEQVALTVPVGDDPSVPVLTFRMWVLGTISCALLSFLNQFFWYRKEPLSITSISAQIA  111

Query  324   TLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
              +P+G  MA  +    F   G    +F+LNPGPFN+KEHVLITIFAN+G      S YA+
Sbjct  112   VVPLGHLMARTITDRVF-FKG-RRWEFTLNPGPFNIKEHVLITIFANSGAG----SVYAI  165

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFR  683
              +V  +  FYRR I+FF   L+++TTQVLG+GWAG+ ++Y+VEPA MWWP  LVQ+SLFR
Sbjct  166   HVVTAVKIFYRRHITFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPYNLVQVSLFR  225

Query  684   TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTA  863
              LHEKE     G    ++R +FF+++  CSF +Y FPGY+F  L S+SW+CW+FP+SV A
Sbjct  226   ALHEKEARPKHG----LTRNQFFMVAFICSFSYYVFPGYLFSMLTSLSWICWIFPRSVLA  281

Query  864   HQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLN  1043
              QLGSGL GLG+GA+ LDWSTI+S+L SPL  P+FA  NV  G+ +IMY++ P +YW LN
Sbjct  282   QQLGSGLYGLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFVLIMYVITPTAYW-LN  340

Query  1044  VYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFA  1223
             +Y AK FP++S DLFT+ GQEY+IS+I++  F LD + Y K+G +YLSTFF+++YG GFA
Sbjct  341   LYKAKTFPIFSDDLFTSTGQEYNISSIIDSDFHLDVEAYEKEGPLYLSTFFAVTYGVGFA  400

Query  1224  TIASTITHVALFYGREIYDRYRAS-TKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSL  1400
             ++ +T+ HV LF+GREI+   +++  + KMD+HT+LM+ YK +P WWF  +LV  +A+++
Sbjct  401   SLTATVCHVLLFHGREIWQMSKSAFQEKKMDVHTRLMRQYKQVPQWWFICILVANVALTI  460

Query  1401  ALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKP  1580
               C +  D++Q+P+WG++ A  LA  FTLPI IITATTNQTPGLNIITEYIMG +YPG+P
Sbjct  461   FACEYYIDQLQLPWWGVLLACGLAIFFTLPIGIITATTNQTPGLNIITEYIMGYLYPGRP  520

Query  1581  IANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLL  1760
             +AN+CFK YGY+SMTQA+ FL DFKLGHYMKIPPR+MF+ Q +GTLIA  + +  AWWL+
Sbjct  521   VANMCFKVYGYISMTQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLGTAWWLM  580

Query  1761  HSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
              +I NIC  D L S+SPWTCPSD+VFFDASVIWGL+GP+RIF   G Y+A+NWFFL G +
Sbjct  581   DTIPNICDTDLLSSDSPWTCPSDQVFFDASVIWGLIGPRRIFGDLGTYSAINWFFLAGAI  640

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
              P+++WL H+ FP++ WI LIN+PVL+GATG MPPAT++NY++WI+VG +  F V+RYR+
Sbjct  641   APLLIWLAHKAFPNKKWISLINMPVLIGATGMMPPATAVNYTTWIIVGFLSGFVVYRYRR  700

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV  2297
              WWQR+NY+LS  LDAG+AFMAVLLY  +GLED +++WWG  DL+ C LASCPTAKG+ V
Sbjct  701   DWWQRHNYVLSGALDAGLAFMAVLLYLCLGLEDVSLNWWG-NDLDGCSLASCPTAKGVVV  759

Query  2298  DGCPVF  2315
             DGCPVF
Sbjct  760   DGCPVF  765



>ref|XP_002272972.2| PREDICTED: oligopeptide transporter 7 [Vitis vinifera]
Length=749

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/730 (59%), Positives = 567/730 (78%), Gaps = 16/730 (2%)
 Frame = +3

Query  132   DEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSIT  311
             DEE SPI++V LTV  TDDP+LPV TFRMWVLG VSCVLLSFLNQFF YR EPL IT+I+
Sbjct  33    DEENSPIKQVALTVPTTDDPSLPVLTFRMWVLGTVSCVLLSFLNQFFWYRTEPLTITAIS  92

Query  312   VQVATLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIfanagfafgng  488
              Q+A +P+GR MAA +     R+   G+  +F+LNPGPFN+KEHVLITIFAN+G      
Sbjct  93    AQIAVVPLGRLMAAKITD---RVFFKGTPWEFTLNPGPFNVKEHVLITIFANSGAG----  145

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
             + YA+ +V ++  FY++ ISFF   +++ITTQVLG+GWAG+ ++Y+VEPA MWWP+ LVQ
Sbjct  146   TVYAIHVVTVVKVFYKKHISFFVSLIVVITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQ  205

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +SLFR LHEKEE   GG    ++R +FF+I+  CSF +Y FPGY+F+ L S+SW+CW+FP
Sbjct  206   VSLFRALHEKEERPKGG----VTRTQFFLIAFICSFAYYVFPGYMFEMLTSLSWICWIFP  261

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
              SV A QLGSGL GLG+ A+ LDWSTI+++L SPL  P+FA  NV VG+  +MY++ PI 
Sbjct  262   TSVLAQQLGSGLYGLGIAAVGLDWSTISAYLGSPLASPWFATANVAVGFVFVMYVLTPIC  321

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             YW LNVY AK FP++S DLFT+ GQEY+IS+I+   F L+   Y ++G +YLSTFF+++Y
Sbjct  322   YW-LNVYKAKTFPIFSDDLFTSTGQEYNISSIITSNFHLNITAYEEEGPLYLSTFFAMTY  380

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTKGK-MDIHTKLMKNYKDIPSWWFYVLLVVT  1385
             G GFA +++T  HV LF+GREI+++ ++S K K MDIHT+LM  YK +P WWF+ +L+  
Sbjct  381   GVGFAALSATAVHVLLFHGREIWEQSKSSFKDKGMDIHTRLMTRYKQVPEWWFWSILIAN  440

Query  1386  IAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGII  1565
             IA ++  C + ND++Q+P+WG++ A A+A +FTLPI IITA TNQTPGLNIITEYI+G I
Sbjct  441   IAFTIFACQYYNDQLQLPWWGVLLACAIAIVFTLPIGIITAITNQTPGLNIITEYIIGYI  500

Query  1566  YPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSV  1745
             YPG P+AN+CFK YGY+SMTQA+ FL DFKLGHYMKIPPR+MF+ Q +GTLIAG + +  
Sbjct  501   YPGYPVANMCFKVYGYISMTQAVTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAGFVYLGT  560

Query  1746  AWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             AWW++ +I +IC +   S+SPWTCPSDRVF+DASVIWGL+GP+RIF  EG Y A+NWFFL
Sbjct  561   AWWMMETIPDIC-ETTASSSPWTCPSDRVFYDASVIWGLIGPRRIFGDEGVYEAVNWFFL  619

Query  1926  GGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVF  2105
              G + PV+VWL H+ FP Q WI LIN+PVL+ +TG MPPAT++NY++W++ G +  F V+
Sbjct  620   AGAVAPVLVWLAHKAFPKQEWIGLINMPVLISSTGMMPPATAVNYTTWVIAGFLSGFVVY  679

Query  2106  RYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAK  2285
             RYR  WWQR+NY+LS  LDAG+AFM VLLY  +GLED ++ WWG  DL+ C  A+CPTAK
Sbjct  680   RYRPDWWQRHNYVLSGALDAGLAFMGVLLYLCLGLEDISVDWWG-NDLDGCPYATCPTAK  738

Query  2286  GIAVDGCPVF  2315
             G+ V+GCPVF
Sbjct  739   GVFVEGCPVF  748



>ref|XP_008239235.1| PREDICTED: oligopeptide transporter 7-like [Prunus mume]
Length=759

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/734 (59%), Positives = 573/734 (78%), Gaps = 18/734 (2%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
             ++  +EE SP+E+V LTV  TDDP+LPV TFRMWVLG +SCVLLSFLNQFF YR EPL I
Sbjct  41    QNPEEEENSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSI  100

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIfanagfa  476
             T+I+ Q+A +P+G+ MA+ +    F     GS  +F+LNPGPFN+KEHVLITIFAN+G  
Sbjct  101   TAISAQIAVVPLGQLMASKITTHAFFK---GSRWEFTLNPGPFNVKEHVLITIFANSGAG  157

Query  477   fgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPS  656
                 + YA+ +V ++  FY++ I+FF   L+I+TTQVLG+GWAG+ ++Y+VEPA MWWP+
Sbjct  158   ----TVYAIHVVTVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPA  213

Query  657   TLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVC  836
              LVQ+SLFR LHEKE    GG    ++R +FF+I+  CSF +Y FPGY+F+ L S+SW+C
Sbjct  214   NLVQVSLFRALHEKEARPKGG----LTRTQFFLIAFMCSFAYYVFPGYLFEMLTSLSWIC  269

Query  837   WVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLV  1016
             W+FP +V A QLGSGL GLG+GA+ LDWSTI+S+L SPL  P+FA  NV  G+  +MY++
Sbjct  270   WIFPNNVLAQQLGSGLYGLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFFFVMYIL  329

Query  1017  MPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFF  1196
              P+ YW LNVY AK FP++S  LFT+ GQEY+I+AI++  F LD   Y ++G +YLSTFF
Sbjct  330   TPLCYW-LNVYKAKTFPIFSDTLFTSDGQEYNITAIIDSNFHLDSAAYDREGPLYLSTFF  388

Query  1197  SLSYGFGFATIASTITHVALFYGREIYDRYRASTKGK-MDIHTKLMKNYKDIPSWWFYVL  1373
             +++YG GFA + +TI HVALF+GREI+++ +AS K K MDIHT+LM+ Y  +P WWF  +
Sbjct  389   AITYGVGFAALTATIIHVALFHGREIWEQSKASFKEKQMDIHTRLMQRYNQVPEWWFVAI  448

Query  1374  LVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYI  1553
             L+V IAV++  C + ND++Q+P+WG++ A A+A  FTLPI IITA TNQTPGLNIITEYI
Sbjct  449   LLVNIAVTIFTCQYYNDQLQLPWWGVLLACAIAIFFTLPIGIITAITNQTPGLNIITEYI  508

Query  1554  MGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTI  1733
             +G IYPG P+AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR+MF+ Q +GTLIAG +
Sbjct  509   IGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIAGIV  568

Query  1734  NMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALN  1913
              +  AWWL+ +I +IC +DK  +S WTCPSD VF+DASVIWGL+GP+RIF + G Y A+N
Sbjct  569   YLGTAWWLMETIPDIC-EDK--SSVWTCPSDTVFYDASVIWGLIGPRRIFGNLGTYEAVN  625

Query  1914  WFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFN  2093
             WFFLGG + P++VW   + FP Q WI LIN+PVL+G+TG+MPPAT++NY+SWI++G +  
Sbjct  626   WFFLGGAVAPLVVWAAAKAFPKQEWIRLINMPVLIGSTGNMPPATAVNYTSWIILGFLSG  685

Query  2094  FFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASC  2273
             F V+RYR  WW+R+NY+LS  LDAG+AFM VLLYF++GLED ++SWWG  DL+ C LA+C
Sbjct  686   FVVYRYRPDWWRRHNYVLSGALDAGLAFMGVLLYFSLGLEDISLSWWG-NDLDGCPLATC  744

Query  2274  PTAKGIAVDGCPVF  2315
             PTAKG+ V+GCPV+
Sbjct  745   PTAKGVIVEGCPVY  758



>ref|XP_002518892.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF43425.1| Oligopeptide transporter, putative [Ricinus communis]
Length=760

 Score =   874 bits (2259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/768 (57%), Positives = 576/768 (75%), Gaps = 36/768 (5%)
 Frame = +3

Query  81    TVEIEAPALKLAG--EDVND--------------------EEVSPIEEVRLTVTNTDDPT  194
             T+EI AP +      ED ND                    EE SP+++V LTV+ TDD +
Sbjct  5     TLEIRAPLITKDEKIEDYNDTPPSSSANSKQEIYQQLQETEENSPVKQVALTVSTTDDTS  64

Query  195   LPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKF  374
             LPV TFRMW LG +SC+LLSFLNQFF YR EPL IT+I+ Q+A +P+G+ MAA +    F
Sbjct  65    LPVLTFRMWFLGAISCILLSFLNQFFWYRTEPLSITAISAQIAVVPLGQLMAAKITDRVF  124

Query  375   RIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFF  554
                G    +F+LNPGPFN+KEHVLITIFAN+G      S YA+ +V ++  FY++ I+FF
Sbjct  125   -FKG-TRCEFTLNPGPFNVKEHVLITIFANSGAG----SVYAIHVVTVVKVFYKKHITFF  178

Query  555   AGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrM  734
               +++IITTQVLG+GWAG+ ++Y+VEPA MWWP+ LVQ+SLFR LHEKEE   GG    +
Sbjct  179   VSFIVIITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGG----V  234

Query  735   SRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltl  914
             +R +FF+I+  CSF +YFFPGY+FQ L S+SW+CW+FP+SV A QLGSGL GLG+GAL +
Sbjct  235   TRIQFFLIAFICSFAYYFFPGYLFQMLTSLSWICWIFPQSVLAQQLGSGLYGLGIGALGI  294

Query  915   DWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTA  1094
             DWSTI+S+L SPL  P+FA  NV  G+ ++MY + P+SYW LNVY AK FP++S DLFT+
Sbjct  295   DWSTISSYLGSPLASPWFATANVAAGFIVVMYFLTPLSYW-LNVYKAKTFPIFSDDLFTS  353

Query  1095  QGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREI  1274
              GQEYDIS+I++  F LD   Y K+G +YLSTFF+++YG GFA + +TI HVALF+GRE+
Sbjct  354   TGQEYDISSIIDSNFHLDIAAYEKEGPLYLSTFFAMTYGVGFAALTATIVHVALFHGREV  413

Query  1275  YDRYRASTKG-KMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGL  1451
             +++ +AS K  KMDIHTKLM+ YK +P WWF  +L+  IA ++  C + N+++Q+P+WG+
Sbjct  414   WEQSKASFKETKMDIHTKLMRKYKQVPEWWFLCILLANIAATIFACEYYNEQLQLPWWGV  473

Query  1452  IFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQA  1631
             + A  +A +FTLPI IITA TNQTPGLNIITEY++G IYPG P+AN+CFK YGY+SMTQA
Sbjct  474   LLACGIAIVFTLPIGIITAITNQTPGLNIITEYVIGYIYPGYPVANMCFKVYGYISMTQA  533

Query  1632  IAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPW  1811
             I FL DFKLGHYMKIPPR+MF+ Q +GT+IA    +  AWWL+ +I +IC +   SNS W
Sbjct  534   ITFLQDFKLGHYMKIPPRTMFMAQIVGTIIACLTYLGTAWWLMETIPDIC-ETTASNSVW  592

Query  1812  TCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWI  1991
             TCPSD VF+DASVIWGL+GP+RIF   G Y A+NWFFLGG + P++VWL  + FP Q WI
Sbjct  593   TCPSDTVFYDASVIWGLIGPRRIFGDLGTYEAINWFFLGGAIAPILVWLAAKAFPHQEWI  652

Query  1992  PLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGV  2171
              LIN+PVL+GATG MPPAT++NY+SWI++G +  F V+RYR   WQRYNY+LS  LDAG+
Sbjct  653   RLINMPVLIGATGMMPPATAVNYTSWIIMGFLSGFVVYRYRPDLWQRYNYVLSGSLDAGL  712

Query  2172  AFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             AFM VL+Y  +G+ED ++ WWG  DL+ C LA+CPTA+G+ VDGCPVF
Sbjct  713   AFMGVLIYLCLGIEDISVDWWG-NDLDGCPLATCPTAQGVVVDGCPVF  759



>ref|XP_010053083.1| PREDICTED: oligopeptide transporter 7 [Eucalyptus grandis]
Length=751

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/748 (58%), Positives = 572/748 (76%), Gaps = 19/748 (3%)
 Frame = +3

Query  75    MGTVEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLS  254
             +G     +PAL    E+   EE SP+ +V LTV  TDDP+LPV TFRMWVLG +SCVLLS
Sbjct  21    IGPASSSSPALDRVVEE--PEENSPVPQVALTVQTTDDPSLPVLTFRMWVLGTLSCVLLS  78

Query  255   FLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMK  434
             FLNQFF YR EPL IT+I+ Q+A +P+GR MAA +    F + G    +F+LNPGPFN+K
Sbjct  79    FLNQFFWYRTEPLTITAISAQIAVVPLGRLMAARITDRVF-LKG-TRWEFTLNPGPFNVK  136

Query  435   EHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLL  614
             EHVLITIFAN+G      + YA+ +V ++  FY+++I+FF   +++ITTQVLG+GWAG+ 
Sbjct  137   EHVLITIFANSGAG----TVYAIYVVTVVKVFYKKQITFFVSLIVVITTQVLGFGWAGIF  192

Query  615   KKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFP  794
             +KY+VEPA MWWP+ LVQ+SLFR LHEKEE   GG    ++R +FF+I+  CSF +Y FP
Sbjct  193   RKYLVEPAAMWWPANLVQVSLFRALHEKEERPKGG----VTRTQFFLIAFICSFAYYVFP  248

Query  795   GYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAI  974
             GYIF+ L S+SW+CW+FPKSV A QLGSGL GLG+ A  LDWSTI+S+L SPL  P+FA 
Sbjct  249   GYIFEMLTSMSWICWIFPKSVLAQQLGSGLYGLGITAFGLDWSTISSYLGSPLASPWFAT  308

Query  975   VNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDED  1154
              NV VG+  +MY++ PI YW LNVY AK FP++S DLFT+ GQEY+IS+I++  F LD  
Sbjct  309   ANVAVGFVFVMYVLTPICYW-LNVYKAKTFPIFSDDLFTSTGQEYNISSIIDANFHLDLA  367

Query  1155  EYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGKM-DIHTKLM  1331
              Y K+G +YLSTFF+++YG GFA++ +T+ HVALF+GREI+ + +AS + K  DIHT++M
Sbjct  368   AYEKEGPLYLSTFFAMTYGVGFASLTATVVHVALFHGREIWAQSKASFQDKTADIHTRMM  427

Query  1332  KNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITAT  1511
             + Y+ +P WWF+ +LVV IA ++  C + N ++Q+P+WG++ A  +A +FTLPI IITA 
Sbjct  428   RRYQQVPEWWFWCILVVNIAATIFACEYYNSQLQLPWWGVLLACLIAIVFTLPIGIITAI  487

Query  1512  TNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSM  1691
             TNQTPGLNIITEYI+G IYPG P+AN+CFK YGY+SMTQA+ FL DFKLGHYMKIPP++M
Sbjct  488   TNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAVTFLQDFKLGHYMKIPPKTM  547

Query  1692  FLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGP  1871
             F+ Q +GTLIAG + +S AWWL+ +I +IC     ++S WTCPSD VF+DASVIWGL+GP
Sbjct  548   FMAQVVGTLIAGVVYLSTAWWLMETIPDICE----TSSVWTCPSDTVFYDASVIWGLIGP  603

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATS  2051
             +RIF  EG Y A+NWFFLGG + P++VWL H+ FP Q WI LIN+PVL+GATG MPPAT+
Sbjct  604   RRIFGDEGTYEAINWFFLGGAIAPILVWLAHKAFPEQEWISLINMPVLIGATGYMPPATA  663

Query  2052  LNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISW  2231
             +NY++WI+ G +  F V+RYR + W++YNY+LS  LDAG+AFM VLLY  +GLE   + W
Sbjct  664   VNYTTWIIAGFLSGFVVYRYRPELWKKYNYVLSGALDAGLAFMGVLLYLCLGLESIDLDW  723

Query  2232  WGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             WG  DL+ C LA+CPTA G+ V+GCPVF
Sbjct  724   WG-NDLDGCPLATCPTAVGVVVEGCPVF  750



>gb|EEC79904.1| hypothetical protein OsI_21444 [Oryza sativa Indica Group]
 gb|EEE65007.1| hypothetical protein OsJ_19952 [Oryza sativa Japonica Group]
Length=758

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/753 (58%), Positives = 576/753 (76%), Gaps = 20/753 (3%)
 Frame = +3

Query  78    GTVEIEAPALK----LAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCV  245
             G  EI AP L+        ++ +EE SPIE+V LTV  +D+P  PV TFRMWVLG  SC 
Sbjct  18    GDDEITAPFLRPSTSRGSPELEEEENSPIEQVALTVPVSDEPETPVLTFRMWVLGTASCA  77

Query  246   LLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPA-AKFRIPGFGSGQFSLNPGP  422
             +LSFLNQFF YR+EPL IT+I+ Q+A +P+GR MAAALP  A FR   +   +F+LNPGP
Sbjct  78    VLSFLNQFFWYRKEPLTITAISAQIAVVPLGRLMAAALPERAFFRGRPW---EFTLNPGP  134

Query  423   FNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGW  602
             FN+KEHVLITIFAN+G      + YA+ ++  +  FY + ISFF   L+++TTQVLG+GW
Sbjct  135   FNVKEHVLITIFANSGAG----TVYAIHVITAVRVFYGKHISFFVSLLVVLTTQVLGFGW  190

Query  603   AGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCW  782
             AG+ ++Y+VEPA MWWPS LVQ+SLFR LHEKE    GG    ++R +FF+++  CSF +
Sbjct  191   AGIFRRYLVEPAAMWWPSNLVQVSLFRALHEKEARSKGG----LTRNQFFLVAFICSFAY  246

Query  783   YFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCP  962
             Y FPGY+FQ L S+SW+CWVFP SV A QLGSGL+GLG+GA+ LDWST++S+L SPL  P
Sbjct  247   YIFPGYLFQMLTSLSWICWVFPHSVLAQQLGSGLSGLGIGAIGLDWSTVSSYLGSPLASP  306

Query  963   FFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFE  1142
             +FA  NV  G+  IMY++ PI+YW  N Y A+ FP++S  LFT+ GQ+Y+IS+IV+  F 
Sbjct  307   WFATANVAAGFFFIMYIITPIAYW-FNFYKAQNFPIFSDGLFTSTGQKYNISSIVDSHFH  365

Query  1143  LDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRAS-TKGKMDIH  1319
              D   Y K G +YLSTFF+++YG GFA++ +TI HV LF+G EI+   +++  + +MDIH
Sbjct  366   FDTKAYEKNGPLYLSTFFAVTYGVGFASLTATIVHVLLFHGSEIWQLSKSAFQEKRMDIH  425

Query  1320  TKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISI  1499
             TKLM+ YK +P WWF  +L+  IAV++  C +  +++Q+P+WG++ A A+AF FTLPI I
Sbjct  426   TKLMRRYKQVPEWWFVCILIANIAVTIFACEYYIEQLQLPWWGVLLACAIAFFFTLPIGI  485

Query  1500  ITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIP  1679
             ITATTNQTPGLNIITEYIMG +YPG+P+AN+CFK YGY+SM+QA+ FL DFKLGHYMKIP
Sbjct  486   ITATTNQTPGLNIITEYIMGYLYPGRPVANMCFKVYGYISMSQALTFLQDFKLGHYMKIP  545

Query  1680  PRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIW  1856
             PR+MF+ Q +GTLIA  + +  AWWL+ +I NIC+ + L S+SPWTCP D VF+DASVIW
Sbjct  546   PRTMFMAQVVGTLIAAFVYIGTAWWLMETIPNICNTELLPSDSPWTCPGDHVFYDASVIW  605

Query  1857  GLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSM  2036
             GL+ P+RIF   G Y+A+NWFFLGG + PV+VW  H+ FP+Q+WI LIN+PVL+GATG M
Sbjct  606   GLISPRRIFGDLGTYSAVNWFFLGGAIAPVLVWFAHKAFPNQNWILLINMPVLIGATGQM  665

Query  2037  PPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLED  2216
             PPAT++NY++WILVG +  + V+RYR+ WW+R+NY+LS  LDAG+AFMAVL+Y  +GLE+
Sbjct  666   PPATAVNYTTWILVGFLSGYVVYRYRRDWWERHNYLLSGALDAGLAFMAVLIYLCLGLEN  725

Query  2217  RTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
              +++WWG  DL+ C LASCPTAKG+ VDGCPV+
Sbjct  726   ISLNWWG-NDLDGCPLASCPTAKGVVVDGCPVY  757



>ref|XP_007039426.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
 gb|EOY23927.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
Length=762

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/726 (60%), Positives = 564/726 (78%), Gaps = 16/726 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SP+ +V LTV  TDDP+LPV TFRMWVLG +SCVLLSFLNQFF YR EPL IT+I+ Q+A
Sbjct  50    SPVRQVALTVPTTDDPSLPVLTFRMWVLGTISCVLLSFLNQFFWYRTEPLTITAISAQIA  109

Query  324   TLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIfanagfafgngSAYA  500
              +P+G+ MAA +     R+   G+  +FSLNPGPFN+KEHVLITIFAN+G      S YA
Sbjct  110   VVPLGQLMAAKITD---RVFFKGTRWEFSLNPGPFNVKEHVLITIFANSGAG----SVYA  162

Query  501   VGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLF  680
             + +V ++  FY++ I+FF   ++IITTQVLG+GWAG+ ++Y+VEPA MWWP+ LVQ+SLF
Sbjct  163   IHVVTVVKVFYKKHITFFVSLIVIITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLF  222

Query  681   RTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVT  860
             R LHEKEE   GG    ++R +FF+I+L CSF +Y FPGY+FQ L S+SW+CW+FPKSV 
Sbjct  223   RALHEKEERAKGG----VTRTQFFLIALICSFAYYVFPGYLFQMLTSLSWICWIFPKSVL  278

Query  861   AHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGL  1040
             A QLGSGL GLG+GA+ LDWSTI+S+L SPL  P+FA  NV  G+ +IMY++ PI+YW L
Sbjct  279   AQQLGSGLYGLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFILIMYVLTPITYW-L  337

Query  1041  NVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGF  1220
             NVYNAK FP++S  LFT+ GQEY+I+AI++  F LD   Y K+G +YLSTFF+++YG GF
Sbjct  338   NVYNAKTFPIFSDALFTSTGQEYNITAIIDSNFHLDIAAYEKEGPLYLSTFFAMTYGVGF  397

Query  1221  ATIASTITHVALFYGREIYDRYRAS-TKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVS  1397
             A + +TI HVALF+GREI+++ +AS  + KMD+HT+LM+ YK +P WWF  +L+V IA +
Sbjct  398   AALTATIVHVALFHGREIWEQSKASFQEKKMDVHTRLMRKYKQVPEWWFVCILLVNIAAT  457

Query  1398  LALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGK  1577
             +  C + ND++Q+P+WG++ A  +A +FTLPI IITA TNQTPGLNIITEYI+G IYPG 
Sbjct  458   ILACEYYNDQLQLPWWGVLLACGIAIVFTLPIGIITAITNQTPGLNIITEYIIGYIYPGY  517

Query  1578  PIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWL  1757
             P+AN+CFK YGY+SMTQA+ FL DFKLGHYMKIPPR+MF+ Q +GTLIA  + +  AWWL
Sbjct  518   PVANMCFKVYGYISMTQAVTFLQDFKLGHYMKIPPRTMFMAQVVGTLIACFVYLGTAWWL  577

Query  1758  LHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
             + +I +IC     SNS WTCPSD VF+DASVIWGLV P+RIF   G Y A+NWFFL G +
Sbjct  578   METIPDICDTTA-SNSVWTCPSDTVFYDASVIWGLVAPRRIFGDLGTYEAINWFFLAGAI  636

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
              P++VWL  + FP Q WI LIN+PVL+GATG MPPAT++NY++WI+VG +  F V+RYR 
Sbjct  637   APLLVWLATKAFPHQEWIKLINMPVLIGATGMMPPATAVNYTTWIIVGFLSGFVVYRYRP  696

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV  2297
               WQRYNY+LS  LDAG+AFM VL+Y  +GLE+ ++ WWG  DL+ C LASCPTAKGI V
Sbjct  697   DLWQRYNYVLSGSLDAGLAFMGVLIYLCLGLENISLDWWG-NDLDGCPLASCPTAKGIEV  755

Query  2298  DGCPVF  2315
             +GCPV+
Sbjct  756   EGCPVY  761



>ref|XP_010676880.1| PREDICTED: oligopeptide transporter 7-like [Beta vulgaris subsp. 
vulgaris]
Length=763

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/731 (59%), Positives = 569/731 (78%), Gaps = 14/731 (2%)
 Frame = +3

Query  123   DVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIIT  302
             D++++E SP+++V +TV   DDP LPV TFRMW LG +SCV+LSFLNQFF YR EPL IT
Sbjct  43    DLDNKENSPVKQVAMTVPTIDDPELPVLTFRMWALGTLSCVVLSFLNQFFWYRTEPLSIT  102

Query  303   SITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafg  482
             +I+ Q+A +P+G+ MAA LP+  F + G    +F+LNPGPFN+KEHVLITIFANAG    
Sbjct  103   AISAQIAVVPLGQLMAAKLPSRPF-LRG-TRWEFTLNPGPFNIKEHVLITIFANAGAG--  158

Query  483   ngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTL  662
               S YA+ +V ++  FY+++I+FF   ++++TTQVLG+GWAG+ ++Y+VEPA MWWP+ L
Sbjct  159   --SVYAIHVVTVVKIFYKKQITFFVSLIVVLTTQVLGFGWAGIFRRYLVEPAEMWWPANL  216

Query  663   VQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWV  842
             VQ+SLFR LHEKEE   GG    ++R +FF+IS  CSF +Y FPGY+FQ L S+SW+CW+
Sbjct  217   VQVSLFRALHEKEERAKGG----LTRTQFFLISFICSFAYYVFPGYLFQMLTSLSWICWL  272

Query  843   FPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMP  1022
             +PKS+ A QLGSGL GLG+ A  LDWSTI+S+L SPL  P+FA  NV  G+  +MY++ P
Sbjct  273   WPKSILAQQLGSGLYGLGITAFGLDWSTISSYLGSPLASPWFATANVAAGFVFVMYVLTP  332

Query  1023  ISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSL  1202
             ISYW LNVY AK FP++S DLFT+ G  Y+ISAIV+  F ++++ Y KQG +YLSTFFS+
Sbjct  333   ISYW-LNVYKAKTFPIFSDDLFTSNGSIYNISAIVDSNFHINQEAYEKQGPLYLSTFFSM  391

Query  1203  SYGFGFATIASTITHVALFYGREIYDRYRASTKGK-MDIHTKLMKNYKDIPSWWFYVLLV  1379
             +YG GFA +++T+ HVALF+GREI+++ +AS K K MDIHTKLM  YK+ P WWF+V+LV
Sbjct  392   TYGVGFAALSATVVHVALFHGREIWEQSKASFKDKKMDIHTKLMTRYKEAPEWWFWVILV  451

Query  1380  VTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMG  1559
             + IA ++  C +  +++Q+P+WG++ A A+AF+FTLPI IITA TNQ+PGLNIITEYI+G
Sbjct  452   INIAATIFACEYYKEQLQLPWWGVLLACAIAFIFTLPIGIITAITNQSPGLNIITEYIIG  511

Query  1560  IIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINM  1739
              IYPG P+AN+CFK YGY+SMTQAIAFL DFKLGHYMKIPPR+MF+ Q +GTLI+  + +
Sbjct  512   YIYPGYPVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTLISAFVYL  571

Query  1740  SVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWF  1919
               AWWL+ SI ++C +    N+ WTCPSD VF+DASVIWGL+GP+RIF +EG Y  +NWF
Sbjct  572   GTAWWLMESIPDMCEKTA-RNTVWTCPSDTVFYDASVIWGLIGPRRIFGNEGVYETINWF  630

Query  1920  FLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFF  2099
             FLGG + P++VWL  + FP+Q WI LIN+PVL+ ATG MPPAT++NY++WILVG +  + 
Sbjct  631   FLGGAIAPILVWLATKTFPNQEWIRLINMPVLIAATGMMPPATAVNYTTWILVGFLSGYV  690

Query  2100  VFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPT  2279
              FRY  +WW+R+NY+LS  LDAG+AFM V LY  +GLE+ ++SWWG  DL+ C  ASCPT
Sbjct  691   AFRYAPEWWERHNYLLSGALDAGLAFMGVALYLCLGLEEVSLSWWG-NDLDGCPYASCPT  749

Query  2280  AKGIAVDGCPV  2312
              KGI V GCPV
Sbjct  750   EKGIMVQGCPV  760



>gb|KDP25233.1| hypothetical protein JCGZ_20389 [Jatropha curcas]
Length=756

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/728 (60%), Positives = 559/728 (77%), Gaps = 14/728 (2%)
 Frame = +3

Query  135   EEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITV  314
             EE SP+++V LTV  TDDP+LPV TFRMWVLG +SCVLLSFLNQFF YR EPL IT+I+ 
Sbjct  41    EENSPVKQVALTVPTTDDPSLPVLTFRMWVLGTISCVLLSFLNQFFWYRTEPLSITAISA  100

Query  315   QVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSA  494
             Q+A +P+G+ MAA +    F + G    +F+LNPGPFN+KEHVLITIFAN+G      S 
Sbjct  101   QIAVVPLGQLMAAKITDRVF-LKG-TRWEFTLNPGPFNVKEHVLITIFANSGAG----SV  154

Query  495   YAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQIS  674
             YA+ IV ++  FY++ I+FF   ++IITTQVLG+GWAG+ +KY+VEPA MWWP+ LVQ+S
Sbjct  155   YAIHIVTVVKMFYKKHITFFVSLIVIITTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVS  214

Query  675   LFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKS  854
             LFR LHEKEE   GG    ++R +FFVI+  CSF +Y FPGY+FQ L S+SWVCW+FPKS
Sbjct  215   LFRALHEKEERAKGG----VTRIQFFVIAFICSFAYYVFPGYLFQMLTSLSWVCWIFPKS  270

Query  855   VTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYW  1034
             V   QLGSGL GLG+GA+ +DWSTI+S+L SPL  P+FA  NV  G+  +MY++ P+ YW
Sbjct  271   VLTQQLGSGLYGLGIGAIGIDWSTISSYLGSPLASPWFATANVAAGFIFVMYILTPLCYW  330

Query  1035  GLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGF  1214
               NVY AK FP++S DLFT+ GQEY+ISAIV+  F LD   Y KQG +YLSTFF+++YG 
Sbjct  331   -FNVYKAKTFPIFSDDLFTSSGQEYNISAIVDSNFHLDLAAYEKQGPLYLSTFFAMTYGV  389

Query  1215  GFATIASTITHVALFYGREIYDRYRAS-TKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIA  1391
             GFA + +TI HVALF+GREI+++ +AS  + KMDIHTKLM+ YK +P  WF  +L+  IA
Sbjct  390   GFAALTATIVHVALFHGREIWEQSKASFQEKKMDIHTKLMRKYKQVPESWFVGILLCNIA  449

Query  1392  VSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYP  1571
              ++  C + ND++Q+P+WG++ A  +A +FTLPI  ITA TNQTPGLN+ITEYI+G IYP
Sbjct  450   ATIFACEYYNDQLQLPWWGVLLACGIAILFTLPIGTITAITNQTPGLNVITEYIIGYIYP  509

Query  1572  GKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAW  1751
             G P+AN+CFK YGY+SMTQAIAFL DFKLGHYMKIPPR+MF+ Q +G+LIA    +  AW
Sbjct  510   GYPVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQIVGSLIACLTYLGTAW  569

Query  1752  WLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGG  1931
             WL+ +I +IC     SNS WTCPSD VF+DASVIWGL+GP+RIF   G Y A+NWFFL G
Sbjct  570   WLMETITDICDTTA-SNSVWTCPSDTVFYDASVIWGLIGPRRIFGDLGTYEAINWFFLAG  628

Query  1932  ILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRY  2111
              + PV+VWL  + FP Q WI LIN+PVL+GATG MPPAT++NY+SWI++G +  F V+RY
Sbjct  629   AVAPVLVWLAAKAFPKQEWITLINMPVLIGATGMMPPATAVNYTSWIILGFLSGFVVYRY  688

Query  2112  RKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGI  2291
             R   WQRYNY+LS  LDAG+AFM VL+Y  +G+E+ ++ WWG  DL+ C LA+CPTAKGI
Sbjct  689   RPDLWQRYNYVLSGSLDAGLAFMGVLIYLCLGIENISVDWWG-NDLDGCPLATCPTAKGI  747

Query  2292  AVDGCPVF  2315
              VDGCPVF
Sbjct  748   VVDGCPVF  755



>ref|XP_002437735.1| hypothetical protein SORBIDRAFT_10g001530 [Sorghum bicolor]
 gb|EER89102.1| hypothetical protein SORBIDRAFT_10g001530 [Sorghum bicolor]
Length=785

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/731 (59%), Positives = 566/731 (77%), Gaps = 14/731 (2%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
             ++ E SPIE+V LTV   DDPT PV TFRMWVLG  SC LLSFLNQFF YR+EPL IT+I
Sbjct  66    SEGENSPIEQVALTVPVGDDPTTPVLTFRMWVLGTASCALLSFLNQFFWYRKEPLTITAI  125

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgng  488
             + Q+A +P+GR MAAALP   F + G    +FSLNPGPFN+KEHVLITIFAN+G      
Sbjct  126   SAQIAVVPLGRLMAAALPERAF-LRG-TRWEFSLNPGPFNVKEHVLITIFANSGAG----  179

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
             + YA+ ++  +  FY + I+FF   L+++TTQVLG+GWAG+ ++Y+VEPA MWWPS LVQ
Sbjct  180   TVYAIHVITAVRVFYGKNITFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPSNLVQ  239

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +SLFR LHE+E    GG    M+R +FF+++  CSF +Y FPGY+FQ L S+SW+CWVFP
Sbjct  240   VSLFRALHERERRVKGG----MTRNQFFLVAFICSFAYYIFPGYLFQMLTSLSWICWVFP  295

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
              SV A QLGSGL GLG+GA+ LDWSTI+S+L SPL  P+FA  NV  G+ IIMY++ PI+
Sbjct  296   HSVLAQQLGSGLTGLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFFIIMYVITPIA  355

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             YW  N Y A+ FP++S  LFT  GQ Y+IS+IV+  F+ D + Y K G +YLSTFF+++Y
Sbjct  356   YW-FNFYKAQNFPIFSDGLFTLTGQTYNISSIVDSHFQFDTEAYEKNGPLYLSTFFAVTY  414

Query  1209  GFGFATIASTITHVALFYGREIYDRYRAS-TKGKMDIHTKLMKNYKDIPSWWFYVLLVVT  1385
             G GFA++ +TI HV LF+G EI    +++  + K+DIHTKLM+ YK +P WWF  +L+  
Sbjct  415   GVGFASLTATIVHVFLFHGSEILQLSKSAFQEKKVDIHTKLMRRYKQVPEWWFICILIAN  474

Query  1386  IAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGII  1565
             IAV++  C +  +++Q+P+WG++ A A+AF FTLPI IITATTNQTPGLNIITEYIMG +
Sbjct  475   IAVTIFACEYYIEQLQLPWWGVLLACAIAFTFTLPIGIITATTNQTPGLNIITEYIMGYL  534

Query  1566  YPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSV  1745
             YPG+P+AN+CFK YGY+SM+QA+ FL DFKLGHYMKIPPR+MF+ Q +GTLIA  + +  
Sbjct  535   YPGRPVANMCFKVYGYISMSQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAFVYLGT  594

Query  1746  AWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFF  1922
             AWWL+ ++ NIC+ + L S+SPWTCP D VF+DASVIWGL+ P+RIF   G Y+A+NWFF
Sbjct  595   AWWLMDTVPNICNTELLPSDSPWTCPGDHVFYDASVIWGLISPRRIFGDLGTYSAVNWFF  654

Query  1923  LGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFV  2102
             LGG + P++VWL H+ FPSQSWI LIN+PV++GATG MPPAT++NY++WILVG +  + V
Sbjct  655   LGGAVAPLLVWLAHKAFPSQSWILLINMPVMIGATGMMPPATAVNYTTWILVGFLSGYVV  714

Query  2103  FRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTA  2282
             +RYR+ WW+R+NY+LS  LDAG+AFMAVL+Y  +GLE+ +++WWG  DL+ C L+SCPTA
Sbjct  715   YRYRRDWWERHNYLLSGALDAGLAFMAVLIYLCLGLENISLNWWG-NDLDGCPLSSCPTA  773

Query  2283  KGIAVDGCPVF  2315
             KGI V+GCPV+
Sbjct  774   KGIVVEGCPVY  784



>ref|XP_008239237.1| PREDICTED: oligopeptide transporter 7 [Prunus mume]
Length=760

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/726 (59%), Positives = 564/726 (78%), Gaps = 18/726 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SP+E+V LTV  TDDP+LPV TFRMWVLG +SCVLLSFLNQFF YR+EPL IT+I+ Q+A
Sbjct  50    SPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRKEPLSITAISAQIA  109

Query  324   TLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIfanagfafgngSAYA  500
              +P+G+ MA+ +    F     GS  +F+LNPGPFN+KEHVLITIFAN+G      + YA
Sbjct  110   VVPLGQLMASKITTHAFFK---GSRWEFTLNPGPFNVKEHVLITIFANSGAG----TVYA  162

Query  501   VGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLF  680
             + IV ++  FY++ I+FF   L+I+TTQVLG+GWAG+ ++Y+VEPA MWWP+ LVQ+SLF
Sbjct  163   IHIVTVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLF  222

Query  681   RTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVT  860
             R LHEKE    GG    ++R +FF+I+  CSF +Y FPGY+F+ L S+SW+CW+FPKSV 
Sbjct  223   RALHEKEARPKGG----LTRTQFFLIAFICSFAYYVFPGYLFEMLTSLSWICWIFPKSVL  278

Query  861   AHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGL  1040
             A QLGSGL GLG+G + LDWSTI+S+L SPL  P+FA  NV  G+ ++MY++ P  YW  
Sbjct  279   AQQLGSGLYGLGIGTIGLDWSTISSYLGSPLASPWFATANVAAGFVLVMYILTPFCYW-F  337

Query  1041  NVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGF  1220
             NVY AK FP++SS +F + G+EY+I+AI++  F LD   Y ++G +YLS  F ++YG GF
Sbjct  338   NVYKAKTFPIFSSTMFKSDGEEYNITAIIDSNFHLDSAAYNREGPLYLSIIFVITYGVGF  397

Query  1221  ATIASTITHVALFYGREIYDRYRASTKGK-MDIHTKLMKNYKDIPSWWFYVLLVVTIAVS  1397
             A + +TI HVALF+GREI+++ +AS K K MDIHT+LM+ YK +P WWF V+L+V IAV+
Sbjct  398   AALTATIVHVALFHGREIWEQSKASFKEKEMDIHTRLMQRYKQVPEWWFVVILLVNIAVT  457

Query  1398  LALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGK  1577
             +  C + ND++Q+P+WG++ A A+A  FTLPI IITA TNQTPGLNIITEYI+G IYPG 
Sbjct  458   IFTCQYYNDQLQLPWWGVLLACAIAIFFTLPIGIITAITNQTPGLNIITEYIIGYIYPGY  517

Query  1578  PIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWL  1757
             P+AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR+MF+ Q +GTLIA  + +  AWWL
Sbjct  518   PVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLGTAWWL  577

Query  1758  LHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
             + +I +IC     ++S WTCP D VF+DASVIWGL+GP+RIF +EG Y A+NWFFLGG +
Sbjct  578   METIPDICED---TSSVWTCPGDTVFYDASVIWGLIGPRRIFGNEGTYEAVNWFFLGGAV  634

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
              P++VW   + FP Q WI LIN+PVL+GATGSMPPAT++NY+SWI++G +  F V+RYR 
Sbjct  635   APLVVWAAAKAFPKQEWIRLINMPVLIGATGSMPPATAVNYTSWIILGFLSGFVVYRYRP  694

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV  2297
              WW+R+NY+LS  LDAG+AFM VLLYF++GLED +++WWG  DL+ C LA+CPTAKG+ V
Sbjct  695   DWWRRHNYVLSGALDAGLAFMGVLLYFSLGLEDISLNWWG-NDLDGCPLATCPTAKGVIV  753

Query  2298  DGCPVF  2315
             +GCPV+
Sbjct  754   EGCPVY  759



>ref|NP_001130398.1| uncharacterized protein LOC100191494 [Zea mays]
 gb|ACG28837.1| oligopeptide transporter 9 [Zea mays]
 gb|ACL53218.1| unknown [Zea mays]
 gb|AFW86095.1| oligopeptide transporter 9 [Zea mays]
Length=781

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/735 (58%), Positives = 569/735 (77%), Gaps = 15/735 (2%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
              + +D E SPIE+V LTV   DDP+ PV TFRMWVLG  SC LLSFLNQFF YR+EPL I
Sbjct  58    SEGDDPENSPIEQVALTVPVGDDPSTPVLTFRMWVLGTASCALLSFLNQFFWYRKEPLTI  117

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIfanagfa  476
             T+I+ Q+A +P+GR MAAALPA   R    G+  +FSLNPGPF++KEHVL+TIFAN+G  
Sbjct  118   TAISAQIAVVPLGRLMAAALPA---RAVLRGTRWEFSLNPGPFSVKEHVLVTIFANSGAG  174

Query  477   fgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPS  656
                 + YA+ ++  +  FY + I+FF   L+++TTQVLG+GWAG+ ++Y+VEPA MWWPS
Sbjct  175   ----TVYAIHVITAVRVFYGKHITFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPS  230

Query  657   TLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVC  836
              LVQ+SLFR LHEKE    GG    M+R +FF+++  CSF +Y FPGY+FQ L S+SW+C
Sbjct  231   NLVQVSLFRALHEKERRVKGG----MTRNQFFLVAFVCSFAYYVFPGYLFQMLTSLSWLC  286

Query  837   WVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLV  1016
             W FP+SV A QLGSGL+GLG+GA+ LDWSTI+S+L SPL  P+FA  NV  G+ +IMY++
Sbjct  287   WAFPRSVVAQQLGSGLSGLGVGAVGLDWSTISSYLGSPLASPWFATANVAAGFVLIMYVI  346

Query  1017  MPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFF  1196
              P +Y+ L +Y A+ FP++S  LFTA GQ Y+IS+IV+  F  D + Y + G +YLSTFF
Sbjct  347   TPAAYYWLGLYGARSFPIFSDGLFTAAGQTYNISSIVDSNFRFDTEAYERNGPLYLSTFF  406

Query  1197  SLSYGFGFATIASTITHVALFYGREIYDRYRAS-TKGKMDIHTKLMKNYKDIPSWWFYVL  1373
             +++YG GFA++ +T+ HV LF+G EI+   R++  + K+D+HT+LM+ Y+ +P WWF  +
Sbjct  407   AVTYGVGFASLTATVVHVFLFHGSEIWQLSRSAFQEKKVDVHTRLMRRYRQVPEWWFICI  466

Query  1374  LVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYI  1553
             LV  +AV++  C +  +++Q+P+WG++ A A+AF FTLPI IITATTNQTPGLNIITEYI
Sbjct  467   LVANVAVTIFACEYYIEQLQLPWWGVLLACAIAFFFTLPIGIITATTNQTPGLNIITEYI  526

Query  1554  MGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTI  1733
             MG +YPG+P+AN+CFK YGY+SMTQA+AFL DFKLGHYMKIPPR+MF+ Q +GTLIA  +
Sbjct  527   MGYLYPGRPVANMCFKVYGYISMTQALAFLQDFKLGHYMKIPPRTMFMAQVVGTLIAALV  586

Query  1734  NMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNAL  1910
              +  AWWL+ S+ NIC  + L ++SPWTCP D VF+DASVIWGL+GP+RIF   G Y+A+
Sbjct  587   YIGTAWWLMDSVPNICSTELLPADSPWTCPMDHVFYDASVIWGLIGPRRIFGDLGTYSAV  646

Query  1911  NWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIF  2090
             NWFFLGG + P++VWL HR FPSQSWI L+N+PVL+G+TG MPPAT++NY++WI+ G + 
Sbjct  647   NWFFLGGAVAPLLVWLAHRVFPSQSWILLVNMPVLIGSTGMMPPATAVNYTTWIIAGFLS  706

Query  2091  NFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLAS  2270
              + V+RYR+ WW+R+NY+LS  LDAG+AFMAVL+Y  +GLE+  ++WWG  DL+ C LAS
Sbjct  707   GYVVYRYRRHWWERHNYLLSGALDAGLAFMAVLIYLCLGLENVGLNWWG-NDLDGCPLAS  765

Query  2271  CPTAKGIAVDGCPVF  2315
             CPTAKGI V+GCPV+
Sbjct  766   CPTAKGIVVEGCPVY  780



>ref|XP_002303684.2| hypothetical protein POPTR_0003s14540g [Populus trichocarpa]
 gb|EEE78663.2| hypothetical protein POPTR_0003s14540g [Populus trichocarpa]
Length=800

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/733 (59%), Positives = 564/733 (77%), Gaps = 14/733 (2%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
                +DEE SP+++V LTV  TDDP+LPV TFRMWVLG +SCVLLSFLNQFF YR EPL I
Sbjct  80    NQAHDEENSPVKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSI  139

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
             T+I+ Q+A +P+G+ MAA +    F   G    +F+LNPGPFN+KEHVLITIFAN+G   
Sbjct  140   TAISAQIAVVPLGQLMAAKITDRVF-FKG-TRCEFTLNPGPFNVKEHVLITIFANSGAG-  196

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
                S YA+ IV ++ AFY++ I+FF  +++IITTQVLG+GWAG+ ++Y+VEPA MWWP+ 
Sbjct  197   ---SVYAIHIVTVVKAFYKKNITFFVSFIVIITTQVLGFGWAGIFRRYLVEPAAMWWPAN  253

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR LHEKEE   GG    ++R +FF+I+  CSF +Y FPGY+F+ L S+SW+CW
Sbjct  254   LVQVSLFRALHEKEERSKGG----VTRTQFFLIAFTCSFAYYVFPGYLFEMLTSLSWICW  309

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
             +FPKS+ A QLGSGL GLG+GA  LDWSTI+S+L SPL  P+FA  NV  G+  +MY++ 
Sbjct  310   IFPKSILAQQLGSGLYGLGIGAFGLDWSTISSYLGSPLASPWFATANVAAGFVFVMYVLT  369

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             P+ YW  NVY AK FP++S DLFTA GQEY+ISAI++  F LD   Y ++G +YLSTFF+
Sbjct  370   PLCYW-FNVYKAKTFPIFSDDLFTATGQEYNISAIIDSNFHLDLAAYDREGPLYLSTFFA  428

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGK-MDIHTKLMKNYKDIPSWWFYVLL  1376
             ++YG GFA + +TI HVALF+GREI+++  AS + K MDIHT+ M+ Y  +P WWF  +L
Sbjct  429   VTYGVGFAALTATIVHVALFHGREIWEQSMASFQEKTMDIHTRHMRKYNQVPEWWFVCIL  488

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
             +V IA+++  C +  D++Q+P+WG++ A  +A  FTLPI IITA TNQ+PGLNIITEYI+
Sbjct  489   LVNIALTIFACEYYKDQLQLPWWGVLLACGIAITFTLPIGIITAITNQSPGLNIITEYII  548

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             G IYPG P+AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR+MF+ Q +GT+IA    
Sbjct  549   GYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTIIACITY  608

Query  1737  MSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNW  1916
             +  AWWLL +I +IC     S+S WTCPSD VF+DASVIWGL+GP+RIF + G Y A+NW
Sbjct  609   LGTAWWLLETITDIC-DSTASDSVWTCPSDHVFYDASVIWGLIGPRRIFGNLGTYEAVNW  667

Query  1917  FFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNF  2096
             FFL G + P++VWL  + FP Q WI LIN+PVL+GATG MPPAT++NY++W+LVG +  F
Sbjct  668   FFLVGAIAPILVWLAAKAFPQQEWIRLINMPVLIGATGMMPPATAVNYTTWVLVGFLSGF  727

Query  2097  FVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCP  2276
              V+RY+   WQRYNY+LS  LDAG+AFM VLLYF +GLE+ +I+WWG  DL+ C LASCP
Sbjct  728   VVYRYKPDLWQRYNYVLSGSLDAGLAFMGVLLYFCLGLENISINWWG-NDLDGCPLASCP  786

Query  2277  TAKGIAVDGCPVF  2315
             TAKG++V+GCPVF
Sbjct  787   TAKGVSVEGCPVF  799



>ref|XP_003601453.1| Oligopeptide transporter [Medicago truncatula]
Length=741

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/745 (59%), Positives = 568/745 (76%), Gaps = 17/745 (2%)
 Frame = +3

Query  87    EIEAPALKLAGEDVND-EEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLN  263
              I +P  K      ND EE SPI++V LTV  TDDP+LPV TFRMWVLG +SCVLLSFLN
Sbjct  11    NITSPLRKQTLSKKNDSEENSPIKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLN  70

Query  264   QFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHV  443
             QFF YR EPL IT+I+ Q+A +P+G+ MA+ +    F   G  S +F+LNPGPFN+KEHV
Sbjct  71    QFFWYRTEPLTITAISAQIAVVPLGQLMASKITKRVF-FKG-KSWEFTLNPGPFNVKEHV  128

Query  444   LITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKY  623
             LITIFAN+G      + YA+ IV  +  FY + I+F   +L+IITTQVLG+GWAG+ ++Y
Sbjct  129   LITIFANSGAG----TVYAIHIVTAVKVFYHQHITFCVSFLVIITTQVLGFGWAGIFRRY  184

Query  624   VVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYI  803
             +VEPA MWWP+ LVQ+SLFR LHEKEE   GG    ++R++FFVIS  CSF +Y FPGY+
Sbjct  185   LVEPAAMWWPANLVQVSLFRALHEKEERTKGG----LTRSQFFVISFLCSFAYYVFPGYL  240

Query  804   FQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNV  983
             FQ L S+SW+CWVFP SV A QLGSGL GLG+GA+ LDWS I+++L SPL  P+FA  NV
Sbjct  241   FQMLTSLSWICWVFPHSVLAQQLGSGLKGLGIGAIGLDWSAISAYLGSPLASPWFATANV  300

Query  984   FVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYA  1163
              VG+  +MY++ P+ YW  NVYNAK FP++S+ LFT++G+ Y+I+ I++  F +D   Y 
Sbjct  301   AVGFVFVMYILTPLCYW-FNVYNAKTFPIFSNQLFTSKGEIYNITEIIDSNFHMDLAAYE  359

Query  1164  KQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGK-MDIHTKLMKNY  1340
             KQGR++LSTFF+++YG GFA + +TI HVALF+GREI+++ ++S   K MDIHTKLM+ Y
Sbjct  360   KQGRLHLSTFFAMTYGVGFAALTATIVHVALFHGREIWEQSKSSFNEKSMDIHTKLMRRY  419

Query  1341  KDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQ  1520
             K +P WWF  +L+ TIA ++  C + N+++Q+P+WG++ A  +A  FTLPI IITA TNQ
Sbjct  420   KQVPEWWFVCILIATIATTIFACEYYNEQLQLPWWGVLLACGIAIFFTLPIGIITAITNQ  479

Query  1521  TPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLV  1700
             +PGLNIITEYI+G IYPG P+AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR+MF+ 
Sbjct  480   SPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMA  539

Query  1701  QFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRI  1880
             Q +GTLIAG + +S AWWL+ SI +IC   K ++S WTCP D VF+DASVIWGL+GP+RI
Sbjct  540   QVVGTLIAGLVYLSTAWWLMESIPDIC---KDTSSVWTCPGDTVFYDASVIWGLIGPRRI  596

Query  1881  FDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNY  2060
             F + G Y  +NWFFLGG + P++VWL  R FP Q WI LIN+PVL+GATG MPPAT++NY
Sbjct  597   FGNLGTYENINWFFLGGAIAPLLVWLATRAFPQQEWIKLINMPVLIGATGMMPPATAVNY  656

Query  2061  SSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGT  2240
             +SWI+VG +  F V+RY+ +WWQR+NY+LS  LDAG+AFM V+LY  +GLE+ +I WWG 
Sbjct  657   TSWIIVGFLSGFVVYRYKPEWWQRHNYVLSGALDAGLAFMGVVLYLCLGLEEISIDWWG-  715

Query  2241  TDLEHCDLASCPTAKGIAVDGCPVF  2315
              +L+ C LA CPTAKG  V GCPVF
Sbjct  716   NNLDGCPLAHCPTAKGFEVQGCPVF  740



>ref|XP_010934487.1| PREDICTED: oligopeptide transporter 7 [Elaeis guineensis]
Length=765

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/726 (59%), Positives = 560/726 (77%), Gaps = 14/726 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIE+V LTV   DDP++PV TFRMWVLG VSC LLSFLNQFF YR+EPL ITSI+ Q+A
Sbjct  52    SPIEQVALTVPVGDDPSVPVLTFRMWVLGTVSCALLSFLNQFFWYRKEPLSITSISAQIA  111

Query  324   TLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
              +P+G  MA  +    F   G    +F+LNPGPFNMKEHVLITIFAN+G      S YA+
Sbjct  112   VVPLGHLMARTITDRVF-FKG-RRWEFTLNPGPFNMKEHVLITIFANSGAG----SVYAI  165

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFR  683
              +V  +  FYR+ I+FF   L+++TTQVLG+GWAG+ ++++VEPA MWWP  LVQ+SLFR
Sbjct  166   HVVTAVKIFYRQHITFFVSLLVVLTTQVLGFGWAGIFRQHLVEPAAMWWPYNLVQVSLFR  225

Query  684   TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTA  863
              LHEKE     G    ++R +FF+++  CSF +Y FPGY+F  L S+SW+CW+FP SV A
Sbjct  226   ALHEKEVRPKHG----LTRNQFFMVAFVCSFAYYVFPGYLFSMLTSLSWICWIFPGSVLA  281

Query  864   HQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLN  1043
              QLGSGL GLG+GA+ LDWSTI+S+L SPL  P+FA  NV  G+ IIMY++ P +YW LN
Sbjct  282   QQLGSGLYGLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFVIIMYVITPTAYW-LN  340

Query  1044  VYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFA  1223
             +Y AK FP++S  LFT+ GQ Y+IS+I++  F LD + Y K+G +YLS FF+++YG GFA
Sbjct  341   LYKAKTFPIFSDGLFTSTGQSYNISSIIDSDFHLDVEAYEKEGPLYLSAFFAVTYGVGFA  400

Query  1224  TIASTITHVALFYGREIYDRYRAS-TKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSL  1400
             ++ +T++HV LF+GREI+   +++  + K+D+HTKLM+ YK +P WWF  +LV  +A+++
Sbjct  401   SLTATVSHVLLFHGREIWQMSKSAFQEKKIDVHTKLMRQYKQVPQWWFICILVANVALTI  460

Query  1401  ALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKP  1580
               C +  D++Q+P+WG++ A  +A  FTLPI IITATTNQTPGLNIITEYIMG +YPG+P
Sbjct  461   FACEYYIDQLQLPWWGVLLACGIAIFFTLPIGIITATTNQTPGLNIITEYIMGYLYPGRP  520

Query  1581  IANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLL  1760
             +AN+CFK YGY+SMTQA+ FL DFKLGHYMKIPPR+MF+ Q +GTLIA  + +  AWWL+
Sbjct  521   VANMCFKVYGYISMTQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLGTAWWLM  580

Query  1761  HSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
              +I NIC+ + L S+SPWTCPSD VF+DASVIWGL+GP+RIF   G Y+A+NWFFL G +
Sbjct  581   DTIPNICNTELLSSDSPWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYSAINWFFLAGAI  640

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
              P++VWL H+ FP+Q WI LIN+PVL+GATG MPPAT++NY++WI VG +  F V+RYR+
Sbjct  641   APLLVWLAHKAFPNQKWISLINMPVLIGATGMMPPATAVNYTTWITVGFLSGFVVYRYRR  700

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV  2297
              WWQR+NY+LS  LDAG+AFMAVLLY  +GLED +++WWG  DL+ C LASCPTAKG+ V
Sbjct  701   DWWQRHNYVLSGALDAGLAFMAVLLYLCLGLEDVSLNWWG-NDLDGCALASCPTAKGVVV  759

Query  2298  DGCPVF  2315
             DGCPVF
Sbjct  760   DGCPVF  765



>dbj|BAD67732.1| putative sexual differentiation process protein isp4 [Oryza sativa 
Japonica Group]
Length=763

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/758 (57%), Positives = 576/758 (76%), Gaps = 25/758 (3%)
 Frame = +3

Query  78    GTVEIEAPALK----LAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCV  245
             G  EI AP L+        ++ +EE SPIE+V LTV  +D+P  PV TFRMWVLG  SC 
Sbjct  18    GDDEITAPFLRPSTSRGSPELEEEENSPIEQVALTVPVSDEPETPVLTFRMWVLGTASCA  77

Query  246   LLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPA-AKFRIPGFGSGQFSLNPGP  422
             +LSFLNQFF YR+EPL IT+I+ Q+A +P+GR MAAALP  A FR   +   +F+LNPGP
Sbjct  78    VLSFLNQFFWYRKEPLTITAISAQIAVVPLGRLMAAALPERAFFRGRPW---EFTLNPGP  134

Query  423   FNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQV-----  587
             FN+KEHVLITIFAN+G      + YA+ ++  +  FY + ISFF   L+++TTQV     
Sbjct  135   FNVKEHVLITIFANSGAG----TVYAIHVITAVRVFYGKHISFFVSLLVVLTTQVVDDQV  190

Query  588   LGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLC  767
             LG+GWAG+ ++Y+VEPA MWWPS LVQ+SLFR LHEKE    GG    ++R +FF+++  
Sbjct  191   LGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALHEKEARSKGG----LTRNQFFLVAFI  246

Query  768   CSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSS  947
             CSF +Y FPGY+FQ L S+SW+CWVFP SV A QLGSGL+GLG+GA+ LDWST++S+L S
Sbjct  247   CSFAYYIFPGYLFQMLTSLSWICWVFPHSVLAQQLGSGLSGLGIGAIGLDWSTVSSYLGS  306

Query  948   PLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIV  1127
             PL  P+FA  NV  G+  IMY++ PI+YW  N Y A+ FP++S  LFT+ GQ+Y+IS+IV
Sbjct  307   PLASPWFATANVAAGFFFIMYIITPIAYW-FNFYKAQNFPIFSDGLFTSTGQKYNISSIV  365

Query  1128  NKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRAS-TKG  1304
             +  F  D   Y K G +YLSTFF+++YG GFA++ +TI HV LF+G EI+   +++  + 
Sbjct  366   DSHFHFDTKAYEKNGPLYLSTFFAVTYGVGFASLTATIVHVLLFHGSEIWQLSKSAFQEK  425

Query  1305  KMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFT  1484
             +MDIHTKLM+ YK +P WWF  +L+  IAV++  C +  +++Q+P+WG++ A A+AF FT
Sbjct  426   RMDIHTKLMRRYKQVPEWWFVCILIANIAVTIFACEYYIEQLQLPWWGVLLACAIAFFFT  485

Query  1485  LPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGH  1664
             LPI IITATTNQTPGLNIITEYIMG +YPG+P+AN+CFK YGY+SM+QA+ FL DFKLGH
Sbjct  486   LPIGIITATTNQTPGLNIITEYIMGYLYPGRPVANMCFKVYGYISMSQALTFLQDFKLGH  545

Query  1665  YMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFD  1841
             YMKIPPR+MF+ Q +GTLIA  + +  AWWL+ +I NIC+ + L S+SPWTCP D VF+D
Sbjct  546   YMKIPPRTMFMAQVVGTLIAAFVYIGTAWWLMETIPNICNTELLPSDSPWTCPGDHVFYD  605

Query  1842  ASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLG  2021
             ASVIWGL+ P+RIF   G Y+A+NWFFLGG + PV+VW  H+ FP+Q+WI LIN+PVL+G
Sbjct  606   ASVIWGLISPRRIFGDLGTYSAVNWFFLGGAIAPVLVWFAHKAFPNQNWILLINMPVLIG  665

Query  2022  ATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFT  2201
             ATG MPPAT++NY++WILVG +  + V+RYR+ WW+R+NY+LS  LDAG+AFMAVL+Y  
Sbjct  666   ATGQMPPATAVNYTTWILVGFLSGYVVYRYRRDWWERHNYLLSGALDAGLAFMAVLIYLC  725

Query  2202  VGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             +GLE+ +++WWG  DL+ C LASCPTAKG+ VDGCPV+
Sbjct  726   LGLENISLNWWG-NDLDGCPLASCPTAKGVVVDGCPVY  762



>ref|XP_011022429.1| PREDICTED: oligopeptide transporter 7-like [Populus euphratica]
Length=760

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/733 (59%), Positives = 563/733 (77%), Gaps = 14/733 (2%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
                +DEE SP+++V LTV  TDDP+LPV TFRMWVLG +SCVLLSFLNQFF YR EPL I
Sbjct  40    NQAHDEENSPVKQVALTVPTTDDPSLPVLTFRMWVLGTISCVLLSFLNQFFWYRTEPLSI  99

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
             T+I+ Q+A +P+G+ MAA +    F   G    +F+LNPGPFN+KEHVLITIFAN+G   
Sbjct  100   TAISAQIAVVPLGQLMAAKITDRVF-FKG-TRCEFTLNPGPFNVKEHVLITIFANSGAG-  156

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
                S YA+ IV ++ AFY++ I+ F  +++IITTQVLG+GWAG+ ++Y+VEPA MWWP+ 
Sbjct  157   ---SVYAIHIVTVVKAFYKKNITLFVSFIVIITTQVLGFGWAGIFRRYLVEPAAMWWPAN  213

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR LHEKEE   GG    ++R +FF+I+  CSF +Y FPGY+F+ L S+SW+CW
Sbjct  214   LVQVSLFRALHEKEERSKGG----VTRTQFFLIAFTCSFAYYVFPGYLFEMLTSLSWICW  269

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
             +FPKS+ A QLGSGL GLG+GA  LDWSTI+S+L SPL  P+FA  NV  G+  +MY++ 
Sbjct  270   IFPKSILAQQLGSGLYGLGIGAFGLDWSTISSYLGSPLASPWFATANVAAGFVFVMYILT  329

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             P+ YW  NVY AK FP++S DLFTA GQEY+ISAI++  F LD   Y +QG +YLSTFF+
Sbjct  330   PLCYW-FNVYKAKTFPIFSDDLFTATGQEYNISAIIDSNFHLDLAAYDRQGPLYLSTFFA  388

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGK-MDIHTKLMKNYKDIPSWWFYVLL  1376
             ++YG GFA + +TI HVALF+GREI+++  AS + + MDIHT+ M+ Y  +P WWF  +L
Sbjct  389   VTYGVGFAALTATIVHVALFHGREIWEQSMASFQERTMDIHTRHMRKYNQVPEWWFVCIL  448

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
             +V IA+++  C +  D++Q+P+WG++ A  +A  FTLPI IITA TNQ+PGLNIITEYI+
Sbjct  449   LVNIALTIFACEYYKDQLQLPWWGVLLACGIAITFTLPIGIITAITNQSPGLNIITEYII  508

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             G IYPG P+AN+CFK YGY+SMTQA+ FL DFKLGHYMKIPPR+MF+ Q +GT+IA    
Sbjct  509   GYIYPGYPVANMCFKVYGYISMTQAVTFLQDFKLGHYMKIPPRTMFMAQVVGTIIACITY  568

Query  1737  MSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNW  1916
             +  AWWLL +I +IC     S+S WTCPSD VF+DASVIWGL+GP+RIF + G Y A+NW
Sbjct  569   LGTAWWLLETITDICDASA-SDSVWTCPSDHVFYDASVIWGLIGPRRIFGNLGTYEAVNW  627

Query  1917  FFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNF  2096
             FFL G + P++VWL  + FP Q WI LIN+PVL+GATG MPPAT++NY++W+LVG +  F
Sbjct  628   FFLVGAIAPILVWLAAKAFPQQEWIRLINMPVLIGATGMMPPATAVNYTTWVLVGFLSGF  687

Query  2097  FVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCP  2276
              V+RY+   WQRYNY+LS  LDAG+AFM VLLYF +GLE+ +I+WWG  DL+ C LASCP
Sbjct  688   VVYRYKPDLWQRYNYVLSGSLDAGLAFMGVLLYFCLGLENISINWWG-NDLDGCPLASCP  746

Query  2277  TAKGIAVDGCPVF  2315
             TAKG++V+GCPVF
Sbjct  747   TAKGVSVEGCPVF  759



>ref|XP_010436760.1| PREDICTED: oligopeptide transporter 7-like [Camelina sativa]
Length=766

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/745 (58%), Positives = 572/745 (77%), Gaps = 19/745 (3%)
 Frame = +3

Query  87    EIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQ  266
             E E   L ++GE+  +EE SPI +V LTV  TDDP+LPV TFRMWVLG +SC+LLSFLNQ
Sbjct  38    ETEELLLPISGEE--EEENSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQ  95

Query  267   FFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHV  443
             FF YR EPL I++I+ Q+A +P+GR MAA +     R+   GS  QF+LNPGPFN+KEHV
Sbjct  96    FFWYRTEPLTISAISAQIAVVPLGRLMAAKISE---RVYFQGSKWQFTLNPGPFNVKEHV  152

Query  444   LITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKY  623
             LITIFANAG      S YA+ +V ++ AFY + I+FF  +L+I+TTQVLG+GWAG+ +KY
Sbjct  153   LITIFANAGAG----SVYAIHVVTVVKAFYMKNITFFVSFLVIVTTQVLGFGWAGIFRKY  208

Query  624   VVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYI  803
             +VEPA MWWP+ LVQ+SLFR LHEKEE   GG    ++R +FFVI+  CSF +Y FPGY+
Sbjct  209   LVEPAAMWWPANLVQVSLFRALHEKEERTKGG----LTRTQFFVIAFVCSFAYYVFPGYL  264

Query  804   FQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNV  983
             FQ + S+SWVCW FP SV A Q+GSGL+GLG+GA+ LDWSTI+S+L SPL  P+FA  NV
Sbjct  265   FQIMTSLSWVCWCFPSSVIAQQIGSGLHGLGVGAIGLDWSTISSYLGSPLASPWFATANV  324

Query  984   FVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYA  1163
              VG+ +++Y+++PI YW L+V+ AK FP++SS LFT QG +Y+I++I++  F LD   Y 
Sbjct  325   GVGFVLVIYVLVPICYW-LDVFKAKTFPIFSSSLFTNQGSKYNITSIIDSNFHLDLPAYE  383

Query  1164  KQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTK-GKMDIHTKLMKNY  1340
             ++G +YLSTFF++SYG GFA +++TI HVALF+GREI+++ R S K  KMDIH +LM+ Y
Sbjct  384   REGPLYLSTFFAISYGVGFAALSATIVHVALFHGREIWEQSRESLKEKKMDIHARLMQRY  443

Query  1341  KDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQ  1520
             K +P WWF+ +LV  I  ++  C +  D++Q+P+WG++ A  +A +FTLPI IITA TNQ
Sbjct  444   KQVPEWWFWCILVTNIGATIFSCEYYKDQLQLPWWGVLLACTIAIIFTLPIGIITAITNQ  503

Query  1521  TPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLV  1700
              PGLNIITEYI+G IYPG P+AN+CFK YGY+SM QAI FL DFKLGHYMKIPPR+MF+ 
Sbjct  504   APGLNIITEYIIGYIYPGYPVANMCFKVYGYISMRQAITFLQDFKLGHYMKIPPRTMFMA  563

Query  1701  QFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRI  1880
             Q +GTLI+  + ++ AWWL+ +I NIC  D +SNS WTCP+D+VF+DASVIWGL+GP+RI
Sbjct  564   QIVGTLISCLVYLTTAWWLMETIPNIC--DTVSNSVWTCPTDKVFYDASVIWGLIGPRRI  621

Query  1881  FDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNY  2060
             F   G Y ++NWFFL G + P++VWL  R FP Q WI LIN+PVL+ AT SMPPAT++NY
Sbjct  622   FGDLGLYKSVNWFFLVGAIAPILVWLASRMFPRQEWIKLINMPVLISATSSMPPATAVNY  681

Query  2061  SSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGT  2240
             ++W+L G +  F VFRYR   WQRYNY+LS  LDAG+AFM VLLY  +GLE+ ++ WWG 
Sbjct  682   TTWVLAGFLSGFVVFRYRPNLWQRYNYVLSGALDAGLAFMGVLLYMCLGLENVSLDWWG-  740

Query  2241  TDLEHCDLASCPTAKGIAVDGCPVF  2315
              +L+ C LASCPTA GI+V+GCP++
Sbjct  741   NELDGCPLASCPTAPGISVEGCPLY  765



>ref|XP_007210345.1| hypothetical protein PRUPE_ppa001827mg [Prunus persica]
 gb|EMJ11544.1| hypothetical protein PRUPE_ppa001827mg [Prunus persica]
Length=760

 Score =   866 bits (2238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/726 (58%), Positives = 565/726 (78%), Gaps = 18/726 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SP+E+V LTV  TDDP+LPV TFRMWVLG +SC+LLSFLNQFF YR+EPL IT+I+ Q+A
Sbjct  50    SPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRKEPLSITAISAQIA  109

Query  324   TLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIfanagfafgngSAYA  500
              +P+G+ MA+ +    F     GS  +F+LNPGPFN+KEHVLITIFAN+G      + YA
Sbjct  110   VVPLGQLMASKITTHAFFK---GSRWEFTLNPGPFNVKEHVLITIFANSGAG----TVYA  162

Query  501   VGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLF  680
             + IV ++  FY++ I+FF   L+I+TTQVLG+GWAG+ ++Y+VEPA MWWP+ LVQ+SLF
Sbjct  163   IHIVTVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLF  222

Query  681   RTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVT  860
             R LHEKE    GG    ++R +FF+I+  CSF +Y FPGY+F+ L S+SW+CW+FPKSV 
Sbjct  223   RALHEKEARPKGG----VTRTQFFLIAFICSFAYYVFPGYLFEMLTSLSWICWIFPKSVL  278

Query  861   AHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGL  1040
             A QLGSGL GLG+G + +DWSTI+S+L SPL  P+FA  NV  G+ ++MY++ P  YW  
Sbjct  279   AQQLGSGLYGLGIGTVGIDWSTISSYLGSPLASPWFATANVAAGFFLVMYILTPFCYW-F  337

Query  1041  NVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGF  1220
             NVY AK FP++SS +F + G+EY+I+AI++  F LD   Y ++G +YLS  F+++YG GF
Sbjct  338   NVYKAKTFPIFSSTMFKSDGEEYNITAIIDSNFHLDSAAYNREGPLYLSIIFAITYGVGF  397

Query  1221  ATIASTITHVALFYGREIYDRYRASTKGK-MDIHTKLMKNYKDIPSWWFYVLLVVTIAVS  1397
             A + +TI HVALF+GREI+++ +AS K K MDIHT+LM+ YK +P WWF V+L+V IAV+
Sbjct  398   AALTATIVHVALFHGREIWEQSKASFKEKQMDIHTRLMQRYKQVPEWWFVVILLVNIAVT  457

Query  1398  LALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGK  1577
             +  C + ND++Q+P+WG++ A A+A  FTLPI IITA TNQTPGLNIITEYI+G IYPG 
Sbjct  458   IFTCQYYNDQLQLPWWGVLLACAIAIFFTLPIGIITAITNQTPGLNIITEYIIGYIYPGY  517

Query  1578  PIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWL  1757
             P+AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR+MF+ Q +GTLIA  + +  AWWL
Sbjct  518   PVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLGTAWWL  577

Query  1758  LHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
             + +I +IC     ++S WTCP D VF+DASVIWGL+GP+RIF ++G Y A+NWFFLGG +
Sbjct  578   METIPDICED---TSSVWTCPGDTVFYDASVIWGLIGPRRIFGNKGTYEAINWFFLGGAV  634

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
              P++VW   + FP Q WI LIN+PVL+GATG+MPPAT++NY+SWI++G +  F V+RYR 
Sbjct  635   APLVVWAAAKAFPKQEWIRLINMPVLIGATGNMPPATAVNYTSWIILGFLSGFVVYRYRP  694

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV  2297
              WW+R+NY+LS  LDAG+AFM VLLYF++GLED +++WWG  DL+ C LA+CPTAKG+ V
Sbjct  695   DWWRRHNYVLSGALDAGLAFMGVLLYFSLGLEDISLNWWG-NDLDGCPLATCPTAKGVIV  753

Query  2298  DGCPVF  2315
             +GCPV+
Sbjct  754   EGCPVY  759



>gb|KHG17686.1| Oligopeptide transporter 7 [Gossypium arboreum]
Length=783

 Score =   865 bits (2235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/726 (60%), Positives = 561/726 (77%), Gaps = 16/726 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SP+ +V LTV  TDDP+LPV TFRMWVLG +SC LLSFLNQFF YR EPL IT+I+ Q+A
Sbjct  71    SPVRQVALTVPTTDDPSLPVLTFRMWVLGTISCFLLSFLNQFFWYRTEPLTITAISAQIA  130

Query  324   TLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIfanagfafgngSAYA  500
              +P+G+ MAA +     R+   GS  +F+LNPGPFN+KEHVLITIFAN+G      S YA
Sbjct  131   VVPLGQLMAAKITK---RVFFKGSRWEFTLNPGPFNVKEHVLITIFANSGAG----SVYA  183

Query  501   VGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLF  680
             + +V ++  FY++ I+FF   ++I+TTQVLG+GWAG+ ++Y+VEPA MWWP+ LVQ+SLF
Sbjct  184   IHVVTVVKVFYKQHITFFVSLIVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLF  243

Query  681   RTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVT  860
             R LHEKEE  +GG    ++R +FF+I+  CSF +Y FPGY+FQ L S+SW+CW+FPKSV 
Sbjct  244   RALHEKEERANGG----VTRTQFFLIAFICSFAYYVFPGYLFQMLTSLSWICWIFPKSVL  299

Query  861   AHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGL  1040
             A QLGSGL GLG+GA+ LDWSTI+S+L SPL  P+FA  NV  GY  +MY++ PI YW L
Sbjct  300   AQQLGSGLYGLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGYIFVMYVLTPICYW-L  358

Query  1041  NVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGF  1220
             NVY+AK FP++S  LFT+ GQEY+I+AI++  F LD   Y K+G +YLSTFF+++YG GF
Sbjct  359   NVYSAKTFPIFSDTLFTSTGQEYNITAIIDSNFHLDVAAYEKEGPLYLSTFFAMTYGVGF  418

Query  1221  ATIASTITHVALFYGREIYDRYRAS-TKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVS  1397
             A + +TI HV LF+GREI+++ +AS  + KMDIHT+LM+ YK +P WWF  +L+V IA +
Sbjct  419   AALTATIVHVGLFHGREIWEQSKASFQEKKMDIHTRLMRKYKQVPEWWFVCILLVNIAAT  478

Query  1398  LALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGK  1577
             +  C + ND++Q+P+WG++ A  +A +FTLPI IITA TNQTPGLNIITEYI+G IYPG 
Sbjct  479   VFACQYYNDQLQLPWWGVLLACGIAIVFTLPIGIITAITNQTPGLNIITEYIIGYIYPGY  538

Query  1578  PIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWL  1757
             P+AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR+MF+ Q +GTLIA  + +  AWWL
Sbjct  539   PVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLIACFVYLGTAWWL  598

Query  1758  LHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
             + +I +IC     SNS WTCPSD VF+DASVIWGL+ P+RIF   G Y A+NWFFL G +
Sbjct  599   MENIPDICDTTA-SNSVWTCPSDTVFYDASVIWGLIAPRRIFGDLGTYEAVNWFFLAGAV  657

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
              P++VWL  + FPSQ WI LIN+PVL+GATG MPPAT++NY++WI+VG +  F V+RYR 
Sbjct  658   APLLVWLASKAFPSQEWIRLINMPVLIGATGMMPPATAVNYTTWIIVGFLSGFVVYRYRP  717

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV  2297
               WQRYNY+LS  LDAG+AFM VLLY  +GLE+ ++ WWG  DL+ C LASCPTA+GI V
Sbjct  718   DLWQRYNYVLSGALDAGLAFMGVLLYLCLGLENISLDWWG-NDLDGCPLASCPTAQGIKV  776

Query  2298  DGCPVF  2315
             +GCP+F
Sbjct  777   EGCPLF  782



>gb|AES71704.2| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=737

 Score =   865 bits (2235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/736 (59%), Positives = 565/736 (77%), Gaps = 16/736 (2%)
 Frame = +3

Query  111   LAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREP  290
             L  +  + EE SPI++V LTV  TDDP+LPV TFRMWVLG +SCVLLSFLNQFF YR EP
Sbjct  16    LLSKKNDSEENSPIKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEP  75

Query  291   LIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanag  470
             L IT+I+ Q+A +P+G+ MA+ +    F   G  S +F+LNPGPFN+KEHVLITIFAN+G
Sbjct  76    LTITAISAQIAVVPLGQLMASKITKRVF-FKG-KSWEFTLNPGPFNVKEHVLITIFANSG  133

Query  471   fafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWW  650
                   + YA+ IV  +  FY + I+F   +L+IITTQVLG+GWAG+ ++Y+VEPA MWW
Sbjct  134   AG----TVYAIHIVTAVKVFYHQHITFCVSFLVIITTQVLGFGWAGIFRRYLVEPAAMWW  189

Query  651   PSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISW  830
             P+ LVQ+SLFR LHEKEE   GG    ++R++FFVIS  CSF +Y FPGY+FQ L S+SW
Sbjct  190   PANLVQVSLFRALHEKEERTKGG----LTRSQFFVISFLCSFAYYVFPGYLFQMLTSLSW  245

Query  831   VCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMY  1010
             +CWVFP SV A QLGSGL GLG+GA+ LDWS I+++L SPL  P+FA  NV VG+  +MY
Sbjct  246   ICWVFPHSVLAQQLGSGLKGLGIGAIGLDWSAISAYLGSPLASPWFATANVAVGFVFVMY  305

Query  1011  LVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLST  1190
             ++ P+ YW  NVYNAK FP++S+ LFT++G+ Y+I+ I++  F +D   Y KQGR++LST
Sbjct  306   ILTPLCYW-FNVYNAKTFPIFSNQLFTSKGEIYNITEIIDSNFHMDLAAYEKQGRLHLST  364

Query  1191  FFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGK-MDIHTKLMKNYKDIPSWWFY  1367
             FF+++YG GFA + +TI HVALF+GREI+++ ++S   K MDIHTKLM+ YK +P WWF 
Sbjct  365   FFAMTYGVGFAALTATIVHVALFHGREIWEQSKSSFNEKSMDIHTKLMRRYKQVPEWWFV  424

Query  1368  VLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITE  1547
              +L+ TIA ++  C + N+++Q+P+WG++ A  +A  FTLPI IITA TNQ+PGLNIITE
Sbjct  425   CILIATIATTIFACEYYNEQLQLPWWGVLLACGIAIFFTLPIGIITAITNQSPGLNIITE  484

Query  1548  YIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAG  1727
             YI+G IYPG P+AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR+MF+ Q +GTLIAG
Sbjct  485   YIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIAG  544

Query  1728  TINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNA  1907
              + +S AWWL+ SI +IC   K ++S WTCP D VF+DASVIWGL+GP+RIF + G Y  
Sbjct  545   LVYLSTAWWLMESIPDIC---KDTSSVWTCPGDTVFYDASVIWGLIGPRRIFGNLGTYEN  601

Query  1908  LNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTI  2087
             +NWFFLGG + P++VWL  R FP Q WI LIN+PVL+GATG MPPAT++NY+SWI+VG +
Sbjct  602   INWFFLGGAIAPLLVWLATRAFPQQEWIKLINMPVLIGATGMMPPATAVNYTSWIIVGFL  661

Query  2088  FNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLA  2267
               F V+RY+ +WWQR+NY+LS  LDAG+AFM V+LY  +GLE+ +I WWG  +L+ C LA
Sbjct  662   SGFVVYRYKPEWWQRHNYVLSGALDAGLAFMGVVLYLCLGLEEISIDWWG-NNLDGCPLA  720

Query  2268  SCPTAKGIAVDGCPVF  2315
              CPTAKG  V GCPVF
Sbjct  721   HCPTAKGFEVQGCPVF  736



>gb|KHG17687.1| Oligopeptide transporter 7 [Gossypium arboreum]
Length=759

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/726 (60%), Positives = 561/726 (77%), Gaps = 16/726 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SP+ +V LTV  TDDP+LPV TFRMWVLG +SC LLSFLNQFF YR EPL IT+I+ Q+A
Sbjct  47    SPVRQVALTVPTTDDPSLPVLTFRMWVLGTISCFLLSFLNQFFWYRTEPLTITAISAQIA  106

Query  324   TLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIfanagfafgngSAYA  500
              +P+G+ MAA +     R+   GS  +F+LNPGPFN+KEHVLITIFAN+G      S YA
Sbjct  107   VVPLGQLMAAKITK---RVFFKGSRWEFTLNPGPFNVKEHVLITIFANSGAG----SVYA  159

Query  501   VGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLF  680
             + +V ++  FY++ I+FF   ++I+TTQVLG+GWAG+ ++Y+VEPA MWWP+ LVQ+SLF
Sbjct  160   IHVVTVVKVFYKQHITFFVSLIVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLF  219

Query  681   RTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVT  860
             R LHEKEE  +GG    ++R +FF+I+  CSF +Y FPGY+FQ L S+SW+CW+FPKSV 
Sbjct  220   RALHEKEERANGG----VTRTQFFLIAFICSFAYYVFPGYLFQMLTSLSWICWIFPKSVL  275

Query  861   AHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGL  1040
             A QLGSGL GLG+GA+ LDWSTI+S+L SPL  P+FA  NV  GY  +MY++ PI YW L
Sbjct  276   AQQLGSGLYGLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGYIFVMYVLTPICYW-L  334

Query  1041  NVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGF  1220
             NVY+AK FP++S  LFT+ GQEY+I+AI++  F LD   Y K+G +YLSTFF+++YG GF
Sbjct  335   NVYSAKTFPIFSDTLFTSTGQEYNITAIIDSNFHLDVAAYEKEGPLYLSTFFAMTYGVGF  394

Query  1221  ATIASTITHVALFYGREIYDRYRAS-TKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVS  1397
             A + +TI HV LF+GREI+++ +AS  + KMDIHT+LM+ YK +P WWF  +L+V IA +
Sbjct  395   AALTATIVHVGLFHGREIWEQSKASFQEKKMDIHTRLMRKYKQVPEWWFVCILLVNIAAT  454

Query  1398  LALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGK  1577
             +  C + ND++Q+P+WG++ A  +A +FTLPI IITA TNQTPGLNIITEYI+G IYPG 
Sbjct  455   VFACQYYNDQLQLPWWGVLLACGIAIVFTLPIGIITAITNQTPGLNIITEYIIGYIYPGY  514

Query  1578  PIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWL  1757
             P+AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR+MF+ Q +GTLIA  + +  AWWL
Sbjct  515   PVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLIACFVYLGTAWWL  574

Query  1758  LHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
             + +I +IC     SNS WTCPSD VF+DASVIWGL+ P+RIF   G Y A+NWFFL G +
Sbjct  575   MENIPDICDTTA-SNSVWTCPSDTVFYDASVIWGLIAPRRIFGDLGTYEAVNWFFLAGAV  633

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
              P++VWL  + FPSQ WI LIN+PVL+GATG MPPAT++NY++WI+VG +  F V+RYR 
Sbjct  634   APLLVWLASKAFPSQEWIRLINMPVLIGATGMMPPATAVNYTTWIIVGFLSGFVVYRYRP  693

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV  2297
               WQRYNY+LS  LDAG+AFM VLLY  +GLE+ ++ WWG  DL+ C LASCPTA+GI V
Sbjct  694   DLWQRYNYVLSGALDAGLAFMGVLLYLCLGLENISLDWWG-NDLDGCPLASCPTAQGIKV  752

Query  2298  DGCPVF  2315
             +GCP+F
Sbjct  753   EGCPLF  758



>ref|XP_006397011.1| hypothetical protein EUTSA_v10028453mg [Eutrema salsugineum]
 gb|ESQ38464.1| hypothetical protein EUTSA_v10028453mg [Eutrema salsugineum]
Length=764

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/744 (58%), Positives = 568/744 (76%), Gaps = 15/744 (2%)
 Frame = +3

Query  87    EIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQ  266
             E E   L ++G+   DEE SPI +V LTV  TDDP+LPV TFRMWVLG +SC+LLSFLNQ
Sbjct  34    ETEGLCLPISGDSGEDEENSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQ  93

Query  267   FFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVL  446
             FF YR EPL I++I+ Q+A +P+GR MAA +    F + G    +F+LNPGPFN+KEHVL
Sbjct  94    FFWYRTEPLTISAISAQIAVVPLGRLMAAKISDRVF-LQG-SKWEFTLNPGPFNVKEHVL  151

Query  447   ITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYV  626
             ITIFANAG      S YA+ IV ++ AFY + ++FF  +++I+TTQVLG+GWAG+ +KY+
Sbjct  152   ITIFANAGAG----SVYAIHIVTVVRAFYMKNLTFFVSFIVIVTTQVLGFGWAGIFRKYL  207

Query  627   VEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIF  806
             VEPA MWWP+ LVQ+SLFR LHEKEE   GG    ++R +FF+I+  CSF +Y FPGY+F
Sbjct  208   VEPAAMWWPANLVQVSLFRALHEKEERTKGG----LTRTQFFLIAFVCSFAYYVFPGYLF  263

Query  807   QTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVF  986
             Q L S+SW+CW FP SV A Q+GSGL+GLG+GA+ LDWSTI+S+L SPL  P+FA  NV 
Sbjct  264   QILTSLSWICWFFPASVMAQQIGSGLHGLGVGAIGLDWSTISSYLGSPLASPWFATANVG  323

Query  987   VGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAK  1166
             VG+ +++Y+++PI YW L+VY AK FPL+SS LFT +G +Y+I++I++ +F LD   Y +
Sbjct  324   VGFVLLVYVLVPICYW-LDVYKAKTFPLFSSSLFTNEGSKYNITSIIDSKFHLDLQAYER  382

Query  1167  QGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTK-GKMDIHTKLMKNYK  1343
             +G +YLSTFF++SYG GFA +++TI HVALF+GREI+++ + S K  K+DIH KLMK YK
Sbjct  383   EGPLYLSTFFAISYGVGFAALSATIMHVALFHGREIWEQSKESFKEKKLDIHAKLMKRYK  442

Query  1344  DIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQT  1523
              +P WWF+ +L   I V++  C +  D++Q+P+WG++ A  +A +FTLPI I+TA TNQ 
Sbjct  443   QVPEWWFWCILATNIGVTIFACEYYKDQLQLPWWGVLLACTIAIIFTLPIGILTAITNQA  502

Query  1524  PGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQ  1703
             PGLNIITEYI+G IYPG P+AN+CFK YGY+SM QAI FL DFKLGHYMKIPPR+MF+ Q
Sbjct  503   PGLNIITEYIIGYIYPGYPVANMCFKVYGYISMQQAITFLQDFKLGHYMKIPPRTMFMAQ  562

Query  1704  FIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIF  1883
              +GTLI+  + +  AWWL+ +I NIC  D +SNS WTCP D+VF+DASVIWGL+GP+RIF
Sbjct  563   IVGTLISCLVYLITAWWLMETIPNIC--DSVSNSVWTCPGDKVFYDASVIWGLIGPRRIF  620

Query  1884  DSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYS  2063
                G Y ++NWFFL G + PV+VWL  R FP Q WI LIN+PVL+ AT SMPPAT++NY+
Sbjct  621   GDLGLYKSVNWFFLVGAIAPVLVWLASRTFPRQEWIKLINMPVLISATSSMPPATAVNYT  680

Query  2064  SWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTT  2243
             +W+L G +  F VFRYR   WQRYNY+LS  LDAG+AFM VLLY  +GLE+ ++ WWG  
Sbjct  681   TWVLAGFLSGFVVFRYRPNLWQRYNYVLSGALDAGLAFMGVLLYMCLGLENVSLDWWG-N  739

Query  2244  DLEHCDLASCPTAKGIAVDGCPVF  2315
             +L+ C LASCPTA GI V+GCP++
Sbjct  740   ELDGCPLASCPTAPGIIVEGCPLY  763



>ref|XP_004964383.1| PREDICTED: oligopeptide transporter 7-like isoform X2 [Setaria 
italica]
Length=775

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/726 (59%), Positives = 562/726 (77%), Gaps = 14/726 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIE+V LTV   DDP+ PV TFRMWVLG  SC LLSFLNQFF YR+EPL IT+I+ Q+A
Sbjct  61    SPIEQVALTVPVGDDPSTPVLTFRMWVLGTASCALLSFLNQFFWYRKEPLTITAISAQIA  120

Query  324   TLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
              +P+GR MAAALP   F + G    +FSLNPGPFN+KEHVLITIFAN+G      + YA+
Sbjct  121   VVPLGRLMAAALPERAF-LRG-TRWEFSLNPGPFNVKEHVLITIFANSGAG----TVYAI  174

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFR  683
              ++  +  FY + I+FF   L+++TTQVLG+GWAG+ ++Y+VEPA MWWPS LVQ+SLFR
Sbjct  175   HVITAVRVFYGKHITFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFR  234

Query  684   TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTA  863
              LHEKE+   GG    ++R +FF+++  CSF +Y FPGY+FQ L S+SWVCWVFP SV A
Sbjct  235   ALHEKEQRVKGG----LTRNQFFLVAFICSFAYYIFPGYLFQMLTSLSWVCWVFPHSVFA  290

Query  864   HQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLN  1043
              QLGSGL GLG+GA+ LDWST++S+L SPL  P+FA  NV  G+  +MY+V PI+YW  N
Sbjct  291   QQLGSGLRGLGIGAIGLDWSTVSSYLGSPLASPWFATANVAAGFVFVMYIVTPIAYW-FN  349

Query  1044  VYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFA  1223
              Y A+ FP++S  LFT  GQ+Y+IS+IV+  F  D   Y K G +YLSTFF+++YG GFA
Sbjct  350   FYKAQNFPIFSDGLFTTTGQKYNISSIVDSHFHFDTKAYEKNGPLYLSTFFAVTYGVGFA  409

Query  1224  TIASTITHVALFYGREIYDRYRAS-TKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSL  1400
             ++ +TI HV LF+G EI+   +++  + KMD+HTKLM+ YK +P WWF  +LV  IAV++
Sbjct  410   SLTATIVHVFLFHGSEIWQLSKSAFQEKKMDVHTKLMRRYKQVPEWWFICILVANIAVTI  469

Query  1401  ALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKP  1580
               C +  +++Q+P+WG++ A A+AF FTLP+ IITATTNQTPGLNIITEYIMG +YPG+P
Sbjct  470   FACEYYIEQLQLPWWGVLLACAIAFFFTLPVGIITATTNQTPGLNIITEYIMGYLYPGRP  529

Query  1581  IANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLL  1760
             +AN+CFK YGY+SM+QA+ FL DFKLGHYMKIPPR+MF+ Q +GTLIA  + +  AWWL+
Sbjct  530   VANMCFKVYGYISMSQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAFVYIGTAWWLM  589

Query  1761  HSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
              ++ NIC+ + L  +SPWTCP D VF+DASVIWGL+ P+RIF   G Y+A+NWFFLGG +
Sbjct  590   ETVPNICNTELLPRDSPWTCPGDHVFYDASVIWGLISPRRIFGDLGTYSAVNWFFLGGAI  649

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
              P++VWL H+ FP QSWI LIN+PVL+GATG+MPPAT++NY++WILVG +  + V+RYR+
Sbjct  650   APLLVWLAHKAFPGQSWILLINMPVLIGATGNMPPATAVNYTTWILVGFLSGYVVYRYRR  709

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV  2297
              WW+R+NY+LS  LDAG+AFMAVL+Y  +GLE+ +++WWG  DL+ C LASCPTAKGI V
Sbjct  710   DWWERHNYLLSGALDAGLAFMAVLIYLCLGLENISLNWWG-NDLDGCPLASCPTAKGIVV  768

Query  2298  DGCPVF  2315
             +GCPV+
Sbjct  769   EGCPVY  774



>ref|XP_008390299.1| PREDICTED: oligopeptide transporter 7 isoform X1 [Malus domestica]
Length=757

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/725 (59%), Positives = 566/725 (78%), Gaps = 18/725 (2%)
 Frame = +3

Query  147   PIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVAT  326
             P+++V LTV  TDDP+LPV TFRMWVLG +SCVLLSFLNQFF YR EPL IT+I+ Q+A 
Sbjct  48    PVKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAV  107

Query  327   LPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
             +P+G+ MA+ +     R+   GS  +F+LNPGPFN+KEHVLITIFAN+G      + YA+
Sbjct  108   VPLGQLMASKITN---RVFFKGSRWEFTLNPGPFNVKEHVLITIFANSGAG----TVYAI  160

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFR  683
              IV ++  FY+R I+FF   L+I+TTQVLG+GWAG+ ++Y+VEPA MWWP+ LVQ+SLFR
Sbjct  161   HIVTVVKVFYKRHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFR  220

Query  684   TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTA  863
              LHEKE    GG    ++R +FF+IS  CSF +Y FPGY+FQ L S+SW+CW+FP +V A
Sbjct  221   ALHEKEARPKGG----LTRTQFFLISFMCSFAYYVFPGYLFQMLTSLSWICWIFPNNVLA  276

Query  864   HQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLN  1043
              QLGSGL GLG+GA+ LDWSTI+S+L SPL  P+FA  NV  G+  +MY++ PI YW  N
Sbjct  277   QQLGSGLYGLGIGAVGLDWSTISSYLGSPLASPWFATANVAAGFFFVMYILTPICYW-FN  335

Query  1044  VYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFA  1223
             +Y AK FP++S  LFT+ GQEY+I+AI++  F LD + Y ++G +YLSTFF+++YG GFA
Sbjct  336   IYKAKTFPIFSDTLFTSDGQEYNITAIIDSNFHLDSEAYDREGPLYLSTFFAVTYGVGFA  395

Query  1224  TIASTITHVALFYGREIYDRYRASTK-GKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSL  1400
              + +T+ HVALF+GREI+++ +AS K  KMDIHT+LM+ Y  +P WWF ++L+V IAV++
Sbjct  396   ALTATVVHVALFHGREIWEQSKASFKEKKMDIHTRLMQRYNQVPEWWFVIILLVNIAVTI  455

Query  1401  ALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKP  1580
               C +  +++Q+P+WG++ A A+A +FTLPI IITA TNQTPGLNIITEYI+G IYPG P
Sbjct  456   FSCQYYIEQLQLPWWGVLLACAIAIVFTLPIGIITAITNQTPGLNIITEYIIGYIYPGYP  515

Query  1581  IANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLL  1760
             +AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR+MF+ Q +GTLIA  + +S AWWL+
Sbjct  516   VANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLSTAWWLM  575

Query  1761  HSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILG  1940
              +I +IC     ++S WTCPSD+VF+DASVIWGL+GP+RIF   G Y A+NWFFL G + 
Sbjct  576   ETIPDICED---TSSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGIYEAINWFFLVGAIA  632

Query  1941  PVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKK  2120
             P+ VWL  + FP Q WI LIN+PVL+GATG MPPAT++NY+SWI++G +  F V+RYR +
Sbjct  633   PIFVWLAAKAFPQQEWIRLINMPVLIGATGYMPPATAVNYTSWIILGFLSGFVVYRYRPE  692

Query  2121  WWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVD  2300
             WW+R+NY+LS  LDAG+AFM VLLYF++GLED ++SWWG  DL+ C LA+CPTAKG+ V+
Sbjct  693   WWRRHNYVLSGALDAGLAFMGVLLYFSLGLEDISLSWWG-NDLDGCPLATCPTAKGVVVE  751

Query  2301  GCPVF  2315
             GCP++
Sbjct  752   GCPIY  756



>ref|XP_008806360.1| PREDICTED: oligopeptide transporter 7-like [Phoenix dactylifera]
Length=766

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/726 (58%), Positives = 557/726 (77%), Gaps = 14/726 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIE+V LTV   DDP++PV TFRMWVLG +SC LLSFLNQFF YR+EPL ITSI+ Q+A
Sbjct  53    SPIEQVALTVPVGDDPSVPVLTFRMWVLGTISCALLSFLNQFFWYRKEPLSITSISAQIA  112

Query  324   TLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
              +P+G  MA  +    F   G    +F+LNPGPFN+KEHVLITIFAN+G      S YA+
Sbjct  113   VVPLGHLMARTITDRVF-FKG-RRWEFTLNPGPFNIKEHVLITIFANSGAG----SVYAI  166

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFR  683
              +V  +  FYR+ I+FF   L+++TTQVLG+GWAG+ ++Y+VEPA MWWP  LVQ+SLFR
Sbjct  167   HVVTAVKIFYRQHITFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPYNLVQVSLFR  226

Query  684   TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTA  863
              LHEKE     G    ++R +FF+++  CSF +Y FPGY+F  L S+SW+CW+FP+S+ A
Sbjct  227   ALHEKEARPKHG----LTRNQFFMVAFICSFGYYVFPGYLFSMLTSLSWICWIFPRSILA  282

Query  864   HQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLN  1043
              QLGSGL GLG+GA+ LDWSTI+S+L SPL  P+FA  NV  G+ +IMY++ P +YW LN
Sbjct  283   QQLGSGLYGLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFVLIMYVITPTAYW-LN  341

Query  1044  VYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFA  1223
             +Y AK FP++S  LF++ GQ Y+IS+I++  F LD D Y K+G +YLSTFF+++YG GFA
Sbjct  342   LYKAKTFPIFSDGLFSSTGQSYNISSIIDSNFHLDVDAYEKEGPLYLSTFFAVTYGVGFA  401

Query  1224  TIASTITHVALFYGREIYDRYRAS-TKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSL  1400
             ++ + ++HV LF+GREI+   +++  + KMD+HT+LM+ YK +P WWF  +LV  +A+++
Sbjct  402   SLTAIVSHVLLFHGREIWQMSKSAFQEKKMDVHTRLMRQYKQVPQWWFICILVANVALTI  461

Query  1401  ALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKP  1580
               C +  D++Q+P+WG++ A  LA  FTLPI IITATTNQTPGLNIITEYIMG +YPG+P
Sbjct  462   FACEYYIDQLQLPWWGVLLACGLAIFFTLPIGIITATTNQTPGLNIITEYIMGYLYPGRP  521

Query  1581  IANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLL  1760
             +AN+CFK YGY+SMTQA+ FL DFKLGHYMKIPPR+MF+ Q +GTLIA  + +  AWWL+
Sbjct  522   VANMCFKVYGYISMTQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLGTAWWLM  581

Query  1761  HSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
              +I NIC  + L S+SPWTCPSD VFFDASVIWGL+GP+RIF   G Y+A+NWFFL G +
Sbjct  582   DTIPNICDTELLSSDSPWTCPSDHVFFDASVIWGLIGPRRIFGDLGTYSAINWFFLAGAI  641

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
              P+++WL H+ FP + WI LIN+PVL+GAT  MPPAT+ NY++WI+VG +  F V+RYR+
Sbjct  642   APLLIWLAHKAFPKKQWISLINMPVLIGATHKMPPATAANYATWIIVGFLSGFVVYRYRR  701

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV  2297
              WWQR+NY+LS  LD+G+AFMAVLLY  +GLED ++ WWG  DL+ C LASCPTAKG+ V
Sbjct  702   DWWQRHNYVLSGALDSGLAFMAVLLYLCLGLEDVSLKWWG-NDLDGCSLASCPTAKGVVV  760

Query  2298  DGCPVF  2315
             DGCPVF
Sbjct  761   DGCPVF  766



>ref|XP_003555686.1| PREDICTED: oligopeptide transporter 7 [Glycine max]
Length=749

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/755 (58%), Positives = 574/755 (76%), Gaps = 28/755 (4%)
 Frame = +3

Query  87    EIEAPALKLAGED----------VNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVV  236
             EI+ P L    E+            +EE SPI++V LTV  TDDP+LPV TFRMWVLG +
Sbjct  10    EIKTPLLSSNKEEDEVGSSTSHRQQNEENSPIKQVALTVPTTDDPSLPVLTFRMWVLGTL  69

Query  237   SCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSG-QFSLN  413
             SCVLLSFLNQFF YR +PL IT+I+ Q+A +P+G+ MAA +     R+   G+  +F+LN
Sbjct  70    SCVLLSFLNQFFWYRIQPLTITAISAQIAVVPLGQLMAATITK---RVFFRGTRWEFTLN  126

Query  414   PGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLG  593
             PGPFN+KEHVLITIFAN+G      + YA+ +V  +  FY + ISFF   L++ITTQVLG
Sbjct  127   PGPFNVKEHVLITIFANSGAG----TVYAIHVVTAVKIFYHKHISFFVSLLVVITTQVLG  182

Query  594   YGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCS  773
             +GWAG+ ++Y+VEPA MWWP+ LVQ+SLFR LHEK+E   GG    ++R++FFVI+  CS
Sbjct  183   FGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKDERPKGG----LTRSQFFVIAFLCS  238

Query  774   FCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPL  953
             F +Y FPGYIFQ L S+SW+CW++P +V A QLGSGLNGLG+GA+ LDWSTI+S+L SPL
Sbjct  239   FAYYVFPGYIFQMLTSLSWICWLYPNNVLAQQLGSGLNGLGIGAIGLDWSTISSYLGSPL  298

Query  954   VCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNK  1133
               P+FA  NV VG+  +MY++ P+ YW L++YNAK FP++S +LFT +GQ Y+I+AI++ 
Sbjct  299   ASPWFATANVAVGFVFVMYVLTPLCYW-LDLYNAKTFPIFSDELFTEKGQVYNITAIIDS  357

Query  1134  QFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGK-M  1310
              F LD   Y +QGR+Y+STFF+++YG GFA + +TI HVALF+GREI+++ ++S K K +
Sbjct  358   NFHLDLAAYERQGRLYISTFFAMTYGVGFAALTATIMHVALFHGREIWEQSKSSFKEKSV  417

Query  1311  DIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLP  1490
             DIHTKLM+ YK +P WWF  +L+ TIA ++  C + ND++Q+P+WG++ A A+A  FTLP
Sbjct  418   DIHTKLMRRYKQVPEWWFVCILMATIAATVFTCEYYNDQLQLPWWGVLLACAIAIFFTLP  477

Query  1491  ISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYM  1670
             I IITA TNQ+PGLNIITEYI+G IYPG P+AN+CFK YGY+SMTQAI FL DFKLGHYM
Sbjct  478   IGIITAITNQSPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYM  537

Query  1671  KIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASV  1850
             KIPPR+MF+ Q +GTL+AG + +  AWWL+ +I +IC   K ++S WTCPSD VF+DASV
Sbjct  538   KIPPRTMFMGQVVGTLVAGFVYLGTAWWLMETIPDIC---KDTSSVWTCPSDTVFYDASV  594

Query  1851  IWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATG  2030
             IWGL+GP+RIF   G Y  +NWFFLGG + P++VWL  R FP Q WI LIN+PVL+GATG
Sbjct  595   IWGLIGPRRIFGDLGTYEKVNWFFLGGAIAPLLVWLAARSFPQQEWIRLINMPVLIGATG  654

Query  2031  SMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGL  2210
              MPPAT++NY+SWI+ G +  F VFRY+ +WW+R+NY+LS  LDAG+AFM VLLY  +GL
Sbjct  655   MMPPATAVNYTSWIIAGFLSGFVVFRYKPEWWKRHNYVLSGALDAGLAFMGVLLYLCLGL  714

Query  2211  EDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             ED +++WWG  DL+ C LA CPTAK + V GC VF
Sbjct  715   EDISLNWWG-NDLDGCTLAHCPTAKVVEVQGCAVF  748



>ref|XP_004245468.1| PREDICTED: oligopeptide transporter 7-like [Solanum lycopersicum]
Length=749

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/729 (58%), Positives = 562/729 (77%), Gaps = 14/729 (2%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
             +++E SP+E+V LTV  TDDP+LPV TFRMW LG VSCVLLSFLNQFF YR EPL IT+I
Sbjct  32    DEDENSPVEQVALTVPTTDDPSLPVLTFRMWFLGTVSCVLLSFLNQFFWYRTEPLTITAI  91

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgng  488
             + Q+A +P+G+ MAA +    F + G    +FSLNPGPFN+KEHVLITIFAN+G      
Sbjct  92    SAQIAVVPLGQLMAAKITKRVF-LQG-SKWEFSLNPGPFNVKEHVLITIFANSGAG----  145

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
             + YA+ +V  +  FY++ I+FF   ++IITTQVLG+GWAG+ +KY+VEPA MWWPS LVQ
Sbjct  146   TVYAIHVVTAVKVFYKKDITFFVSLIVIITTQVLGFGWAGIFRKYLVEPAAMWWPSNLVQ  205

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +SLFR LHEKEE   GG    ++R +FF+++  CSF +Y FPGY+F  L S+SW+CW+FP
Sbjct  206   VSLFRALHEKEERCKGG----LTRTQFFIVAFICSFAYYIFPGYLFSMLTSLSWICWIFP  261

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
             KSV A QLGSGL GLG+GA+ LDWS+I+S+L SPL  P+FA  NV  G+  +MY++ PI 
Sbjct  262   KSVFAQQLGSGLKGLGIGAIGLDWSSISSYLGSPLASPWFATANVAAGFIFVMYVLTPIC  321

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             YW L+++ AK FP++S ++FT+ GQ Y+IS+I++  F LD D Y +QG +YLSTFF+++Y
Sbjct  322   YW-LDIFKAKTFPIFSDEMFTSNGQVYNISSIIDSNFHLDVDAYERQGHLYLSTFFAVTY  380

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTKG-KMDIHTKLMKNYKDIPSWWFYVLLVVT  1385
             G GFA +++T+ HV LF+GREI+++ ++S K  KMDIHT+LM  Y  +P WWF+ +LV  
Sbjct  381   GVGFAALSATVMHVLLFHGREIWEQSKSSFKDQKMDIHTRLMSKYNQVPEWWFWCILVAN  440

Query  1386  IAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGII  1565
             I +++  C + N+++Q+P+WG+I A  +AF FTLPI IITA TNQTPGLN+ITEYI+G +
Sbjct  441   ITLTIFACEYYNEQLQLPWWGVILACVIAFFFTLPIGIITAITNQTPGLNVITEYIIGYL  500

Query  1566  YPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSV  1745
             YPG P+AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR MF+ Q +GTLIAG + +  
Sbjct  501   YPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRIMFMAQVVGTLIAGFVYLGT  560

Query  1746  AWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             AWWL+ +I +IC +  LSN+ WTCPSD VF+DASVIWGL+ P+RIF   G Y  +NWFFL
Sbjct  561   AWWLMETIPDICDK-TLSNTVWTCPSDHVFYDASVIWGLIAPRRIFGDLGTYGMVNWFFL  619

Query  1926  GGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVF  2105
              G + PV+VWL  R FP Q WI LIN+PVL+GATG MPPAT++NY++WI+VG +  F V+
Sbjct  620   FGAIAPVLVWLAARAFPKQEWIKLINMPVLIGATGMMPPATAVNYTTWIIVGFLSGFVVY  679

Query  2106  RYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAK  2285
             RYR  WWQR+NY+LS  LDAG+AFMAVL+Y  +GLE+ TI+WWG  DL+ C  A+CPTA+
Sbjct  680   RYRPDWWQRHNYVLSGALDAGLAFMAVLIYLCLGLENITINWWG-NDLDGCPYAACPTAR  738

Query  2286  GIAVDGCPV  2312
             GI ++GCPV
Sbjct  739   GIVIEGCPV  747



>ref|XP_008437437.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7 [Cucumis 
melo]
Length=752

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/733 (59%), Positives = 561/733 (77%), Gaps = 17/733 (2%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
             E    +E SPI +V LTV  +DDP+LPV TFRMW LG +SCVLLSFLNQFF YR+EPL I
Sbjct  35    EISESDENSPIPQVALTVPTSDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRKEPLSI  94

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
             T+I+ Q+A +P+GR MA+ +    F+   +   +FSLNPGPFN+KEHVLITIFAN+G   
Sbjct  95    TAISAQIAVVPLGRLMASKITDRVFKGKRW---EFSLNPGPFNVKEHVLITIFANSGAG-  150

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
                S YA+ +V ++  FY++ ++FF   ++++TTQVLG+GWAG+ +KY+VEPA MWWP+ 
Sbjct  151   ---SVYAIHVVTVVKTFYKQHLTFFVSLIVVVTTQVLGFGWAGIFRKYLVEPAAMWWPAN  207

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR LHEKEE   G     +SR +FFVI+  CSF +Y FPGY+FQ L S+SWVCW
Sbjct  208   LVQVSLFRALHEKEERSKGS----LSRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWVCW  263

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
             +FP S+ A QLGSGL GLGLG++ LDWSTI+S+L SPL  P+FA  NV VG+  IMY++ 
Sbjct  264   IFPTSILAQQLGSGLYGLGLGSIGLDWSTISSYLGSPLASPWFATANVAVGFGFIMYILT  323

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             PI YW  NVY A+ FP++S  LFT +G +Y+IS+I++  F LD   Y  QGR+Y+STFF+
Sbjct  324   PICYW-FNVYKAQTFPIFSDGLFTGKGHKYNISSIIDPNFHLDFAAYETQGRLYISTFFA  382

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRAS-TKGKMDIHTKLMKNYKDIPSWWFYVLL  1376
             ++YG GFA +++TI HVALF+GREI+++ ++S  + KMDIHTKLM  YK +P WWF ++L
Sbjct  383   VTYGVGFAALSATIVHVALFHGREIWEQSKSSFEEKKMDIHTKLMSKYKQVPEWWFVLIL  442

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
             +  IA+++  C + ND++Q+P+WG++ A ++A  FTLPI IITA TNQ PGLNIITEYI+
Sbjct  443   LGNIALTIFACEYYNDQLQLPWWGVLLACSIAVFFTLPIGIITAITNQAPGLNIITEYII  502

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             G IYPG P+AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR+MF+ Q +GTLIA  + 
Sbjct  503   GYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIASLVY  562

Query  1737  MSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNW  1916
             +  AWWLL +I +IC     S S WTCPSDRVF+DASVIWGL+GP+RIF   G Y ++NW
Sbjct  563   LGTAWWLLETIPDICSS---SQSFWTCPSDRVFYDASVIWGLIGPRRIFGDLGYYASVNW  619

Query  1917  FFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNF  2096
             FFL G + PV+VWL  + FP   WI LIN+PVL+GATG MPPAT++NY +WIL+G +  F
Sbjct  620   FFLVGAIAPVLVWLAIKAFPQHEWIKLINMPVLIGATGYMPPATAVNYITWILMGFLSGF  679

Query  2097  FVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCP  2276
              V+RY+ +WW+R+NY+LS  LDAG+AFM VLLYFT+GL++ T+ WWG  DL+ C LA CP
Sbjct  680   VVYRYKPEWWRRHNYVLSGALDAGLAFMGVLLYFTLGLQETTLDWWG-NDLDGCPLAQCP  738

Query  2277  TAKGIAVDGCPVF  2315
             TA GIAV+GCP+F
Sbjct  739   TAPGIAVEGCPLF  751



>emb|CDP12213.1| unnamed protein product [Coffea canephora]
Length=763

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/768 (57%), Positives = 574/768 (75%), Gaps = 40/768 (5%)
 Frame = +3

Query  87    EIEAPALKLAGEDVNDEEV------------------------SPIEEVRLTVTNTDDPT  194
             EI AP +    ED+ND++V                        SPI +V LTV  TDDP+
Sbjct  8     EIRAPLIISKDEDINDDDVYAISSSKSNEVHHVYDEEEEEEENSPIPQVALTVPTTDDPS  67

Query  195   LPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKF  374
             LPV TFRMWVLG +SC+LLSFLNQFF YR EPL IT+I+ QVA +P+G+ MAA LP   F
Sbjct  68    LPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTITAISAQVAVVPLGQLMAAKLPKGAF  127

Query  375   RIPGFGSG-QFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISF  551
                  GS  +FSLNPGPFN+KEHVLITIFAN+G      + YA+ IV ++ AFY+R I+F
Sbjct  128   FK---GSRWEFSLNPGPFNVKEHVLITIFANSGAG----TVYAIHIVTVVKAFYKRHITF  180

Query  552   FAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrr  731
             F   ++++TTQVLG+GWAG+ ++Y+VEPA MWWP+ LVQ+SLFR LHEKEE   GG    
Sbjct  181   FVSLIVVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGG----  236

Query  732   MSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgalt  911
             ++R +FF+I+   SF +Y FPGY+FQ L S+SW+CW+FP S+ A QLGSGLNGLG+GA+ 
Sbjct  237   VTRTQFFLIAFISSFAYYVFPGYLFQMLTSLSWLCWIFPTSILAQQLGSGLNGLGIGAIG  296

Query  912   lDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFT  1091
             LDWSTI+S+L SPL  P+FA  NV  G+ ++MY++ P++YW L++Y AK FP++S +LF 
Sbjct  297   LDWSTISSYLGSPLASPWFATANVAAGFVLVMYVLTPLAYW-LDLYKAKTFPIFSDELFN  355

Query  1092  AQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGRE  1271
             A+GQ YDI+AI++  F LD   Y +QG +YLSTFF+++YG GFA + +TITHV LF+G E
Sbjct  356   ARGQVYDIAAIIDSNFHLDIAAYERQGPLYLSTFFAMTYGIGFAALTATITHVCLFHGSE  415

Query  1272  IYDRYRASTK-GKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWG  1448
             I+++ ++S K  KMDIHT+LM  Y  +P WWF+ +LV  IA+++ +C + N+++Q+P+WG
Sbjct  416   IWEQSKSSFKEKKMDIHTRLMSKYNQVPEWWFWCILVANIALAIFVCEYYNEQLQLPWWG  475

Query  1449  LIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQ  1628
             ++ A  +A  FTLPI IITA TNQ+PGLNIITEYI+G IYPG P+AN+CFK YGY+SM+Q
Sbjct  476   VLLACLIAIFFTLPIGIITAITNQSPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMSQ  535

Query  1629  AIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSP  1808
             AI FL DFKLGHYMK+PPR+MF+ Q +GTLIA  + +  AWWLL +I +IC     S S 
Sbjct  536   AITFLQDFKLGHYMKVPPRTMFMAQVVGTLIAAIVYLGTAWWLLETIPDICETTS-SQSV  594

Query  1809  WTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSW  1988
             WTCP DRVF+DASVIWGL+GP+RIF   G Y  +NWFFLGG + P++VWL  R FP+Q W
Sbjct  595   WTCPGDRVFYDASVIWGLIGPRRIFGDLGTYAMVNWFFLGGAIAPLLVWLAARAFPNQHW  654

Query  1989  IPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAG  2168
             I LIN+PVL+GATGSMPPAT++NY++WI+VG +  +  +RYR + W+R+NY+LS  LDAG
Sbjct  655   IKLINMPVLIGATGSMPPATAVNYTTWIIVGFLSGYVWYRYRPESWRRFNYVLSGALDAG  714

Query  2169  VAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPV  2312
             +AFM VLLY  +GLED ++SWWG  DL+ C  A+CPTAKG+ V+GCPV
Sbjct  715   LAFMGVLLYMALGLEDISLSWWG-NDLDGCPYATCPTAKGVVVEGCPV  761



>ref|XP_010422002.1| PREDICTED: oligopeptide transporter 7 [Camelina sativa]
Length=769

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/726 (59%), Positives = 563/726 (78%), Gaps = 17/726 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPI +V LTV  TDDP+LPV TFRMWVLG +SC+LLSFLNQFF YR EPL I++I+ Q+A
Sbjct  58    SPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQIA  117

Query  324   TLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIfanagfafgngSAYA  500
              +P+GR MAA +     R+   GS  QF+LNPGPFN+KEHVLITIFANAG      S YA
Sbjct  118   VVPLGRLMAAKISE---RVYFQGSKWQFTLNPGPFNVKEHVLITIFANAGAG----SVYA  170

Query  501   VGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLF  680
             + +V ++ AFY + I+FF  +L+I+TTQVLG+GWAG+ +KY+VEPA MWWP+ LVQ+SLF
Sbjct  171   IHVVTVVKAFYMKNITFFVSFLVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLF  230

Query  681   RTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVT  860
             R LHEKEE   GG    ++R +FFVI+  CSF +Y FPGY+FQ + S+SWVCW FP SV 
Sbjct  231   RALHEKEERTKGG----LTRTQFFVIAFVCSFAYYVFPGYLFQIMTSLSWVCWFFPSSVM  286

Query  861   AHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGL  1040
             A Q+GSGL+GLG+GA+ LDWSTI+S+L SPL  P+FA  NV VG+ +++Y+++PI YW L
Sbjct  287   AQQIGSGLHGLGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLVIYVLVPICYW-L  345

Query  1041  NVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGF  1220
             +V+ AK FP++SS LFT QG +Y+I++I++  F LD   Y ++G +YLSTFF++SYG GF
Sbjct  346   DVFKAKTFPIFSSSLFTEQGSKYNITSIIDSNFHLDLPAYEREGPLYLSTFFAISYGVGF  405

Query  1221  ATIASTITHVALFYGREIYDRYRASTK-GKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVS  1397
             A +++TI HVALF+GREI+++ + S K  K+D+H +LMK YK +P WWF+ +LV  IA +
Sbjct  406   AALSATIMHVALFHGREIWEQSKESFKEKKLDVHARLMKRYKQVPEWWFWCILVTNIAAT  465

Query  1398  LALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGK  1577
             +  C + ND++Q+P+WG++ A  +A +FTLPI IITA TNQ PGLNIITEYI+G IYPG 
Sbjct  466   IFACEYYNDQLQLPWWGVLLACTIAIIFTLPIGIITAITNQAPGLNIITEYIIGYIYPGY  525

Query  1578  PIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWL  1757
             P+AN+CFK YGY+SM QAI FL DFKLGHYMKIPPR+MF+ Q +GTLI+  + ++ AWWL
Sbjct  526   PVANMCFKVYGYISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCLVYLTTAWWL  585

Query  1758  LHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
             + +I NIC  D +SNS WTCPSD+VF+DASVIWGL+GP+RIF   G Y ++NWFFL G +
Sbjct  586   METIPNIC--DTVSNSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAI  643

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
              P++VWL  R FP Q WI LIN+PVL+ AT SMPPAT++NY++W+L G +  F VFRYR 
Sbjct  644   APILVWLASRMFPRQEWIKLINMPVLISATSSMPPATAVNYTTWVLAGFLSGFVVFRYRP  703

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV  2297
               WQRYNY+LS  LDAG+AFM VLLY  +GLE+ ++ WWG  +L+ C LASCPTA GI+V
Sbjct  704   NLWQRYNYVLSGALDAGLAFMGVLLYMCLGLENVSLDWWG-NELDGCPLASCPTAPGISV  762

Query  2298  DGCPVF  2315
             +GCP++
Sbjct  763   EGCPLY  768



>ref|XP_002971950.1| hypothetical protein SELMODRAFT_148240 [Selaginella moellendorffii]
 gb|EFJ26867.1| hypothetical protein SELMODRAFT_148240 [Selaginella moellendorffii]
Length=740

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/734 (59%), Positives = 561/734 (76%), Gaps = 25/734 (3%)
 Frame = +3

Query  117   GEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLI  296
             G+ +++EE SPIEEV LTV  TDD +LPV+TFRMW LG++SC LL+F+NQFFSYR EPL 
Sbjct  27    GDKLSEEEQSPIEEVALTVPTTDDASLPVYTFRMWTLGLLSCALLAFINQFFSYRTEPLT  86

Query  297   ITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfa  476
             +  I+ Q+A LP+GR MAAALP+A+ R+ G     FSLNPGPFN+KEHVLITIFANAG  
Sbjct  87    VGVISAQIAALPLGRLMAAALPSAQLRLLG---RSFSLNPGPFNVKEHVLITIFANAGAG  143

Query  477   fgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPS  656
                  AYA+GIVNI+ AFY R++SF      +IT    GYGWAG+ ++Y+V+PA MWWPS
Sbjct  144   ----GAYAIGIVNIVKAFYGRELSF------VIT----GYGWAGIFRRYLVDPAEMWWPS  189

Query  657   TLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVC  836
              LVQ+S+F TLHEK+    G     ++R +FF+I+L CSF +Y  PGY+F+TL SISWVC
Sbjct  190   NLVQVSIFNTLHEKDSRRKGD----VTRLQFFLITLACSFLYYSLPGYLFKTLTSISWVC  245

Query  837   WVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLV  1016
             W +PKSV AHQLGSG++G+G+GA+  DWST+AS+LSSPL  P+FAI NV VG+ I+MY++
Sbjct  246   WAWPKSVLAHQLGSGMSGMGIGAVGFDWSTVASYLSSPLATPWFAIANVMVGFLIVMYVI  305

Query  1017  MPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFF  1196
              P +Y+  NVY+AK FP++SS LF   G  Y+IS +VN++FELD   Y    ++ LSTFF
Sbjct  306   TPAAYFS-NVYSAKTFPIFSSQLFADDGSRYNISRVVNERFELDVQAYNSYSKLNLSTFF  364

Query  1197  SLSYGFGFATIASTITHVALFYGREIYDRYRASTKG-KMDIHTKLMKNYKDIPSWWFYVL  1373
               +YG GFA + +T++HV LF+G+E++ R  A+    K+D+HT+LM+ YK  P WWF  L
Sbjct  365   VFTYGVGFAALTATVSHVVLFHGKEMWSRAVAAFHAEKLDVHTRLMRKYKPCPQWWFLAL  424

Query  1374  LVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYI  1553
             L ++I  S+  C+   D+VQ+P+WG++ A  LAF+FTLPI +ITATTNQTPGLN+ITE+I
Sbjct  425   LALSIFGSIITCVVFKDQVQLPWWGVLLACGLAFVFTLPIGVITATTNQTPGLNVITEFI  484

Query  1554  MGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTI  1733
             +G +YPG+P+ANVCFKTYGY+SM QAI FL+DFKLGHYMKIPPRSMF VQ IGT +A  +
Sbjct  485   IGYMYPGRPVANVCFKTYGYISMLQAITFLADFKLGHYMKIPPRSMFTVQIIGTAVAALV  544

Query  1734  NMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNAL  1910
             N+  AWWLL S++NICH DKL   SPWTCPSDRVFF ASVIWGL+GP RIF S G+Y A+
Sbjct  545   NLGTAWWLLTSVDNICHTDKLPQGSPWTCPSDRVFFSASVIWGLIGPNRIFGSLGHYQAI  604

Query  1911  NWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIF  2090
             NWFFL G + P++VWL  + FP Q WI  +N+P+L+GATG+MPPATS+NY+SW +VG IF
Sbjct  605   NWFFLVGAVAPLLVWLAAKAFPRQRWIRYVNMPILIGATGNMPPATSVNYTSWFVVGFIF  664

Query  2091  NFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLAS  2270
             N+ +F++RKKWW RYNY+LSA +DAG+AFM + LYF    +   ++WWG  D+++C LAS
Sbjct  665   NYLIFKHRKKWWTRYNYVLSAAMDAGLAFMGIFLYFATREDRMELAWWG-QDVDNCPLAS  723

Query  2271  CPTAKGIAVDGCPV  2312
             CP AKG     CP+
Sbjct  724   CPAAKGARSSDCPL  737



>ref|XP_006476310.1| PREDICTED: oligopeptide transporter 7-like isoform X2 [Citrus 
sinensis]
Length=731

 Score =   859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/733 (58%), Positives = 558/733 (76%), Gaps = 18/733 (2%)
 Frame = +3

Query  126   VNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITS  305
             V +EE SP+++V LTV+  DD  LPV TFRMWVLG +SCVLLSFLNQFF YR EPL IT+
Sbjct  13    VEEEENSPVKQVALTVSTEDDSCLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITA  72

Query  306   ITVQVATLPIGRFMAAALPAAKFRIPGFGSG--QFSLNPGPFNMKEHVLITIfanagfaf  479
             I+ Q+A +P+G+ MAA L    F    F S   +F+LNPGPFN+KEHVLITIFAN+G   
Sbjct  73    ISAQIAVVPLGQLMAAKLTDRVF----FKSTPLEFTLNPGPFNVKEHVLITIFANSGAG-  127

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
                S YA+ IV ++  FY++  +FF   L++ TTQVLG+GWAG+ ++Y+VEPA MWWP+ 
Sbjct  128   ---SVYAIHIVTVVKVFYKQHFTFFVSLLVVFTTQVLGFGWAGIFRRYLVEPAAMWWPAN  184

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR LHE+E+   GG    ++R +FF+I   CSF +Y FPGY+ + L S+SW+CW
Sbjct  185   LVQVSLFRALHEREKRASGG----VTRTQFFMIGFVCSFAYYVFPGYLLEMLTSLSWICW  240

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
             +FPKSV A Q+GSGL GLG+ A+ +DWSTI+S+L SPL  P+FA  NV  G+ ++MY++ 
Sbjct  241   IFPKSVVAQQVGSGLFGLGVAAVGIDWSTISSYLGSPLASPWFATANVAAGFVLVMYVLT  300

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             P+ YW LN+YNAK FP++S  LFT  G+EY+I+AI++  F +D   Y ++G +YLS FF+
Sbjct  301   PLCYW-LNIYNAKTFPIFSDQLFTTTGREYNITAIIDSNFHIDIAAYQREGPLYLSIFFA  359

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGK-MDIHTKLMKNYKDIPSWWFYVLL  1376
             ++YG GFA + +TI HVALF+GREI+++ RAS + K +DIHTKLM+ YK +P  WF ++L
Sbjct  360   MTYGLGFAALTATIVHVALFHGREIWEQSRASFQEKGIDIHTKLMRKYKRVPESWFVIIL  419

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
             ++ IA ++  C + ND++Q+P+WG++ A A+A  FTLPI IITA TNQTPGLNIITEYI+
Sbjct  420   LINIAATVFACEYYNDQLQLPWWGVLLACAIAITFTLPIGIITAITNQTPGLNIITEYII  479

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             G +YPG P+AN+CFK YGY+SMTQA+ FL DFKLGHYMKIPPR+MF+ Q +GT+IA  + 
Sbjct  480   GYVYPGYPVANMCFKVYGYISMTQAVTFLQDFKLGHYMKIPPRTMFMAQIVGTVIACFVY  539

Query  1737  MSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNW  1916
             +  AWWL+ SI +IC   K +NS WTCPSD+VF+DASVIWGL+GP+RIF   G Y A+NW
Sbjct  540   LGTAWWLMESITDIC-DTKAANSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGTYEAINW  598

Query  1917  FFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNF  2096
             FFL G + P +VWL  + FP+Q WI LIN+PVL+GAT  MPPAT++NY++WI+ G +  F
Sbjct  599   FFLAGAIAPSLVWLGSKAFPNQEWITLINMPVLIGATAMMPPATAVNYTTWIVAGFLSGF  658

Query  2097  FVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCP  2276
              V+RYR   WQRYNY+LS  LDAG+AFM VLLY  +GLED T+ WWG  DL+ C  A+CP
Sbjct  659   VVYRYRPDLWQRYNYVLSGALDAGLAFMGVLLYLCLGLEDVTLDWWG-NDLDGCPYATCP  717

Query  2277  TAKGIAVDGCPVF  2315
             TA+GIAV+GCPVF
Sbjct  718   TARGIAVEGCPVF  730



>ref|XP_006476309.1| PREDICTED: oligopeptide transporter 7-like isoform X1 [Citrus 
sinensis]
Length=759

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/733 (58%), Positives = 558/733 (76%), Gaps = 18/733 (2%)
 Frame = +3

Query  126   VNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITS  305
             V +EE SP+++V LTV+  DD  LPV TFRMWVLG +SCVLLSFLNQFF YR EPL IT+
Sbjct  41    VEEEENSPVKQVALTVSTEDDSCLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITA  100

Query  306   ITVQVATLPIGRFMAAALPAAKFRIPGFGSG--QFSLNPGPFNMKEHVLITIfanagfaf  479
             I+ Q+A +P+G+ MAA L    F    F S   +F+LNPGPFN+KEHVLITIFAN+G   
Sbjct  101   ISAQIAVVPLGQLMAAKLTDRVF----FKSTPLEFTLNPGPFNVKEHVLITIFANSGAG-  155

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
                S YA+ IV ++  FY++  +FF   L++ TTQVLG+GWAG+ ++Y+VEPA MWWP+ 
Sbjct  156   ---SVYAIHIVTVVKVFYKQHFTFFVSLLVVFTTQVLGFGWAGIFRRYLVEPAAMWWPAN  212

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR LHE+E+   GG    ++R +FF+I   CSF +Y FPGY+ + L S+SW+CW
Sbjct  213   LVQVSLFRALHEREKRASGG----VTRTQFFMIGFVCSFAYYVFPGYLLEMLTSLSWICW  268

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
             +FPKSV A Q+GSGL GLG+ A+ +DWSTI+S+L SPL  P+FA  NV  G+ ++MY++ 
Sbjct  269   IFPKSVVAQQVGSGLFGLGVAAVGIDWSTISSYLGSPLASPWFATANVAAGFVLVMYVLT  328

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             P+ YW LN+YNAK FP++S  LFT  G+EY+I+AI++  F +D   Y ++G +YLS FF+
Sbjct  329   PLCYW-LNIYNAKTFPIFSDQLFTTTGREYNITAIIDSNFHIDIAAYQREGPLYLSIFFA  387

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGK-MDIHTKLMKNYKDIPSWWFYVLL  1376
             ++YG GFA + +TI HVALF+GREI+++ RAS + K +DIHTKLM+ YK +P  WF ++L
Sbjct  388   MTYGLGFAALTATIVHVALFHGREIWEQSRASFQEKGIDIHTKLMRKYKRVPESWFVIIL  447

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
             ++ IA ++  C + ND++Q+P+WG++ A A+A  FTLPI IITA TNQTPGLNIITEYI+
Sbjct  448   LINIAATVFACEYYNDQLQLPWWGVLLACAIAITFTLPIGIITAITNQTPGLNIITEYII  507

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             G +YPG P+AN+CFK YGY+SMTQA+ FL DFKLGHYMKIPPR+MF+ Q +GT+IA  + 
Sbjct  508   GYVYPGYPVANMCFKVYGYISMTQAVTFLQDFKLGHYMKIPPRTMFMAQIVGTVIACFVY  567

Query  1737  MSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNW  1916
             +  AWWL+ SI +IC   K +NS WTCPSD+VF+DASVIWGL+GP+RIF   G Y A+NW
Sbjct  568   LGTAWWLMESITDIC-DTKAANSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGTYEAINW  626

Query  1917  FFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNF  2096
             FFL G + P +VWL  + FP+Q WI LIN+PVL+GAT  MPPAT++NY++WI+ G +  F
Sbjct  627   FFLAGAIAPSLVWLGSKAFPNQEWITLINMPVLIGATAMMPPATAVNYTTWIVAGFLSGF  686

Query  2097  FVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCP  2276
              V+RYR   WQRYNY+LS  LDAG+AFM VLLY  +GLED T+ WWG  DL+ C  A+CP
Sbjct  687   VVYRYRPDLWQRYNYVLSGALDAGLAFMGVLLYLCLGLEDVTLDWWG-NDLDGCPYATCP  745

Query  2277  TAKGIAVDGCPVF  2315
             TA+GIAV+GCPVF
Sbjct  746   TARGIAVEGCPVF  758



>ref|XP_003564333.1| PREDICTED: oligopeptide transporter 7-like [Brachypodium distachyon]
Length=772

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/730 (57%), Positives = 563/730 (77%), Gaps = 14/730 (2%)
 Frame = +3

Query  132   DEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSIT  311
              EE SPIE+V LTV   DDPT PV TFRMWVLG  SCV+LSFLNQFF YR+EPL IT+I+
Sbjct  54    SEENSPIEQVALTVPVGDDPTTPVLTFRMWVLGTASCVVLSFLNQFFWYRKEPLTITAIS  113

Query  312   VQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngS  491
              Q+A +P+GR MAA LP+  F      S +F+LNPGPFN+KEHVLITIFANAG      S
Sbjct  114   AQIAVVPMGRLMAALLPSRPFF--SGTSYEFTLNPGPFNVKEHVLITIFANAGAG----S  167

Query  492   AYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQI  671
              YA+ +V  +  FY ++++FF   ++++TTQVLG+GWAG+ ++Y+VEPA MWWP+ LVQ+
Sbjct  168   VYAIHVVTAVRVFYGKELTFFVSLIVVLTTQVLGFGWAGIFRRYLVEPAAMWWPTNLVQV  227

Query  672   SLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPK  851
             SLFR LHEKE+   GG    ++R++FFV++  CSF +Y FPGY+FQ L S+SW+CW++P 
Sbjct  228   SLFRALHEKEKLSKGG----LTRSQFFVVAFVCSFAYYVFPGYLFQMLTSLSWICWLYPN  283

Query  852   SVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISY  1031
             SV A QLGSGL GLG+G + LDW++++S+L SPL  P+FA  N+ VG+  IMY+  PI+Y
Sbjct  284   SVFAQQLGSGLKGLGIGTIGLDWASVSSYLGSPLASPWFATANIAVGFLTIMYVFTPIAY  343

Query  1032  WGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYG  1211
             W  N Y A+ FP++SS LFT  G +Y+I+ IV++ F  D + Y K G +YLSTFFS++YG
Sbjct  344   W-FNFYKARNFPIFSSGLFTESGHKYNITTIVDEHFHFDTEAYEKNGPLYLSTFFSVTYG  402

Query  1212  FGFATIASTITHVALFYGREIYDRYRASTKGK-MDIHTKLMKNYKDIPSWWFYVLLVVTI  1388
              GFA++ +TI HV LF+G EI    +++ +GK +D+HTKLM+ YK +P WWF  +L+  I
Sbjct  403   VGFASLTATIVHVLLFHGSEILQLSKSAFQGKKLDVHTKLMRRYKQVPEWWFICILIANI  462

Query  1389  AVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIY  1568
             A+++  C +  +++Q+P+WG++ A A+AF FTLP+ IITATTNQTPGLNIITEYI+G +Y
Sbjct  463   AITVFACEYYIEQLQLPWWGVLLACAIAFFFTLPVGIITATTNQTPGLNIITEYIIGYLY  522

Query  1569  PGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVA  1748
             PG+P+AN+CFK YGY+SMTQA+ FL DFKLGHYMKIPPR+MF+ Q +GTLIA  + +  A
Sbjct  523   PGRPVANMCFKVYGYISMTQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAFVYLGTA  582

Query  1749  WWLLHSIENICHQDKLSN-SPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             WWL+ +I NIC+ + LS+ SPWTCP D VF+DASVIWGL+GP+RIF   G Y+A+NWFFL
Sbjct  583   WWLMDTIPNICNSELLSSGSPWTCPGDHVFYDASVIWGLIGPRRIFGDLGTYSAINWFFL  642

Query  1926  GGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVF  2105
             GG + P++VW  H+ FP+Q+WI LIN+PVL+G+T SMPPAT++NY +WI VG +  + V+
Sbjct  643   GGAIAPLLVWFAHKAFPNQTWILLINMPVLIGSTSSMPPATAVNYIAWIFVGFMSGYVVY  702

Query  2106  RYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAK  2285
             RYR+ WW+R+NY+LS  LDAG+AFMAVL+Y  +GLE+ ++ WWG  DL+ C LASCPTAK
Sbjct  703   RYRRNWWERHNYLLSGALDAGLAFMAVLIYLCLGLENISVDWWG-NDLDGCPLASCPTAK  761

Query  2286  GIAVDGCPVF  2315
             G+ V GCPV+
Sbjct  762   GVFVKGCPVY  771



>gb|EMS45133.1| Oligopeptide transporter 4 [Triticum urartu]
Length=681

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/718 (64%), Positives = 544/718 (76%), Gaps = 55/718 (8%)
 Frame = +3

Query  216   MWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGS  395
             MW +G++SC L+SFLNQFFSYR EPLI+T ITVQVA+LP+G F+A  LP  +FR P    
Sbjct  1     MWSIGLLSCALMSFLNQFFSYRTEPLIVTQITVQVASLPMGHFLARVLPRRRFRAPAALG  60

Query  396   GQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLII  575
             G   LNPGPFNMKEHVLI+IFANAG+AFGNG+AYAV IV+II AFY R ISF A WLLI 
Sbjct  61    GGEGLNPGPFNMKEHVLISIFANAGYAFGNGNAYAVMIVDIIRAFYGRSISFIAAWLLIT  120

Query  576   TTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFV  755
             TTQVLGYGWAGL++K +V     W  S L +      LHEKEE   G  +  +SR+KFF+
Sbjct  121   TTQVLGYGWAGLMRKKIVLSCATWIMSGLSEHR--GALHEKEESTKGSRQ--ISRSKFFL  176

Query  756   ISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIAS  935
             ++L CSF WY  PGY+F  L SISWVCWVF KSVTA QLGSG+ GLGLGA TLDWS ++S
Sbjct  177   VALICSFAWYVVPGYLFPALTSISWVCWVFSKSVTAQQLGSGMKGLGLGAFTLDWSAVSS  236

Query  936   FLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDI  1115
             FL SPL+ PFFA  N+FVGY   +Y+++P +YWG+N+YNAK FP++SS LF + G  Y I
Sbjct  237   FLFSPLISPFFATANIFVGYFCFLYVLVPTAYWGMNLYNAKTFPIFSSHLFMSNGSAYQI  296

Query  1116  SAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYG----------  1265
             + IVN+QF+LD + YA+ GRI LSTFF+LSYG  FATIASTITHV +FYG          
Sbjct  297   TDIVNQQFQLDTEAYARLGRINLSTFFALSYGLSFATIASTITHVGIFYGKWKIHICNWT  356

Query  1266  ---REIYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQM  1436
                REIY R+RAS + + DIHTKLM+ Y DIP+WWFY L V+++ VSL LC  L D    
Sbjct  357   PMHREIYHRFRASQQEEPDIHTKLMRKYDDIPAWWFYSLTVLSMTVSLILCTVLKD----  412

Query  1437  PYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYM  1616
                                        QTPGLN+ITEY MG+I PG PIANVCFK YGYM
Sbjct  413   ---------------------------QTPGLNVITEYAMGLIMPGYPIANVCFKVYGYM  445

Query  1617  SMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL  1796
             SM+QA+AFLSDFKLGHYMKIPPRSMF+VQF GTL+AGT+N+SVAWWLL S+ENIC QD+L
Sbjct  446   SMSQAVAFLSDFKLGHYMKIPPRSMFIVQFAGTLVAGTVNLSVAWWLLGSVENIC-QDQL  504

Query  1797  --SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRK  1970
                +SPWTCP DRVFFDASVIWGLVGPKRIF   GNY A+NWFFL G  GPVIV++ HR 
Sbjct  505   LPPDSPWTCPGDRVFFDASVIWGLVGPKRIFGPHGNYEAVNWFFLIGAAGPVIVYIFHRI  564

Query  1971  FPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILS  2150
             FPSQ WI +INLPVL+GAT +MPPAT++NY+SW+L+GTIFNFFVFRYRKKWWQRYNYILS
Sbjct  565   FPSQRWILMINLPVLIGATANMPPATAVNYNSWLLIGTIFNFFVFRYRKKWWQRYNYILS  624

Query  2151  AGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDG---CPVF  2315
             A LDAGVAFMAVLLYFT+ +E+RT++WWGT   EHC LASCPTAKG+ +     CPVF
Sbjct  625   AALDAGVAFMAVLLYFTLTMENRTVNWWGTAG-EHCPLASCPTAKGVDLGPDSVCPVF  681



>ref|XP_004502063.1| PREDICTED: oligopeptide transporter 7-like [Cicer arietinum]
Length=740

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/743 (58%), Positives = 562/743 (76%), Gaps = 17/743 (2%)
 Frame = +3

Query  87    EIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQ  266
              I +P L    ED   EE SPI++V LTV  TDDP+LPV TFRMWVLG +SCVLLSFLNQ
Sbjct  12    SITSPLLS-KEEDEKLEENSPIKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQ  70

Query  267   FFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVL  446
             FF YR EPL IT+I+ Q+A +P+G+ MA+ +    F   G  S +F+LNPGPFN+KEHVL
Sbjct  71    FFWYRTEPLTITAISAQIAVVPLGQLMASKITKRVF-FKG-TSWEFTLNPGPFNVKEHVL  128

Query  447   ITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYV  626
             ITIFAN+G      + YA+ IV  +  FY + ISF    L++ITTQVLG+GWAG+ ++Y+
Sbjct  129   ITIFANSGAG----TVYAIHIVTAVKVFYHKHISFSVSLLVVITTQVLGFGWAGIFRRYL  184

Query  627   VEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIF  806
             VEPA MWWP+ LVQ+SLFR LHEKEE   GG    ++R++FFVI+  CSF +Y FPGYIF
Sbjct  185   VEPAAMWWPANLVQVSLFRALHEKEERPKGG----LTRSQFFVIAFFCSFAYYVFPGYIF  240

Query  807   QTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVF  986
             Q L S+SW+CW+FP SV AHQLGSGLNGLG+GA+ LDWS I+++L SPL  P+FA  NV 
Sbjct  241   QMLTSLSWICWIFPNSVLAHQLGSGLNGLGIGAIGLDWSAISAYLGSPLASPWFATANVA  300

Query  987   VGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAK  1166
              G+  +MY++ P+ YW  N+YNAK FP++S+ LFT++G  Y+I+ I++  F LD   Y +
Sbjct  301   AGFVFVMYILTPLCYW-FNIYNAKTFPIFSNKLFTSKGHVYNITDIIDSNFHLDHAAYER  359

Query  1167  QGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGK-MDIHTKLMKNYK  1343
             QGR+YLSTFF+++YG GFA + +TI HVALF+GREI+++ ++S   K MDIHTKLM+ Y 
Sbjct  360   QGRLYLSTFFAMTYGVGFAALTATIVHVALFHGREIWEQSKSSFNEKSMDIHTKLMRKYN  419

Query  1344  DIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQT  1523
              +P WWF  +L+ TIA ++  C + N+++Q+P+WG++ A ++A  FTLPI IITA TNQ+
Sbjct  420   QVPEWWFVCILIATIATTVFACEYYNEQLQLPWWGVLLACSIAIFFTLPIGIITAITNQS  479

Query  1524  PGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQ  1703
             PGLNIITEYI+G IYPG P+AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR+MF+ Q
Sbjct  480   PGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQ  539

Query  1704  FIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIF  1883
              +GTLIA  + +S AWWLL SI +IC   K ++S WTCP D VF+DASVIWGL+GP+RIF
Sbjct  540   VVGTLIAALVYLSTAWWLLGSIPDIC---KDTSSVWTCPGDTVFYDASVIWGLIGPRRIF  596

Query  1884  DSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYS  2063
                G Y  +NWFFLGG + P++V+L  R FP Q WI LIN+PVL+GATG MPPAT++NY+
Sbjct  597   GDLGTYEKINWFFLGGAIAPLLVYLATRAFPEQEWIKLINMPVLIGATGMMPPATAVNYT  656

Query  2064  SWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTT  2243
             SWI+VG +  F V+RY+  WW+R+NY+LS  LDAG+AFM V+LY  +GLED +I WWG  
Sbjct  657   SWIVVGFLSGFVVYRYKPDWWRRHNYVLSGALDAGLAFMGVVLYLCLGLEDISIDWWG-N  715

Query  2244  DLEHCDLASCPTAKGIAVDGCPV  2312
             +L+ C LA CPTAKG    GCPV
Sbjct  716   NLDGCPLAHCPTAKGFEFQGCPV  738



>ref|XP_004143945.1| PREDICTED: oligopeptide transporter 7-like [Cucumis sativus]
 gb|KGN49990.1| hypothetical protein Csa_5G148610 [Cucumis sativus]
Length=757

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/733 (59%), Positives = 561/733 (77%), Gaps = 16/733 (2%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
             E    +E SPI +V LTV  TDDP+LPV TFRMW LG +SCVLLSFLNQFF YR+EPL I
Sbjct  39    EISESDENSPIPQVALTVPTTDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRKEPLSI  98

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
             T+I+ Q+A +P+GR MA+ +    F   G    +FSLNPGPFN+KEHVLITIFAN+G   
Sbjct  99    TAISAQIAVVPLGRLMASKITDRVF-FKG-KRWEFSLNPGPFNVKEHVLITIFANSGAG-  155

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
                S YA+ +V ++  FY++ ++FF   ++++TTQVLG+GWAG+ +KY+VEPA MWWPS 
Sbjct  156   ---SVYAIHVVTVVKTFYKQHLTFFVSLIVVVTTQVLGFGWAGIFRKYLVEPAAMWWPSN  212

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR LHEKEE   G     +SR +FFVI+  CSF +Y  PGY+FQ L S+SWVCW
Sbjct  213   LVQVSLFRALHEKEERIKGS----LSRTQFFVIAFICSFAYYVIPGYLFQMLISLSWVCW  268

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
             +FP S+ A QLGSGL GLGLG++ LDWSTI+S+L SPL  P+FA  NV VG+  IMY++ 
Sbjct  269   IFPTSILAQQLGSGLYGLGLGSIGLDWSTISSYLGSPLASPWFATANVAVGFGFIMYILT  328

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             PI YW  NVY A+ FP++S  LFT +GQ+Y+IS+I++  F LD   Y  QGR+Y+STFF+
Sbjct  329   PICYW-FNVYKAQTFPMFSDGLFTGKGQKYNISSIIDSNFHLDFAAYETQGRLYISTFFA  387

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRAS-TKGKMDIHTKLMKNYKDIPSWWFYVLL  1376
             ++YG GFA +++TI HVALF+GREI+++ ++S  + KMDIHTKLM+ YK +P WWF ++L
Sbjct  388   VTYGVGFAALSATIVHVALFHGREIWEQSKSSFEEKKMDIHTKLMRKYKQVPEWWFVLIL  447

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
             +  IA+++  C + ND++Q+P+WG+I A ++A  FTLPI IITA TNQ PGLNIITEYI+
Sbjct  448   LGNIALTIFACEYYNDQLQLPWWGVILACSIAVFFTLPIGIITAITNQAPGLNIITEYII  507

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             G IYPG P+AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR+MF+ Q +GTLIA  + 
Sbjct  508   GYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIASFVY  567

Query  1737  MSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNW  1916
             +  AWWLL +I +IC     S S WTCPSDRVF+DASVIWGL+GP+RIF   G Y+++NW
Sbjct  568   LGTAWWLLETIPDICSS---SQSFWTCPSDRVFYDASVIWGLIGPRRIFGDLGFYSSVNW  624

Query  1917  FFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNF  2096
             FF+ G + PV+VWL  + FP   WI LIN+PVL+GATG MPPAT++NY +WILVG +  F
Sbjct  625   FFVVGAIAPVLVWLAIKAFPQHEWIKLINMPVLIGATGYMPPATAVNYITWILVGFLSGF  684

Query  2097  FVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCP  2276
              V+RY+ +WW+R+NY+LS  LDAG+AFM VLLYFT+G ++ T+ WWG  +L+ C LA CP
Sbjct  685   VVYRYKPEWWKRHNYVLSGALDAGLAFMGVLLYFTLGSQEITLDWWG-NELDGCPLAQCP  743

Query  2277  TAKGIAVDGCPVF  2315
             TA GIAV+GCP+F
Sbjct  744   TAPGIAVEGCPLF  756



>ref|XP_004309550.1| PREDICTED: oligopeptide transporter 7-like [Fragaria vesca subsp. 
vesca]
Length=749

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/750 (57%), Positives = 564/750 (75%), Gaps = 22/750 (3%)
 Frame = +3

Query  87    EIEAPALKLAGEDV------NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVL  248
             EI AP +    E         +EE SP+++V LTV   DDP+LPV TFRMWVLG +SCVL
Sbjct  14    EITAPLISRDEEGQTSSSPPEEEENSPVKQVALTVPTGDDPSLPVLTFRMWVLGTLSCVL  73

Query  249   LSFLNQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFN  428
             LSFLNQFF YR EPL IT+I+ Q+A +P+G+ MAA +    F   G    +F+LNPGPFN
Sbjct  74    LSFLNQFFWYRTEPLSITAISAQIAVVPLGQLMAANITTRVF-FKG-TRWEFTLNPGPFN  131

Query  429   MKEHVLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAG  608
             +KEHVLITIFAN+G      + YA+ IV ++  FY++ I+FF   L+I+TTQVLG+GWAG
Sbjct  132   VKEHVLITIFANSGAG----TVYAIHIVTVVKVFYKQHITFFVSLLVILTTQVLGFGWAG  187

Query  609   LLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYF  788
             + ++Y+VEPA MWWP+ LVQ+SLFR LHE+EE   GG    ++R +FF+I+  CSF +Y 
Sbjct  188   IFRRYLVEPAAMWWPANLVQVSLFRALHEREERPKGG----VTRTQFFLIAFMCSFAYYV  243

Query  789   FPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFF  968
             FPGY+F  L S+SW+CW+FP SV A Q+GSGL GLGLGA+ LDWSTI+S+L SPL  P+F
Sbjct  244   FPGYLFTMLTSLSWICWIFPSSVLAQQIGSGLYGLGLGAVGLDWSTISSYLGSPLASPWF  303

Query  969   AIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELD  1148
             A  NV  G+  +MY++ PI YW LN+Y AK FP++S +LFT  GQEYDI+AI++  F L+
Sbjct  304   ATANVAAGFVFVMYVLTPICYW-LNLYKAKTFPIFSDELFTEDGQEYDITAIIDSNFHLN  362

Query  1149  EDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGK-MDIHTK  1325
                Y ++G +Y+STFF+++YG GFA + +T+ HVALF+GREI+++ ++S K K MDIHT+
Sbjct  363   ITAYEEEGPLYISTFFAMTYGVGFAALTATVVHVALFHGREIWEQSKSSFKEKRMDIHTR  422

Query  1326  LMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIIT  1505
             LM+ Y  +P WWF  +L+  IA+++  C + ND++Q+P+WG++ A A+A +FTLPI IIT
Sbjct  423   LMQRYNPVPEWWFVAILLTNIALTIFTCEYYNDQLQLPWWGVLLACAIAILFTLPIGIIT  482

Query  1506  ATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPR  1685
             A TNQTPGLNIITEYI+G IYPG P+AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR
Sbjct  483   AITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPR  542

Query  1686  SMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLV  1865
             +MF+ Q +GTLIA  + +  AWWL+ +I  IC     + S WTCP D VF+DASV+WGL+
Sbjct  543   TMFMAQVVGTLIAAFVYLCTAWWLMETIPGICTD---TTSVWTCPMDTVFYDASVLWGLI  599

Query  1866  GPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPA  2045
             GP+RIF   G Y A+NWFFL G + PV+VWL  + FP Q WI LIN+PVL+GATGSMPPA
Sbjct  600   GPRRIFGDLGTYAAVNWFFLAGAIAPVLVWLAAKAFPQQEWIRLINMPVLIGATGSMPPA  659

Query  2046  TSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTI  2225
             T++NY+SWI++G +  F V+RYR  WW+R+NY+LS  LDAG+AFM VLLYFTVGLE+ ++
Sbjct  660   TAVNYTSWIILGFLSGFVVYRYRPDWWRRHNYVLSGALDAGLAFMGVLLYFTVGLEEISV  719

Query  2226  SWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
              WWG  DL+ C LA CPTA G+ V GCPVF
Sbjct  720   DWWG-NDLDGCPLAECPTAVGVIVAGCPVF  748



>ref|XP_009358688.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7-like 
[Pyrus x bretschneideri]
Length=749

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/731 (57%), Positives = 561/731 (77%), Gaps = 18/731 (2%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
              DEE SP+E+V LTV  TDDP+LPV TFRMWVLG +SCVLLSFLNQFF YR EPL IT+I
Sbjct  34    TDEENSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAI  93

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIfanagfafgn  485
             + Q+A +P+G+ MA+ +     R+   GS  +F+LNPGPFN+KEHVLITIFAN+G     
Sbjct  94    SAQIAVVPLGQLMASKITN---RVFFKGSRWEFTLNPGPFNVKEHVLITIFANSGAG---  147

Query  486   gSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLV  665
              + YA+ IV  +  FY++ I+FF   L+I+TTQVLG+GWAG+ ++Y+VEPA MWWP+ LV
Sbjct  148   -TVYAIHIVTAVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLV  206

Query  666   QISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVF  845
             Q+SLFR LHEKE    GG    ++R +FF+I+  CSF +Y FPGY+FQ L S+SW+CW+F
Sbjct  207   QVSLFRALHEKEVRHKGG----LTRTQFFLIAFMCSFAYYVFPGYLFQMLTSLSWICWIF  262

Query  846   PKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPI  1025
             P +V A QLGSGL+GLG+GA+ +DWSTI+++L SPL  P+FA  NV  G+  +MY++ P+
Sbjct  263   PTNVLAQQLGSGLHGLGIGAVGVDWSTISAYLGSPLASPWFATANVAAGFFFVMYILTPL  322

Query  1026  SYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLS  1205
             SYW  N+Y AK FP++S+ +FT+ GQEY+I+AI++  F LD D Y ++G +Y+S  F+++
Sbjct  323   SYW-FNIYKAKTFPIFSNSMFTSDGQEYNITAIIDSNFHLDYDAYEQEGHLYISIIFTIT  381

Query  1206  YGFGFATIASTITHVALFYGREIYDRYRASTK-GKMDIHTKLMKNYKDIPSWWFYVLLVV  1382
             YG  FA + +TI HVALF+GREI+++ +AS K  KMDIHT+LM+ Y  +P WWF V+L+ 
Sbjct  382   YGVSFAALTATIVHVALFHGREIWEQSKASFKEKKMDIHTRLMQRYNQVPEWWFVVILLA  441

Query  1383  TIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGI  1562
              IA+++  C + ND++Q+P+WG++ A  +A  FTLPI IITA TNQ PGLN+ITEYI+G 
Sbjct  442   NIALTIFTCQYYNDQLQLPWWGVLLACGIAIFFTLPIGIITAITNQGPGLNVITEYIIGY  501

Query  1563  IYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMS  1742
             IYPG P+AN+CFK  GY+SM+QA+ FL DFKLGHYMKIPPR+MF+ Q +GTLIA  + +S
Sbjct  502   IYPGYPVANMCFKVXGYISMSQAVTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLS  561

Query  1743  VAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFF  1922
              AWWL+ +I +IC     + S WTCP D VF+DASVIWGL+GP+RIF   G Y A+NWFF
Sbjct  562   TAWWLMETIPDICED---TTSVWTCPGDTVFYDASVIWGLIGPRRIFGDLGRYEAVNWFF  618

Query  1923  LGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFV  2102
             L G + P+ VWL  + FP Q WI LIN+PVL+GAT SMPPAT++NY+SWI++G +  F V
Sbjct  619   LVGAIAPIFVWLAVKAFPRQEWIGLINMPVLMGATSSMPPATAVNYTSWIILGFLSGFVV  678

Query  2103  FRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTA  2282
             +RYR  WW+R+NY+LS  LDAG+AFM VLLYF++GLED ++SWWG  DL+ C LA+CPTA
Sbjct  679   YRYRPNWWKRHNYVLSGALDAGLAFMGVLLYFSLGLEDISLSWWG-NDLDGCPLATCPTA  737

Query  2283  KGIAVDGCPVF  2315
             KG+ V+GCP++
Sbjct  738   KGVVVEGCPIY  748



>ref|XP_006289826.1| hypothetical protein CARUB_v10003431mg [Capsella rubella]
 gb|EOA22724.1| hypothetical protein CARUB_v10003431mg [Capsella rubella]
Length=766

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/726 (59%), Positives = 563/726 (78%), Gaps = 17/726 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPI +V LTV  TDDP+LPV TFRMWVLG +SC+LLSFLNQFF YR EPL I++I+ Q+A
Sbjct  55    SPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQIA  114

Query  324   TLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIfanagfafgngSAYA  500
              +P+GR MAA +     R+   GS  QF+LNPGPFN+KEHVLITIFANAG      S YA
Sbjct  115   VVPLGRLMAAKISE---RVYFQGSKWQFTLNPGPFNVKEHVLITIFANAGAG----SVYA  167

Query  501   VGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLF  680
             + +V ++ AFY + I+FF  +++I+TTQVLG+GWAG+ +KY+VEPA MWWP+ LVQ+SLF
Sbjct  168   IHVVTVVKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLF  227

Query  681   RTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVT  860
             R LHEKEE   GG    ++R +FF+I+  CSF +Y FPGY+FQ + S+SWVCW FP SV 
Sbjct  228   RALHEKEERTKGG----LTRTQFFLIAFICSFAYYVFPGYLFQIMTSLSWVCWFFPSSVM  283

Query  861   AHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGL  1040
             A Q+GSGL+GLG+GA+ LDWSTI+S+L SPL  P+FA  NV VG+ +++Y+++PI YW L
Sbjct  284   AQQIGSGLHGLGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLVIYVLVPICYW-L  342

Query  1041  NVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGF  1220
             +V+ AK FP++SS LFT QG +Y+I++I++  F LD   Y ++G +YLSTFF++SYG GF
Sbjct  343   DVFKAKTFPIFSSSLFTNQGSKYNITSIIDSNFHLDLPAYEREGPLYLSTFFAISYGVGF  402

Query  1221  ATIASTITHVALFYGREIYDRYRAS-TKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVS  1397
             A +++TI HVALF+GREI+++ + S  + K+D+H +LMK YK +P WWF+ +LV  IA +
Sbjct  403   AALSATIMHVALFHGREIWEQSKESFNEKKLDVHARLMKRYKQVPEWWFWSILVTNIAAT  462

Query  1398  LALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGK  1577
             +  C + ND++Q+P+WG++ A  +A +FTLPI IITA TNQ PGLNIITEYI+G IYPG 
Sbjct  463   IFACEYYNDQLQLPWWGVLLACTIAIIFTLPIGIITAITNQAPGLNIITEYIIGYIYPGY  522

Query  1578  PIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWL  1757
             P+AN+CFK YGY+SM QAI FL DFKLGHYMKIPPR+MF+ Q +GTLI+  + ++ AWWL
Sbjct  523   PVANMCFKVYGYISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCLVYLTTAWWL  582

Query  1758  LHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
             + +I NIC  D ++NS WTCPSD+VF+DASVIWGL+GP+RIF   G Y ++NWFFL G +
Sbjct  583   METIPNIC--DTVTNSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAI  640

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
              PV+VWL  R FP Q WI LIN+PVL+ AT SMPPAT++NY++W+L G +  F VFRYR 
Sbjct  641   APVLVWLASRTFPRQEWIKLINMPVLISATSSMPPATAVNYTTWVLAGFLSGFVVFRYRP  700

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV  2297
               WQRYNY+LS  LDAG+AFM VLLY  +GLE+ ++ WWG  +L+ C LASCPTA GI+V
Sbjct  701   NLWQRYNYVLSGALDAGLAFMGVLLYMCLGLENVSLDWWG-NELDGCPLASCPTAPGISV  759

Query  2298  DGCPVF  2315
             +GCP++
Sbjct  760   EGCPLY  765



>ref|XP_007145948.1| hypothetical protein PHAVU_006G000100g [Phaseolus vulgaris]
 gb|ESW17942.1| hypothetical protein PHAVU_006G000100g [Phaseolus vulgaris]
Length=760

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/726 (59%), Positives = 563/726 (78%), Gaps = 17/726 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPI++V +TV+ TDDP+LPV TFRMWVLG +SCV+LSFLNQFF YRREPL IT+I+ Q+A
Sbjct  49    SPIKQVAMTVSTTDDPSLPVLTFRMWVLGSLSCVVLSFLNQFFWYRREPLAITAISAQIA  108

Query  324   TLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
              +P+G+ MAA +    F + G    +F LNPGPFN+KEHVLITIFAN+G      + YA+
Sbjct  109   VVPLGQLMAATMTKRVF-LRG-TRWEFRLNPGPFNVKEHVLITIFANSGAG----NVYAI  162

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFR  683
              IV  +  FYR+ ISFF   L++ITTQVLG+GWAG+ ++Y+VEPA MWWP+ LVQ+SLFR
Sbjct  163   HIVTAVKIFYRQHISFFVSLLVVITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFR  222

Query  684   TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTA  863
              LHEK+E   GG    ++R++FFV++  CSF +Y FPGYIFQ L S+SWVCW+FP ++ A
Sbjct  223   ALHEKDERAKGG----LTRSQFFVMAFVCSFAYYVFPGYIFQMLVSLSWVCWLFPNNILA  278

Query  864   HQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLN  1043
              QLGSGL GLG+GA+ LDWSTI+S+L SPL  P+FA  N+ VG+ +++Y++ P+ YW  N
Sbjct  279   QQLGSGLYGLGIGAVGLDWSTISSYLGSPLASPWFATANIAVGFVLVIYVLTPLCYW-FN  337

Query  1044  VYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFA  1223
             VY AK FP++S+ LFT QGQ Y+I+AI++  F LD   Y +Q R+YLSTFF+++YG GFA
Sbjct  338   VYRAKTFPIFSNKLFTDQGQIYNITAIIDSNFHLDLAAYQRQDRLYLSTFFAITYGVGFA  397

Query  1224  TIASTITHVALFYGREIYDRYRASTKGK--MDIHTKLMKNYKDIPSWWFYVLLVVTIAVS  1397
              + +T+ HVALF+GREI+++ + S K K  +DIHTKLM+ YK +P WWF  +L+ TIA +
Sbjct  398   ALTATVMHVALFHGREIWEQSKWSFKEKTSVDIHTKLMRRYKQVPEWWFVCILLATIAAT  457

Query  1398  LALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGK  1577
             +  C +   ++Q+P+WG++ A A+A  FTLPI IITA TNQ+PGLN+ITEYI+G +YPG 
Sbjct  458   VFTCEYYKAQLQLPWWGVLLACAIAIFFTLPIGIITAITNQSPGLNVITEYIIGYMYPGY  517

Query  1578  PIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWL  1757
             P+AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR+MF+ Q +GTLIA  + +  AWWL
Sbjct  518   PVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIASLVYLLTAWWL  577

Query  1758  LHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
             + +I +IC   K S+S WTCPSD VF+DASVIWGL+GP+RIF   G Y  +NWFFLGG +
Sbjct  578   METIPDIC---KDSSSVWTCPSDTVFYDASVIWGLIGPRRIFGDLGTYENVNWFFLGGAI  634

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
              P++VWL+ R FP Q WI LIN+PVL+GATG MPPAT++NY+SWI+VG +  F VFRY+ 
Sbjct  635   APLLVWLVARSFPQQEWIRLINMPVLIGATGMMPPATAVNYTSWIIVGFLSGFVVFRYKP  694

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV  2297
             +WW+R+NY+LS  LDAG+AFMAVLLY  +GLED ++SWWG  +L+ C LA CPTAKG+ +
Sbjct  695   EWWKRHNYVLSGALDAGLAFMAVLLYLCLGLEDISMSWWG-NELDACPLAHCPTAKGVHI  753

Query  2298  DGCPVF  2315
              GCPVF
Sbjct  754   PGCPVF  759



>ref|XP_006439250.1| hypothetical protein CICLE_v10018971mg [Citrus clementina]
 gb|ESR52490.1| hypothetical protein CICLE_v10018971mg [Citrus clementina]
Length=764

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/733 (57%), Positives = 557/733 (76%), Gaps = 18/733 (2%)
 Frame = +3

Query  126   VNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITS  305
             V +EE SP+++V LTV+  DD  LPV TFRMWVLG +SCVLLSFLNQFF YR EPL IT+
Sbjct  46    VEEEENSPVKQVALTVSTEDDTCLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITA  105

Query  306   ITVQVATLPIGRFMAAALPAAKFRIPGFGSG--QFSLNPGPFNMKEHVLITIfanagfaf  479
             I+ Q+A +P+G+ MAA L    F    F S   +F+LNPGPFN+KEHVLITIFAN+G   
Sbjct  106   ISAQIAVVPLGQLMAAKLTDRVF----FKSTPLEFTLNPGPFNVKEHVLITIFANSGAG-  160

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
                S YA+ IV ++  FY++  +FF   L++ TTQVLG+GWAG+ ++Y+VEPA MWWP+ 
Sbjct  161   ---SVYAIHIVTVVKVFYKQHFTFFVSLLVVFTTQVLGFGWAGIFRRYLVEPAAMWWPAN  217

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR LHE+E+   GG    ++R +FF++   CSF +Y FPGY+ + L S+SW+CW
Sbjct  218   LVQVSLFRALHEREKRASGG----VTRTQFFMMGFVCSFAYYVFPGYLLEMLTSLSWICW  273

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
             +FPKSV A Q+GSGL GLG+ A+ +DWSTI+S+L SPL  P+FA  NV  G+ ++MY++ 
Sbjct  274   IFPKSVVAQQVGSGLYGLGVAAVGIDWSTISSYLGSPLASPWFATANVAAGFVLVMYVLT  333

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             P+ YW LN+YNAK FP++S  LFT  G+EY+I+AI++  F +D   Y ++G +YLS FF+
Sbjct  334   PLCYW-LNIYNAKTFPIFSDQLFTTTGREYNITAIIDSSFHIDIAAYQREGPLYLSIFFA  392

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGK-MDIHTKLMKNYKDIPSWWFYVLL  1376
              +YG GFA + +TI HVALF+GREI+++ RAS + K MDIHTKLM+ YK +P  WF ++L
Sbjct  393   TTYGLGFAALTATIVHVALFHGREIWEQSRASFQEKGMDIHTKLMRKYKRVPESWFVIIL  452

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
             ++ IA ++  C + ND++Q+P+WG++ A A+A  FTLPI IITA TNQTPGLNIITEYI+
Sbjct  453   LINIAATVFACEYYNDQLQLPWWGVLLACAIAITFTLPIGIITAITNQTPGLNIITEYII  512

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             G +YPG P+AN+CFK YGY+SMTQA+ FL DFKLGHYMKIPPR+MF+ Q +GT+IA  + 
Sbjct  513   GYVYPGYPVANMCFKVYGYISMTQAVTFLQDFKLGHYMKIPPRTMFMAQIVGTVIACFVY  572

Query  1737  MSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNW  1916
             +  AWWL+ SI +IC   K +NS WTCPSD+VF+DASVIWGL+GP+R F   G Y A+NW
Sbjct  573   LGTAWWLMESITDIC-DTKAANSVWTCPSDKVFYDASVIWGLIGPRRTFGDLGTYEAINW  631

Query  1917  FFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNF  2096
             FFL G + P++VWL  + FP+Q WI LIN+PVL+GAT  MPPAT++NY++WI+ G +  F
Sbjct  632   FFLAGAIAPLLVWLGSKAFPNQEWIRLINMPVLIGATAMMPPATAVNYTTWIVAGFLSGF  691

Query  2097  FVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCP  2276
              V+RYR   WQRYNY+LS  LDAG+AFM VLLY  +GLED T+ WWG  DL+ C  A+CP
Sbjct  692   VVYRYRPDLWQRYNYVLSGALDAGLAFMGVLLYLCLGLEDITLDWWG-NDLDGCPYATCP  750

Query  2277  TAKGIAVDGCPVF  2315
             TA+GIAV+GCPVF
Sbjct  751   TARGIAVEGCPVF  763



>ref|XP_004163578.1| PREDICTED: oligopeptide transporter 7-like [Cucumis sativus]
Length=835

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/733 (59%), Positives = 561/733 (77%), Gaps = 16/733 (2%)
 Frame = +3

Query  120   EDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLII  299
             E    +E SPI +V LTV  TDDP+LPV TFRMW LG +SCVLLSFLNQFF YR+EPL I
Sbjct  117   EISESDENSPIPQVALTVPTTDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRKEPLSI  176

Query  300   TSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfaf  479
             T+I+ Q+A +P+GR MA+ +    F   G    +FSLNPGPFN+KEHVLITIFAN+G   
Sbjct  177   TAISAQIAVVPLGRLMASKITDRVF-FKG-KRWEFSLNPGPFNVKEHVLITIFANSGAG-  233

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
                S YA+ +V ++  FY++ ++FF   ++++TTQVLG+GWAG+ +KY+VEPA MWWPS 
Sbjct  234   ---SVYAIHVVTVVKTFYKQHLTFFVSLIVVVTTQVLGFGWAGIFRKYLVEPAAMWWPSN  290

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR LHEKEE   G     +SR +FFVI+  CSF +Y  PGY+FQ L S+SWVCW
Sbjct  291   LVQVSLFRALHEKEERIKGS----LSRTQFFVIAFICSFAYYVIPGYLFQMLISLSWVCW  346

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
             +FP S+ A QLGSGL GLGLG++ LDWSTI+S+L SPL  P+FA  NV VG+  IMY++ 
Sbjct  347   IFPTSILAQQLGSGLYGLGLGSIGLDWSTISSYLGSPLASPWFATANVAVGFGFIMYILT  406

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             PI YW  NVY A+ FP++S  LFT +GQ+Y+IS+I++  F LD   Y  QGR+Y+STFF+
Sbjct  407   PICYW-FNVYKAQTFPMFSDGLFTGKGQKYNISSIIDSNFHLDFAAYETQGRLYISTFFA  465

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRAS-TKGKMDIHTKLMKNYKDIPSWWFYVLL  1376
             ++YG GFA +++TI HVALF+GREI+++ ++S  + KMDIHTKLM+ YK +P WWF ++L
Sbjct  466   VTYGVGFAALSATIVHVALFHGREIWEQSKSSFEEKKMDIHTKLMRKYKQVPEWWFVLIL  525

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
             +  IA+++  C + ND++Q+P+WG+I A ++A  FTLPI IITA TNQ PGLNIITEYI+
Sbjct  526   LGNIALTIFACEYYNDQLQLPWWGVILACSIAVFFTLPIGIITAITNQAPGLNIITEYII  585

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             G IYPG P+AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR+MF+ Q +GTLIA  + 
Sbjct  586   GYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIASFVY  645

Query  1737  MSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNW  1916
             +  AWWLL +I +IC     S S WTCPSDRVF+DASVIWGL+GP+RIF   G Y+++NW
Sbjct  646   LGTAWWLLETIPDICSS---SQSFWTCPSDRVFYDASVIWGLIGPRRIFGDLGFYSSVNW  702

Query  1917  FFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNF  2096
             FF+ G + PV+VWL  + FP   WI LIN+PVL+GATG MPPAT++NY +WILVG +  F
Sbjct  703   FFVVGAIAPVLVWLAIKAFPQHEWIKLINMPVLIGATGYMPPATAVNYITWILVGFLSGF  762

Query  2097  FVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCP  2276
              V+RY+ +WW+R+NY+LS  LDAG+AFM VLLYFT+G ++ T+ WWG  +L+ C LA CP
Sbjct  763   VVYRYKPEWWKRHNYVLSGALDAGLAFMGVLLYFTLGSQEITLDWWG-NELDGCPLAQCP  821

Query  2277  TAKGIAVDGCPVF  2315
             TA GIAV+GCP+F
Sbjct  822   TAPGIAVEGCPLF  834



>ref|XP_002317799.2| hypothetical protein POPTR_0012s02660g [Populus trichocarpa]
 gb|EEE96019.2| hypothetical protein POPTR_0012s02660g [Populus trichocarpa]
Length=731

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/744 (57%), Positives = 562/744 (76%), Gaps = 18/744 (2%)
 Frame = +3

Query  96    APALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFS  275
             A A ++   ++ DEE  P+++V LTV  TDDPTLPV TFRMWVLG+ SCVLLSF+NQFF 
Sbjct  2     AGANEVQAMEIEDEEECPVKQVDLTVLKTDDPTLPVLTFRMWVLGLGSCVLLSFVNQFFW  61

Query  276   YRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITI  455
             YR +P+ I+SI+ Q+A +P+G  MA  L   KF   G  S +F++NPGPFN+KEHVLITI
Sbjct  62    YRTQPMFISSISAQIAVVPLGHLMAKKLTTRKF-FEG-TSWEFTMNPGPFNIKEHVLITI  119

Query  456   fanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEP  635
             FAN+G      + YA  I+  +  +Y+RK++F     ++ITTQVLG+GWAGL +KY+VEP
Sbjct  120   FANSGAG----TVYATHILTAVKLYYKRKLTFVPALFVMITTQVLGFGWAGLFRKYLVEP  175

Query  636   AHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTL  815
               MWWPS LVQ+SLFR LHEKE+   G      SR +FF++ + CSF +Y  PGY+F  L
Sbjct  176   GEMWWPSNLVQVSLFRALHEKEKRLKGYT----SRTQFFLLVIICSFAYYVLPGYLFTML  231

Query  816   ASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGY  995
              S SWVCW+  KSV   QLGSGL GLG+GA+  DW+T++++L SPL  P+FA  NV VG+
Sbjct  232   TSFSWVCWLGSKSVLVQQLGSGLQGLGIGAVGFDWATVSAYLGSPLASPWFATANVAVGF  291

Query  996   AIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGR  1175
             ++IMY++ PI YW LNVYNAK FPLYS++LFT +G+EYDI  I+N +F LD D YAK G 
Sbjct  292   SLIMYVMTPICYW-LNVYNAKNFPLYSNELFTEKGEEYDILNIINSKFHLDRDAYAKFGP  350

Query  1176  IYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKG--KMDIHTKLMKNYKDI  1349
             I++STFFS++YG GFAT+++T+ HV LF G +++ + + +  G  K+DIHT+LMK YK +
Sbjct  351   IHMSTFFSMTYGLGFATLSATVMHVLLFNGSDLWKQSKRAFGGRRKIDIHTRLMKKYKSV  410

Query  1350  PSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPG  1529
             P+WWFY++LV+ IA  +  C   N+ +Q+P+WG++ A A+AF FTLPI II+ATTNQ PG
Sbjct  411   PTWWFYIILVINIAAIIFACEHYNESLQLPWWGVLLACAIAFFFTLPIGIISATTNQQPG  470

Query  1530  LNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFI  1709
             LN+ITEYI+G +YP +P+AN+CFK YGY+SMTQA+ FL+DFKLGHYMKIPPRSMF+ Q +
Sbjct  471   LNVITEYIIGYMYPERPVANMCFKVYGYISMTQALTFLADFKLGHYMKIPPRSMFMAQVV  530

Query  1710  GTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDS  1889
             GTL+A  + +  AWW++ +I N+C QD   N PW CP DRVFFDASVIWGLVGP+RIF +
Sbjct  531   GTLVAVLVYLGTAWWMMDAIPNLCSQD---NGPWKCPMDRVFFDASVIWGLVGPRRIFGN  587

Query  1890  EGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSW  2069
              G Y  +NWFFLGG + P+IVW+ H+ FP + WI LI++PVLLGAT  MPPA+++NY+SW
Sbjct  588   LGEYGGVNWFFLGGAVAPLIVWIFHKAFPRKEWISLIHMPVLLGATSMMPPASAVNYTSW  647

Query  2070  ILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWG--TT  2243
             I+VG +  + +FRYR +WW+RYNY+LS GLDAG AFM +L++F +G  D  ++WWG  ++
Sbjct  648   IVVGFLSGYVLFRYRTEWWKRYNYVLSGGLDAGTAFMTLLIFFALGYWDVDLTWWGSNSS  707

Query  2244  DLEHCDLASCPTAKGIAVDGCPVF  2315
             + E C LASCPTAKGI VDGCPV 
Sbjct  708   NPEGCLLASCPTAKGIIVDGCPVL  731



>ref|XP_009407958.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
Length=759

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/726 (59%), Positives = 560/726 (77%), Gaps = 16/726 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIE+V LTV   DDPT+PV TFRMWVLG  SCVLLSFLNQFF YR+EPL ITSI+ Q+A
Sbjct  46    SPIEQVALTVPVEDDPTMPVLTFRMWVLGTASCVLLSFLNQFFWYRKEPLSITSISAQIA  105

Query  324   TLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIfanagfafgngSAYA  500
              +P+G  MA+ +     R+   GS  +F+LNPGPFN+KEHVLITIFAN+G      S YA
Sbjct  106   VVPLGHLMASTITD---RVFFKGSRWEFTLNPGPFNIKEHVLITIFANSGAG----SVYA  158

Query  501   VGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLF  680
             + +V  +  FY + I+FF   L++ITTQVLG+GWAG+ ++Y+VEPA MWWP  LVQ+SLF
Sbjct  159   IHVVTAVKIFYGKHITFFVSLLVVITTQVLGFGWAGIFRRYLVEPAAMWWPYNLVQVSLF  218

Query  681   RTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVT  860
             R LHE+E+   GG    M+R +FF+++  CSF +Y FPGY+F  L S+SW+CW+FP S+ 
Sbjct  219   RALHEREDRAKGG----MTRNQFFMMAFICSFAYYVFPGYLFSMLTSLSWICWIFPHSIL  274

Query  861   AHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGL  1040
             A QLGSGL GLGLGA+ LDWSTI+S+L SPL  P+FA  NV  G+ +IMY+V P +YW L
Sbjct  275   AQQLGSGLYGLGLGAIGLDWSTISSYLGSPLASPWFATANVAAGFVLIMYVVTPTAYW-L  333

Query  1041  NVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGF  1220
             ++Y+AK FP++S  LFT+ GQ Y+IS+I++  F LD + Y K G +YLSTFF+++YG GF
Sbjct  334   DLYDAKTFPIFSDGLFTSTGQSYNISSIIDSNFHLDIEAYDKNGPLYLSTFFAVTYGVGF  393

Query  1221  ATIASTITHVALFYGREIYDRYRAS-TKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVS  1397
             A++ +TI+HV LF+G EI+   +++  + KMDIHTKLM  Y  +P WWF V+LV  IA++
Sbjct  394   ASLTATISHVLLFHGSEIWQMSKSAFEEKKMDIHTKLMSRYTQVPQWWFIVILVANIALT  453

Query  1398  LALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGK  1577
             +  C +  D++Q+P+WG++ A  +A  FTLPI IITATTNQTPGLNIITEY+MG +YPG+
Sbjct  454   IFACEYYIDQLQLPWWGVLLACFIAIFFTLPIGIITATTNQTPGLNIITEYVMGYLYPGR  513

Query  1578  PIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWL  1757
             P+AN+CFK YGY+SMTQA+ FL DFKLGHYMKIPPR+MF+ Q +GTL+A  + +  AWWL
Sbjct  514   PVANMCFKVYGYISMTQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLVAAIVYLGTAWWL  573

Query  1758  LHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGI  1934
             + +I NIC+ + L S+SPWTCPSD VF+DASVIWGL+GP+RIF   G Y+A+NWFFL G 
Sbjct  574   METIPNICNTELLSSDSPWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYSAINWFFLVGA  633

Query  1935  LGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYR  2114
             + P++VWL H+ FP Q WI LIN+PVL+GATG MPPAT++NY++WI+VG    + V+RYR
Sbjct  634   VAPLLVWLAHKAFPGQDWIRLINMPVLIGATGMMPPATAVNYTTWIIVGFFSGYVVYRYR  693

Query  2115  KKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIA  2294
             + WW R+NY+LS  LDAG+AFMAVLLY  +GLED +++WWG  DL+ C LASCPTAKG+ 
Sbjct  694   RDWWTRHNYVLSGALDAGLAFMAVLLYLCLGLEDISLNWWG-NDLDGCSLASCPTAKGVI  752

Query  2295  VDGCPV  2312
             ++GCPV
Sbjct  753   IEGCPV  758



>ref|XP_006439249.1| hypothetical protein CICLE_v10018971mg [Citrus clementina]
 gb|ESR52489.1| hypothetical protein CICLE_v10018971mg [Citrus clementina]
Length=756

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/733 (57%), Positives = 557/733 (76%), Gaps = 18/733 (2%)
 Frame = +3

Query  126   VNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITS  305
             V +EE SP+++V LTV+  DD  LPV TFRMWVLG +SCVLLSFLNQFF YR EPL IT+
Sbjct  38    VEEEENSPVKQVALTVSTEDDTCLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITA  97

Query  306   ITVQVATLPIGRFMAAALPAAKFRIPGFGSG--QFSLNPGPFNMKEHVLITIfanagfaf  479
             I+ Q+A +P+G+ MAA L    F    F S   +F+LNPGPFN+KEHVLITIFAN+G   
Sbjct  98    ISAQIAVVPLGQLMAAKLTDRVF----FKSTPLEFTLNPGPFNVKEHVLITIFANSGAG-  152

Query  480   gngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPST  659
                S YA+ IV ++  FY++  +FF   L++ TTQVLG+GWAG+ ++Y+VEPA MWWP+ 
Sbjct  153   ---SVYAIHIVTVVKVFYKQHFTFFVSLLVVFTTQVLGFGWAGIFRRYLVEPAAMWWPAN  209

Query  660   LVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCW  839
             LVQ+SLFR LHE+E+   GG    ++R +FF++   CSF +Y FPGY+ + L S+SW+CW
Sbjct  210   LVQVSLFRALHEREKRASGG----VTRTQFFMMGFVCSFAYYVFPGYLLEMLTSLSWICW  265

Query  840   VFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVM  1019
             +FPKSV A Q+GSGL GLG+ A+ +DWSTI+S+L SPL  P+FA  NV  G+ ++MY++ 
Sbjct  266   IFPKSVVAQQVGSGLYGLGVAAVGIDWSTISSYLGSPLASPWFATANVAAGFVLVMYVLT  325

Query  1020  PISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFS  1199
             P+ YW LN+YNAK FP++S  LFT  G+EY+I+AI++  F +D   Y ++G +YLS FF+
Sbjct  326   PLCYW-LNIYNAKTFPIFSDQLFTTTGREYNITAIIDSSFHIDIAAYQREGPLYLSIFFA  384

Query  1200  LSYGFGFATIASTITHVALFYGREIYDRYRASTKGK-MDIHTKLMKNYKDIPSWWFYVLL  1376
              +YG GFA + +TI HVALF+GREI+++ RAS + K MDIHTKLM+ YK +P  WF ++L
Sbjct  385   TTYGLGFAALTATIVHVALFHGREIWEQSRASFQEKGMDIHTKLMRKYKRVPESWFVIIL  444

Query  1377  VVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIM  1556
             ++ IA ++  C + ND++Q+P+WG++ A A+A  FTLPI IITA TNQTPGLNIITEYI+
Sbjct  445   LINIAATVFACEYYNDQLQLPWWGVLLACAIAITFTLPIGIITAITNQTPGLNIITEYII  504

Query  1557  GIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTIN  1736
             G +YPG P+AN+CFK YGY+SMTQA+ FL DFKLGHYMKIPPR+MF+ Q +GT+IA  + 
Sbjct  505   GYVYPGYPVANMCFKVYGYISMTQAVTFLQDFKLGHYMKIPPRTMFMAQIVGTVIACFVY  564

Query  1737  MSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNW  1916
             +  AWWL+ SI +IC   K +NS WTCPSD+VF+DASVIWGL+GP+R F   G Y A+NW
Sbjct  565   LGTAWWLMESITDIC-DTKAANSVWTCPSDKVFYDASVIWGLIGPRRTFGDLGTYEAINW  623

Query  1917  FFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNF  2096
             FFL G + P++VWL  + FP+Q WI LIN+PVL+GAT  MPPAT++NY++WI+ G +  F
Sbjct  624   FFLAGAIAPLLVWLGSKAFPNQEWIRLINMPVLIGATAMMPPATAVNYTTWIVAGFLSGF  683

Query  2097  FVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCP  2276
              V+RYR   WQRYNY+LS  LDAG+AFM VLLY  +GLED T+ WWG  DL+ C  A+CP
Sbjct  684   VVYRYRPDLWQRYNYVLSGALDAGLAFMGVLLYLCLGLEDITLDWWG-NDLDGCPYATCP  742

Query  2277  TAKGIAVDGCPVF  2315
             TA+GIAV+GCPVF
Sbjct  743   TARGIAVEGCPVF  755



>ref|XP_006343795.1| PREDICTED: oligopeptide transporter 7-like [Solanum tuberosum]
Length=749

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/729 (58%), Positives = 561/729 (77%), Gaps = 14/729 (2%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
             +++E SPIE+V LTV  TDDP+LPV TFRMW LG +SCVLLSFLNQFF YR EPL IT+I
Sbjct  32    DEDENSPIEQVALTVPTTDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLTITAI  91

Query  309   TVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgng  488
             + Q+A +P+G+ MAA +    F + G    +F+LNPGPFN+KEHVLITIFAN+G      
Sbjct  92    SAQIAVVPLGQLMAAKITKRVF-LQG-SKWEFTLNPGPFNVKEHVLITIFANSGAG----  145

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
             + YA+ +V  +  FY++ I+FF   ++IITTQVLG+GWAG+ +KY+VEPA MWWPS LVQ
Sbjct  146   TVYAIHVVTAVKVFYKKDITFFVSLIVIITTQVLGFGWAGIFRKYLVEPAAMWWPSNLVQ  205

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +SLFR LHEKEE   GG    ++R +FF+++  CSF +Y FPGY+F  L S+SWVCW+FP
Sbjct  206   VSLFRALHEKEERSKGG----LTRTQFFIVAFICSFAYYIFPGYLFSMLTSLSWVCWIFP  261

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
             KSV A QLGSGL GLG+GA+ LDWS+I+S+L SPL  P+FA  NV  G+  +MY++ PI 
Sbjct  262   KSVFAQQLGSGLKGLGIGAIGLDWSSISSYLGSPLASPWFATANVAAGFIFVMYVLTPIC  321

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             YW L+++ AK FP++S  ++T+ GQ Y+IS+I++  F LD D Y +QG +YLSTFF+++Y
Sbjct  322   YW-LDIFKAKTFPIFSDGMYTSNGQVYNISSIIDSNFHLDIDAYEQQGHLYLSTFFAVTY  380

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTKG-KMDIHTKLMKNYKDIPSWWFYVLLVVT  1385
             G GFA +++T+ HV LF+GREI+++ ++S K  KMDIHT+LM  Y  +P WWF+ +LV  
Sbjct  381   GVGFAALSATVMHVLLFHGREIWEQSKSSFKDQKMDIHTRLMSKYNQVPEWWFWCILVAN  440

Query  1386  IAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGII  1565
             I +++  C + N+++Q+P+WG+I A  +AF FTLPI IITA TNQTPGLN+ITEYI+G +
Sbjct  441   ITLTIFACEYYNEQLQLPWWGVILACVIAFFFTLPIGIITAITNQTPGLNVITEYIIGYL  500

Query  1566  YPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSV  1745
             YPG P+AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR MF+ Q +GTLIAG + +  
Sbjct  501   YPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRIMFMAQVVGTLIAGFVYLGT  560

Query  1746  AWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFL  1925
             AWWL+ +I ++C++  LSN+ WTCPSD VF+DASVIWGL+ P+RIF   G Y  +NWFFL
Sbjct  561   AWWLMETIPDMCNK-TLSNTVWTCPSDHVFYDASVIWGLIAPRRIFGDLGTYGMVNWFFL  619

Query  1926  GGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVF  2105
              G + PV+VWL  R FP Q WI LI++PVL+GATG MPPAT++NY++WI+VG +  F V+
Sbjct  620   FGAIAPVLVWLAARAFPKQEWIKLISMPVLIGATGMMPPATAVNYTTWIIVGFLSGFVVY  679

Query  2106  RYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAK  2285
             RYR  WWQR+NY+LS  LDAG+AFMAVL+Y  +GLE+ T++WWG  DL+ C  A+CPTA+
Sbjct  680   RYRPDWWQRHNYVLSGALDAGLAFMAVLIYLCLGLENITVNWWG-NDLDGCPYAACPTAR  738

Query  2286  GIAVDGCPV  2312
             GI  +GCPV
Sbjct  739   GIVTEGCPV  747



>dbj|BAJ85948.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=755

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/747 (57%), Positives = 570/747 (76%), Gaps = 16/747 (2%)
 Frame = +3

Query  87    EIEAPALKLA--GEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFL  260
              I +P L+ +    D   EE SPIE+V LTV   DDP  PV TFRMWVLG+ SC +LSFL
Sbjct  20    RITSPLLRRSSPARDEASEENSPIEQVALTVPVGDDPDTPVLTFRMWVLGMASCAVLSFL  79

Query  261   NQFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEH  440
             NQFF YR+EPL +T+I+ Q+A +P+GR MAAALP   F  P     +F+LNPGPFN+KEH
Sbjct  80    NQFFWYRKEPLTVTAISAQIAVVPLGRLMAAALPERAF-FPD-RPYEFTLNPGPFNVKEH  137

Query  441   VLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKK  620
             VLITIFANAG      + YA+ +V  +  FY + ++FF   L+++TTQVLG+GWAG+ ++
Sbjct  138   VLITIFANAGAG----TVYAIHVVTAVRVFYGKNLTFFVSLLVVLTTQVLGFGWAGIFRR  193

Query  621   YVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGY  800
             Y+VEPA MWWPS LVQ+SLFR LHEKE  + GG     +R +FF+++  CSF +Y FPGY
Sbjct  194   YLVEPAAMWWPSNLVQVSLFRALHEKEGRQKGG----FTRNQFFLVAFTCSFTYYVFPGY  249

Query  801   IFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVN  980
             +FQ L S+SW+CWVFP SV A QLGSGL GLG+GA+ LDW++++S+L SPLV P+FA VN
Sbjct  250   LFQMLTSLSWICWVFPHSVLAQQLGSGLRGLGIGAIGLDWASVSSYLGSPLVSPWFATVN  309

Query  981   VFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEY  1160
             V  G+ IIMY++ PI YW  N YNA  FP++S+DLFT+ GQ+Y+ISAIV+  F  D + Y
Sbjct  310   VAAGFFIIMYVITPIGYW-FNFYNAWTFPIFSADLFTSTGQKYNISAIVDDHFRFDTEAY  368

Query  1161  AKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGK-MDIHTKLMKN  1337
              + G +YLST  +++YG  FAT+ +TI HV LF+GREI    R++ +G+ +DIHTKLM+ 
Sbjct  369   ERNGPLYLSTLLAITYGVSFATLTATIVHVLLFHGREILQLSRSTFQGENVDIHTKLMRR  428

Query  1338  YKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTN  1517
             YK +P WWF  +L+V+IA ++  C +  +++Q+P+WG++ A A+AF FTLPI IITATTN
Sbjct  429   YKQVPEWWFICILLVSIAATVFACEYYIEQLQLPWWGVLLACAIAFFFTLPIGIITATTN  488

Query  1518  QTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFL  1697
             QTPGLNI+TEYI+G +YPG+P+AN+CFK YG++SM QA+ FL DFKLGHYMKIPPR+MF+
Sbjct  489   QTPGLNIVTEYIIGYLYPGRPVANMCFKVYGHISMHQALMFLQDFKLGHYMKIPPRTMFM  548

Query  1698  VQFIGTLIAGTINMSVAWWLLHSIENICHQDKLS-NSPWTCPSDRVFFDASVIWGLVGPK  1874
              Q +GT IA  + +  AWWL+ +I NIC+ + LS ++PWTCP+D VF+DASVIWGL+GP+
Sbjct  549   AQVVGTSIAAFVYLGTAWWLMDTIPNICNIELLSADNPWTCPTDHVFYDASVIWGLIGPR  608

Query  1875  RIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSL  2054
             RIF   G Y+A+NWFFLGG + P++VW  H+ FP+Q+WI LIN+PV++G T  MPPAT++
Sbjct  609   RIFGVLGTYSAVNWFFLGGAIAPLLVWFAHKAFPAQNWILLINMPVMIGCTVKMPPATAV  668

Query  2055  NYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWW  2234
             NY++WIL+G +  + V+RYR+ WW+R+NY+LS  LDAG+AFMAVL+Y  +GLE  +++WW
Sbjct  669   NYTTWILIGFLSGYVVYRYRRDWWERHNYLLSGALDAGLAFMAVLIYLCLGLEKISLNWW  728

Query  2235  GTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             G  DL+ C LASCPTAKGI V GCPV+
Sbjct  729   G-NDLDGCPLASCPTAKGIVVKGCPVY  754



>ref|XP_011043664.1| PREDICTED: oligopeptide transporter 9-like [Populus euphratica]
Length=731

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/744 (56%), Positives = 562/744 (76%), Gaps = 18/744 (2%)
 Frame = +3

Query  96    APALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFS  275
             A A ++   ++ DEE  P+++V LTV  TDDPTLPV TFRMWVLG+ SCVLLSF+NQFF 
Sbjct  2     AGANEVQAMEIEDEEECPVKQVDLTVLKTDDPTLPVLTFRMWVLGLGSCVLLSFVNQFFW  61

Query  276   YRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITI  455
             YR +P+ I+SI+ Q+A +P+G  MA  L   KF   G  S +F++NPGPFN+KEHVLITI
Sbjct  62    YRTQPMFISSISAQIAVVPLGHLMAKKLTTRKF-FEG-TSWEFTMNPGPFNIKEHVLITI  119

Query  456   fanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEP  635
             FAN+G      + YA  I+  +  +Y+RK++F     ++ITTQVLG+GWAGL ++Y+VEP
Sbjct  120   FANSGAG----TVYATHILTAVKLYYKRKLTFVPALFVMITTQVLGFGWAGLFRRYLVEP  175

Query  636   AHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTL  815
               MWWPS LVQ+SLFR LHEK++   G      +R +FF++ + CSF +Y  PGY+F  L
Sbjct  176   GEMWWPSNLVQVSLFRALHEKDKRLKGYT----TRTQFFLLVIICSFAYYVLPGYLFTML  231

Query  816   ASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGY  995
              S SWVCW+  KSV   QLGSGL GLG+GA+  DW+T++++L SPL  P+FA  NV VG+
Sbjct  232   TSFSWVCWLGSKSVLVQQLGSGLQGLGIGAVGFDWATVSAYLGSPLASPWFATANVAVGF  291

Query  996   AIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGR  1175
             ++IMY++ PI YW LNVYNAK FPLYS++LFTA+G+EYDI  I+N +F LD D YAK G 
Sbjct  292   SLIMYVMTPICYW-LNVYNAKNFPLYSNELFTAKGEEYDILNIINSKFHLDRDAYAKFGP  350

Query  1176  IYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKG--KMDIHTKLMKNYKDI  1349
             +++STFFS++YG GFAT+++T+ HV LF G +++ + + +  G  K+DIHT+LMK YK +
Sbjct  351   VHMSTFFSMTYGLGFATLSATVMHVLLFNGSDLWKQSKRAFGGRRKIDIHTRLMKKYKSV  410

Query  1350  PSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPG  1529
             P+WWFY++LV+ IA  +  C   N+ +Q+P+WG++ A A+AF FTLPI II+ATTNQ PG
Sbjct  411   PTWWFYIILVINIAAIIFACEHYNESLQLPWWGVLLACAIAFFFTLPIGIISATTNQQPG  470

Query  1530  LNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFI  1709
             LN+ITEYI+G +YP +P+AN+CFK YGY+SMTQA+ FL+DFKLGHYMKIPPRSMF+ Q +
Sbjct  471   LNVITEYIIGYMYPERPVANMCFKVYGYISMTQALTFLADFKLGHYMKIPPRSMFMAQVV  530

Query  1710  GTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDS  1889
             GTL+A  + +  AWW++ +I N+C QD   N PW CP DRVFFDASVIWGLVGP+RIF +
Sbjct  531   GTLVAVLVYLGTAWWMMDAIPNLCSQD---NGPWKCPMDRVFFDASVIWGLVGPRRIFGN  587

Query  1890  EGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSW  2069
              G Y  +NWFFLGG + P+IVW+ H+ FP + WI LI++PVLLGAT  MPPA+++NY+SW
Sbjct  588   LGEYGGVNWFFLGGAVAPLIVWIFHKAFPRKEWISLIHMPVLLGATSMMPPASAVNYTSW  647

Query  2070  ILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWG--TT  2243
             I+VG +  + +FRYR +WW+RYNY+LS GLDAG AFM +L++F +G  D  ++WWG  + 
Sbjct  648   IIVGFLSGYVLFRYRTEWWKRYNYVLSGGLDAGTAFMTLLIFFALGYWDVGLTWWGSNSN  707

Query  2244  DLEHCDLASCPTAKGIAVDGCPVF  2315
             + E C LASCPTAKGI VDGCPV 
Sbjct  708   NPEGCLLASCPTAKGIVVDGCPVL  731



>ref|XP_009108224.1| PREDICTED: oligopeptide transporter 7 [Brassica rapa]
Length=765

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/724 (59%), Positives = 563/724 (78%), Gaps = 15/724 (2%)
 Frame = +3

Query  147   PIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVAT  326
             PI EV LTV  TDDP+LPV TFRMWVLG +SC+LLSFLNQFF YRREPL I++I+ Q+A 
Sbjct  55    PIREVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRREPLSISAISAQIAV  114

Query  327   LPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAVG  506
             +P+GR MAA +    F + G    +F+LNPGPFN+KEHVLITIFANAG      S YA+ 
Sbjct  115   VPLGRLMAAKISDRVF-LQG-SKWEFTLNPGPFNVKEHVLITIFANAGAG----SVYAIH  168

Query  507   IVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFRT  686
             +V ++ AFY + I+FF  +++I+TTQVLG+GWAG+ +KY+VEPA MWWP+ LVQ+SLFR 
Sbjct  169   VVTVVKAFYMKNITFFVSFVVIVTTQVLGFGWAGIFRKYLVEPAEMWWPANLVQVSLFRA  228

Query  687   LHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAH  866
             LHEKEE   GG    ++R +FFVI+  CSF +Y FPGY+FQ L S+SWVCW FP SV A 
Sbjct  229   LHEKEERTKGG----LTRTQFFVIAFVCSFAYYVFPGYLFQMLTSLSWVCWFFPTSVMAQ  284

Query  867   QlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNV  1046
             Q+GSGL+GLG+GA+ LDWSTI+S+L SPL  P+FA  NV VG+ + +Y+V+PI YW L+V
Sbjct  285   QIGSGLHGLGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLAIYVVVPICYW-LDV  343

Query  1047  YNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFAT  1226
             + AK FPLYSS LFT++G +Y+I++I++ +F LD   Y ++G +YLSTFF++SYG GFA 
Sbjct  344   FKAKTFPLYSSSLFTSEGSKYNITSIIDSKFHLDLQAYEREGPLYLSTFFAISYGIGFAA  403

Query  1227  IASTITHVALFYGREIYDRYRASTK-GKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLA  1403
             +++TI HV+LF+GREI+D+ + S K  K+DIHT+LM+ YK++P WWF+ +L + I+V++ 
Sbjct  404   LSATIVHVSLFHGREIWDQSKQSFKEKKIDIHTRLMRRYKEVPEWWFWCILAINISVTIF  463

Query  1404  LCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPI  1583
              C +  D++Q+P+WG++ A ++A +FTLPI I+TA TNQ PGLNIITEYI+G IYPG P+
Sbjct  464   ACEYYIDQLQLPWWGVLLACSVAIIFTLPIGILTAITNQAPGLNIITEYIIGYIYPGYPV  523

Query  1584  ANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLH  1763
             AN+CFK YGY+SM QA+ FL DFKLGHYMKIPPR+MF+ Q +GTL++  + ++ AWWL+ 
Sbjct  524   ANMCFKVYGYISMKQAVLFLQDFKLGHYMKIPPRNMFMAQIVGTLLSCLVYLATAWWLME  583

Query  1764  SIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGP  1943
             +I NIC  D +SNS WTCPSD+VF+DASVIWGL+GP+RIF   G Y ++NWFFL G + P
Sbjct  584   TIPNIC--DSISNSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIAP  641

Query  1944  VIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKW  2123
             V+VWL  R FP Q WI LIN+PVL+ A  SMPPAT++NY++W+L G +  F VFRYR   
Sbjct  642   VLVWLASRMFPRQQWIKLINMPVLISAISSMPPATAVNYTTWLLAGFLSGFVVFRYRPHL  701

Query  2124  WQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDG  2303
             WQRYNY+LS  LDAG+AFM VLLY  +GLE+ ++ WWG  +L+ C LASCPTA  I VDG
Sbjct  702   WQRYNYVLSGALDAGLAFMGVLLYMCLGLENVSLDWWG-NELDGCPLASCPTAANIIVDG  760

Query  2304  CPVF  2315
             CP++
Sbjct  761   CPLY  764



>ref|XP_009412736.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
Length=759

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/727 (59%), Positives = 558/727 (77%), Gaps = 16/727 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIE+V LTV   DDPT PV TFRMWVLG  SCVLLSFLNQFF YR+EPL ITSI+ Q+A
Sbjct  46    SPIEQVALTVPVEDDPTTPVLTFRMWVLGTASCVLLSFLNQFFWYRKEPLSITSISAQIA  105

Query  324   TLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIfanagfafgngSAYA  500
              +P+G  MA+ +     R+   GS  +F+LNPGPFNMKEHVLITIFAN+G      S YA
Sbjct  106   VVPLGHLMASTITD---RVFFKGSRWEFTLNPGPFNMKEHVLITIFANSGAG----SVYA  158

Query  501   VGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLF  680
             + +V  +  FY++ I+FF  +L++ITTQVLG+GWAG+ ++Y+VEPA MWWP  LVQ+SLF
Sbjct  159   IHVVTAVKIFYQKHITFFVSFLVVITTQVLGFGWAGIFRRYLVEPAAMWWPYNLVQVSLF  218

Query  681   RTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVT  860
             R LHEKEE   GG    M+R +FF+++  CSF +Y FPGY+   L S+SWVCW+FP+S+ 
Sbjct  219   RALHEKEERVKGG----MTRNQFFMVAFVCSFAYYVFPGYLVSMLTSLSWVCWIFPQSIL  274

Query  861   AHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGL  1040
             A QLGSGL GLG+GA+ LDWSTI+S++ SPL  P+FA  NV  G+ +IMY++ PISYW L
Sbjct  275   AQQLGSGLYGLGIGAIGLDWSTISSYIGSPLASPWFATANVAAGFVLIMYVITPISYW-L  333

Query  1041  NVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGF  1220
             N+Y AK FP++S  LFT+ GQ Y+IS+I++  F LD   Y K G +YLSTFF+++YG GF
Sbjct  334   NLYKAKTFPIFSDGLFTSTGQGYNISSIIDSNFHLDIMAYEKNGPLYLSTFFAVTYGIGF  393

Query  1221  ATIASTITHVALFYGREIYDRYRASTK-GKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVS  1397
             A++ +TI+HV LF+G EI+   +++ K  KMDIHTKLM  Y  +P WWF  +L+  IA++
Sbjct  394   ASLTATISHVLLFHGSEIWQMSKSAFKEKKMDIHTKLMSRYDQVPQWWFIAVLIANIALT  453

Query  1398  LALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGK  1577
             +  C +  D++Q+P+WG++ A  +A  FTLPI IITATTNQTPGLNIITEYIMG +YPG+
Sbjct  454   IFACEYYIDQLQLPWWGVLLACFIAIFFTLPIGIITATTNQTPGLNIITEYIMGYLYPGR  513

Query  1578  PIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWL  1757
             P+AN+CFK YGY+SMTQA+ FL DFKLGHYMKIPPR+MF+ Q +GT+IA  + +  AWWL
Sbjct  514   PVANMCFKVYGYISMTQALTFLQDFKLGHYMKIPPRTMFMAQVVGTVIAAMVYLGTAWWL  573

Query  1758  LHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGI  1934
             + +I +IC+++ L S+SPWTCP D VF+DASVIWGL+GP+RIF   G Y+ +NWFFL G 
Sbjct  574   METIPDICNKELLPSDSPWTCPGDHVFYDASVIWGLIGPRRIFGDLGTYSNVNWFFLAGA  633

Query  1935  LGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYR  2114
             L PV+VW  H+ FP+Q WI LIN+PVL+GATGSMPPAT++NY +WI+VG +  + V+RYR
Sbjct  634   LAPVLVWFGHKAFPNQEWIRLINMPVLIGATGSMPPATAVNYITWIIVGFLSGYVVYRYR  693

Query  2115  KKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIA  2294
             + WWQR+NY+LS  LDAG+AFM VLLY  +GLE+  +SW G  DL+ C LASCPTAKG+ 
Sbjct  694   RDWWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVNLSWPG-NDLDGCPLASCPTAKGVV  752

Query  2295  VDGCPVF  2315
             ++GCPVF
Sbjct  753   IEGCPVF  759



>ref|XP_009608843.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana tomentosiformis]
Length=757

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/739 (58%), Positives = 565/739 (76%), Gaps = 16/739 (2%)
 Frame = +3

Query  102   ALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYR  281
             +L+L  ++ ++EE SPI++V LTV  TDDP+LPV TFRMW LG +SCVLLSFLNQFF YR
Sbjct  31    SLELKKQEEDEEENSPIKQVALTVPITDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYR  90

Query  282   REPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIf  458
              EPL IT+I+ Q+A +P+G+ MAA +     R+   GS  +F+LNPGPFN+KEHVLITIF
Sbjct  91    TEPLTITAISAQIAVVPLGQLMAAKITK---RVFFQGSKWEFTLNPGPFNVKEHVLITIF  147

Query  459   anagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPA  638
             AN+G      + YA+ +V  +  FY++ I+FF   +++ITTQVLG+GWAG+ ++Y+VEPA
Sbjct  148   ANSGAG----TVYAIHVVTAVKVFYQKNITFFVSLIVVITTQVLGFGWAGIFRRYLVEPA  203

Query  639   HMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLA  818
              MWWP+ LVQ+SLFR LHEKEE    G    ++R +FF+I+  CSF +Y FPGY+F  L 
Sbjct  204   AMWWPANLVQVSLFRALHEKEERPKCG----LTRTQFFLIAFICSFAYYVFPGYLFSMLT  259

Query  819   SISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYA  998
             S+SW+CW+FPKSV A QLGSGLNGLG+GA+ LDWS+I+S+L SPL  P+FA  NV VG+ 
Sbjct  260   SLSWICWIFPKSVFAQQLGSGLNGLGIGAIGLDWSSISSYLGSPLASPWFATANVAVGFF  319

Query  999   IIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRI  1178
              IMY++ PI YW L+V+ AK FP++S  LFT+ GQ Y+IS+I++  F LD   Y +QG +
Sbjct  320   FIMYILTPICYW-LDVFKAKTFPIFSDGLFTSSGQVYNISSIIDSNFHLDIAAYEQQGHL  378

Query  1179  YLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTK-GKMDIHTKLMKNYKDIPS  1355
             YLSTFF ++YG GFA +++T+ HV +F+GREI+++ ++S K  KMDIHTKLM  Y  +P 
Sbjct  379   YLSTFFVITYGVGFAALSATVMHVLIFHGREIWEQSKSSFKEKKMDIHTKLMSKYNQVPE  438

Query  1356  WWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLN  1535
             WWF+ +LV  I +++  C + N+++Q+P+WG+I A  +A  FTLPI IITA TNQTPGLN
Sbjct  439   WWFWCILVANITLTVFACEYYNEQLQLPWWGVILACVIAIFFTLPIGIITAITNQTPGLN  498

Query  1536  IITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGT  1715
             IITEYI+G +YPG P+AN+CFK YGY+SM QAI FL DFKLGHYMKIPPR+MF+ Q +GT
Sbjct  499   IITEYIIGYLYPGYPVANMCFKVYGYISMNQAITFLQDFKLGHYMKIPPRTMFMAQIVGT  558

Query  1716  LIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEG  1895
             LIAG + +  AWWL+ +I +IC++  LSN+ WTCPSD VF+DASVIWGL+ P+RIF   G
Sbjct  559   LIAGFVYLGTAWWLMETIPDICNK-TLSNTVWTCPSDHVFYDASVIWGLIAPRRIFGDLG  617

Query  1896  NYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWIL  2075
              Y  +NWFFL G + PV+VWL  R FP Q WI LIN+PVL+GATG MPPAT++NY++WI+
Sbjct  618   TYEMVNWFFLFGAIAPVLVWLAARAFPKQEWIKLINMPVLIGATGMMPPATAVNYATWII  677

Query  2076  VGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEH  2255
             VG +  + V+RYR  WWQR+NY+LS  LDAG+AFMAVLLY  +GLE+ +++WWG  DL+ 
Sbjct  678   VGFLSGYVVYRYRPDWWQRHNYVLSGALDAGLAFMAVLLYMCLGLENVSVNWWG-NDLDG  736

Query  2256  CDLASCPTAKGIAVDGCPV  2312
             C  ASCPTAKGI   GCPV
Sbjct  737   CPYASCPTAKGIVKQGCPV  755



>ref|XP_010455470.1| PREDICTED: oligopeptide transporter 7-like [Camelina sativa]
Length=767

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/726 (59%), Positives = 562/726 (77%), Gaps = 17/726 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPI +V LTV  TDDP+LPV TFRMWVLG +SC+LLSFLNQFF YR EPL I++I+ Q+A
Sbjct  56    SPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQIA  115

Query  324   TLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIfanagfafgngSAYA  500
              +P+GR MAA +     R+   GS  QF+LNPGPFN+KEHVLITIFANAG      S YA
Sbjct  116   VVPLGRLMAAKISE---RVYFQGSKWQFTLNPGPFNVKEHVLITIFANAGAG----SVYA  168

Query  501   VGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLF  680
             + +V ++ AFY + I+FF  +++I+TTQVLG+GWAG+ +KY+VEPA MWWP+ LVQ+SLF
Sbjct  169   IHVVTVVKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLF  228

Query  681   RTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVT  860
             R LHEKEE   GG    ++R +FF+I+  CSF +Y FPGY+FQ + S+SWVCW FP SV 
Sbjct  229   RALHEKEERTKGG----LTRTQFFLIAFVCSFAYYVFPGYLFQIMTSLSWVCWFFPSSVM  284

Query  861   AHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGL  1040
             A Q+GSGL+GLG+GA+ LDWSTI+S+L SPL  P+FA  NV VG+ +++Y+++PI YW L
Sbjct  285   AQQIGSGLHGLGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLVIYVLVPICYW-L  343

Query  1041  NVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGF  1220
             +V+ AK FP++SS LFT QG +Y+I +I++  F LD   Y ++G +YLSTFF++SYG GF
Sbjct  344   DVFKAKTFPIFSSSLFTEQGSKYNIKSIIDSNFHLDLPAYEREGPLYLSTFFAISYGVGF  403

Query  1221  ATIASTITHVALFYGREIYDRYRASTK-GKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVS  1397
             A +++TI HVALF+GREI+++   S K  K+D+H +LMK+YK +P WWF+ +LV  I  +
Sbjct  404   AALSATIMHVALFHGREIWEQSTESFKEKKLDVHARLMKSYKQVPEWWFWCILVTNIGAT  463

Query  1398  LALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGK  1577
             +  C + ND++Q+P+WG++ A A+A +FTLPI IITA TNQ PGLNIITEYI+G IYPG 
Sbjct  464   IFACEYYNDQLQLPWWGVLLACAIAIIFTLPIGIITAITNQAPGLNIITEYIIGYIYPGY  523

Query  1578  PIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWL  1757
             P+AN+CFK YGY+SM QAI FL DFKLGHYMKIPPR+MF+ Q +GTLI+  + ++ AWWL
Sbjct  524   PVANMCFKVYGYISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCLVYLTTAWWL  583

Query  1758  LHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGIL  1937
             + +I NIC  D +SNS WTCP+D+VF+DASVIWGL+GP+RIF   G Y ++NWFFL G +
Sbjct  584   METIPNIC--DMVSNSVWTCPTDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAI  641

Query  1938  GPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRK  2117
              P++VWL  R FP Q WI LIN+PVL+ AT SMPPAT++NY++W+L G +  F VFRYR 
Sbjct  642   APILVWLASRMFPRQEWIKLINMPVLISATSSMPPATAVNYTTWVLAGFLSGFVVFRYRP  701

Query  2118  KWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAV  2297
               WQRYNY+LS  LDAG+AFM VLLY  +GLE+ ++ WWG  +L+ C LASCPTA GI+V
Sbjct  702   NLWQRYNYVLSGALDAGLAFMGVLLYMCLGLENVSLDWWG-NELDGCPLASCPTAPGISV  760

Query  2298  DGCPVF  2315
             +GCP++
Sbjct  761   EGCPLY  766



>emb|CDX86844.1| BnaA09g22340D [Brassica napus]
Length=765

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/725 (59%), Positives = 562/725 (78%), Gaps = 15/725 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPI EV LTV  TDDP+LPV TFRMWVLG +SC+LLSFLNQFF YRREPL I++I+ Q+A
Sbjct  54    SPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRREPLSISAISAQIA  113

Query  324   TLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
              +P+GR MAA +    F + G    +F+LNPGPFN+KEHVLITIFANAG      S YA+
Sbjct  114   VVPLGRLMAAKISDRVF-LQG-SKWEFTLNPGPFNVKEHVLITIFANAGAG----SVYAI  167

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFR  683
              +V ++ AFY + I+FF  +++I+TTQVLG+GWAG+ +KY+VEPA MWWP+ LVQ+SLFR
Sbjct  168   HVVTVVKAFYMKNITFFVSFVVIVTTQVLGFGWAGIFRKYLVEPAEMWWPANLVQVSLFR  227

Query  684   TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTA  863
              LHEKEE   GG    ++R +FFVI+  CSF +Y FPGY+FQ L S+SWVCW FP SV A
Sbjct  228   ALHEKEERTKGG----LTRTQFFVIAFVCSFAYYVFPGYLFQMLTSLSWVCWFFPTSVMA  283

Query  864   HQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLN  1043
              Q+GSGL+GLG+GA+ LDWSTI+S+L SPL  P+FA  NV VG+ + +Y+V+PI YW L+
Sbjct  284   QQIGSGLHGLGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLAIYVVVPICYW-LD  342

Query  1044  VYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFA  1223
             V+ AK FPLYSS LFT++G +Y+I++I++ +F LD   Y ++G +YLSTFF++SYG GFA
Sbjct  343   VFKAKTFPLYSSSLFTSEGSKYNITSIIDSKFHLDLQAYEREGPLYLSTFFAISYGIGFA  402

Query  1224  TIASTITHVALFYGREIYDRYRASTK-GKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSL  1400
              +++TI HV+LF+GREI+D+ + S K  K+DIHT+LM+ YK +P WWF+ +L + I+V++
Sbjct  403   ALSATIVHVSLFHGREIWDQSKQSFKEKKIDIHTRLMRRYKAVPEWWFWCILAINISVTI  462

Query  1401  ALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKP  1580
               C +  D++Q+P+WG++ A ++A +FTLPI I+TA TNQ PGLNIITEYI+G IYPG P
Sbjct  463   FACEYYIDQLQLPWWGVLLACSVAIIFTLPIGILTAITNQAPGLNIITEYIIGYIYPGYP  522

Query  1581  IANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLL  1760
             +AN+CFK YGY+SM QA+ FL DFKLGHYMKIPPR+MF+ Q +GTL++  + +  AWWL+
Sbjct  523   VANMCFKVYGYISMKQAVLFLQDFKLGHYMKIPPRNMFMAQIVGTLLSCLVYLVTAWWLM  582

Query  1761  HSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILG  1940
              +I NIC  D +SNS WTCPSD+VF+DASVIWGL+GP+RIF   G Y ++NWFFL G + 
Sbjct  583   ETIPNIC--DSISNSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIA  640

Query  1941  PVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKK  2120
             PV+VWL  R FP Q WI LIN+PVL+ A  SMPPAT++NY++W+L G +  F VFRYR  
Sbjct  641   PVLVWLASRMFPRQQWIKLINMPVLISAISSMPPATAVNYTTWLLAGFLSGFVVFRYRPH  700

Query  2121  WWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVD  2300
              WQRYNY+LS  LDAG+AFM VLLY  +GLE+ ++ WWG  +L+ C LASCPTA  I VD
Sbjct  701   LWQRYNYVLSGALDAGLAFMGVLLYMCLGLENVSLDWWG-NELDGCPLASCPTAANIIVD  759

Query  2301  GCPVF  2315
             GCP++
Sbjct  760   GCPLY  764



>ref|XP_009359568.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7-like 
[Pyrus x bretschneideri]
Length=757

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/725 (58%), Positives = 559/725 (77%), Gaps = 18/725 (2%)
 Frame = +3

Query  147   PIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVAT  326
             P+E+V LTV  TDDP+LPV TFRMWVLG +SCVLLSFLNQFF YR EPL IT+I+ Q+A 
Sbjct  48    PVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAV  107

Query  327   LPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
             +P+G+ MA+ +     R+   GS  +F+LNPGPFN+KEHVLITIFAN+G      + YA+
Sbjct  108   VPLGQLMASKITN---RVFFKGSRWEFTLNPGPFNVKEHVLITIFANSGAG----TVYAI  160

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLFR  683
              IV ++  FY++ I+FF   L+I+TTQVLG+GWAG+ ++Y+VEPA MWWP+ LVQ+SLFR
Sbjct  161   HIVTVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFR  220

Query  684   TLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTA  863
              LHEKE    GG    ++R +FF+IS  CSF +Y FPGY+FQ L S+SW+CW+FP +V A
Sbjct  221   ALHEKEARPKGG----LTRTQFFLISFMCSFAYYVFPGYLFQMLTSLSWICWIFPNNVLA  276

Query  864   HQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLN  1043
              QLGSGL GLG+GA+ +DWSTI+S+L SPL  P+FA  NV  G+  +MY++ PI YW  N
Sbjct  277   QQLGSGLYGLGIGAVGIDWSTISSYLGSPLASPWFATANVAAGFFFVMYILTPICYW-FN  335

Query  1044  VYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFA  1223
             +Y AK FP++S  LFT+ GQEY+I+AI++  F LD + Y ++G +YLSTFF+++YG GFA
Sbjct  336   IYKAKTFPIFSDTLFTSNGQEYNITAIIDSNFHLDLEAYEREGPLYLSTFFAITYGVGFA  395

Query  1224  TIASTITHVALFYGREIYDRYRASTK-GKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSL  1400
              + +T+ HVALF+GREI+++ +AS K  KMD+HT+LM+ Y  +P WWF ++L+V IAV++
Sbjct  396   ALTATVVHVALFHGREIWEQSKASFKEKKMDVHTRLMQRYNQVPEWWFVIILLVNIAVTI  455

Query  1401  ALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKP  1580
               C +  +++Q+P+WG++ A  +A +FTLPI IITA TNQTPGLNIITEYI+G IYPG P
Sbjct  456   FSCQYYIEQLQLPWWGVLLACVIAIVFTLPIGIITAITNQTPGLNIITEYIIGYIYPGYP  515

Query  1581  IANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLL  1760
             +AN+CFK YG +SMTQAI FL DFKLGHYMKIPPR+MF  Q +GTLIA  + +  AWWL+
Sbjct  516   VANMCFKVYGXISMTQAITFLQDFKLGHYMKIPPRTMFTAQVVGTLIAAIVYLGTAWWLM  575

Query  1761  HSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILG  1940
              +I +IC     ++S WTCPSD VF+DASVIWGL+GP+RIF   G Y A+NWFFL G + 
Sbjct  576   ETIPDICED---TSSIWTCPSDTVFYDASVIWGLIGPRRIFGDLGIYEAINWFFLVGAIA  632

Query  1941  PVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKK  2120
             P+ VWL  + FP Q WI LIN+PVL+GATG MPPAT++NY+SWI++G +  F V+RYR  
Sbjct  633   PIFVWLAAKAFPQQEWIRLINMPVLIGATGLMPPATAVNYTSWIILGFLSGFVVYRYRPN  692

Query  2121  WWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVD  2300
             WW+R+NY+LS  LDAG+AFM VLLYF++GLED ++SWWG  DL+ C LA+CPTAKG+ V+
Sbjct  693   WWRRHNYVLSGALDAGLAFMGVLLYFSLGLEDISLSWWG-NDLDGCPLATCPTAKGVVVE  751

Query  2301  GCPVF  2315
             GCP +
Sbjct  752   GCPTY  756



>ref|XP_010252553.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=731

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/731 (58%), Positives = 562/731 (77%), Gaps = 16/731 (2%)
 Frame = +3

Query  132   DEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSIT  311
             + E S I++V LTV  TDDP  PV TFRMWVLG+VSCVLLSFLNQFF YR EP+ IT ++
Sbjct  14    ESENSSIKQVALTVPTTDDPNQPVLTFRMWVLGIVSCVLLSFLNQFFWYRTEPISITGLS  73

Query  312   VQVATLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIfanagfafgng  488
              Q+A +P+G  MA+ +     R+   G+  +FS+NPGPFN+KEHVLITIFANAG      
Sbjct  74    AQIAVVPLGHLMASTVTK---RVFFKGTRWEFSMNPGPFNVKEHVLITIFANAGAG----  126

Query  489   SAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQ  668
             + YA  I++ +  FY+RK++F    L+I+TTQ+LG+GWAGL ++Y+VEPA MWWP+ LVQ
Sbjct  127   TVYATHILSAVKLFYKRKLTFIPALLVILTTQMLGFGWAGLFRRYLVEPAEMWWPNNLVQ  186

Query  669   ISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFP  848
             +SLFR LHEKE+   GG    ++R +FF++ L CSF +Y FPGY+F  L S+SWVCW+FP
Sbjct  187   VSLFRALHEKEKRPKGG----VTRTQFFLMVLVCSFAYYVFPGYLFPMLTSLSWVCWIFP  242

Query  849   KSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPIS  1028
             KS+ A QLGSGL GLG+GA+ LDWST++S+L SPL  P+FA  N+ VG+AI+MY++ PIS
Sbjct  243   KSILAQQLGSGLEGLGIGAIGLDWSTVSSYLGSPLASPWFATANIAVGFAILMYVITPIS  302

Query  1029  YWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSY  1208
             YW  + Y AK FPL+SS LFT  GQ+Y+IS+I+N +F +D + Y   G ++LSTFF++SY
Sbjct  303   YW-FDFYQAKTFPLFSSGLFTRTGQKYNISSIINDKFHIDMNAYEHNGPLHLSTFFAISY  361

Query  1209  GFGFATIASTITHVALFYGREIYDRYRASTK-GKMDIHTKLMKNYKDIPSWWFYVLLVVT  1385
             G GFA + +T+ HV +F+GREI+   R++ K  KMD+HT+LM+ YK +P WWF  +LVV 
Sbjct  362   GAGFAALTATVVHVLVFHGREIWQLSRSALKESKMDVHTRLMRRYKQVPQWWFICVLVVI  421

Query  1386  IAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGII  1565
             IA +   C + ND++Q+P+WG++ A  LA +FTLPI II ATTNQ+PGLNIITEYIMG +
Sbjct  422   IATTFFACGYYNDQLQLPWWGVLLACFLAILFTLPIGIIAATTNQSPGLNIITEYIMGYL  481

Query  1566  YPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSV  1745
             YPG+P+AN+CFK YGY+SMTQA+ F+SDFKLGHYMKIPPR+MF+ Q IGTLIAG + ++ 
Sbjct  482   YPGRPVANICFKVYGYISMTQALTFISDFKLGHYMKIPPRAMFMAQMIGTLIAGFVYLAT  541

Query  1746  AWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFF  1922
             AWWL+ +I N+C  + L  NSPWTCP DRVF+DASVIWGL+GP+RIF   G Y A+NWFF
Sbjct  542   AWWLMKTIPNLCDTNLLPDNSPWTCPMDRVFYDASVIWGLIGPRRIFGDLGTYPAVNWFF  601

Query  1923  LGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFV  2102
             LGG + P++VW  H+ FP+Q WI LIN+P+L+GATG MPPAT++N++ WI++G +  F +
Sbjct  602   LGGAVAPLLVWAAHKVFPNQKWIRLINMPILIGATGMMPPATAVNFTVWIIIGFLSGFVI  661

Query  2103  FRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTA  2282
             +RYR+ WWQR+NY+LS  LDAG+AFM VLL+  +G ++ +I WWG +  + C LASCPTA
Sbjct  662   YRYRQGWWQRHNYVLSGALDAGLAFMGVLLFLCLGSKNISIDWWGASP-DGCPLASCPTA  720

Query  2283  KGIAVDGCPVF  2315
             KG+ VD CPVF
Sbjct  721   KGVVVDHCPVF  731



>ref|XP_002874647.1| ATOPT7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50906.1| ATOPT7 [Arabidopsis lyrata subsp. lyrata]
Length=764

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/745 (58%), Positives = 571/745 (77%), Gaps = 17/745 (2%)
 Frame = +3

Query  87    EIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQ  266
             E E   L ++GE+  +EE SPI +V LTV  TDDP+LPV TFRMWVLG +S +LLSFLNQ
Sbjct  34    ETEDLLLPISGEEEEEEENSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSGILLSFLNQ  93

Query  267   FFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHV  443
             FF YR EPL I++I+ Q+A +P+GR MAA +     R+   GS  QF+LNPGPFN+KEHV
Sbjct  94    FFWYRTEPLTISAISAQIAVVPLGRLMAAKISD---RVFFQGSKWQFTLNPGPFNVKEHV  150

Query  444   LITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKY  623
             LITIFANAG      S YA+ +V ++ AFY + I+FF  +++I+TTQVLG+GWAG+ +KY
Sbjct  151   LITIFANAGAG----SVYAIHVVTVVKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKY  206

Query  624   VVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYI  803
             +VEPA MWWP+ LVQ+SLFR LHEKEE   GG    ++R +FFVI+  CSF +Y FPGY+
Sbjct  207   LVEPAAMWWPANLVQVSLFRALHEKEERTKGG----LTRTQFFVIAFVCSFAYYVFPGYL  262

Query  804   FQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNV  983
             FQ + S+SWVCW FP SV A Q+GSGL+GLG+GA+ LDWSTI+S+L SPL  P+FA  NV
Sbjct  263   FQIMTSLSWVCWFFPSSVMAQQIGSGLHGLGVGAIGLDWSTISSYLGSPLASPWFATANV  322

Query  984   FVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYA  1163
              VG+ +++Y+++PI YW L+VY AK FP++SS LFT+QG +Y+I++I++  F LD   Y 
Sbjct  323   GVGFVLVIYVLVPICYW-LDVYKAKTFPIFSSSLFTSQGSKYNITSIIDSNFHLDLPSYE  381

Query  1164  KQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTK-GKMDIHTKLMKNY  1340
             ++G +YL TFF++SYG GFA +++TI HVALF+GREI+++ + S K  K+D+H +LM+ Y
Sbjct  382   REGPLYLCTFFAISYGVGFAALSATIMHVALFHGREIWEQSKESFKEKKLDVHARLMQRY  441

Query  1341  KDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQ  1520
             K +P WWF+ +LV  +  ++  C + ND++Q+P+WG++ A  +A +FTLPI IITA TNQ
Sbjct  442   KQVPEWWFWCILVTNVGATIFACEYYNDQLQLPWWGVLLACTVAIIFTLPIGIITAITNQ  501

Query  1521  TPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLV  1700
              PGLNIITEYI+G IYPG P+AN+CFK YGY+SM QAI FL DFKLGHYMKIPPR+MF+ 
Sbjct  502   APGLNIITEYIIGYIYPGYPVANMCFKVYGYISMQQAITFLQDFKLGHYMKIPPRTMFMA  561

Query  1701  QFIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRI  1880
             Q +GTLI+  + ++ AWWL+ +I NIC  D +SNS WTCPSD+VF+DASVIWGL+GP+RI
Sbjct  562   QIVGTLISCLVYLTTAWWLMETIPNIC--DSVSNSVWTCPSDKVFYDASVIWGLIGPRRI  619

Query  1881  FDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNY  2060
             F   G Y ++NWFFL G + PV+VWL  R FP Q WI LIN+PVL+ AT SMPPAT++NY
Sbjct  620   FGDLGLYKSVNWFFLVGAIAPVLVWLASRMFPRQEWIKLINMPVLISATSSMPPATAVNY  679

Query  2061  SSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGT  2240
             ++W+L G +  F VFRYR   WQRYNY+LS  LDAG+AFM VLLY  +GLE+ ++ WWG 
Sbjct  680   TTWVLAGFLSGFVVFRYRPNLWQRYNYVLSGALDAGLAFMGVLLYMCLGLENVSLDWWG-  738

Query  2241  TDLEHCDLASCPTAKGIAVDGCPVF  2315
              +L+ C LASCPTA GI V+GCP++
Sbjct  739   NELDGCPLASCPTAPGIIVEGCPLY  763



>gb|KFK31865.1| hypothetical protein AALP_AA6G168500 [Arabis alpina]
Length=755

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/744 (57%), Positives = 564/744 (76%), Gaps = 18/744 (2%)
 Frame = +3

Query  87    EIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQ  266
             E E  +L ++ E+   EE SPI +V LTV  TDDP+LPV TFRMWVLG +SC+LLSFLNQ
Sbjct  28    ETEDLSLPISEEE---EENSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQ  84

Query  267   FFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVL  446
             FF YR EPL I++I+ Q+A +P+GR MAA +    F    +   +F+LNPGPFN+KEHVL
Sbjct  85    FFWYRTEPLTISAISAQIAVVPLGRLMAAKISDRVFLQGSYW--EFTLNPGPFNVKEHVL  142

Query  447   ITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYV  626
             ITIFANAG      S YA+ +V ++ AFY + I+FF   ++I+TTQVLG+GWAG+ +KY+
Sbjct  143   ITIFANAGAG----SVYAIHVVTVVKAFYMKNITFFVSLIVIVTTQVLGFGWAGIFRKYL  198

Query  627   VEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIF  806
             VEPA MWWP+ LVQ+SLFR LHEKEE   GG    ++R +FF+I+  CSF +Y FPGY+F
Sbjct  199   VEPAAMWWPANLVQVSLFRALHEKEERAKGG----VTRTQFFLIAFVCSFAYYVFPGYLF  254

Query  807   QTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVF  986
             Q + S+SWVCW FP SV A Q+GSGL+GLG+GA+ LDWSTI+S+L SPL  P+FA  NV 
Sbjct  255   QMMTSLSWVCWFFPTSVMAQQIGSGLHGLGVGAIGLDWSTISSYLGSPLASPWFATANVG  314

Query  987   VGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAK  1166
             VG+ + +Y+++PI YW L+VY AK FPL+SS LFT QG +Y+I+ I++  F LD   Y +
Sbjct  315   VGFVLAIYVLIPICYW-LDVYQAKTFPLFSSSLFTNQGSKYNITTIIDSNFHLDLQAYER  373

Query  1167  QGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTK-GKMDIHTKLMKNYK  1343
             +G +YLSTFF++SYG GFA +++TI HVALF+GREI+++ + S K  K+D+H +LMK YK
Sbjct  374   EGPLYLSTFFAISYGIGFAALSATIMHVALFHGREIWEQSKESFKEKKLDVHARLMKRYK  433

Query  1344  DIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQT  1523
              +P WWF+ +LV  +  ++  C + ND++Q+P+WG++ A  +A +FTLPI IITA TNQ 
Sbjct  434   QVPDWWFWCILVTNVGATIFACEYYNDQLQLPWWGVLLACTIAIIFTLPIGIITAITNQA  493

Query  1524  PGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQ  1703
             PGLNIITEYI+G IYPG P+AN+CFK YGY+SM QAI FL DFKLGHYMKIPPR+MF+ Q
Sbjct  494   PGLNIITEYIIGYIYPGYPVANMCFKVYGYISMQQAITFLQDFKLGHYMKIPPRTMFMAQ  553

Query  1704  FIGTLIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIF  1883
              +GTLI+  + +  AWWL+ +I NIC  D ++NS WTCP D+VF+DASVIWGL+GP+RIF
Sbjct  554   IVGTLISCLVYLVTAWWLMETIPNIC--DSVTNSLWTCPGDKVFYDASVIWGLIGPRRIF  611

Query  1884  DSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYS  2063
                G Y ++NWFFL G + P++VW+  R FP Q WI L+N+PVL+ A  SMPPAT++NY+
Sbjct  612   GDLGLYKSVNWFFLVGAIAPILVWIASRMFPRQEWIKLVNMPVLISAISSMPPATAVNYT  671

Query  2064  SWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTT  2243
             +W+L G +  F VFRYR   WQRYNY+LS  LDAG+AFM VLLY  +GLE+ ++ WWG  
Sbjct  672   TWLLAGFLSGFVVFRYRPNLWQRYNYVLSGALDAGLAFMGVLLYMCLGLENISLDWWG-N  730

Query  2244  DLEHCDLASCPTAKGIAVDGCPVF  2315
             DL+ C LA+CPTA GI+V+GCP++
Sbjct  731   DLDGCPLAACPTAPGISVEGCPLY  754



>ref|XP_011070370.1| PREDICTED: oligopeptide transporter 7 [Sesamum indicum]
Length=753

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/734 (58%), Positives = 563/734 (77%), Gaps = 19/734 (3%)
 Frame = +3

Query  123   DVNDE--EVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLI  296
              VN+E  E SPI++V LTV  TDDPTLPV TFRMW LG +SCVLLSFLNQFF YR EPL 
Sbjct  33    QVNEEPGENSPIKQVALTVPTTDDPTLPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLS  92

Query  297   ITSITVQVATLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIfanagf  473
             IT+I+ Q+A +P+G+ MAA +     R+   G+  +F+LNPGPFN+KEHVLITIFAN+G 
Sbjct  93    ITAISAQIAVVPLGQLMAAKITD---RVFFRGTRWEFTLNPGPFNVKEHVLITIFANSGA  149

Query  474   afgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWP  653
                  + YA+ +V  +  FY++ ISFF   +++ITTQVLG+GWAG+ ++Y+VEPA MWWP
Sbjct  150   G----TVYAIHVVTAVKVFYKQHISFFVSLIVVITTQVLGFGWAGIYRRYLVEPAAMWWP  205

Query  654   STLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWV  833
             + LVQ+SLFR LHEK+E   GG    ++R +FF+I+  CSF +Y FPGY+FQ L S+SW+
Sbjct  206   ANLVQVSLFRALHEKDERPKGG----VTRTQFFIIAFICSFAYYIFPGYLFQMLTSLSWI  261

Query  834   CWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYL  1013
             CW+FPKSV A QLGSGL GLG+GA+ LDWSTI+S+L SPL  P+FA  NV VG+  +MY+
Sbjct  262   CWIFPKSVIAQQLGSGLKGLGIGAIGLDWSTISSYLGSPLASPWFATANVAVGFFFVMYV  321

Query  1014  VMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTF  1193
             V P+SYW LN+Y AK FP++S DLFT+ GQ Y+IS+I++  F LD   Y ++G ++LSTF
Sbjct  322   VTPLSYW-LNIYEAKTFPIFSDDLFTSSGQIYNISSIIDLNFHLDAAAYQREGPLHLSTF  380

Query  1194  FSLSYGFGFATIASTITHVALFYGREIYDRYRAS-TKGKMDIHTKLMKNYKDIPSWWFYV  1370
             F+++YG GFA +++T+ HV LF+GREI+++ ++S  + KMDIHTKLM  Y+ +P WWF+ 
Sbjct  381   FAMTYGVGFAALSATVMHVLLFHGREIWEQSKSSFNQKKMDIHTKLMSKYRQVPEWWFWC  440

Query  1371  LLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEY  1550
             +LV  +A+++  C +  +++Q+P+WG+I A  +A  FTLPI IITA TNQ+PGLNIITEY
Sbjct  441   ILVANVALTIFACEYYKEQLQLPWWGVILACVIAIFFTLPIGIITAITNQSPGLNIITEY  500

Query  1551  IMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGT  1730
             I+G IYPG P+AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR MF+ Q +GTLIAG 
Sbjct  501   IIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRMMFMAQVVGTLIAGF  560

Query  1731  INMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNAL  1910
             + +  AWWL+ +I +IC  DK S+S WTCP D VF+DASVIWGL+GP++IF  +G Y  +
Sbjct  561   VYLGTAWWLMETIPDIC--DKSSDSVWTCPGDHVFYDASVIWGLIGPRKIFGDQGTYGMV  618

Query  1911  NWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIF  2090
             NWFFLGG + P++VWL  + FP+Q WI LIN+PVL+GA G MPPAT++NY++WI+VG + 
Sbjct  619   NWFFLGGAIAPLLVWLATKAFPNQEWIRLINMPVLIGACGQMPPATAVNYTTWIIVGFLS  678

Query  2091  NFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLAS  2270
              + V+RYR   WQR+NY+LS  LDAG+AFM VLLY  +GLE+ +I WWG  DL+ C  AS
Sbjct  679   GYVVYRYRPDLWQRHNYVLSGALDAGLAFMGVLLYMCLGLENISIDWWG-NDLDGCPYAS  737

Query  2271  CPTAKGIAVDGCPV  2312
             CPTAKGI  + CPV
Sbjct  738   CPTAKGILFESCPV  751



>gb|KDO81278.1| hypothetical protein CISIN_1g0461252mg, partial [Citrus sinensis]
Length=532

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/529 (78%), Positives = 469/529 (89%), Gaps = 13/529 (2%)
 Frame = +3

Query  732   MSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgalt  911
             +SR KFFVI+L CSFCW+ FPGY FQ+L SISWVCW FP SV AHQ+GSGLNGLG+GALT
Sbjct  15    LSRVKFFVIALVCSFCWHLFPGYFFQSLQSISWVCWAFPNSVAAHQIGSGLNGLGVGALT  74

Query  912   lDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFT  1091
             LDW+ +ASFL SPL+CPFFAI NVFVGYA I+Y+V+P++YWGLN+YNAK FP++SS L+T
Sbjct  75    LDWTAVASFLFSPLICPFFAIANVFVGYAFIIYVVIPVAYWGLNLYNAKTFPIFSSHLYT  134

Query  1092  AQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGRE  1271
             AQG EY+I+ IVN +FELD   Y + GRI++STFF+L+YGFGFATIA+T+THVALFYGRE
Sbjct  135   AQGPEYNITLIVNDKFELDLASYKQHGRIHMSTFFALTYGFGFATIAATLTHVALFYGRE  194

Query  1272  IYDRYRASTKGKMDIHTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGL  1451
             I DRYRAS++GK D+HT+LMKNYKDIPSWWF VLLV TIAVSLALCIFL  EVQMP+WGL
Sbjct  195   ILDRYRASSEGKQDVHTRLMKNYKDIPSWWFQVLLVGTIAVSLALCIFLKKEVQMPWWGL  254

Query  1452  IFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQA  1631
             IFA+ LAF+FTLP+SIITATTNQTPGLNIITEYIMG+I PG+PIANVCFKTYGYMSM QA
Sbjct  255   IFASGLAFIFTLPVSIITATTNQTPGLNIITEYIMGVILPGEPIANVCFKTYGYMSMAQA  314

Query  1632  IAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSP  1808
             I+FLSDFKLGHYMKIPPRSMFLVQFIGT+IAGTIN+ VAWWLL+S+E+IC    L  NSP
Sbjct  315   ISFLSDFKLGHYMKIPPRSMFLVQFIGTIIAGTINLIVAWWLLNSVEHICQPGLLPKNSP  374

Query  1809  WTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSW  1988
             WTCP+DRVFFDASVIWGLVGP+RIF S+GNY ALNWFFLGG+LGP  VWLLH+KFP+QSW
Sbjct  375   WTCPNDRVFFDASVIWGLVGPRRIFGSQGNYGALNWFFLGGLLGPCAVWLLHKKFPNQSW  434

Query  1989  IPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAG  2168
             IPLINLPVLLGAT  MPPAT+LNY++WILVGTIFNFFVFRYRKKWWQRYNYILSA LDAG
Sbjct  435   IPLINLPVLLGATAYMPPATALNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAG  494

Query  2169  VAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
              AFM VLLY ++GLE            EHCDLA+CPTAKG+AVDGCPVF
Sbjct  495   TAFMTVLLYVSLGLE------------EHCDLATCPTAKGVAVDGCPVF  531



>ref|XP_010267481.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=734

 Score =   847 bits (2189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/748 (57%), Positives = 570/748 (76%), Gaps = 27/748 (4%)
 Frame = +3

Query  84    VEIEAPALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLN  263
             +E+E+P          +   S I++V LTV  TDD ++PV TFRMWVLG+VSCVLLSFLN
Sbjct  10    MEMESP----------ESGNSTIKQVALTVPTTDDSSIPVLTFRMWVLGLVSCVLLSFLN  59

Query  264   QFFSYRREPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEH  440
             QFF YR EP+ IT+++ Q+A +P+G  MA+ +     R+   GS  +F++NPGPFN+KEH
Sbjct  60    QFFWYRTEPISITALSAQIAVVPLGHLMASTITK---RVFFKGSRWEFTMNPGPFNVKEH  116

Query  441   VLITIfanagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKK  620
             VLITIFANAG      + YA  I++ I  +Y+RK++FF   L+I+TTQ+LG+GWAG+ ++
Sbjct  117   VLITIFANAGAG----TVYATHILSAIKLYYKRKLTFFPALLIILTTQILGFGWAGMFRR  172

Query  621   YVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGY  800
             Y+VEPA MWWPS LVQ+SLFR LHEKE+   GG    ++R +FF+I+L CSF +Y  PGY
Sbjct  173   YLVEPAEMWWPSNLVQVSLFRALHEKEKRPRGG----VTRTQFFLIALTCSFAYYLLPGY  228

Query  801   IFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVN  980
             IF  L S+SWVCW+FPKS+ A Q+GSGL GLG+GA+ LDWST++S+L SPL  P+FA  N
Sbjct  229   IFPMLTSLSWVCWIFPKSILAQQIGSGLEGLGIGAIGLDWSTVSSYLGSPLASPWFATAN  288

Query  981   VFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEY  1160
             V VG+ IIMY+++PISYW L+VY AK FPL+SS LFT++GQ+Y+IS+IVN +F +D D Y
Sbjct  289   VAVGFFIIMYIIVPISYW-LDVYKAKTFPLFSSGLFTSKGQKYNISSIVNSKFHIDLDSY  347

Query  1161  AKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTKGK--MDIHTKLMK  1334
              + G ++LSTFF+ +YG GFA + +TI HV LF+G EI +  R++ K K  MD+HT+LMK
Sbjct  348   ERNGPLHLSTFFAFTYGVGFAALTATIVHVLLFHGSEILELSRSALKDKKRMDVHTRLMK  407

Query  1335  NYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATT  1514
              YK +P WWF  +LVV +A ++  C + ND++Q+ +WG++ A  +A++FTLPI +I ATT
Sbjct  408   KYKQVPQWWFMFILVVVMAATIFACEYYNDQLQLRWWGVLLACLVAYVFTLPIGVIAATT  467

Query  1515  NQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMF  1694
             NQ PGLNIITEYI+G +YPG+P+AN+CFK YGY+SMTQA+ F+ DFKLGHYMKIPPR+MF
Sbjct  468   NQAPGLNIITEYILGYLYPGRPVANICFKVYGYISMTQALTFIQDFKLGHYMKIPPRAMF  527

Query  1695  LVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVIWGLVGP  1871
             +VQ IGT+IAG + +   WWL+ +I N+C    L  NSPWTCP DRVF+DASVIWGL+GP
Sbjct  528   MVQMIGTVIAGLVYLGTGWWLMMTIPNLCDTAVLPDNSPWTCPMDRVFYDASVIWGLIGP  587

Query  1872  KRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATS  2051
             +RIF   G+Y A+NWFFLGG + P++VW+ H+ FP+Q WI LIN+PVL+ ATG MPPAT+
Sbjct  588   RRIFGDLGSYAAVNWFFLGGAIAPLLVWVAHKAFPNQKWIRLINMPVLISATGMMPPATA  647

Query  2052  LNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISW  2231
             +N+++WI++G +  F V+RYR+  WQR+NY+LS  LDAG+AFM VLL+  +G ++ +I W
Sbjct  648   VNFTTWIIIGFLSGFVVYRYRQDLWQRHNYVLSGALDAGLAFMGVLLFACLGSKEISIDW  707

Query  2232  WGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             WG    + C LASCPTAKG+ VD CPVF
Sbjct  708   WGANP-DGCPLASCPTAKGVVVDHCPVF  734



>ref|XP_004964382.1| PREDICTED: oligopeptide transporter 7-like isoform X1 [Setaria 
italica]
Length=803

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/754 (57%), Positives = 562/754 (75%), Gaps = 42/754 (6%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIE+V LTV   DDP+ PV TFRMWVLG  SC LLSFLNQFF YR+EPL IT+I+ Q+A
Sbjct  61    SPIEQVALTVPVGDDPSTPVLTFRMWVLGTASCALLSFLNQFFWYRKEPLTITAISAQIA  120

Query  324   TLPIGRFMAAALPAAKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYAV  503
              +P+GR MAAALP   F + G    +FSLNPGPFN+KEHVLITIFAN+G      + YA+
Sbjct  121   VVPLGRLMAAALPERAF-LRG-TRWEFSLNPGPFNVKEHVLITIFANSGAG----TVYAI  174

Query  504   GIVNIIIAFYRRKISFFAGWLLIITTQV----------------------------LGYG  599
              ++  +  FY + I+FF   L+++TTQV                            LG+G
Sbjct  175   HVITAVRVFYGKHITFFVSLLVVLTTQVSEGCTEKAFASLLLRGVRDYSLSFDMQVLGFG  234

Query  600   WAGLLKKYVVEPAHMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFC  779
             WAG+ ++Y+VEPA MWWPS LVQ+SLFR LHEKE+   GG    ++R +FF+++  CSF 
Sbjct  235   WAGIFRRYLVEPAAMWWPSNLVQVSLFRALHEKEQRVKGG----LTRNQFFLVAFICSFA  290

Query  780   WYFFPGYIFQTLASISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVC  959
             +Y FPGY+FQ L S+SWVCWVFP SV A QLGSGL GLG+GA+ LDWST++S+L SPL  
Sbjct  291   YYIFPGYLFQMLTSLSWVCWVFPHSVFAQQLGSGLRGLGIGAIGLDWSTVSSYLGSPLAS  350

Query  960   PFFAIVNVFVGYAIIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQF  1139
             P+FA  NV  G+  +MY+V PI+YW  N Y A+ FP++S  LFT  GQ+Y+IS+IV+  F
Sbjct  351   PWFATANVAAGFVFVMYIVTPIAYW-FNFYKAQNFPIFSDGLFTTTGQKYNISSIVDSHF  409

Query  1140  ELDEDEYAKQGRIYLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRAS-TKGKMDI  1316
               D   Y K G +YLSTFF+++YG GFA++ +TI HV LF+G EI+   +++  + KMD+
Sbjct  410   HFDTKAYEKNGPLYLSTFFAVTYGVGFASLTATIVHVFLFHGSEIWQLSKSAFQEKKMDV  469

Query  1317  HTKLMKNYKDIPSWWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPIS  1496
             HTKLM+ YK +P WWF  +LV  IAV++  C +  +++Q+P+WG++ A A+AF FTLP+ 
Sbjct  470   HTKLMRRYKQVPEWWFICILVANIAVTIFACEYYIEQLQLPWWGVLLACAIAFFFTLPVG  529

Query  1497  IITATTNQTPGLNIITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKI  1676
             IITATTNQTPGLNIITEYIMG +YPG+P+AN+CFK YGY+SM+QA+ FL DFKLGHYMKI
Sbjct  530   IITATTNQTPGLNIITEYIMGYLYPGRPVANMCFKVYGYISMSQALTFLQDFKLGHYMKI  589

Query  1677  PPRSMFLVQFIGTLIAGTINMSVAWWLLHSIENICHQDKL-SNSPWTCPSDRVFFDASVI  1853
             PPR+MF+ Q +GTLIA  + +  AWWL+ ++ NIC+ + L  +SPWTCP D VF+DASVI
Sbjct  590   PPRTMFMAQVVGTLIAAFVYIGTAWWLMETVPNICNTELLPRDSPWTCPGDHVFYDASVI  649

Query  1854  WGLVGPKRIFDSEGNYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGS  2033
             WGL+ P+RIF   G Y+A+NWFFLGG + P++VWL H+ FP QSWI LIN+PVL+GATG+
Sbjct  650   WGLISPRRIFGDLGTYSAVNWFFLGGAIAPLLVWLAHKAFPGQSWILLINMPVLIGATGN  709

Query  2034  MPPATSLNYSSWILVGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLE  2213
             MPPAT++NY++WILVG +  + V+RYR+ WW+R+NY+LS  LDAG+AFMAVL+Y  +GLE
Sbjct  710   MPPATAVNYTTWILVGFLSGYVVYRYRRDWWERHNYLLSGALDAGLAFMAVLIYLCLGLE  769

Query  2214  DRTISWWGTTDLEHCDLASCPTAKGIAVDGCPVF  2315
             + +++WWG  DL+ C LASCPTAKGI V+GCPV+
Sbjct  770   NISLNWWG-NDLDGCPLASCPTAKGIVVEGCPVY  802



>ref|XP_009765351.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana sylvestris]
Length=757

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/739 (58%), Positives = 563/739 (76%), Gaps = 16/739 (2%)
 Frame = +3

Query  102   ALKLAGEDVNDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYR  281
             +L+L  ++ ++EE SPI++V LTV  TDDP+LPV TFRMW LG VSCVLLSFLNQFF YR
Sbjct  31    SLELKKQEEDEEENSPIKQVALTVPITDDPSLPVLTFRMWFLGTVSCVLLSFLNQFFWYR  90

Query  282   REPLIITSITVQVATLPIGRFMAAALPAAKFRIPGFGSG-QFSLNPGPFNMKEHVLITIf  458
              EPL IT+I+ Q+A +P+G+ MAA +     R+   GS  +F+LNPGPFN+KEHVLITIF
Sbjct  91    TEPLTITAISAQIAVVPLGQLMAAKITK---RVFFQGSKWEFTLNPGPFNVKEHVLITIF  147

Query  459   anagfafgngSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPA  638
             AN+G      + YA+ +V  +  FY++ I+FF   +++ITTQVLG+GWAG+ ++Y+VEPA
Sbjct  148   ANSGAG----TVYAIHVVTAVKVFYQKNITFFVSLIVVITTQVLGFGWAGIFRRYLVEPA  203

Query  639   HMWWPSTLVQISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLA  818
              MWWP+ LVQ+SLFR LHEKEE   GG    ++R +FF+I+  CSF +Y FPGY+F  L 
Sbjct  204   AMWWPANLVQVSLFRALHEKEERSKGG----LTRTQFFLIAFICSFAYYVFPGYLFSMLT  259

Query  819   SISWVCWVFPKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYA  998
             S+SW+CW+FPKSV   QLGSGLNGLG+GA+ LDWS+I+S+L SPL  P+FA  NV VG+ 
Sbjct  260   SLSWICWIFPKSVFVQQLGSGLNGLGIGAIGLDWSSISSYLGSPLASPWFATANVAVGFF  319

Query  999   IIMYLVMPISYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRI  1178
              IMY++ PI YW L+V+ AK FP++SS LFT+ GQ Y+IS+I++  F LD   Y +QG +
Sbjct  320   FIMYILTPICYW-LDVFKAKTFPIFSSGLFTSSGQVYNISSIIDSNFHLDIAAYEQQGHL  378

Query  1179  YLSTFFSLSYGFGFATIASTITHVALFYGREIYDRYRASTK-GKMDIHTKLMKNYKDIPS  1355
             YLSTFF ++YG GFA +++T+ HV LF+GREI+++ ++S K  K DIHT+LM  Y  +P 
Sbjct  379   YLSTFFVITYGVGFAALSATVMHVLLFHGREIWEQSKSSFKEKKTDIHTRLMSKYNQVPE  438

Query  1356  WWFYVLLVVTIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLN  1535
             WWF+ +LV  I +++  C + N+++Q+P+WG+I A  +A  FTLPI +ITA TNQTPGLN
Sbjct  439   WWFWCILVANITLTVFACEYYNEQLQLPWWGVILACVIAIFFTLPIGVITAITNQTPGLN  498

Query  1536  IITEYIMGIIYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGT  1715
             +ITEYI+G +YPG P+AN+CFK YGY+SM QAI FL DFKLGHYMKIPPR+MF+ Q +GT
Sbjct  499   VITEYIIGYLYPGYPVANMCFKVYGYISMNQAITFLQDFKLGHYMKIPPRTMFMAQVVGT  558

Query  1716  LIAGTINMSVAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEG  1895
             LIAG + +  AWWL+ +I +IC +  LSN+ WTCPSD VF+DASVIWGL+ P+RIF   G
Sbjct  559   LIAGFVYLGTAWWLMETIPDICIK-TLSNTVWTCPSDHVFYDASVIWGLIAPRRIFGDLG  617

Query  1896  NYNALNWFFLGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWIL  2075
              Y  +NWFFL G + PV+VWL  R FP Q WI LIN+PVL+GATG MPPAT++NY++WI+
Sbjct  618   TYGMVNWFFLFGAIAPVVVWLAARAFPKQEWIKLINMPVLIGATGMMPPATAVNYTTWII  677

Query  2076  VGTIFNFFVFRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEH  2255
             VG +  + V+RYR  WWQR+NY+LS  LDAG+AFMAVLLY  +G E+ +++WWG  DL+ 
Sbjct  678   VGFLSGYVVYRYRPDWWQRHNYVLSGALDAGLAFMAVLLYLCLGSENISVNWWG-NDLDG  736

Query  2256  CDLASCPTAKGIAVDGCPV  2312
             C  ASCPTAKGI   GCPV
Sbjct  737   CPYASCPTAKGIIKQGCPV  755



>gb|EPS60258.1| hypothetical protein M569_14546, partial [Genlisea aurea]
Length=705

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/718 (58%), Positives = 557/718 (78%), Gaps = 17/718 (2%)
 Frame = +3

Query  129   NDEEVSPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSI  308
              +EE SPI+EV LTV+ +DD ++PV TFRMW LG VSCVLLSFLNQFF YR EPL IT+I
Sbjct  2     EEEENSPIKEVALTVSTSDDASIPVLTFRMWFLGTVSCVLLSFLNQFFWYRTEPLSITAI  61

Query  309   TVQVATLPIGRFMAAALPAAKF-RIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgn  485
             + Q+A +P+GR MAA LPA  F R  G+   +F+LNPGPFN+KEHVLITIFAN+G     
Sbjct  62    SAQIAVVPLGRLMAARLPARVFFRNTGW---EFTLNPGPFNVKEHVLITIFANSGAG---  115

Query  486   gSAYAVGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLV  665
              + YA+ +V  +  FYR+ I+FF   +++ITTQVLG+GWAG+ ++Y+VEPA MWWP+ LV
Sbjct  116   -TVYAIHVVTAVKVFYRKHINFFVSLVVVITTQVLGFGWAGIFRRYLVEPAEMWWPANLV  174

Query  666   QISLFRTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVF  845
             Q+SLFR LHEKEE   GG    ++R +FFVI+  CSF +Y FPGY+FQ L S+SW+CW+F
Sbjct  175   QVSLFRALHEKEERRKGG----VTRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWIF  230

Query  846   PKSVTAHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPI  1025
             PKS+ A QLGSGL GLG+GA+ LDWST++S+L SPL  P+FA  NV VG+  +MY+V P+
Sbjct  231   PKSILAQQLGSGLKGLGIGAVGLDWSTVSSYLGSPLASPWFATANVAVGFFFVMYVVTPL  290

Query  1026  SYWGLNVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLS  1205
             SYW  NVY+AK FP++S +LFT+ G+ Y+IS I++  F LD D Y +QG ++LSTFF+++
Sbjct  291   SYW-FNVYDAKKFPIFSDELFTSSGEVYNISGIIDSNFHLDMDSYNRQGTLHLSTFFAMT  349

Query  1206  YGFGFATIASTITHVALFYGREIYDRYRASTK-GKMDIHTKLMKNYKDIPSWWFYVLLVV  1382
             YG GFA +++TI HV LF+GREI++  R+S K  KMDIHT+LM+ Y+ +P WWF+ +L+V
Sbjct  350   YGVGFAALSATIVHVILFHGREIWELSRSSFKEKKMDIHTRLMRRYRQVPEWWFWCILLV  409

Query  1383  TIAVSLALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGI  1562
              I++++  C +  D++Q+P+WG++ A  +AF+FTLPI IITA TNQ+PGLNIITEYI+G 
Sbjct  410   NISLTIFACEYYKDQLQLPWWGVLLACFIAFVFTLPIGIITAITNQSPGLNIITEYIIGY  469

Query  1563  IYPGKPIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMS  1742
             IYPG P+AN+CFK YGY+SMTQAI FL DFKLGHYMKIPPR+MF+ Q +GTLIAG + +S
Sbjct  470   IYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIAGVVYLS  529

Query  1743  VAWWLLHSIENICHQDKLSNSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFF  1922
              AWWL+ +I  IC  DK ++  WTCP D VF+DASVIWGL+GP++IF  EG Y A+NWFF
Sbjct  530   TAWWLMETIPGIC--DKAASDVWTCPGDHVFYDASVIWGLIGPRKIFGDEGTYAAVNWFF  587

Query  1923  LGGILGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFV  2102
             L G + PV+VWL  + FP + WI LIN+PVL+GATGSMPPAT++NY++WI VG +  + V
Sbjct  588   LLGAVAPVLVWLGTKAFPDREWIRLINMPVLIGATGSMPPATAVNYTTWIAVGFVSGYVV  647

Query  2103  FRYRKKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCP  2276
             + YR   W+R+NY+LS  LDAG+AFM V++Y ++GLE+  + WWG  DL+ C LASCP
Sbjct  648   YNYRPDLWERHNYVLSGALDAGLAFMGVVMYLSLGLENVGVEWWG-NDLDGCPLASCP  704



>gb|EMT07894.1| Oligopeptide transporter 7 [Aegilops tauschii]
Length=758

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/727 (58%), Positives = 559/727 (77%), Gaps = 16/727 (2%)
 Frame = +3

Query  144   SPIEEVRLTVTNTDDPTLPVWTFRMWVLGVVSCVLLSFLNQFFSYRREPLIITSITVQVA  323
             SPIE+V LTV   DDP  PV TFRMWVLGV+SC +LSFLNQFF YR+EPL +T+I+ QVA
Sbjct  44    SPIEQVALTVPVGDDPDTPVLTFRMWVLGVLSCAVLSFLNQFFWYRKEPLTVTAISAQVA  103

Query  324   TLPIGRFMAAALPA-AKFRIPGFGSGQFSLNPGPFNMKEHVLITIfanagfafgngSAYA  500
              +P+GR MAAALP  A FR   +   +F+LNPGPFN+KEHVLITIFANAG      + YA
Sbjct  104   VVPLGRLMAAALPERAFFRGRPY---EFTLNPGPFNVKEHVLITIFANAGAG----TVYA  156

Query  501   VGIVNIIIAFYRRKISFFAGWLLIITTQVLGYGWAGLLKKYVVEPAHMWWPSTLVQISLF  680
             + +V  +  FY + +SFF   L+++TTQVLG+GWAG+ ++Y+VEPA MWWP+ LVQ+SLF
Sbjct  157   IHVVTAVRVFYGKNLSFFVSLLVVLTTQVLGFGWAGIFRRYLVEPATMWWPANLVQVSLF  216

Query  681   RTLHekeeeedgggrrrMSRAKFFVISLCCSFCWYFFPGYIFQTLASISWVCWVFPKSVT  860
             R LHEKE    GG     +R +FF+++   SF +Y FPGY+FQ L S+SW+CWVFP SV 
Sbjct  217   RALHEKERRRKGG----FTRNQFFLVAFVSSFAYYVFPGYLFQMLTSLSWICWVFPHSVL  272

Query  861   AHQlgsglnglglgaltlDWSTIASFLSSPLVCPFFAIVNVFVGYAIIMYLVMPISYWGL  1040
               QLGSGL+GLG+G + LDW++++S+L SPLV P+FA VNV  G+ IIMY++ PI YW  
Sbjct  273   VQQLGSGLHGLGIGTIGLDWASVSSYLGSPLVSPWFATVNVGAGFFIIMYVITPIGYW-F  331

Query  1041  NVYNAKIFPLYSSDLFTAQGQEYDISAIVNKQFELDEDEYAKQGRIYLSTFFSLSYGFGF  1220
             N Y A+ FP++S+DLFT+ GQ+Y+ISAIV+  F  D + Y + G +YLST  +++YG  F
Sbjct  332   NFYKARTFPIFSADLFTSTGQKYNISAIVDDHFHFDTEAYERNGPLYLSTLLAITYGVSF  391

Query  1221  ATIASTITHVALFYGREIYDRYRASTKGK-MDIHTKLMKNYKDIPSWWFYVLLVVTIAVS  1397
             A++ +TI HV LF+G EI    R++ +GK MDIHTKLM+ YK +P WWF  +L+V+IA +
Sbjct  392   ASLTATIVHVLLFHGSEILQLSRSTFQGKSMDIHTKLMRRYKKVPEWWFICILLVSIAAT  451

Query  1398  LALCIFLNDEVQMPYWGLIFAAALAFMFTLPISIITATTNQTPGLNIITEYIMGIIYPGK  1577
             +  C +  +++Q+P+WG++ A  +AF FTLPI IITATTNQTPGLNI+TEYI+G +YPG+
Sbjct  452   IFACEYYIEQLQLPWWGVLLACVIAFFFTLPIGIITATTNQTPGLNIVTEYIIGYLYPGR  511

Query  1578  PIANVCFKTYGYMSMTQAIAFLSDFKLGHYMKIPPRSMFLVQFIGTLIAGTINMSVAWWL  1757
             P+AN+CFK YGY+SM QA+ FL DFKLGHYMKIPPR+MF+ Q  GT IA  + +  AWWL
Sbjct  512   PVANMCFKVYGYISMHQALMFLQDFKLGHYMKIPPRTMFMAQVAGTSIAAFVYLGTAWWL  571

Query  1758  LHSIENICHQDKLS-NSPWTCPSDRVFFDASVIWGLVGPKRIFDSEGNYNALNWFFLGGI  1934
             + +I NIC+ D LS ++PWTCP+D VF+DASVIWGL+GP+RIF   G Y+A+NWFFLGG 
Sbjct  572   MDTIPNICNIDLLSADNPWTCPTDHVFYDASVIWGLIGPRRIFGVLGTYSAVNWFFLGGA  631

Query  1935  LGPVIVWLLHRKFPSQSWIPLINLPVLLGATGSMPPATSLNYSSWILVGTIFNFFVFRYR  2114
             + P++VW  H+ FPSQ+WI LIN+PV++G T  MPPAT++NY++WILVG +  + V+RYR
Sbjct  632   IAPLLVWFAHKAFPSQNWILLINMPVMIGCTVKMPPATAVNYTTWILVGFLSGYVVYRYR  691

Query  2115  KKWWQRYNYILSAGLDAGVAFMAVLLYFTVGLEDRTISWWGTTDLEHCDLASCPTAKGIA  2294
             + WW+R+NY+LS  LDAG+AFMAVL+Y  +GLE+ +++WWG  DL+ C LASCPTAKGI 
Sbjct  692   RDWWERHNYLLSGALDAGLAFMAVLIYLCLGLENISLNWWG-NDLDGCPLASCPTAKGIV  750

Query  2295  VDGCPVF  2315
             V GCPV+
Sbjct  751   VKGCPVY  757



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7644097903856